F489084

General Info

Members Datasets Scaffolds Average Seq Length
1051 547 2103 166

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0000328|Ga0495660_0000328_11892_12500
Length 202
Sequence MNTEFAACGSSYSGSFCARFMVNFPVSLTLEKRTQFMAQVTRRGNPVQINGELPKVGAAAPAFKLVGGDLADVTLADFAGKRKVLNIFPSVDTPTCATSVRKFNAQANELNNAVVLCISADLPFAQARFCGAEGLENVKNLSTMRGAQFMVDYGVAIADGPMVGLTTRAVVVLDENDKVLHSELVPEIGQEPNYDAALAVLK

Samples

Sample ID Description Type Environment
1 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
222 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
229 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
241 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
249 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
250 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
312 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
318 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
327 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
360 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
377 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
390 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
393 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
394 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
395 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
396 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
397 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
398 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
399 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
408 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
409 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
410 2506520008 Serratia plymuthica AS12 Isolate Unclassified
411 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
412 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
413 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
414 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
415 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
416 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
417 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
418 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
419 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
420 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
421 2547132181 Kosakonia sacchari SP1 Isolate Stem
422 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
423 2561511199 Enterobacter sp. R4-368 Isolate Nodule
424 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
425 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
426 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
427 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
428 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
429 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
430 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
431 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
432 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
433 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
434 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
435 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
436 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
437 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
438 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
439 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
440 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
441 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
442 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
443 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
444 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
445 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
446 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
447 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
448 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
449 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
450 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
451 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
452 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
453 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
454 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
455 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
456 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
457 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
458 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
459 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
460 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
461 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
462 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
463 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
464 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
465 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
466 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
467 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
468 2636415599 Klebsiella variicola DX120E Isolate Unclassified
469 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
470 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
471 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
472 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
473 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
474 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
475 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
476 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
477 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
478 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
479 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
480 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
481 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
482 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
483 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
484 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
485 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
486 2775507074 Klebsiella sp. D5A Isolate Unclassified
487 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
488 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
489 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
490 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
491 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
492 2818991450 Burkholderia sp. 604 Isolate Unclassified
493 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
494 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
495 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
496 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
497 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
498 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
499 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
500 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
501 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
502 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
503 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
504 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
505 2885266251 Ralstonia sp. SET104 Isolate Nodule
506 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
507 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
508 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
509 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
510 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
511 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
512 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
513 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
514 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
515 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
516 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
517 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
518 2928058823 Ralstonia sp. 1138 Isolate Unclassified
519 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
520 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
521 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
522 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
523 2937967321 Serratia sp. YC16 Isolate Unclassified
524 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
525 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
526 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
527 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
528 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
529 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
530 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
531 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
532 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
533 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
534 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
535 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
536 640753048 Serratia proteamaculans 568 Isolate Endosphere
537 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
538 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
539 8004592986 Serratia sp. S119 Isolate Unclassified
540 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
541 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
542 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
543 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
544 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
545 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
546 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
547 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.25
Metatranscriptomes 3.43
Isolates 13.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 11.7
Nodule 1.14
Rhizoplane 7.42
Rhizosphere 67.17
Stem 0.1
Stem Tuber 0.38
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495660_0000328 3300046810 Bacteria 42079
2 SwRhRL2b_contig_1922412 2162886007 Bacteria 3191
3 JGI24741J21665_1000119 3300001915 Bacteria 21193
4 JGI24740J21852_10000217 3300001979 Bacteria 24237
5 JGI24740J21852_10000413 3300001979 Bacteria 18281
6 JGI24740J21852_10004138 3300001979 Bacteria 6264
7 JGI24735J21928_10000832 3300002067 Bacteria 10968
8 JGI24735J21928_10024157 3300002067 Bacteria 1841
9 JGI25156J39149_1011567 3300002705 Bacteria 1988
10 JGI25156J39149_1013119 3300002705 Bacteria 1777
11 JGI25162J39368_1002379 3300002737 Bacteria 7423
12 JGI25162J39368_1002589 3300002737 Bacteria 6804
13 JGI25154J39366_1005222 3300002738 Bacteria 2118
14 JGI25164J39214_1000557 3300002772 Bacteria 16985
15 JGI25164J39214_1000979 3300002772 Bacteria 9042
16 JGI25151J46595_10004250 3300003187 Bacteria 7620
17 JGI25165J46597_1000379 3300003214 Bacteria 48698
18 rootH1_10033773 3300003316 Bacteria 2681
19 rootH1_10033773 3300003323 Bacteria 4965
20 rootH2_10013714 3300003320 Bacteria 2600
21 rootL2_10213623 3300003322 Bacteria 1371
22 rootH1_10317437 3300003323 Bacteria 1038
23 Ga0006556J51387_1023891 3300003479 Bacteria 716
24 Ga0006558J51389_1024036 3300003558 Bacteria 662
25 Ga0006560J51390_1018558 3300003565 Bacteria 775
26 Ga0006554J51385_1035245 3300003567 Bacteria 543
27 Ga0055539_1000148 3300003752 Bacteria 70566
28 Ga0055539_1009355 3300003752 Bacteria 1217
29 Ga0055533_1003082 3300003756 Bacteria 3514
30 Ga0055533_1004726 3300003756 Bacteria 2373
31 Ga0055532_1000072 3300003758 Bacteria 131787
32 Ga0055525_1000148 3300003759 Bacteria 94868
33 Ga0055525_1000463 3300003759 Bacteria 22787
34 Ga0055527_1000277 3300003760 Bacteria 30515
35 Ga0055527_1010338 3300003760 Bacteria 1078
36 Ga0055535_1000053 3300003761 Bacteria 131787
37 Ga0055535_1000584 3300003761 Bacteria 30492
38 Ga0055542_1000611 3300003762 Bacteria 30492
39 Ga0055542_1001477 3300003762 Bacteria 11565
40 Ga0055529_1000099 3300003763 Bacteria 131775
41 Ga0055529_1000795 3300003763 Bacteria 19327
42 Ga0055526_1070007 3300003771 Bacteria 714
43 Ga0055536_1000044 3300003781 Bacteria 123111
44 Ga0055534_1003892 3300003784 Bacteria 4536
45 Ga0055540_1017394 3300003792 Bacteria 2009
46 Ga0055541_1000590 3300003841 Bacteria 9764
47 Ga0058692_1011178 3300003856 Bacteria 2184
48 Ga0065714_10005880 3300005288 Bacteria 5324
49 Ga0065714_10076967 3300005288 Bacteria 2736
50 Ga0065714_10366483 3300005288 Bacteria 620
51 Ga0065704_10011691 3300005289 Bacteria 2210
52 Ga0065704_10073206 3300005289 Bacteria 7448
53 Ga0065704_10196990 3300005289 Bacteria 1163
54 Ga0065712_10072752 3300005290 Bacteria 4618
55 Ga0070658_10002504 3300005327 Bacteria 15351
56 Ga0070658_10087088 3300005327 Bacteria 2570
57 Ga0070658_10324445 3300005327 Bacteria 1315
58 Ga0070683_100210312 3300005329 Bacteria 1848
59 Ga0070670_100282481 3300005331 Bacteria 1449
60 Ga0070682_100002070 3300005337 Bacteria 11164
61 Ga0070682_100004557 3300005337 Bacteria 7706
62 Ga0070660_100002928 3300005339 Bacteria 11747
63 Ga0070660_100483575 3300005339 Bacteria 1029
64 Ga0070660_101256579 3300005339 Bacteria 628
65 Ga0070691_10553996 3300005341 Bacteria 672
66 Ga0070661_100000118 3300005344 Bacteria 65981
67 Ga0070661_100000322 3300005344 Bacteria 38464
68 Ga0070675_100713412 3300005354 Bacteria 914
69 Ga0070674_100788030 3300005356 Bacteria 820
70 Ga0070659_100018001 3300005366 Bacteria 5326
71 Ga0070659_100018699 3300005366 Bacteria 5231
72 Ga0070659_100044900 3300005366 Bacteria 3461
73 Ga0070659_100052789 3300005366 Bacteria 3198
74 Ga0070659_100072579 3300005366 Bacteria 2739
75 Ga0070667_100286151 3300005367 Bacteria 1481
76 Ga0070700_100721807 3300005441 Bacteria 794
77 Ga0070708_100647424 3300005445 Unclassified 996
78 Ga0070663_100000016 3300005455 Bacteria 126268
79 Ga0070663_100117785 3300005455 Bacteria 2003
80 Ga0070663_100249868 3300005455 Bacteria 1403
81 Ga0070663_100368886 3300005455 Bacteria 1166
82 Ga0070663_101105467 3300005455 Bacteria 693
83 Ga0070678_100620852 3300005456 Bacteria 967
84 Ga0070681_10029738 3300005458 Bacteria 5484
85 Ga0068867_100671489 3300005459 Bacteria 911
86 Ga0070685_10471512 3300005466 Bacteria 883
87 Ga0070706_100218277 3300005467 Bacteria 1780
88 Ga0070699_100169076 3300005518 Bacteria 1937
89 Ga0070679_100189384 3300005530 Bacteria 2027
90 Ga0070684_100567155 3300005535 Bacteria 1054
91 Ga0068853_100019581 3300005539 Bacteria 5614
92 Ga0070696_100378248 3300005546 Bacteria 1103
93 Ga0070665_100000718 3300005548 Bacteria 44076
94 Ga0070665_100165776 3300005548 Bacteria 2212
95 Ga0070665_100379760 3300005548 Bacteria 1420
96 Ga0068855_100001358 3300005563 Bacteria 30324
97 Ga0068855_100003246 3300005563 Bacteria 19887
98 Ga0068855_100012611 3300005563 Bacteria 10200
99 Ga0068855_100060560 3300005563 Bacteria 4427
100 Ga0070664_100000017 3300005564 Bacteria 125713
101 Ga0070664_100000044 3300005564 Bacteria 74926
102 Ga0068857_100161783 3300005577 Bacteria 2031
103 Ga0068857_100770071 3300005577 Bacteria 917
104 Ga0068854_100000078 3300005578 Bacteria 69419
105 Ga0068854_100048274 3300005578 Bacteria 3037
106 Ga0068856_100003924 3300005614 Bacteria 14903
107 Ga0068856_100014214 3300005614 Bacteria 7695
108 Ga0068852_100243800 3300005616 Bacteria 1719
109 Ga0068859_100078016 3300005617 Bacteria 3353
110 Ga0068870_10799298 3300005840 Bacteria 659
111 Ga0068863_100048608 3300005841 Bacteria 4022
112 Ga0068863_101346061 3300005841 Bacteria 721
113 Ga0068858_100008871 3300005842 Bacteria 9642
114 Ga0068862_102104765 3300005844 Bacteria 575
115 Ga0075365_10001272 3300006038 Bacteria 11193
116 Ga0075365_10014199 3300006038 Bacteria 4786
117 Ga0075365_10102872 3300006038 Bacteria 1957
118 Ga0075365_10201596 3300006038 Bacteria 1394
119 Ga0075368_10040896 3300006042 Bacteria 1821
120 Ga0075363_100032488 3300006048 Bacteria 2711
121 Ga0075363_100091273 3300006048 Bacteria 1677
122 Ga0075363_100173328 3300006048 Bacteria 1225
123 Ga0075364_10010070 3300006051 Bacteria 5698
124 Ga0075364_10023864 3300006051 Bacteria 3876
125 Ga0075364_10165642 3300006051 Bacteria 1493
126 Ga0075364_10329501 3300006051 Bacteria 1040
127 Ga0075364_10560327 3300006051 Bacteria 781
128 Ga0075364_10563606 3300006051 Bacteria 779
129 Ga0075362_10010642 3300006177 Bacteria 3599
130 Ga0075362_10578240 3300006177 Bacteria 579
131 Ga0075367_10055586 3300006178 Bacteria 2349
132 Ga0075367_10312144 3300006178 Bacteria 990
133 Ga0075367_10829194 3300006178 Bacteria 589
134 Ga0075369_10003792 3300006186 Bacteria 5534
135 Ga0075369_10026537 3300006186 Bacteria 2415
136 Ga0075369_10055016 3300006186 Bacteria 1728
137 Ga0075369_10110140 3300006186 Bacteria 1241
138 Ga0075366_10261763 3300006195 Unclassified 1056
139 Ga0075366_10522608 3300006195 Bacteria 734
140 Ga0075370_10412781 3300006353 Bacteria 811
141 Ga0097620_100078014 3300006931 Bacteria 3353
142 Ga0079104_1000109 3300006946 Bacteria 122060
143 Ga0079104_1006466 3300006946 Bacteria 4427
144 Ga0105251_10000026 3300009011 Bacteria 132136
145 Ga0105251_10000050 3300009011 Bacteria 108597
146 Ga0105251_10001110 3300009011 Bacteria 23404
147 Ga0105251_10001214 3300009011 Bacteria 22276
148 Ga0105251_10001356 3300009011 Bacteria 21161
149 Ga0105251_10002532 3300009011 Bacteria 14237
150 Ga0105251_10005045 3300009011 Bacteria 8759
151 Ga0105251_10351192 3300009011 Bacteria 673
152 Ga0105244_10000134 3300009036 Bacteria 75961
153 Ga0105244_10003992 3300009036 Bacteria 10326
154 Ga0105244_10006264 3300009036 Bacteria 7746
155 Ga0105244_10056969 3300009036 Bacteria 1976
156 Ga0105250_10005274 3300009092 Bacteria 5807
157 Ga0105240_10001607 3300009093 Bacteria 38298
158 Ga0105240_10006881 3300009093 Bacteria 16617
159 Ga0105240_10019958 3300009093 Bacteria 8949
160 Ga0105240_10168315 3300009093 Bacteria 2597
161 Ga0105240_10273986 3300009093 Bacteria 1942
162 Ga0105245_10469844 3300009098 Bacteria 1269
163 Ga0105245_11395317 3300009098 Bacteria 750
164 Ga0105247_10000068 3300009101 Bacteria 118542
165 Ga0105243_10547651 3300009148 Bacteria 1105
166 Ga0105243_12091522 3300009148 Bacteria 602
167 Ga0105243_12485258 3300009148 Bacteria 557
168 Ga0105241_10000002 3300009174 Bacteria 869480
169 Ga0105241_10041044 3300009174 Bacteria 3494
170 Ga0105241_10220053 3300009174 Bacteria 1595
171 Ga0105242_10000968 3300009176 Bacteria 22415
172 Ga0105248_10231179 3300009177 Bacteria 2082
173 Ga0105248_10393131 3300009177 Bacteria 1561
174 Ga0105237_10000116 3300009545 Bacteria 111312
175 Ga0105237_10007711 3300009545 Bacteria 11757
176 Ga0105237_10046215 3300009545 Bacteria 4379
177 Ga0105237_10207093 3300009545 Bacteria 1961
178 Ga0105237_10227882 3300009545 Bacteria 1864
179 Ga0105238_10013663 3300009551 Bacteria 8199
180 Ga0105238_10022760 3300009551 Bacteria 6386
181 Ga0105238_10175713 3300009551 Bacteria 2118
182 Ga0105238_10224733 3300009551 Bacteria 1854
183 Ga0105238_10293593 3300009551 Bacteria 1608
184 Ga0105249_10548092 3300009553 Bacteria 1207
185 Ga0105239_10000033 3300010375 Bacteria 223933
186 Ga0105239_10009931 3300010375 Bacteria 10687
187 Ga0105239_10442887 3300010375 Bacteria 1473
188 Ga0105239_11417152 3300010375 Bacteria 802
189 Ga0105246_10001023 3300011119 Bacteria 16075
190 Ga0105246_10030389 3300011119 Bacteria 3567
191 Ga0105246_10573517 3300011119 Bacteria 971
192 Ga0157373_10004598 3300013100 Bacteria 10377
193 Ga0157373_10009666 3300013100 Bacteria 7118
194 Ga0157373_10012730 3300013100 Bacteria 6182
195 Ga0157373_10015094 3300013100 Bacteria 5649
196 Ga0157373_10017202 3300013100 Bacteria 5265
197 Ga0157373_10019071 3300013100 Bacteria 4993
198 Ga0157373_10037150 3300013100 Bacteria 3493
199 Ga0157373_10040804 3300013100 Bacteria 3320
200 Ga0157373_10058409 3300013100 Bacteria 2735
201 Ga0157373_10294362 3300013100 Bacteria 1151
202 Ga0157373_10451542 3300013100 Bacteria 925
203 Ga0157373_10584233 3300013100 Bacteria 812
204 Ga0157371_10000475 3300013102 Bacteria 49125
205 Ga0157371_10001256 3300013102 Bacteria 26771
206 Ga0157371_10001936 3300013102 Bacteria 20624
207 Ga0157371_10004931 3300013102 Bacteria 11471
208 Ga0157371_10010207 3300013102 Bacteria 7335
209 Ga0157371_10154062 3300013102 Bacteria 1640
210 Ga0157370_10000254 3300013104 Bacteria 67990
211 Ga0157370_10000488 3300013104 Bacteria 49320
212 Ga0157370_10004360 3300013104 Bacteria 16243
213 Ga0157370_10004714 3300013104 Bacteria 15541
214 Ga0157370_10004787 3300013104 Bacteria 15389
215 Ga0157370_10510900 3300013104 Bacteria 1103
216 Ga0157370_10899745 3300013104 Bacteria 803
217 Ga0157370_11298682 3300013104 Bacteria 656
218 Ga0157369_10000416 3300013105 Bacteria 56361
219 Ga0157369_10004727 3300013105 Bacteria 16004
220 Ga0157369_10005112 3300013105 Bacteria 15359
221 Ga0157369_10006013 3300013105 Bacteria 14098
222 Ga0157369_10014146 3300013105 Bacteria 9016
223 Ga0157369_10078681 3300013105 Bacteria 3532
224 Ga0157369_10160578 3300013105 Bacteria 2372
225 Ga0157369_10200701 3300013105 Bacteria 2094
226 Ga0157374_10000055 3300013296 Bacteria 120079
227 Ga0163162_10669017 3300013306 Bacteria 1161
228 Ga0163162_10715195 3300013306 Bacteria 1122
229 Ga0163162_11193391 3300013306 Bacteria 863
230 Ga0163162_11455597 3300013306 Bacteria 780
231 Ga0157372_10001079 3300013307 Bacteria 29711
232 Ga0157372_10003255 3300013307 Bacteria 17548
233 Ga0157372_10040910 3300013307 Bacteria 5123
234 Ga0157372_10360382 3300013307 Bacteria 1694
235 Ga0157375_10007994 3300013308 Bacteria 9261
236 Ga0157375_10009789 3300013308 Bacteria 8426
237 Ga0163163_10032419 3300014325 Bacteria 5045
238 Ga0182008_10001630 3300014497 Bacteria 14875
239 Ga0182008_10010665 3300014497 Bacteria 4913
240 Ga0182008_10027298 3300014497 Bacteria 2894
241 Ga0182008_10570119 3300014497 Bacteria 631
242 Ga0157379_10194662 3300014968 Bacteria 1832
243 Ga0182006_1002847 3300015261 Bacteria 9216
244 Ga0182006_1005072 3300015261 Bacteria 6331
245 Ga0182006_1061982 3300015261 Bacteria 1408
246 Ga0182007_10013391 3300015262 Bacteria 3129
247 Ga0182007_10028446 3300015262 Bacteria 1920
248 Ga0183368_1003 3300015687 Bacteria 1276390
249 Ga0163161_10000001 3300017792 Bacteria 2041488
250 Ga0163161_10073716 3300017792 Bacteria 2502
251 Ga0163161_10090589 3300017792 Bacteria 2263
252 Ga0163161_10378166 3300017792 Bacteria 1131
253 Ga0163161_10491351 3300017792 Bacteria 998
254 Ga0163161_10778182 3300017792 Bacteria 803
255 Ga0197907_10147544 3300020069 Bacteria 799
256 Ga0197907_10992650 3300020069 Bacteria 1923
257 Ga0197907_11106263 3300020069 Bacteria 789
258 Ga0206356_10394404 3300020070 Bacteria 670
259 Ga0206356_11348764 3300020070 Bacteria 875
260 Ga0206356_11831093 3300020070 Bacteria 3815
261 Ga0206349_1553031 3300020075 Bacteria 1857
262 Ga0206349_1623260 3300020075 Bacteria 1133
263 Ga0206355_1505466 3300020076 Bacteria 599
264 Ga0206351_10373233 3300020077 Bacteria 657
265 Ga0206351_10443943 3300020077 Bacteria 10368
266 Ga0206351_10858175 3300020077 Bacteria 1347
267 Ga0206352_11113405 3300020078 Bacteria 810
268 Ga0206350_10052148 3300020080 Bacteria 2179
269 Ga0206350_11518593 3300020080 Bacteria 2832
270 Ga0206354_10692767 3300020081 Bacteria 2210
271 Ga0206354_11639641 3300020081 Bacteria 1167
272 Ga0206353_11895329 3300020082 Bacteria 3896
273 Ga0154015_1288425 3300020610 Bacteria 723
274 Ga0154015_1475337 3300020610 Bacteria 12803
275 Ga0213872_10011976 3300021361 Bacteria 4092
276 Ga0213872_10020982 3300021361 Bacteria 3008
277 Ga0213876_10007089 3300021384 Bacteria 6107
278 Ga0224712_10000038 3300022467 Bacteria 20134
279 Ga0224712_10227102 3300022467 Bacteria 856
280 Ga0224712_10591849 3300022467 Bacteria 541
281 Ga0209784_100063 3300025224 Bacteria 159576
282 Ga0209784_100851 3300025224 Bacteria 6716
283 Ga0209566_100048 3300025225 Bacteria 241570
284 Ga0209566_100376 3300025225 Bacteria 36803
285 Ga0209566_100903 3300025225 Bacteria 14154
286 Ga0209674_100033 3300025226 Bacteria 423450
287 Ga0209674_100071 3300025226 Bacteria 241568
288 Ga0209674_100151 3300025226 Bacteria 95725
289 Ga0209674_100218 3300025226 Bacteria 55386
290 Ga0209672_100004 3300025228 Bacteria 1467504
291 Ga0209672_100193 3300025228 Bacteria 49311
292 Ga0209672_101163 3300025228 Bacteria 10774
293 Ga0209147_100002 3300025229 Bacteria 2158988
294 Ga0209563_100085 3300025230 Bacteria 186579
295 Ga0209563_100132 3300025230 Bacteria 95059
296 Ga0209563_108311 3300025230 Bacteria 1645
297 Ga0207427_100049 3300025231 Bacteria 237504
298 Ga0207427_100101 3300025231 Bacteria 120866
299 Ga0207427_112703 3300025231 Bacteria 837
300 Ga0209437_100083 3300025233 Bacteria 256005
301 Ga0209437_100090 3300025233 Bacteria 247138
302 Ga0209258_100002 3300025242 Bacteria 2158988
303 Ga0209258_100003 3300025242 Bacteria 1467504
304 Ga0209646_1000123 3300025246 Bacteria 142437
305 Ga0209026_1008026 3300025250 Bacteria 2267
306 Ga0209677_100040 3300025253 Bacteria 241568
307 Ga0209677_108088 3300025253 Bacteria 2102
308 Ga0209148_1000025 3300025254 Bacteria 663262
309 Ga0209148_1000077 3300025254 Bacteria 298133
310 Ga0209759_1001778 3300025256 Bacteria 10973
311 Ga0209759_1004890 3300025256 Bacteria 4850
312 Ga0209759_1006697 3300025256 Bacteria 3827
313 Ga0209233_1000075 3300025261 Bacteria 356837
314 Ga0209233_1000077 3300025261 Bacteria 349570
315 Ga0209233_1035653 3300025261 Bacteria 1122
316 Ga0209455_1000004 3300025272 Bacteria 1467504
317 Ga0209455_1000149 3300025272 Bacteria 131876
318 Ga0209673_1036376 3300025273 Bacteria 1461
319 Ga0209130_1037035 3300025284 Bacteria 965
320 Ga0209675_1000260 3300025291 Bacteria 52208
321 Ga0209676_1000141 3300025292 Bacteria 175894
322 Ga0209025_1000824 3300025294 Bacteria 49441
323 Ga0209025_1078115 3300025294 Bacteria 1138
324 Ga0209564_1005964 3300025295 Bacteria 6742
325 Ga0209051_1001387 3300025303 Bacteria 20871
326 Ga0209051_1005756 3300025303 Bacteria 7150
327 Ga0209051_1007639 3300025303 Bacteria 5880
328 Ga0207696_1000001 3300025711 Bacteria 2579611
329 Ga0207655_1000191 3300025728 Bacteria 108382
330 Ga0207655_1001845 3300025728 Bacteria 18324
331 Ga0207655_1011090 3300025728 Bacteria 5401
332 Ga0207655_1011357 3300025728 Bacteria 5307
333 Ga0207655_1129099 3300025728 Bacteria 826
334 Ga0207713_1000008 3300025735 Bacteria 553952
335 Ga0207713_1000035 3300025735 Bacteria 263228
336 Ga0207713_1000039 3300025735 Bacteria 247140
337 Ga0207713_1000247 3300025735 Bacteria 68982
338 Ga0207713_1000251 3300025735 Bacteria 68244
339 Ga0207713_1000527 3300025735 Bacteria 38436
340 Ga0207713_1007458 3300025735 Bacteria 6452
341 Ga0207713_1029172 3300025735 Bacteria 2476
342 Ga0207713_1076077 3300025735 Bacteria 1222
343 Ga0207710_10000965 3300025900 Bacteria 15130
344 Ga0207647_10000869 3300025904 Bacteria 23399
345 Ga0207647_10007730 3300025904 Bacteria 7739
346 Ga0207705_10000221 3300025909 Bacteria 56813
347 Ga0207705_10025243 3300025909 Bacteria 4243
348 Ga0207705_10642931 3300025909 Bacteria 825
349 Ga0207684_10561007 3300025910 Bacteria 976
350 Ga0207654_10000005 3300025911 Bacteria 869492
351 Ga0207654_10315270 3300025911 Bacteria 1067
352 Ga0207707_10023235 3300025912 Bacteria 5425
353 Ga0207695_10000322 3300025913 Bacteria 114700
354 Ga0207695_10000891 3300025913 Bacteria 54140
355 Ga0207695_10004740 3300025913 Bacteria 18409
356 Ga0207695_10005620 3300025913 Bacteria 16569
357 Ga0207695_10223838 3300025913 Bacteria 1788
358 Ga0207671_10000166 3300025914 Bacteria 102694
359 Ga0207671_10009196 3300025914 Bacteria 8287
360 Ga0207671_10272660 3300025914 Bacteria 1333
361 Ga0207671_10396598 3300025914 Bacteria 1097
362 Ga0207671_10726430 3300025914 Bacteria 789
363 Ga0207657_10004640 3300025919 Bacteria 14511
364 Ga0207657_10414991 3300025919 Bacteria 1058
365 Ga0207657_10419695 3300025919 Bacteria 1051
366 Ga0207657_10455717 3300025919 Bacteria 1003
367 Ga0207649_10000051 3300025920 Bacteria 108386
368 Ga0207649_10000056 3300025920 Bacteria 102891
369 Ga0207652_10069744 3300025921 Bacteria 3052
370 Ga0207694_10050284 3300025924 Bacteria 3227
371 Ga0207694_10170343 3300025924 Bacteria 1763
372 Ga0207694_10304344 3300025924 Bacteria 1313
373 Ga0207687_10314075 3300025927 Bacteria 1266
374 Ga0207690_10003937 3300025932 Bacteria 8783
375 Ga0207690_10004321 3300025932 Bacteria 8391
376 Ga0207690_10006220 3300025932 Bacteria 7069
377 Ga0207690_10064138 3300025932 Bacteria 2507
378 Ga0207690_10321448 3300025932 Bacteria 1216
379 Ga0207706_10093119 3300025933 Bacteria 2650
380 Ga0207686_10003389 3300025934 Bacteria 8560
381 Ga0207711_10033801 3300025941 Bacteria 4329
382 Ga0207711_10451953 3300025941 Bacteria 1196
383 Ga0207679_10000036 3300025945 Bacteria 133834
384 Ga0207679_10000042 3300025945 Bacteria 126099
385 Ga0207667_10002443 3300025949 Bacteria 23225
386 Ga0207667_10005486 3300025949 Bacteria 15464
387 Ga0207667_10011114 3300025949 Bacteria 10482
388 Ga0207667_10276743 3300025949 Bacteria 1715
389 Ga0207640_10000165 3300025981 Bacteria 48028
390 Ga0207640_10355993 3300025981 Bacteria 1178
391 Ga0207658_11057384 3300025986 Bacteria 741
392 Ga0207703_10008995 3300026035 Bacteria 7865
393 Ga0207639_10006352 3300026041 Bacteria 8029
394 Ga0207678_10000418 3300026067 Bacteria 38457
395 Ga0207678_10318560 3300026067 Bacteria 1338
396 Ga0207678_11133326 3300026067 Bacteria 693
397 Ga0207708_10741807 3300026075 Bacteria 842
398 Ga0207702_10000156 3300026078 Bacteria 80626
399 Ga0207702_10251440 3300026078 Bacteria 1660
400 Ga0207641_10256843 3300026088 Bacteria 1634
401 Ga0207641_10610259 3300026088 Bacteria 1069
402 Ga0207641_10986059 3300026088 Bacteria 839
403 Ga0207676_10422220 3300026095 Bacteria 1251
404 Ga0207674_10016655 3300026116 Bacteria 8036
405 Ga0207674_10027147 3300026116 Bacteria 6063
406 Ga0207674_10455083 3300026116 Bacteria 1237
407 Ga0207683_10286242 3300026121 Bacteria 1506
408 Ga0207698_10174421 3300026142 Bacteria 1897
409 Ga0209281_1000003 3300027111 Bacteria 1260089
410 Ga0209281_1000006 3300027111 Bacteria 1170244
411 Ga0209281_1006445 3300027111 Bacteria 3062
412 Ga0209371_1001252 3300027312 Bacteria 18113
413 Ga0209371_1022973 3300027312 Bacteria 1479
414 Ga0268266_10014158 3300028379 Bacteria 6863
415 Ga0268266_10069682 3300028379 Bacteria 3048
416 Ga0268266_10461316 3300028379 Bacteria 1209
417 Ga0268266_10914033 3300028379 Bacteria 849
418 Ga0268264_10322401 3300028381 Bacteria 1461
419 Ga0268264_10455004 3300028381 Bacteria 1241
420 Ga0265338_10000409 3300028800 Bacteria 76989
421 Ga0268256_1001070 3300030500 Bacteria 18113
422 Ga0268256_1025815 3300030500 Bacteria 1487
423 Ga0265332_10015987 3300031238 Bacteria 3312
424 Ga0265340_10055264 3300031247 Bacteria 1913
425 Ga0265327_10007248 3300031251 Bacteria 8606
426 Ga0265327_10044332 3300031251 Bacteria 2373
427 Ga0265316_10080403 3300031344 Bacteria 2500
428 Ga0307408_100000057 3300031548 Bacteria 135228
429 Ga0307408_100199053 3300031548 Bacteria 1620
430 Ga0316575_10102790 3300031665 Bacteria 1163
431 Ga0316576_10001993 3300031727 Bacteria 11425
432 Ga0316576_10134954 3300031727 Bacteria 1857
433 Ga0316576_10138114 3300031727 Bacteria 1834
434 Ga0316576_10399330 3300031727 Bacteria 1019
435 Ga0316578_10035002 3300031728 Bacteria 2885
436 Ga0316578_10176705 3300031728 Bacteria 1287
437 Ga0307405_10000290 3300031731 Bacteria 18554
438 Ga0316577_10127792 3300031733 Bacteria 1430
439 Ga0307412_11148337 3300031911 Bacteria 693
440 Ga0307409_101649132 3300031995 Bacteria 670
441 Ga0307416_100724251 3300032002 Bacteria 1086
442 Ga0307411_10790634 3300032005 Bacteria 835
443 Ga0307411_11105722 3300032005 Bacteria 715
444 Ga0316583_10090054 3300032133 Unclassified 1070
445 Ga0316580_10054611 3300032139 Bacteria 1229
446 Ga0307510_10072778 3300033180 Bacteria 3412
447 Ga0373952_0003772 3300035092 Bacteria 2740
448 Ga0373960_0128975 3300035121 Bacteria 846
449 Ga0373946_0406299 3300035171 Bacteria 688
450 Ga0316574_0006721 3300035398 Bacteria 6245
451 Ga0316574_0016714 3300035398 Bacteria 4280
452 Ga0316574_0046107 3300035398 Bacteria 2701
453 Ga0316574_0233389 3300035398 Bacteria 1177
454 Ga0373927_0016667 3300035695 Unclassified 4847
455 Ga0373937_0534814 3300036401 Bacteria 1113
456 Ga0316582_0029005 3300036647 Bacteria 3357
457 Ga0316584_0026659 3300036712 Bacteria 4249
458 Ga0373925_1175956 3300037068 Bacteria 630
459 Ga0395899_0000008 3300037312 Bacteria 567572
460 Ga0395899_0048201 3300037312 Bacteria 3171
461 Ga0395899_0094739 3300037312 Bacteria 2160
462 Ga0395899_0125574 3300037312 Bacteria 1835
463 Ga0395900_0000055 3300037418 Bacteria 219875
464 Ga0395900_0006242 3300037418 Bacteria 12437
465 Ga0395900_0016169 3300037418 Bacteria 7600
466 Ga0395900_0051529 3300037418 Bacteria 4239
467 Ga0395900_0095300 3300037418 Bacteria 3058
468 Ga0395900_0145236 3300037418 Bacteria 2426
469 Ga0395900_0297831 3300037418 Bacteria 1600
470 Ga0395900_0832452 3300037418 Bacteria 849
471 Ga0395898_0000119 3300037466 Bacteria 209937
472 Ga0395898_0001022 3300037466 Bacteria 43575
473 Ga0395898_0007201 3300037466 Bacteria 11808
474 Ga0395898_0020307 3300037466 Bacteria 6747
475 Ga0395898_0860465 3300037466 Bacteria 846
476 Ga0395905_0262289 3300037471 Bacteria 1613
477 Ga0395901_0000003 3300038443 Bacteria 701538
478 Ga0395901_0000186 3300038443 Bacteria 79718
479 Ga0395901_0001409 3300038443 Bacteria 25099
480 Ga0395901_0173956 3300038443 Bacteria 2258
481 Ga0400491_10985 3300038727 Bacteria 1162
482 Ga0400488_44502 3300038741 Bacteria 1692
483 Ga0436365_1408969 3300039437 Bacteria 5160
484 Ga0436361_0010589 3300039447 Bacteria 5514
485 Ga0436361_0501243 3300039447 Bacteria 6465
486 Ga0436363_1333172 3300039450 Bacteria 871
487 Ga0439438_000001 3300041405 Bacteria 1263568
488 Ga0439438_002554 3300041405 Bacteria 7721
489 Ga0439466_0051614 3300041411 Bacteria 1346
490 Ga0451787_594757 3300041441 Bacteria 611
491 Ga0451789_0049916 3300041443 Bacteria 699
492 Ga0451789_0367025 3300041443 Bacteria 879
493 Ga0451789_0593989 3300041443 Bacteria 1388
494 Ga0451791_1692585 3300041451 Bacteria 814
495 Ga0451791_1902633 3300041451 Bacteria 1389
496 Ga0451793_0781259 3300041452 Bacteria 3261
497 Ga0451802_1107995 3300041460 Bacteria 939
498 Ga0451837_0371420 3300041494 Bacteria 1756
499 Ga0451837_1827207 3300041494 Bacteria 562
500 Ga0451849_0288385 3300041505 Bacteria 586
501 Ga0451849_1462733 3300041505 Bacteria 846
502 Ga0451853_1680771 3300041512 Bacteria 1067
503 Ga0439432_002253 3300042006 Bacteria 7279
504 Ga0439432_006644 3300042006 Bacteria 4121
505 Ga0439432_008403 3300042006 Bacteria 3626
506 Ga0439432_023410 3300042006 Bacteria 2035
507 Ga0439452_000001 3300042010 Bacteria 1725439
508 Ga0439455_0075077 3300042012 Bacteria 913
509 Ga0439463_003174 3300042016 Bacteria 4171
510 Ga0450898_011463 3300042134 Bacteria 1452
511 Ga0450898_032064 3300042134 Bacteria 968
512 Ga0450899_021078 3300042135 Bacteria 762
513 Ga0439459_0017919 3300042438 Bacteria 1325
514 Ga0439464_0000909 3300042439 Bacteria 6624
515 Ga0451577_0006045 3300042876 Bacteria 12178
516 Ga0451577_0518351 3300042876 Bacteria 1082
517 Ga0466986_0115117 3300044650 Bacteria 1845
518 Ga0466969_0000949 3300044656 Bacteria 15630
519 Ga0466969_0040127 3300044656 Bacteria 2346
520 Ga0466972_0011622 3300044658 Bacteria 4420
521 Ga0466972_0019262 3300044658 Bacteria 3412
522 Ga0466972_0041080 3300044658 Bacteria 2252
523 Ga0466973_0051992 3300044659 Bacteria 3778
524 Ga0466974_0612504 3300044660 Bacteria 552
525 Ga0466978_0056713 3300044671 Bacteria 2443
526 Ga0466965_0000123 3300044683 Bacteria 21985
527 Ga0466965_0011553 3300044683 Bacteria 4141
528 Ga0466965_0017074 3300044683 Bacteria 3464
529 Ga0466965_0017787 3300044683 Bacteria 3400
530 Ga0466966_0009778 3300044684 Bacteria 6356
531 Ga0466966_0014484 3300044684 Bacteria 5218
532 Ga0466966_0069918 3300044684 Bacteria 2201
533 Ga0466966_0171624 3300044684 Bacteria 1318
534 Ga0466966_0324855 3300044684 Bacteria 924
535 Ga0466961_0000097 3300044693 Bacteria 56628
536 Ga0466961_0000735 3300044693 Bacteria 20551
537 Ga0466961_0001194 3300044693 Bacteria 15981
538 Ga0466961_0002073 3300044693 Bacteria 12496
539 Ga0466961_0005590 3300044693 Bacteria 7940
540 Ga0466961_0036998 3300044693 Bacteria 3132
541 Ga0466961_0057586 3300044693 Bacteria 2473
542 Ga0466963_0003740 3300044694 Bacteria 8761
543 Ga0466963_0014644 3300044694 Bacteria 4840
544 Ga0466963_0017489 3300044694 Bacteria 4469
545 Ga0466963_0089612 3300044694 Bacteria 2093
546 Ga0466963_0106889 3300044694 Bacteria 1919
547 Ga0466964_0002945 3300044706 Bacteria 6149
548 Ga0466964_0066415 3300044706 Bacteria 1513
549 Ga0466964_0331019 3300044706 Bacteria 777
550 Ga0453684_0019091 3300044712 Bacteria 10464
551 Ga0453684_0104794 3300044712 Bacteria 3451
552 Ga0466971_0000504 3300044719 Bacteria 15342
553 Ga0466971_0011044 3300044719 Bacteria 3953
554 Ga0466971_0012315 3300044719 Bacteria 3746
555 Ga0466971_0023753 3300044719 Bacteria 2733
556 Ga0466968_0009580 3300044735 Bacteria 3729
557 Ga0466968_0024612 3300044735 Bacteria 2461
558 Ga0466968_0037811 3300044735 Bacteria 2026
559 Ga0466970_0006012 3300044765 Bacteria 6051
560 Ga0466970_0007260 3300044765 Bacteria 5550
561 Ga0466970_0011454 3300044765 Bacteria 4521
562 Ga0466970_0383344 3300044765 Bacteria 800
563 Ga0466957_0000539 3300044842 Bacteria 19128
564 Ga0466957_0012295 3300044842 Bacteria 4956
565 Ga0466957_0021793 3300044842 Bacteria 3776
566 Ga0466957_0027935 3300044842 Bacteria 3355
567 Ga0466957_0029906 3300044842 Bacteria 3250
568 Ga0466957_0036640 3300044842 Bacteria 2950
569 Ga0466957_0642565 3300044842 Bacteria 745
570 Ga0466960_0230626 3300044901 Bacteria 1022
571 Ga0466959_0001442 3300045049 Bacteria 14559
572 Ga0466959_0004973 3300045049 Bacteria 9011
573 Ga0466959_0014953 3300045049 Bacteria 5655
574 Ga0466959_0038529 3300045049 Bacteria 3532
575 Ga0466959_0101216 3300045049 Bacteria 2062
576 Ga0451576_0018928 3300045051 Bacteria 7525
577 Ga0451576_0023255 3300045051 Bacteria 6713
578 Ga0451576_0217085 3300045051 Bacteria 1997
579 Ga0451576_0500920 3300045051 Bacteria 1276
580 Ga0451576_1333910 3300045051 Bacteria 747
581 Ga0466958_0001102 3300045836 Bacteria 12464
582 Ga0466958_0002984 3300045836 Bacteria 8670
583 Ga0466958_0053691 3300045836 Bacteria 2443
584 Ga0466958_0116312 3300045836 Bacteria 1671
585 Ga0466958_0281368 3300045836 Bacteria 1066
586 Ga0466958_0340708 3300045836 Bacteria 964
587 Ga0466967_0036663 3300045976 Bacteria 4188
588 Ga0466967_0191735 3300045976 Bacteria 1932
589 Ga0466967_0245154 3300045976 Bacteria 1710
590 Ga0466967_0731935 3300045976 Bacteria 980
591 Ga0495627_000010 3300046453 Bacteria 381168
592 Ga0495627_000122 3300046453 Bacteria 95389
593 Ga0495627_002608 3300046453 Bacteria 8494
594 Ga0495603_0016875 3300046455 Bacteria 4418
595 Ga0495603_0392753 3300046455 Bacteria 795
596 Ga0495591_000002 3300046458 Bacteria 455013
597 Ga0495591_000074 3300046458 Bacteria 114062
598 Ga0495591_009243 3300046458 Bacteria 3937
599 Ga0495591_020595 3300046458 Bacteria 2174
600 Ga0495629_0010284 3300046459 Bacteria 6814
601 Ga0495629_0091158 3300046459 Bacteria 2127
602 Ga0495641_0034199 3300046461 Bacteria 2404
603 Ga0495653_0011577 3300046463 Bacteria 7201
604 Ga0495653_0556152 3300046463 Bacteria 709
605 Ga0495650_0005316 3300046471 Bacteria 8416
606 Ga0495650_0022998 3300046471 Bacteria 2976
607 Ga0495580_0002727 3300046472 Bacteria 15255
608 Ga0495582_0003165 3300046473 Bacteria 9239
609 Ga0495605_0000011 3300046474 Bacteria 314856
610 Ga0495605_0000091 3300046474 Bacteria 115482
611 Ga0495605_0000165 3300046474 Bacteria 83731
612 Ga0495605_0002402 3300046474 Bacteria 11590
613 Ga0495605_0011078 3300046474 Bacteria 5038
614 Ga0495605_0012709 3300046474 Bacteria 4663
615 Ga0495605_0061469 3300046474 Bacteria 1797
616 Ga0495605_0079840 3300046474 Bacteria 1532
617 Ga0495639_0300996 3300046475 Bacteria 800
618 Ga0495664_0009421 3300046477 Bacteria 5464
619 Ga0495584_0300011 3300046491 Bacteria 816
620 Ga0495594_0002962 3300046499 Bacteria 8804
621 Ga0495607_0000085 3300046501 Bacteria 96340
622 Ga0495607_0000118 3300046501 Bacteria 83429
623 Ga0495607_0000139 3300046501 Bacteria 76715
624 Ga0495607_0001121 3300046501 Bacteria 24280
625 Ga0495607_0003540 3300046501 Bacteria 11892
626 Ga0495607_0006107 3300046501 Bacteria 8521
627 Ga0495607_0019157 3300046501 Bacteria 4351
628 Ga0495607_0060080 3300046501 Bacteria 2165
629 Ga0495583_0000047 3300046506 Bacteria 217720
630 Ga0495583_0000427 3300046506 Bacteria 63612
631 Ga0495583_0001904 3300046506 Bacteria 19329
632 Ga0495583_0011560 3300046506 Bacteria 5061
633 Ga0495583_0014225 3300046506 Bacteria 4399
634 Ga0495583_0026526 3300046506 Bacteria 2870
635 Ga0495606_0000287 3300046507 Bacteria 87639
636 Ga0495606_0020108 3300046507 Bacteria 4936
637 Ga0495606_0077902 3300046507 Bacteria 2069
638 Ga0495610_0017331 3300046512 Bacteria 4109
639 Ga0495610_0018874 3300046512 Bacteria 3877
640 Ga0495610_0020704 3300046512 Bacteria 3644
641 Ga0495610_0276577 3300046512 Bacteria 655
642 Ga0495620_0000081 3300046515 Bacteria 80343
643 Ga0495620_0000575 3300046515 Bacteria 23138
644 Ga0495620_0001331 3300046515 Bacteria 15000
645 Ga0495620_0194871 3300046515 Bacteria 780
646 Ga0495628_0014240 3300046516 Bacteria 6672
647 Ga0495630_0009921 3300046517 Bacteria 6858
648 Ga0495631_0001943 3300046518 Bacteria 12119
649 Ga0495631_0032931 3300046518 Bacteria 2332
650 Ga0495632_0001180 3300046519 Bacteria 22231
651 Ga0495632_0002979 3300046519 Bacteria 12393
652 Ga0495637_0000383 3300046520 Bacteria 33112
653 Ga0495637_0003884 3300046520 Bacteria 7841
654 Ga0495637_0013463 3300046520 Bacteria 3880
655 Ga0495637_0016150 3300046520 Bacteria 3492
656 Ga0495637_0075854 3300046520 Bacteria 1348
657 Ga0495643_0023397 3300046522 Bacteria 3513
658 Ga0495648_0001054 3300046524 Bacteria 27965
659 Ga0495648_0020107 3300046524 Bacteria 4671
660 Ga0495648_0024174 3300046524 Bacteria 4145
661 Ga0495648_0242586 3300046524 Bacteria 875
662 Ga0495666_0000312 3300046526 Bacteria 21158
663 Ga0495652_0016164 3300046529 Bacteria 6672
664 Ga0495654_0000564 3300046530 Bacteria 29827
665 Ga0495654_0008722 3300046530 Bacteria 5584
666 Ga0495654_0016822 3300046530 Bacteria 3852
667 Ga0495654_0066536 3300046530 Bacteria 1717
668 Ga0495654_0238301 3300046530 Bacteria 762
669 Ga0495665_0001728 3300046531 Bacteria 11736
670 Ga0495640_0018453 3300046533 Bacteria 5171
671 Ga0495586_0003487 3300046535 Bacteria 8433
672 Ga0495587_0008906 3300046536 Bacteria 6439
673 Ga0495609_0000004 3300046538 Bacteria 697346
674 Ga0495609_0000033 3300046538 Bacteria 208889
675 Ga0495597_0000012 3300046542 Bacteria 212005
676 Ga0495597_0002024 3300046542 Bacteria 13561
677 Ga0495645_0004117 3300046543 Bacteria 9929
678 Ga0495645_0148086 3300046543 Bacteria 1633
679 Ga0495622_0001742 3300046557 Bacteria 10765
680 Ga0495633_0000071 3300046558 Bacteria 132537
681 Ga0495668_0014837 3300046616 Bacteria 4560
682 Ga0495668_0032005 3300046616 Bacteria 2961
683 Ga0495668_0060597 3300046616 Bacteria 2087
684 Ga0495634_0013442 3300046642 Bacteria 5915
685 Ga0495611_0003609 3300046648 Bacteria 6783
686 Ga0495611_0008202 3300046648 Bacteria 4433
687 Ga0495625_0030490 3300046660 Bacteria 4023
688 Ga0495635_0010924 3300046663 Bacteria 6366
689 Ga0495661_0000005 3300046665 Bacteria 433622
690 Ga0495661_0000386 3300046665 Bacteria 47241
691 Ga0495661_0009249 3300046665 Bacteria 6769
692 Ga0495661_0011904 3300046665 Bacteria 5888
693 Ga0495661_0064969 3300046665 Bacteria 2151
694 Ga0495588_0007795 3300046674 Bacteria 4889
695 Ga0495588_0056988 3300046674 Bacteria 2018
696 Ga0495623_0012666 3300046679 Bacteria 5458
697 Ga0495646_0010083 3300046680 Bacteria 6008
698 Ga0495613_0013918 3300046689 Bacteria 5969
699 Ga0495624_0005072 3300046690 Bacteria 9522
700 Ga0495670_0012857 3300046691 Bacteria 4114
701 Ga0495670_0292968 3300046691 Bacteria 871
702 Ga0495671_0004767 3300046692 Bacteria 8012
703 Ga0495671_0211666 3300046692 Bacteria 939
704 Ga0495649_0211961 3300046694 Bacteria 1003
705 Ga0495589_0001257 3300046794 Bacteria 15020
706 Ga0495660_0001607 3300046810 Bacteria 15177
707 Ga0495660_0028242 3300046810 Bacteria 3171
708 Ga0495660_0040807 3300046810 Bacteria 2571
709 Ga0495581_0002940 3300047315 Bacteria 9747
710 Ga0495604_0019673 3300047317 Bacteria 5401
711 Ga0495636_0031934 3300047318 Bacteria 2159
712 Ga0495674_0010569 3300047319 Bacteria 8735
713 Ga0495674_0029278 3300047319 Bacteria 5017
714 Ga0495672_0008617 3300047320 Bacteria 7504
715 Ga0495672_0017732 3300047320 Bacteria 4752
716 Ga0495672_0069240 3300047320 Bacteria 2004
717 Ga0495672_0104289 3300047320 Bacteria 1532
718 Ga0495676_0023336 3300047321 Bacteria 5371
719 Ga0495680_0015810 3300047322 Bacteria 6496
720 Ga0495683_0000026 3300047323 Bacteria 154645
721 Ga0495679_000586 3300047446 Bacteria 25086
722 Ga0495679_000587 3300047446 Bacteria 25030
723 Ga0495679_000960 3300047446 Bacteria 17862
724 Ga0495679_002956 3300047446 Bacteria 8385
725 Ga0495673_0000584 3300047469 Bacteria 36694
726 Ga0495673_0000730 3300047469 Bacteria 31488
727 Ga0495673_0001361 3300047469 Bacteria 19751
728 Ga0495673_0016470 3300047469 Bacteria 3778
729 Ga0495673_0022302 3300047469 Bacteria 3107
730 Ga0495673_0039131 3300047469 Bacteria 2152
731 Ga0495673_0097507 3300047469 Bacteria 1193
732 Ga0495673_0198971 3300047469 Bacteria 750
733 Ga0495681_0023649 3300047470 Bacteria 3258
734 Ga0495681_0134198 3300047470 Bacteria 1051
735 Ga0495686_0024032 3300047472 Bacteria 4008
736 Ga0495593_0010775 3300047673 Bacteria 5270
737 Ga0495602_0018226 3300048088 Bacteria 7019
738 Ga0495602_0048561 3300048088 Bacteria 3812
739 Ga0495614_0000551 3300048089 Bacteria 15510
740 Ga0496100_0018396 3300048903 Bacteria 4144
741 Ga0496100_0410562 3300048903 Bacteria 1033
742 Ga0496101_0001896 3300048904 Bacteria 12628
743 Ga0496101_0412702 3300048904 Bacteria 1064
744 Ga0496102_0246783 3300048905 Bacteria 1683
745 Ga0496103_0011943 3300048906 Bacteria 5157
746 Ga0496104_0240177 3300048907 Bacteria 1724
747 Ga0496104_0393800 3300048907 Bacteria 1297
748 Ga0496104_1057475 3300048907 Bacteria 715
749 Ga0496105_0012174 3300048908 Bacteria 6810
750 Ga0496105_0799552 3300048908 Bacteria 717
751 Ga0496107_0049341 3300048910 Bacteria 3033
752 Ga0496108_0012474 3300048911 Bacteria 6920
753 Ga0496110_0179385 3300048913 Bacteria 1923
754 Ga0496111_0253487 3300048914 Bacteria 1306
755 Ga0496111_0284801 3300048914 Bacteria 1226
756 Ga0496112_0319321 3300048915 Bacteria 1497
757 Ga0496113_0031776 3300048916 Bacteria 3834
758 Ga0496113_0236052 3300048916 Bacteria 1459
759 Ga0496114_0007017 3300048917 Bacteria 8886
760 Ga0496114_1022837 3300048917 Bacteria 710
761 Ga0496115_0000092 3300048918 Bacteria 83381
762 Ga0496115_0055709 3300048918 Bacteria 3176
763 Ga0496116_0000001 3300048919 Bacteria 1501681
764 Ga0496116_0000087 3300048919 Bacteria 217284
765 Ga0496116_0041504 3300048919 Bacteria 3156
766 Ga0496116_0046311 3300048919 Bacteria 2936
767 Ga0496117_0000402 3300048920 Bacteria 73339
768 Ga0496117_0000920 3300048920 Bacteria 45030
769 Ga0496117_0003165 3300048920 Bacteria 19567
770 Ga0496117_0030186 3300048920 Bacteria 4163
771 Ga0496117_0065215 3300048920 Bacteria 2477
772 Ga0496117_0126441 3300048920 Bacteria 1559
773 Ga0496117_0301716 3300048920 Bacteria 847
774 Ga0496118_0002911 3300048921 Bacteria 22252
775 Ga0496118_0003489 3300048921 Bacteria 19729
776 Ga0496118_0004037 3300048921 Bacteria 17839
777 Ga0496118_0005114 3300048921 Bacteria 15073
778 Ga0496118_0010824 3300048921 Bacteria 8984
779 Ga0496118_0115037 3300048921 Bacteria 1772
780 Ga0496119_0000113 3300048922 Bacteria 114626
781 Ga0496119_0001146 3300048922 Bacteria 33275
782 Ga0496119_0001595 3300048922 Bacteria 26958
783 Ga0496120_0000510 3300048923 Bacteria 60563
784 Ga0496120_0001436 3300048923 Bacteria 28628
785 Ga0496120_0001526 3300048923 Bacteria 27270
786 Ga0496120_0170324 3300048923 Bacteria 1077
787 Ga0496121_0005286 3300048924 Bacteria 16631
788 Ga0496121_0006741 3300048924 Bacteria 14094
789 Ga0496121_0020650 3300048924 Bacteria 6502
790 Ga0496121_0046031 3300048924 Bacteria 3739
791 Ga0496121_0056800 3300048924 Bacteria 3248
792 Ga0496121_0162105 3300048924 Bacteria 1634
793 Ga0496121_0164678 3300048924 Bacteria 1617
794 Ga0496122_0000292 3300048925 Bacteria 110793
795 Ga0496122_0043371 3300048925 Bacteria 3525
796 Ga0496122_0054388 3300048925 Bacteria 3007
797 Ga0496122_0073108 3300048925 Bacteria 2433
798 Ga0496123_0000037 3300048926 Bacteria 262238
799 Ga0496123_0004344 3300048926 Bacteria 15001
800 Ga0496123_0014959 3300048926 Bacteria 6396
801 Ga0496123_0159298 3300048926 Bacteria 1205
802 Ga0496123_0239841 3300048926 Bacteria 901
803 Ga0496124_0000008 3300048927 Bacteria 864372
804 Ga0496124_0000035 3300048927 Bacteria 318099
805 Ga0496124_0003982 3300048927 Bacteria 17608
806 Ga0496124_0015571 3300048927 Bacteria 7280
807 Ga0496124_0046521 3300048927 Bacteria 3715
808 Ga0496124_0066873 3300048927 Bacteria 2992
809 Ga0496124_0068598 3300048927 Bacteria 2946
810 Ga0496124_0103930 3300048927 Bacteria 2297
811 Ga0496124_0121218 3300048927 Bacteria 2089
812 Ga0496124_0141316 3300048927 Bacteria 1899
813 Ga0496124_0378887 3300048927 Bacteria 990
814 Ga0496125_0004619 3300048928 Bacteria 15739
815 Ga0496125_0032944 3300048928 Bacteria 4594
816 Ga0496125_0223604 3300048928 Bacteria 1210
817 Ga0496125_0245156 3300048928 Bacteria 1134
818 Ga0496126_0000160 3300048929 Bacteria 155144
819 Ga0496126_0143083 3300048929 Bacteria 2056
820 Ga0496126_0624746 3300048929 Bacteria 846
821 Ga0495678_000068 3300049459 Bacteria 132090
822 Ga0495678_000650 3300049459 Bacteria 31974
823 Ga0495682_0000113 3300049460 Bacteria 69969
824 Ga0501031_0004039 3300049568 Bacteria 9468
825 Ga0501031_0037398 3300049568 Bacteria 3167
826 Ga0501032_0001373 3300049569 Bacteria 19318
827 Ga0501032_0006124 3300049569 Bacteria 8860
828 Ga0501032_0081263 3300049569 Bacteria 2156
829 Ga0501033_0000949 3300049570 Bacteria 26319
830 Ga0501033_0061522 3300049570 Bacteria 2766
831 Ga0501033_0138735 3300049570 Bacteria 1758
832 Ga0501034_0010411 3300049571 Bacteria 9692
833 Ga0501036_0018668 3300049572 Bacteria 5815
834 Ga0501036_0035605 3300049572 Bacteria 4211
835 Ga0501036_0118264 3300049572 Bacteria 2238
836 Ga0501036_0687599 3300049572 Bacteria 846
837 Ga0501037_0000474 3300049573 Bacteria 32555
838 Ga0501037_0011730 3300049573 Bacteria 6452
839 Ga0501037_0253146 3300049573 Bacteria 1232
840 Ga0501037_0584106 3300049573 Bacteria 751
841 Ga0501038_0008209 3300049574 Bacteria 9604
842 Ga0501038_0011418 3300049574 Bacteria 8107
843 Ga0501038_0023864 3300049574 Bacteria 5461
844 Ga0501038_0051462 3300049574 Bacteria 3554
845 Ga0501038_0052450 3300049574 Bacteria 3516
846 Ga0501039_0002238 3300049575 Bacteria 14325
847 Ga0501040_0003365 3300049576 Bacteria 10322
848 Ga0501042_0012886 3300049578 Bacteria 5678
849 Ga0501043_0007578 3300049579 Bacteria 8603
850 Ga0501043_0014893 3300049579 Bacteria 6087
851 Ga0501046_0002898 3300049580 Bacteria 15906
852 Ga0501047_0076382 3300049581 Bacteria 3223
853 Ga0501047_0140448 3300049581 Bacteria 2294
854 Ga0501048_0036449 3300049582 Bacteria 3535
855 Ga0501067_0230033 3300049583 Bacteria 1032
856 Ga0501068_0002905 3300049584 Bacteria 9121
857 Ga0501069_0002081 3300049585 Bacteria 10072
858 Ga0501070_0035914 3300049586 Bacteria 4139
859 Ga0501035_0001429 3300049822 Bacteria 24468
860 Ga0501035_0007273 3300049822 Bacteria 10355
861 Ga0501035_0009680 3300049822 Bacteria 8963
862 Ga0501035_0593428 3300049822 Bacteria 903
863 Ga0501044_0000111 3300049823 Bacteria 100080
864 Ga0501044_0023765 3300049823 Bacteria 6517
865 Ga0501044_0024664 3300049823 Bacteria 6380
866 Ga0501044_0193960 3300049823 Bacteria 1992
867 Ga0501044_0965423 3300049823 Bacteria 725
868 Ga0501045_0003419 3300049824 Bacteria 10863
869 nmdc:mga03683_170090_c1 3300050489 Bacteria 990
870 nmdc:mga03683_277911_c1 3300050489 Bacteria 782
871 nmdc:mga03683_63567_c1 3300050489 Bacteria 1565
872 nmdc:mga03n38_106419_c1 3300050490 Bacteria 1360
873 nmdc:mga03n38_32619_c1 3300050490 Bacteria 2209
874 nmdc:mga03n38_98069_c1 3300050490 Bacteria 1409
875 nmdc:mga00v17_174477_c1 3300050491 Bacteria 1386
876 nmdc:mga00v17_650883_c1 3300050491 Bacteria 678
877 nmdc:mga00v17_668693_c1 3300050491 Bacteria 667
878 nmdc:mga00v17_9129_c1 3300050491 Bacteria 5355
879 nmdc:mga0yw44_21321_c1 3300050492 Bacteria 3612
880 nmdc:mga0yw44_455733_c1 3300050492 Bacteria 867
881 nmdc:mga0yw44_97363_c1 3300050492 Bacteria 1869
882 nmdc:mga0k408_318330_c1 3300050493 Bacteria 928
883 nmdc:mga04h51_85156_c1 3300050495 Bacteria 1129
884 nmdc:mga07m45_404952_c1 3300050496 Bacteria 792
885 nmdc:mga0sz30_28020_c1 3300050516 Bacteria 2316
886 Ga0500607_008349 3300053121 Bacteria 6303
887 Ga0500559_0028159 3300053136 Bacteria 2400
888 Ga0500559_0181460 3300053136 Bacteria 992
889 Ga0500573_0143296 3300053140 Bacteria 1314
890 Ga0500604_0021421 3300053151 Bacteria 1827
891 Ga0500622_0000001 3300053156 Bacteria 657715
892 Ga0500633_0202211 3300053160 Bacteria 743
893 Ga0500636_0000128 3300053177 Bacteria 39607
894 Ga0500637_0002322 3300053178 Bacteria 8424
895 Ga0500625_102369 3300053729 Bacteria 1197
896 Ga0500625_161555 3300053729 Bacteria 822
897 Ga0590075_038713 3300059424 Bacteria 1217
898 Ga0587088_023409 3300059508 Bacteria 1050
899 Ga0587088_095037 3300059508 Bacteria 658
900 Ga0587098_003652 3300059604 Bacteria 1401
901 Ga0587098_021066 3300059604 Bacteria 829
902 Ga0587067_008926 3300059640 Bacteria 1480
903 Ga0587068_007455 3300059641 Bacteria 1560
904 Ga0587072_005177 3300059643 Bacteria 1937
905 Ga0587076_011071 3300059645 Bacteria 1318
906 Ga0587079_036737 3300059647 Bacteria 970
907 Ga0466962_0001736 3300061719 Bacteria 10248
908 Ga0466962_0005524 3300061719 Bacteria 6073
909 Ga0466962_0008013 3300061719 Bacteria 5066
910 Ga0466962_0009252 3300061719 Bacteria 4719
911 Ga0466962_0013511 3300061719 Bacteria 3930
912 Ga0466962_0152877 3300061719 Bacteria 1120
913 2501081590 2501025502 Bacteria 9641094
914 2506578682 2506520007 Bacteria 5442880
915 2506583821 2506520008 Bacteria 5443009
916 2508852646 2508501071 Bacteria 5454741
917 2510282100 2510065053 Bacteria 5005518
918 2510291741 2510065055 Bacteria 5037935
919 2510310248 2510065058 Bacteria 5005894
920 2511085529 2510917013 Bacteria 9951648
921 2513556985 2513237082 Bacteria 8640282
922 2513564517 2513237083 Bacteria 8410967
923 2513954286 2513237150 Bacteria 6553639
924 2514043022 2513237165 Bacteria 6771773
925 2538426680 2537561728 Bacteria 5149301
926 2547695863 2547132181 Bacteria 4945084
927 2555262574 2554235234 Bacteria 5762085
928 2562462549 2561511199 Bacteria 5155034
929 2597031766 2596583598 Bacteria 5251611
930 2599409755 2599185169 Bacteria 5441380
931 2599446460 2599185178 Bacteria 5365746
932 2599881189 2599185288 Bacteria 6666191
933 2599925793 2599185299 Bacteria 4854625
934 2599949528 2599185303 Bacteria 6512725
935 2599971139 2599185307 Bacteria 6194719
936 2600444833 2600254954 Bacteria 5100516
937 2601521751 2600255254 Bacteria 5281859
938 2601526776 2600255255 Bacteria 5282785
939 2601613606 2600255280 Bacteria 5292309
940 2601618329 2600255281 Bacteria 5288753
941 2601624041 2600255283 Bacteria 6061572
942 2601643044 2600255287 Bacteria 5210468
943 2601647914 2600255288 Bacteria 5282738
944 2601651754 2600255289 Bacteria 5281907
945 2601657081 2600255290 Bacteria 5282218
946 2601662865 2600255291 Bacteria 5217298
947 2601695824 2600255298 Bacteria 5215185
948 2601700498 2600255299 Bacteria 5218662
949 2601704878 2600255300 Bacteria 5287774
950 2601709907 2600255301 Bacteria 5280532
951 2601714919 2600255302 Bacteria 5288235
952 2601720849 2600255303 Bacteria 5219315
953 2601725325 2600255304 Bacteria 5283973
954 2601729867 2600255305 Bacteria 5282329
955 2601734884 2600255306 Bacteria 5281613
956 2601739569 2600255307 Bacteria 5439064
957 2601750058 2600255309 Bacteria 5431045
958 2602011863 2600255389 Bacteria 5275336
959 2602017311 2600255392 Bacteria 5437392
960 2603660240 2602042052 Bacteria 5215873
961 2603665515 2602042053 Bacteria 5214361
962 2603837246 2602042103 Bacteria 5284714
963 2603842322 2602042104 Bacteria 5281639
964 2603847395 2602042105 Bacteria 5282303
965 2603852466 2602042106 Bacteria 5282744
966 2603864331 2602042109 Bacteria 5152801
967 2603870520 2602042110 Bacteria 5283285
968 2603875458 2602042111 Bacteria 5212080
969 2606047710 2603880178 Bacteria 5283018
970 2606069946 2603880184 Bacteria 5217896
971 2606145785 2603880202 Bacteria 5284684
972 2606175112 2603880211 Bacteria 5284226
973 2637225693 2636415599 Bacteria 5718434
974 2644485592 2643221687 Bacteria 6500351
975 2644621061 2643221713 Bacteria 6554480
976 2650899125 2648501693 Bacteria 5069560
977 2656279659 2654587920 Bacteria 5475511
978 2676406904 2675903046 Bacteria 5451247
979 2686353511 2684622997 Bacteria 4624240
980 2689445235 2687453601 Bacteria 5546041
981 2729145858 2728369097 Bacteria 4333476
982 2738687908 2738541271 Bacteria 5657310
983 2738707092 2738541274 Bacteria 6909446
984 2738810391 2738541294 Bacteria 6925949
985 2738897751 2738541309 Bacteria 6926455
986 2739263657 2738543016 Bacteria 5657564
987 2739333478 2738543028 Bacteria 6917070
988 2753569609 2751185846 Bacteria 7242164
989 2772439193 2772190666 Bacteria 5117644
990 2774132496 2773857672 Bacteria 4993178
991 2777023542 2775507074 Bacteria 5532402
992 2791921492 2791354903 Bacteria 4937680
993 2792313169 2791355010 Bacteria 4864581
994 2807177423 2806310673 Bacteria 4801221
995 2808978401 2808606385 Bacteria 6711065
996 2808994072 2808606388 Bacteria 6706662
997 2819623462 2818991450 Bacteria 6962147
998 2823423835 2823421272 Bacteria 5372474
999 2834030065 2834028612 Bacteria 6354979
1000 2834642911 2834641062 Bacteria 5559922
1001 2847799702 2847797336 Bacteria 5176640
1002 2852617573 2852612431 Bacteria 6885235
1003 2852672308 2852667396 Bacteria 6885555
1004 2854605359 2854601825 Bacteria 4797592
1005 2855199295 2855195626 Bacteria 4927512
1006 2856290931 2856287931 Bacteria 7223934
1007 2857363678 2857357740 Bacteria 9937880
1008 2858468802 2858466076 Bacteria 4722413
1009 2869554672 2869551831 Bacteria 5474685
1010 2885270705 2885266251 Bacteria 4796748
1011 2888369243 2888366609 Bacteria 5155009
1012 2888378387 2888373701 Bacteria 5098052
1013 2900052560 2900051742 Bacteria 4985156
1014 2900579509 2900577576 Bacteria 5438534
1015 2904513452 2904513164 Bacteria 5476410
1016 2908669598 2908669403 Bacteria 5740494
1017 2917835908 2917832318 Bacteria 5346010
1018 2919112201 2919108558 Bacteria 5897419
1019 2919125712 2919125081 Bacteria 5385106
1020 2919503577 2919501602 Bacteria 5286340
1021 2923527111 2923525760 Bacteria 4472324
1022 2926065851 2926063275 Bacteria 5285848
1023 2928061524 2928058823 Bacteria 5520022
1024 2928113607 2928108538 Bacteria 7360024
1025 2928140680 2928135762 Bacteria 7259641
1026 2928506203 2928503688 Bacteria 7268108
1027 2929192806 2929189879 Bacteria 5930554
1028 2937967819 2937967321 Bacteria 5094075
1029 2939609285 2939607340 Bacteria 4719256
1030 2946010155 2946006987 Bacteria 6705746
1031 2946031135 2946027586 Bacteria 6049274
1032 2969082680 2969079654 Bacteria 5439582
1033 2971824033 2971820967 Bacteria 5823634
1034 2974300107 2974298342 Bacteria 4840922
1035 2984496798 2984494565 Bacteria 5000175
1036 2984502488 2984499530 Bacteria 5020881
1037 2984508898 2984504281 Bacteria 5262371
1038 2984559754 2984559226 Bacteria 5683096
1039 2984597836 2984595703 Bacteria 5682994
1040 2990262215 2990261002 Bacteria 4919493
1041 640938155 640753048 Bacteria 5495657
1042 8003400864 8003400568 Bacteria 5535898
1043 8003960982 8003955200 Bacteria 8601927
1044 8004597178 8004592986 Bacteria 5122074
1045 8015397245 8015394850 Bacteria 5064660
1046 8016728808 8016728285 Bacteria 5263933
1047 8034964660 8034962539 Bacteria 4884839
1048 8054505948 8054503363 Bacteria 6101651
1049 8055090702 8055087960 Bacteria 4784273
1050 8055096657 8055092621 Bacteria 4873875
1051 8055098822 8055097453 Bacteria 4865496
1052 8055820592 8055817908 Bacteria 6609162
1053 Ga0495660_0000328
1054 SwRhRL2b_contig_1922412
1055 JGI24741J21665_1000119
1056 JGI24740J21852_10000217
1057 JGI24740J21852_10000413
1058 JGI24740J21852_10004138
1059 JGI24735J21928_10000832
1060 JGI24735J21928_10024157
1061 JGI25156J39149_1011567
1062 JGI25156J39149_1013119
1063 JGI25162J39368_1002379
1064 JGI25162J39368_1002589
1065 JGI25154J39366_1005222
1066 JGI25164J39214_1000557
1067 JGI25164J39214_1000979
1068 JGI25151J46595_10004250
1069 JGI25165J46597_1000379
1070 rootH1_10033773
1071 rootH2_10013714
1072 rootL2_10213623
1073 rootH1_10317437
1074 Ga0006556J51387_1023891
1075 Ga0006558J51389_1024036
1076 Ga0006560J51390_1018558
1077 Ga0006554J51385_1035245
1078 Ga0055539_1000148
1079 Ga0055539_1009355
1080 Ga0055533_1003082
1081 Ga0055533_1004726
1082 Ga0055532_1000072
1083 Ga0055525_1000148
1084 Ga0055525_1000463
1085 Ga0055527_1000277
1086 Ga0055527_1010338
1087 Ga0055535_1000053
1088 Ga0055535_1000584
1089 Ga0055542_1000611
1090 Ga0055542_1001477
1091 Ga0055529_1000099
1092 Ga0055529_1000795
1093 Ga0055526_1070007
1094 Ga0055536_1000044
1095 Ga0055534_1003892
1096 Ga0055540_1017394
1097 Ga0055541_1000590
1098 Ga0058692_1011178
1099 Ga0065714_10005880
1100 Ga0065714_10076967
1101 Ga0065714_10366483
1102 Ga0065704_10011691
1103 Ga0065704_10073206
1104 Ga0065704_10196990
1105 Ga0065712_10072752
1106 Ga0070658_10002504
1107 Ga0070658_10087088
1108 Ga0070658_10324445
1109 Ga0070683_100210312
1110 Ga0070670_100282481
1111 Ga0070682_100002070
1112 Ga0070682_100004557
1113 Ga0070660_100002928
1114 Ga0070660_100483575
1115 Ga0070660_101256579
1116 Ga0070691_10553996
1117 Ga0070661_100000118
1118 Ga0070661_100000322
1119 Ga0070675_100713412
1120 Ga0070674_100788030
1121 Ga0070659_100018001
1122 Ga0070659_100018699
1123 Ga0070659_100044900
1124 Ga0070659_100052789
1125 Ga0070659_100072579
1126 Ga0070667_100286151
1127 Ga0070700_100721807
1128 Ga0070708_100647424
1129 Ga0070663_100000016
1130 Ga0070663_100117785
1131 Ga0070663_100249868
1132 Ga0070663_100368886
1133 Ga0070663_101105467
1134 Ga0070678_100620852
1135 Ga0070681_10029738
1136 Ga0068867_100671489
1137 Ga0070685_10471512
1138 Ga0070706_100218277
1139 Ga0070699_100169076
1140 Ga0070679_100189384
1141 Ga0070684_100567155
1142 Ga0068853_100019581
1143 Ga0070696_100378248
1144 Ga0070665_100000718
1145 Ga0070665_100165776
1146 Ga0070665_100379760
1147 Ga0068855_100001358
1148 Ga0068855_100003246
1149 Ga0068855_100012611
1150 Ga0068855_100060560
1151 Ga0070664_100000017
1152 Ga0070664_100000044
1153 Ga0068857_100161783
1154 Ga0068857_100770071
1155 Ga0068854_100000078
1156 Ga0068854_100048274
1157 Ga0068856_100003924
1158 Ga0068856_100014214
1159 Ga0068852_100243800
1160 Ga0068859_100078016
1161 Ga0068870_10799298
1162 Ga0068863_100048608
1163 Ga0068863_101346061
1164 Ga0068858_100008871
1165 Ga0068862_102104765
1166 Ga0075365_10001272
1167 Ga0075365_10014199
1168 Ga0075365_10102872
1169 Ga0075365_10201596
1170 Ga0075368_10040896
1171 Ga0075363_100032488
1172 Ga0075363_100091273
1173 Ga0075363_100173328
1174 Ga0075364_10010070
1175 Ga0075364_10023864
1176 Ga0075364_10165642
1177 Ga0075364_10329501
1178 Ga0075364_10560327
1179 Ga0075364_10563606
1180 Ga0075362_10010642
1181 Ga0075362_10578240
1182 Ga0075367_10055586
1183 Ga0075367_10312144
1184 Ga0075367_10829194
1185 Ga0075369_10003792
1186 Ga0075369_10026537
1187 Ga0075369_10055016
1188 Ga0075369_10110140
1189 Ga0075366_10261763
1190 Ga0075366_10522608
1191 Ga0075370_10412781
1192 Ga0097620_100078014
1193 Ga0079104_1000109
1194 Ga0079104_1006466
1195 Ga0105251_10000026
1196 Ga0105251_10000050
1197 Ga0105251_10001110
1198 Ga0105251_10001214
1199 Ga0105251_10001356
1200 Ga0105251_10002532
1201 Ga0105251_10005045
1202 Ga0105251_10351192
1203 Ga0105244_10000134
1204 Ga0105244_10003992
1205 Ga0105244_10006264
1206 Ga0105244_10056969
1207 Ga0105250_10005274
1208 Ga0105240_10001607
1209 Ga0105240_10006881
1210 Ga0105240_10019958
1211 Ga0105240_10168315
1212 Ga0105240_10273986
1213 Ga0105245_10469844
1214 Ga0105245_11395317
1215 Ga0105247_10000068
1216 Ga0105243_10547651
1217 Ga0105243_12091522
1218 Ga0105243_12485258
1219 Ga0105241_10000002
1220 Ga0105241_10041044
1221 Ga0105241_10220053
1222 Ga0105242_10000968
1223 Ga0105248_10231179
1224 Ga0105248_10393131
1225 Ga0105237_10000116
1226 Ga0105237_10007711
1227 Ga0105237_10046215
1228 Ga0105237_10207093
1229 Ga0105237_10227882
1230 Ga0105238_10013663
1231 Ga0105238_10022760
1232 Ga0105238_10175713
1233 Ga0105238_10224733
1234 Ga0105238_10293593
1235 Ga0105249_10548092
1236 Ga0105239_10000033
1237 Ga0105239_10009931
1238 Ga0105239_10442887
1239 Ga0105239_11417152
1240 Ga0105246_10001023
1241 Ga0105246_10030389
1242 Ga0105246_10573517
1243 Ga0157373_10004598
1244 Ga0157373_10009666
1245 Ga0157373_10012730
1246 Ga0157373_10015094
1247 Ga0157373_10017202
1248 Ga0157373_10019071
1249 Ga0157373_10037150
1250 Ga0157373_10040804
1251 Ga0157373_10058409
1252 Ga0157373_10294362
1253 Ga0157373_10451542
1254 Ga0157373_10584233
1255 Ga0157371_10000475
1256 Ga0157371_10001256
1257 Ga0157371_10001936
1258 Ga0157371_10004931
1259 Ga0157371_10010207
1260 Ga0157371_10154062
1261 Ga0157370_10000254
1262 Ga0157370_10000488
1263 Ga0157370_10004360
1264 Ga0157370_10004714
1265 Ga0157370_10004787
1266 Ga0157370_10510900
1267 Ga0157370_10899745
1268 Ga0157370_11298682
1269 Ga0157369_10000416
1270 Ga0157369_10004727
1271 Ga0157369_10005112
1272 Ga0157369_10006013
1273 Ga0157369_10014146
1274 Ga0157369_10078681
1275 Ga0157369_10160578
1276 Ga0157369_10200701
1277 Ga0157374_10000055
1278 Ga0163162_10669017
1279 Ga0163162_10715195
1280 Ga0163162_11193391
1281 Ga0163162_11455597
1282 Ga0157372_10001079
1283 Ga0157372_10003255
1284 Ga0157372_10040910
1285 Ga0157372_10360382
1286 Ga0157375_10007994
1287 Ga0157375_10009789
1288 Ga0163163_10032419
1289 Ga0182008_10001630
1290 Ga0182008_10010665
1291 Ga0182008_10027298
1292 Ga0182008_10570119
1293 Ga0157379_10194662
1294 Ga0182006_1002847
1295 Ga0182006_1005072
1296 Ga0182006_1061982
1297 Ga0182007_10013391
1298 Ga0182007_10028446
1299 Ga0183368_1003
1300 Ga0163161_10000001
1301 Ga0163161_10073716
1302 Ga0163161_10090589
1303 Ga0163161_10378166
1304 Ga0163161_10491351
1305 Ga0163161_10778182
1306 Ga0197907_10147544
1307 Ga0197907_10992650
1308 Ga0197907_11106263
1309 Ga0206356_10394404
1310 Ga0206356_11348764
1311 Ga0206356_11831093
1312 Ga0206349_1553031
1313 Ga0206349_1623260
1314 Ga0206355_1505466
1315 Ga0206351_10373233
1316 Ga0206351_10443943
1317 Ga0206351_10858175
1318 Ga0206352_11113405
1319 Ga0206350_10052148
1320 Ga0206350_11518593
1321 Ga0206354_10692767
1322 Ga0206354_11639641
1323 Ga0206353_11895329
1324 Ga0154015_1288425
1325 Ga0154015_1475337
1326 Ga0213872_10011976
1327 Ga0213872_10020982
1328 Ga0213876_10007089
1329 Ga0224712_10000038
1330 Ga0224712_10227102
1331 Ga0224712_10591849
1332 Ga0209784_100063
1333 Ga0209784_100851
1334 Ga0209566_100048
1335 Ga0209566_100376
1336 Ga0209566_100903
1337 Ga0209674_100033
1338 Ga0209674_100071
1339 Ga0209674_100151
1340 Ga0209674_100218
1341 Ga0209672_100004
1342 Ga0209672_100193
1343 Ga0209672_101163
1344 Ga0209147_100002
1345 Ga0209563_100085
1346 Ga0209563_100132
1347 Ga0209563_108311
1348 Ga0207427_100049
1349 Ga0207427_100101
1350 Ga0207427_112703
1351 Ga0209437_100083
1352 Ga0209437_100090
1353 Ga0209258_100002
1354 Ga0209258_100003
1355 Ga0209646_1000123
1356 Ga0209026_1008026
1357 Ga0209677_100040
1358 Ga0209677_108088
1359 Ga0209148_1000025
1360 Ga0209148_1000077
1361 Ga0209759_1001778
1362 Ga0209759_1004890
1363 Ga0209759_1006697
1364 Ga0209233_1000075
1365 Ga0209233_1000077
1366 Ga0209233_1035653
1367 Ga0209455_1000004
1368 Ga0209455_1000149
1369 Ga0209673_1036376
1370 Ga0209130_1037035
1371 Ga0209675_1000260
1372 Ga0209676_1000141
1373 Ga0209025_1000824
1374 Ga0209025_1078115
1375 Ga0209564_1005964
1376 Ga0209051_1001387
1377 Ga0209051_1005756
1378 Ga0209051_1007639
1379 Ga0207696_1000001
1380 Ga0207655_1000191
1381 Ga0207655_1001845
1382 Ga0207655_1011090
1383 Ga0207655_1011357
1384 Ga0207655_1129099
1385 Ga0207713_1000008
1386 Ga0207713_1000035
1387 Ga0207713_1000039
1388 Ga0207713_1000247
1389 Ga0207713_1000251
1390 Ga0207713_1000527
1391 Ga0207713_1007458
1392 Ga0207713_1029172
1393 Ga0207713_1076077
1394 Ga0207710_10000965
1395 Ga0207647_10000869
1396 Ga0207647_10007730
1397 Ga0207705_10000221
1398 Ga0207705_10025243
1399 Ga0207705_10642931
1400 Ga0207684_10561007
1401 Ga0207654_10000005
1402 Ga0207654_10315270
1403 Ga0207707_10023235
1404 Ga0207695_10000322
1405 Ga0207695_10000891
1406 Ga0207695_10004740
1407 Ga0207695_10005620
1408 Ga0207695_10223838
1409 Ga0207671_10000166
1410 Ga0207671_10009196
1411 Ga0207671_10272660
1412 Ga0207671_10396598
1413 Ga0207671_10726430
1414 Ga0207657_10004640
1415 Ga0207657_10414991
1416 Ga0207657_10419695
1417 Ga0207657_10455717
1418 Ga0207649_10000051
1419 Ga0207649_10000056
1420 Ga0207652_10069744
1421 Ga0207694_10050284
1422 Ga0207694_10170343
1423 Ga0207694_10304344
1424 Ga0207687_10314075
1425 Ga0207690_10003937
1426 Ga0207690_10004321
1427 Ga0207690_10006220
1428 Ga0207690_10064138
1429 Ga0207690_10321448
1430 Ga0207706_10093119
1431 Ga0207686_10003389
1432 Ga0207711_10033801
1433 Ga0207711_10451953
1434 Ga0207679_10000036
1435 Ga0207679_10000042
1436 Ga0207667_10002443
1437 Ga0207667_10005486
1438 Ga0207667_10011114
1439 Ga0207667_10276743
1440 Ga0207640_10000165
1441 Ga0207640_10355993
1442 Ga0207658_11057384
1443 Ga0207703_10008995
1444 Ga0207639_10006352
1445 Ga0207678_10000418
1446 Ga0207678_10318560
1447 Ga0207678_11133326
1448 Ga0207708_10741807
1449 Ga0207702_10000156
1450 Ga0207702_10251440
1451 Ga0207641_10256843
1452 Ga0207641_10610259
1453 Ga0207641_10986059
1454 Ga0207676_10422220
1455 Ga0207674_10016655
1456 Ga0207674_10027147
1457 Ga0207674_10455083
1458 Ga0207683_10286242
1459 Ga0207698_10174421
1460 Ga0209281_1000003
1461 Ga0209281_1000006
1462 Ga0209281_1006445
1463 Ga0209371_1001252
1464 Ga0209371_1022973
1465 Ga0268266_10014158
1466 Ga0268266_10069682
1467 Ga0268266_10461316
1468 Ga0268266_10914033
1469 Ga0268264_10322401
1470 Ga0268264_10455004
1471 Ga0265338_10000409
1472 Ga0268256_1001070
1473 Ga0268256_1025815
1474 Ga0265332_10015987
1475 Ga0265340_10055264
1476 Ga0265327_10007248
1477 Ga0265327_10044332
1478 Ga0265316_10080403
1479 Ga0307408_100000057
1480 Ga0307408_100199053
1481 Ga0316575_10102790
1482 Ga0316576_10001993
1483 Ga0316576_10134954
1484 Ga0316576_10138114
1485 Ga0316576_10399330
1486 Ga0316578_10035002
1487 Ga0316578_10176705
1488 Ga0307405_10000290
1489 Ga0316577_10127792
1490 Ga0307412_11148337
1491 Ga0307409_101649132
1492 Ga0307416_100724251
1493 Ga0307411_10790634
1494 Ga0307411_11105722
1495 Ga0316583_10090054
1496 Ga0316580_10054611
1497 Ga0307510_10072778
1498 Ga0373952_0003772
1499 Ga0373960_0128975
1500 Ga0373946_0406299
1501 Ga0316574_0006721
1502 Ga0316574_0016714
1503 Ga0316574_0046107
1504 Ga0316574_0233389
1505 Ga0373927_0016667
1506 Ga0373937_0534814
1507 Ga0316582_0029005
1508 Ga0316584_0026659
1509 Ga0373925_1175956
1510 Ga0395899_0000008
1511 Ga0395899_0048201
1512 Ga0395899_0094739
1513 Ga0395899_0125574
1514 Ga0395900_0000055
1515 Ga0395900_0006242
1516 Ga0395900_0016169
1517 Ga0395900_0051529
1518 Ga0395900_0095300
1519 Ga0395900_0145236
1520 Ga0395900_0297831
1521 Ga0395900_0832452
1522 Ga0395898_0000119
1523 Ga0395898_0001022
1524 Ga0395898_0007201
1525 Ga0395898_0020307
1526 Ga0395898_0860465
1527 Ga0395905_0262289
1528 Ga0395901_0000003
1529 Ga0395901_0000186
1530 Ga0395901_0001409
1531 Ga0395901_0173956
1532 Ga0400491_10985
1533 Ga0400488_44502
1534 Ga0436365_1408969
1535 Ga0436361_0010589
1536 Ga0436361_0501243
1537 Ga0436363_1333172
1538 Ga0439438_000001
1539 Ga0439438_002554
1540 Ga0439466_0051614
1541 Ga0451787_594757
1542 Ga0451789_0049916
1543 Ga0451789_0367025
1544 Ga0451789_0593989
1545 Ga0451791_1692585
1546 Ga0451791_1902633
1547 Ga0451793_0781259
1548 Ga0451802_1107995
1549 Ga0451837_0371420
1550 Ga0451837_1827207
1551 Ga0451849_0288385
1552 Ga0451849_1462733
1553 Ga0451853_1680771
1554 Ga0439432_002253
1555 Ga0439432_006644
1556 Ga0439432_008403
1557 Ga0439432_023410
1558 Ga0439452_000001
1559 Ga0439455_0075077
1560 Ga0439463_003174
1561 Ga0450898_011463
1562 Ga0450898_032064
1563 Ga0450899_021078
1564 Ga0439459_0017919
1565 Ga0439464_0000909
1566 Ga0451577_0006045
1567 Ga0451577_0518351
1568 Ga0466986_0115117
1569 Ga0466969_0000949
1570 Ga0466969_0040127
1571 Ga0466972_0011622
1572 Ga0466972_0019262
1573 Ga0466972_0041080
1574 Ga0466973_0051992
1575 Ga0466974_0612504
1576 Ga0466978_0056713
1577 Ga0466965_0000123
1578 Ga0466965_0011553
1579 Ga0466965_0017074
1580 Ga0466965_0017787
1581 Ga0466966_0009778
1582 Ga0466966_0014484
1583 Ga0466966_0069918
1584 Ga0466966_0171624
1585 Ga0466966_0324855
1586 Ga0466961_0000097
1587 Ga0466961_0000735
1588 Ga0466961_0001194
1589 Ga0466961_0002073
1590 Ga0466961_0005590
1591 Ga0466961_0036998
1592 Ga0466961_0057586
1593 Ga0466963_0003740
1594 Ga0466963_0014644
1595 Ga0466963_0017489
1596 Ga0466963_0089612
1597 Ga0466963_0106889
1598 Ga0466964_0002945
1599 Ga0466964_0066415
1600 Ga0466964_0331019
1601 Ga0453684_0019091
1602 Ga0453684_0104794
1603 Ga0466971_0000504
1604 Ga0466971_0011044
1605 Ga0466971_0012315
1606 Ga0466971_0023753
1607 Ga0466968_0009580
1608 Ga0466968_0024612
1609 Ga0466968_0037811
1610 Ga0466970_0006012
1611 Ga0466970_0007260
1612 Ga0466970_0011454
1613 Ga0466970_0383344
1614 Ga0466957_0000539
1615 Ga0466957_0012295
1616 Ga0466957_0021793
1617 Ga0466957_0027935
1618 Ga0466957_0029906
1619 Ga0466957_0036640
1620 Ga0466957_0642565
1621 Ga0466960_0230626
1622 Ga0466959_0001442
1623 Ga0466959_0004973
1624 Ga0466959_0014953
1625 Ga0466959_0038529
1626 Ga0466959_0101216
1627 Ga0451576_0018928
1628 Ga0451576_0023255
1629 Ga0451576_0217085
1630 Ga0451576_0500920
1631 Ga0451576_1333910
1632 Ga0466958_0001102
1633 Ga0466958_0002984
1634 Ga0466958_0053691
1635 Ga0466958_0116312
1636 Ga0466958_0281368
1637 Ga0466958_0340708
1638 Ga0466967_0036663
1639 Ga0466967_0191735
1640 Ga0466967_0245154
1641 Ga0466967_0731935
1642 Ga0495627_000010
1643 Ga0495627_000122
1644 Ga0495627_002608
1645 Ga0495603_0016875
1646 Ga0495603_0392753
1647 Ga0495591_000002
1648 Ga0495591_000074
1649 Ga0495591_009243
1650 Ga0495591_020595
1651 Ga0495629_0010284
1652 Ga0495629_0091158
1653 Ga0495641_0034199
1654 Ga0495653_0011577
1655 Ga0495653_0556152
1656 Ga0495650_0005316
1657 Ga0495650_0022998
1658 Ga0495580_0002727
1659 Ga0495582_0003165
1660 Ga0495605_0000011
1661 Ga0495605_0000091
1662 Ga0495605_0000165
1663 Ga0495605_0002402
1664 Ga0495605_0011078
1665 Ga0495605_0012709
1666 Ga0495605_0061469
1667 Ga0495605_0079840
1668 Ga0495639_0300996
1669 Ga0495664_0009421
1670 Ga0495584_0300011
1671 Ga0495594_0002962
1672 Ga0495607_0000085
1673 Ga0495607_0000118
1674 Ga0495607_0000139
1675 Ga0495607_0001121
1676 Ga0495607_0003540
1677 Ga0495607_0006107
1678 Ga0495607_0019157
1679 Ga0495607_0060080
1680 Ga0495583_0000047
1681 Ga0495583_0000427
1682 Ga0495583_0001904
1683 Ga0495583_0011560
1684 Ga0495583_0014225
1685 Ga0495583_0026526
1686 Ga0495606_0000287
1687 Ga0495606_0020108
1688 Ga0495606_0077902
1689 Ga0495610_0017331
1690 Ga0495610_0018874
1691 Ga0495610_0020704
1692 Ga0495610_0276577
1693 Ga0495620_0000081
1694 Ga0495620_0000575
1695 Ga0495620_0001331
1696 Ga0495620_0194871
1697 Ga0495628_0014240
1698 Ga0495630_0009921
1699 Ga0495631_0001943
1700 Ga0495631_0032931
1701 Ga0495632_0001180
1702 Ga0495632_0002979
1703 Ga0495637_0000383
1704 Ga0495637_0003884
1705 Ga0495637_0013463
1706 Ga0495637_0016150
1707 Ga0495637_0075854
1708 Ga0495643_0023397
1709 Ga0495648_0001054
1710 Ga0495648_0020107
1711 Ga0495648_0024174
1712 Ga0495648_0242586
1713 Ga0495666_0000312
1714 Ga0495652_0016164
1715 Ga0495654_0000564
1716 Ga0495654_0008722
1717 Ga0495654_0016822
1718 Ga0495654_0066536
1719 Ga0495654_0238301
1720 Ga0495665_0001728
1721 Ga0495640_0018453
1722 Ga0495586_0003487
1723 Ga0495587_0008906
1724 Ga0495609_0000004
1725 Ga0495609_0000033
1726 Ga0495597_0000012
1727 Ga0495597_0002024
1728 Ga0495645_0004117
1729 Ga0495645_0148086
1730 Ga0495622_0001742
1731 Ga0495633_0000071
1732 Ga0495668_0014837
1733 Ga0495668_0032005
1734 Ga0495668_0060597
1735 Ga0495634_0013442
1736 Ga0495611_0003609
1737 Ga0495611_0008202
1738 Ga0495625_0030490
1739 Ga0495635_0010924
1740 Ga0495661_0000005
1741 Ga0495661_0000386
1742 Ga0495661_0009249
1743 Ga0495661_0011904
1744 Ga0495661_0064969
1745 Ga0495588_0007795
1746 Ga0495588_0056988
1747 Ga0495623_0012666
1748 Ga0495646_0010083
1749 Ga0495613_0013918
1750 Ga0495624_0005072
1751 Ga0495670_0012857
1752 Ga0495670_0292968
1753 Ga0495671_0004767
1754 Ga0495671_0211666
1755 Ga0495649_0211961
1756 Ga0495589_0001257
1757 Ga0495660_0001607
1758 Ga0495660_0028242
1759 Ga0495660_0040807
1760 Ga0495581_0002940
1761 Ga0495604_0019673
1762 Ga0495636_0031934
1763 Ga0495674_0010569
1764 Ga0495674_0029278
1765 Ga0495672_0008617
1766 Ga0495672_0017732
1767 Ga0495672_0069240
1768 Ga0495672_0104289
1769 Ga0495676_0023336
1770 Ga0495680_0015810
1771 Ga0495683_0000026
1772 Ga0495679_000586
1773 Ga0495679_000587
1774 Ga0495679_000960
1775 Ga0495679_002956
1776 Ga0495673_0000584
1777 Ga0495673_0000730
1778 Ga0495673_0001361
1779 Ga0495673_0016470
1780 Ga0495673_0022302
1781 Ga0495673_0039131
1782 Ga0495673_0097507
1783 Ga0495673_0198971
1784 Ga0495681_0023649
1785 Ga0495681_0134198
1786 Ga0495686_0024032
1787 Ga0495593_0010775
1788 Ga0495602_0018226
1789 Ga0495602_0048561
1790 Ga0495614_0000551
1791 Ga0496100_0018396
1792 Ga0496100_0410562
1793 Ga0496101_0001896
1794 Ga0496101_0412702
1795 Ga0496102_0246783
1796 Ga0496103_0011943
1797 Ga0496104_0240177
1798 Ga0496104_0393800
1799 Ga0496104_1057475
1800 Ga0496105_0012174
1801 Ga0496105_0799552
1802 Ga0496107_0049341
1803 Ga0496108_0012474
1804 Ga0496110_0179385
1805 Ga0496111_0253487
1806 Ga0496111_0284801
1807 Ga0496112_0319321
1808 Ga0496113_0031776
1809 Ga0496113_0236052
1810 Ga0496114_0007017
1811 Ga0496114_1022837
1812 Ga0496115_0000092
1813 Ga0496115_0055709
1814 Ga0496116_0000001
1815 Ga0496116_0000087
1816 Ga0496116_0041504
1817 Ga0496116_0046311
1818 Ga0496117_0000402
1819 Ga0496117_0000920
1820 Ga0496117_0003165
1821 Ga0496117_0030186
1822 Ga0496117_0065215
1823 Ga0496117_0126441
1824 Ga0496117_0301716
1825 Ga0496118_0002911
1826 Ga0496118_0003489
1827 Ga0496118_0004037
1828 Ga0496118_0005114
1829 Ga0496118_0010824
1830 Ga0496118_0115037
1831 Ga0496119_0000113
1832 Ga0496119_0001146
1833 Ga0496119_0001595
1834 Ga0496120_0000510
1835 Ga0496120_0001436
1836 Ga0496120_0001526
1837 Ga0496120_0170324
1838 Ga0496121_0005286
1839 Ga0496121_0006741
1840 Ga0496121_0020650
1841 Ga0496121_0046031
1842 Ga0496121_0056800
1843 Ga0496121_0162105
1844 Ga0496121_0164678
1845 Ga0496122_0000292
1846 Ga0496122_0043371
1847 Ga0496122_0054388
1848 Ga0496122_0073108
1849 Ga0496123_0000037
1850 Ga0496123_0004344
1851 Ga0496123_0014959
1852 Ga0496123_0159298
1853 Ga0496123_0239841
1854 Ga0496124_0000008
1855 Ga0496124_0000035
1856 Ga0496124_0003982
1857 Ga0496124_0015571
1858 Ga0496124_0046521
1859 Ga0496124_0066873
1860 Ga0496124_0068598
1861 Ga0496124_0103930
1862 Ga0496124_0121218
1863 Ga0496124_0141316
1864 Ga0496124_0378887
1865 Ga0496125_0004619
1866 Ga0496125_0032944
1867 Ga0496125_0223604
1868 Ga0496125_0245156
1869 Ga0496126_0000160
1870 Ga0496126_0143083
1871 Ga0496126_0624746
1872 Ga0495678_000068
1873 Ga0495678_000650
1874 Ga0495682_0000113
1875 Ga0501031_0004039
1876 Ga0501031_0037398
1877 Ga0501032_0001373
1878 Ga0501032_0006124
1879 Ga0501032_0081263
1880 Ga0501033_0000949
1881 Ga0501033_0061522
1882 Ga0501033_0138735
1883 Ga0501034_0010411
1884 Ga0501036_0018668
1885 Ga0501036_0035605
1886 Ga0501036_0118264
1887 Ga0501036_0687599
1888 Ga0501037_0000474
1889 Ga0501037_0011730
1890 Ga0501037_0253146
1891 Ga0501037_0584106
1892 Ga0501038_0008209
1893 Ga0501038_0011418
1894 Ga0501038_0023864
1895 Ga0501038_0051462
1896 Ga0501038_0052450
1897 Ga0501039_0002238
1898 Ga0501040_0003365
1899 Ga0501042_0012886
1900 Ga0501043_0007578
1901 Ga0501043_0014893
1902 Ga0501046_0002898
1903 Ga0501047_0076382
1904 Ga0501047_0140448
1905 Ga0501048_0036449
1906 Ga0501067_0230033
1907 Ga0501068_0002905
1908 Ga0501069_0002081
1909 Ga0501070_0035914
1910 Ga0501035_0001429
1911 Ga0501035_0007273
1912 Ga0501035_0009680
1913 Ga0501035_0593428
1914 Ga0501044_0000111
1915 Ga0501044_0023765
1916 Ga0501044_0024664
1917 Ga0501044_0193960
1918 Ga0501044_0965423
1919 Ga0501045_0003419
1920 nmdc:mga03683_170090_c1
1921 nmdc:mga03683_277911_c1
1922 nmdc:mga03683_63567_c1
1923 nmdc:mga03n38_106419_c1
1924 nmdc:mga03n38_32619_c1
1925 nmdc:mga03n38_98069_c1
1926 nmdc:mga00v17_174477_c1
1927 nmdc:mga00v17_650883_c1
1928 nmdc:mga00v17_668693_c1
1929 nmdc:mga00v17_9129_c1
1930 nmdc:mga0yw44_21321_c1
1931 nmdc:mga0yw44_455733_c1
1932 nmdc:mga0yw44_97363_c1
1933 nmdc:mga0k408_318330_c1
1934 nmdc:mga04h51_85156_c1
1935 nmdc:mga07m45_404952_c1
1936 nmdc:mga0sz30_28020_c1
1937 Ga0500607_008349
1938 Ga0500559_0028159
1939 Ga0500559_0181460
1940 Ga0500573_0143296
1941 Ga0500604_0021421
1942 Ga0500622_0000001
1943 Ga0500633_0202211
1944 Ga0500636_0000128
1945 Ga0500637_0002322
1946 Ga0500625_102369
1947 Ga0500625_161555
1948 Ga0590075_038713
1949 Ga0587088_023409
1950 Ga0587088_095037
1951 Ga0587098_003652
1952 Ga0587098_021066
1953 Ga0587067_008926
1954 Ga0587068_007455
1955 Ga0587072_005177
1956 Ga0587076_011071
1957 Ga0587079_036737
1958 Ga0466962_0001736
1959 Ga0466962_0005524
1960 Ga0466962_0008013
1961 Ga0466962_0009252
1962 Ga0466962_0013511
1963 Ga0466962_0152877
1964 2501081590
1965 2506578682
1966 2506583821
1967 2508852646
1968 2510282100
1969 2510291741
1970 2510310248
1971 2511085529
1972 2513556985
1973 2513564517
1974 2513954286
1975 2514043022
1976 2538426680
1977 2547695863
1978 2555262574
1979 2562462549
1980 2597031766
1981 2599409755
1982 2599446460
1983 2599881189
1984 2599925793
1985 2599949528
1986 2599971139
1987 2600444833
1988 2601521751
1989 2601526776
1990 2601613606
1991 2601618329
1992 2601624041
1993 2601643044
1994 2601647914
1995 2601651754
1996 2601657081
1997 2601662865
1998 2601695824
1999 2601700498
2000 2601704878
2001 2601709907
2002 2601714919
2003 2601720849
2004 2601725325
2005 2601729867
2006 2601734884
2007 2601739569
2008 2601750058
2009 2602011863
2010 2602017311
2011 2603660240
2012 2603665515
2013 2603837246
2014 2603842322
2015 2603847395
2016 2603852466
2017 2603864331
2018 2603870520
2019 2603875458
2020 2606047710
2021 2606069946
2022 2606145785
2023 2606175112
2024 2637225693
2025 2644485592
2026 2644621061
2027 2650899125
2028 2656279659
2029 2676406904
2030 2686353511
2031 2689445235
2032 2729145858
2033 2738687908
2034 2738707092
2035 2738810391
2036 2738897751
2037 2739263657
2038 2739333478
2039 2753569609
2040 2772439193
2041 2774132496
2042 2777023542
2043 2791921492
2044 2792313169
2045 2807177423
2046 2808978401
2047 2808994072
2048 2819623462
2049 2823423835
2050 2834030065
2051 2834642911
2052 2847799702
2053 2852617573
2054 2852672308
2055 2854605359
2056 2855199295
2057 2856290931
2058 2857363678
2059 2858468802
2060 2869554672
2061 2885270705
2062 2888369243
2063 2888378387
2064 2900052560
2065 2900579509
2066 2904513452
2067 2908669598
2068 2917835908
2069 2919112201
2070 2919125712
2071 2919503577
2072 2923527111
2073 2926065851
2074 2928061524
2075 2928113607
2076 2928140680
2077 2928506203
2078 2929192806
2079 2937967819
2080 2939609285
2081 2946010155
2082 2946031135
2083 2969082680
2084 2971824033
2085 2974300107
2086 2984496798
2087 2984502488
2088 2984508898
2089 2984559754
2090 2984597836
2091 2990262215
2092 640938155
2093 8003400864
2094 8003960982
2095 8004597178
2096 8015397245
2097 8016728808
2098 8034964660
2099 8054505948
2100 8055090702
2101 8055096657
2102 8055098822
2103 8055820592

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

55

198

0.97

PF00578

AhpC-TSA

AhpC/TSA family

56

182

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i43-assembly1.cif.gz_A escherichia coli thiol peroxidase (tpx) wild type disulfide form 0.9812 2 168
1q98-assembly1.cif.gz_B structure of a thiol peroxidase from haemophilus influenzae rd 0.9756 5 166
3i43-assembly1.cif.gz_A escherichia coli thiol peroxidase (tpx) wild type disulfide form 0.9754 2 168
2xpe-assembly1.cif.gz_A oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis 0.9729 5 166
3hvx-assembly1.cif.gz_A-2 escherichia coli thiol peroxidase (tpx) resolving cysteine to serine mutant (c95s) with an intermolecular disulfide bond 0.9697 2 168
ID Description Score Start End Superfamily
1xvqA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9526 12 166 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9407 1 168 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9354 1 168 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9125 5 167 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8964 5 167 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A098BXX0-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9847 1 165 GO:0008379
AF-Q3B4X6-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9826 1 166 GO:0008379
AF-A0A1M3ED54-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9822 3 166 GO:0008379
AF-A0A1T0ARY6-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.982 3 166 GO:0008379
AF-I2DJQ9-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9812 5 166 GO:0008379

Map