F489084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1051 | 547 | 2103 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300046810|Ga0495660_0000328|Ga0495660_0000328_11892_12500 |
| Length | 202 |
| Sequence | MNTEFAACGSSYSGSFCARFMVNFPVSLTLEKRTQFMAQVTRRGNPVQINGELPKVGAAAPAFKLVGGDLADVTLADFAGKRKVLNIFPSVDTPTCATSVRKFNAQANELNNAVVLCISADLPFAQARFCGAEGLENVKNLSTMRGAQFMVDYGVAIADGPMVGLTTRAVVVLDENDKVLHSELVPEIGQEPNYDAALAVLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 205 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 222 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 227 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 228 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 234 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 237 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 238 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 239 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 240 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 241 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 242 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 249 | 3300044660 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 | Metagenome | Unclassified |
| 250 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 393 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 395 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 396 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 398 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 399 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 408 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 409 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 410 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 411 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 412 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 413 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 414 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 415 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 416 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 417 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 418 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 419 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 420 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 421 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 422 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 423 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 424 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 425 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 426 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 427 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 428 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 429 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 430 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 431 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 432 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 433 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 434 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 435 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 436 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 437 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 438 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 439 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 440 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 441 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 442 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 443 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 444 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 445 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 446 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 447 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 448 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 449 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 450 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 451 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 452 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 453 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 454 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 455 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 456 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 457 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 458 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 459 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 460 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 461 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 462 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 463 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 464 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 465 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 466 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 467 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 468 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 469 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 470 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 471 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 472 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 473 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 474 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 475 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 476 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 477 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 478 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 479 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 480 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 481 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 482 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 483 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 484 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 485 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 486 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 487 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 488 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 489 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 490 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 491 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 492 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 493 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 494 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 495 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 496 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 497 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 498 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 499 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 500 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 501 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 502 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 503 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 504 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 505 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 506 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 507 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 508 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 509 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 510 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 511 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 512 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 513 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 514 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 515 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 516 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 517 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 518 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 519 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 520 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 521 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 522 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 523 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 524 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 525 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 526 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 527 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 528 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 529 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 530 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 531 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 532 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 533 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 534 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 535 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 536 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 537 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 538 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 539 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 540 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 541 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 542 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 543 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 544 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 545 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 546 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 547 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.25 |
| Metatranscriptomes | 3.43 |
| Isolates | 13.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 11.7 |
| Nodule | 1.14 |
| Rhizoplane | 7.42 |
| Rhizosphere | 67.17 |
| Stem | 0.1 |
| Stem Tuber | 0.38 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495660_0000328 | 3300046810 | Bacteria | 42079 |
| 2 | SwRhRL2b_contig_1922412 | 2162886007 | Bacteria | 3191 |
| 3 | JGI24741J21665_1000119 | 3300001915 | Bacteria | 21193 |
| 4 | JGI24740J21852_10000217 | 3300001979 | Bacteria | 24237 |
| 5 | JGI24740J21852_10000413 | 3300001979 | Bacteria | 18281 |
| 6 | JGI24740J21852_10004138 | 3300001979 | Bacteria | 6264 |
| 7 | JGI24735J21928_10000832 | 3300002067 | Bacteria | 10968 |
| 8 | JGI24735J21928_10024157 | 3300002067 | Bacteria | 1841 |
| 9 | JGI25156J39149_1011567 | 3300002705 | Bacteria | 1988 |
| 10 | JGI25156J39149_1013119 | 3300002705 | Bacteria | 1777 |
| 11 | JGI25162J39368_1002379 | 3300002737 | Bacteria | 7423 |
| 12 | JGI25162J39368_1002589 | 3300002737 | Bacteria | 6804 |
| 13 | JGI25154J39366_1005222 | 3300002738 | Bacteria | 2118 |
| 14 | JGI25164J39214_1000557 | 3300002772 | Bacteria | 16985 |
| 15 | JGI25164J39214_1000979 | 3300002772 | Bacteria | 9042 |
| 16 | JGI25151J46595_10004250 | 3300003187 | Bacteria | 7620 |
| 17 | JGI25165J46597_1000379 | 3300003214 | Bacteria | 48698 |
| 18 | rootH1_10033773 | 3300003316 | Bacteria | 2681 |
| 19 | rootH1_10033773 | 3300003323 | Bacteria | 4965 |
| 20 | rootH2_10013714 | 3300003320 | Bacteria | 2600 |
| 21 | rootL2_10213623 | 3300003322 | Bacteria | 1371 |
| 22 | rootH1_10317437 | 3300003323 | Bacteria | 1038 |
| 23 | Ga0006556J51387_1023891 | 3300003479 | Bacteria | 716 |
| 24 | Ga0006558J51389_1024036 | 3300003558 | Bacteria | 662 |
| 25 | Ga0006560J51390_1018558 | 3300003565 | Bacteria | 775 |
| 26 | Ga0006554J51385_1035245 | 3300003567 | Bacteria | 543 |
| 27 | Ga0055539_1000148 | 3300003752 | Bacteria | 70566 |
| 28 | Ga0055539_1009355 | 3300003752 | Bacteria | 1217 |
| 29 | Ga0055533_1003082 | 3300003756 | Bacteria | 3514 |
| 30 | Ga0055533_1004726 | 3300003756 | Bacteria | 2373 |
| 31 | Ga0055532_1000072 | 3300003758 | Bacteria | 131787 |
| 32 | Ga0055525_1000148 | 3300003759 | Bacteria | 94868 |
| 33 | Ga0055525_1000463 | 3300003759 | Bacteria | 22787 |
| 34 | Ga0055527_1000277 | 3300003760 | Bacteria | 30515 |
| 35 | Ga0055527_1010338 | 3300003760 | Bacteria | 1078 |
| 36 | Ga0055535_1000053 | 3300003761 | Bacteria | 131787 |
| 37 | Ga0055535_1000584 | 3300003761 | Bacteria | 30492 |
| 38 | Ga0055542_1000611 | 3300003762 | Bacteria | 30492 |
| 39 | Ga0055542_1001477 | 3300003762 | Bacteria | 11565 |
| 40 | Ga0055529_1000099 | 3300003763 | Bacteria | 131775 |
| 41 | Ga0055529_1000795 | 3300003763 | Bacteria | 19327 |
| 42 | Ga0055526_1070007 | 3300003771 | Bacteria | 714 |
| 43 | Ga0055536_1000044 | 3300003781 | Bacteria | 123111 |
| 44 | Ga0055534_1003892 | 3300003784 | Bacteria | 4536 |
| 45 | Ga0055540_1017394 | 3300003792 | Bacteria | 2009 |
| 46 | Ga0055541_1000590 | 3300003841 | Bacteria | 9764 |
| 47 | Ga0058692_1011178 | 3300003856 | Bacteria | 2184 |
| 48 | Ga0065714_10005880 | 3300005288 | Bacteria | 5324 |
| 49 | Ga0065714_10076967 | 3300005288 | Bacteria | 2736 |
| 50 | Ga0065714_10366483 | 3300005288 | Bacteria | 620 |
| 51 | Ga0065704_10011691 | 3300005289 | Bacteria | 2210 |
| 52 | Ga0065704_10073206 | 3300005289 | Bacteria | 7448 |
| 53 | Ga0065704_10196990 | 3300005289 | Bacteria | 1163 |
| 54 | Ga0065712_10072752 | 3300005290 | Bacteria | 4618 |
| 55 | Ga0070658_10002504 | 3300005327 | Bacteria | 15351 |
| 56 | Ga0070658_10087088 | 3300005327 | Bacteria | 2570 |
| 57 | Ga0070658_10324445 | 3300005327 | Bacteria | 1315 |
| 58 | Ga0070683_100210312 | 3300005329 | Bacteria | 1848 |
| 59 | Ga0070670_100282481 | 3300005331 | Bacteria | 1449 |
| 60 | Ga0070682_100002070 | 3300005337 | Bacteria | 11164 |
| 61 | Ga0070682_100004557 | 3300005337 | Bacteria | 7706 |
| 62 | Ga0070660_100002928 | 3300005339 | Bacteria | 11747 |
| 63 | Ga0070660_100483575 | 3300005339 | Bacteria | 1029 |
| 64 | Ga0070660_101256579 | 3300005339 | Bacteria | 628 |
| 65 | Ga0070691_10553996 | 3300005341 | Bacteria | 672 |
| 66 | Ga0070661_100000118 | 3300005344 | Bacteria | 65981 |
| 67 | Ga0070661_100000322 | 3300005344 | Bacteria | 38464 |
| 68 | Ga0070675_100713412 | 3300005354 | Bacteria | 914 |
| 69 | Ga0070674_100788030 | 3300005356 | Bacteria | 820 |
| 70 | Ga0070659_100018001 | 3300005366 | Bacteria | 5326 |
| 71 | Ga0070659_100018699 | 3300005366 | Bacteria | 5231 |
| 72 | Ga0070659_100044900 | 3300005366 | Bacteria | 3461 |
| 73 | Ga0070659_100052789 | 3300005366 | Bacteria | 3198 |
| 74 | Ga0070659_100072579 | 3300005366 | Bacteria | 2739 |
| 75 | Ga0070667_100286151 | 3300005367 | Bacteria | 1481 |
| 76 | Ga0070700_100721807 | 3300005441 | Bacteria | 794 |
| 77 | Ga0070708_100647424 | 3300005445 | Unclassified | 996 |
| 78 | Ga0070663_100000016 | 3300005455 | Bacteria | 126268 |
| 79 | Ga0070663_100117785 | 3300005455 | Bacteria | 2003 |
| 80 | Ga0070663_100249868 | 3300005455 | Bacteria | 1403 |
| 81 | Ga0070663_100368886 | 3300005455 | Bacteria | 1166 |
| 82 | Ga0070663_101105467 | 3300005455 | Bacteria | 693 |
| 83 | Ga0070678_100620852 | 3300005456 | Bacteria | 967 |
| 84 | Ga0070681_10029738 | 3300005458 | Bacteria | 5484 |
| 85 | Ga0068867_100671489 | 3300005459 | Bacteria | 911 |
| 86 | Ga0070685_10471512 | 3300005466 | Bacteria | 883 |
| 87 | Ga0070706_100218277 | 3300005467 | Bacteria | 1780 |
| 88 | Ga0070699_100169076 | 3300005518 | Bacteria | 1937 |
| 89 | Ga0070679_100189384 | 3300005530 | Bacteria | 2027 |
| 90 | Ga0070684_100567155 | 3300005535 | Bacteria | 1054 |
| 91 | Ga0068853_100019581 | 3300005539 | Bacteria | 5614 |
| 92 | Ga0070696_100378248 | 3300005546 | Bacteria | 1103 |
| 93 | Ga0070665_100000718 | 3300005548 | Bacteria | 44076 |
| 94 | Ga0070665_100165776 | 3300005548 | Bacteria | 2212 |
| 95 | Ga0070665_100379760 | 3300005548 | Bacteria | 1420 |
| 96 | Ga0068855_100001358 | 3300005563 | Bacteria | 30324 |
| 97 | Ga0068855_100003246 | 3300005563 | Bacteria | 19887 |
| 98 | Ga0068855_100012611 | 3300005563 | Bacteria | 10200 |
| 99 | Ga0068855_100060560 | 3300005563 | Bacteria | 4427 |
| 100 | Ga0070664_100000017 | 3300005564 | Bacteria | 125713 |
| 101 | Ga0070664_100000044 | 3300005564 | Bacteria | 74926 |
| 102 | Ga0068857_100161783 | 3300005577 | Bacteria | 2031 |
| 103 | Ga0068857_100770071 | 3300005577 | Bacteria | 917 |
| 104 | Ga0068854_100000078 | 3300005578 | Bacteria | 69419 |
| 105 | Ga0068854_100048274 | 3300005578 | Bacteria | 3037 |
| 106 | Ga0068856_100003924 | 3300005614 | Bacteria | 14903 |
| 107 | Ga0068856_100014214 | 3300005614 | Bacteria | 7695 |
| 108 | Ga0068852_100243800 | 3300005616 | Bacteria | 1719 |
| 109 | Ga0068859_100078016 | 3300005617 | Bacteria | 3353 |
| 110 | Ga0068870_10799298 | 3300005840 | Bacteria | 659 |
| 111 | Ga0068863_100048608 | 3300005841 | Bacteria | 4022 |
| 112 | Ga0068863_101346061 | 3300005841 | Bacteria | 721 |
| 113 | Ga0068858_100008871 | 3300005842 | Bacteria | 9642 |
| 114 | Ga0068862_102104765 | 3300005844 | Bacteria | 575 |
| 115 | Ga0075365_10001272 | 3300006038 | Bacteria | 11193 |
| 116 | Ga0075365_10014199 | 3300006038 | Bacteria | 4786 |
| 117 | Ga0075365_10102872 | 3300006038 | Bacteria | 1957 |
| 118 | Ga0075365_10201596 | 3300006038 | Bacteria | 1394 |
| 119 | Ga0075368_10040896 | 3300006042 | Bacteria | 1821 |
| 120 | Ga0075363_100032488 | 3300006048 | Bacteria | 2711 |
| 121 | Ga0075363_100091273 | 3300006048 | Bacteria | 1677 |
| 122 | Ga0075363_100173328 | 3300006048 | Bacteria | 1225 |
| 123 | Ga0075364_10010070 | 3300006051 | Bacteria | 5698 |
| 124 | Ga0075364_10023864 | 3300006051 | Bacteria | 3876 |
| 125 | Ga0075364_10165642 | 3300006051 | Bacteria | 1493 |
| 126 | Ga0075364_10329501 | 3300006051 | Bacteria | 1040 |
| 127 | Ga0075364_10560327 | 3300006051 | Bacteria | 781 |
| 128 | Ga0075364_10563606 | 3300006051 | Bacteria | 779 |
| 129 | Ga0075362_10010642 | 3300006177 | Bacteria | 3599 |
| 130 | Ga0075362_10578240 | 3300006177 | Bacteria | 579 |
| 131 | Ga0075367_10055586 | 3300006178 | Bacteria | 2349 |
| 132 | Ga0075367_10312144 | 3300006178 | Bacteria | 990 |
| 133 | Ga0075367_10829194 | 3300006178 | Bacteria | 589 |
| 134 | Ga0075369_10003792 | 3300006186 | Bacteria | 5534 |
| 135 | Ga0075369_10026537 | 3300006186 | Bacteria | 2415 |
| 136 | Ga0075369_10055016 | 3300006186 | Bacteria | 1728 |
| 137 | Ga0075369_10110140 | 3300006186 | Bacteria | 1241 |
| 138 | Ga0075366_10261763 | 3300006195 | Unclassified | 1056 |
| 139 | Ga0075366_10522608 | 3300006195 | Bacteria | 734 |
| 140 | Ga0075370_10412781 | 3300006353 | Bacteria | 811 |
| 141 | Ga0097620_100078014 | 3300006931 | Bacteria | 3353 |
| 142 | Ga0079104_1000109 | 3300006946 | Bacteria | 122060 |
| 143 | Ga0079104_1006466 | 3300006946 | Bacteria | 4427 |
| 144 | Ga0105251_10000026 | 3300009011 | Bacteria | 132136 |
| 145 | Ga0105251_10000050 | 3300009011 | Bacteria | 108597 |
| 146 | Ga0105251_10001110 | 3300009011 | Bacteria | 23404 |
| 147 | Ga0105251_10001214 | 3300009011 | Bacteria | 22276 |
| 148 | Ga0105251_10001356 | 3300009011 | Bacteria | 21161 |
| 149 | Ga0105251_10002532 | 3300009011 | Bacteria | 14237 |
| 150 | Ga0105251_10005045 | 3300009011 | Bacteria | 8759 |
| 151 | Ga0105251_10351192 | 3300009011 | Bacteria | 673 |
| 152 | Ga0105244_10000134 | 3300009036 | Bacteria | 75961 |
| 153 | Ga0105244_10003992 | 3300009036 | Bacteria | 10326 |
| 154 | Ga0105244_10006264 | 3300009036 | Bacteria | 7746 |
| 155 | Ga0105244_10056969 | 3300009036 | Bacteria | 1976 |
| 156 | Ga0105250_10005274 | 3300009092 | Bacteria | 5807 |
| 157 | Ga0105240_10001607 | 3300009093 | Bacteria | 38298 |
| 158 | Ga0105240_10006881 | 3300009093 | Bacteria | 16617 |
| 159 | Ga0105240_10019958 | 3300009093 | Bacteria | 8949 |
| 160 | Ga0105240_10168315 | 3300009093 | Bacteria | 2597 |
| 161 | Ga0105240_10273986 | 3300009093 | Bacteria | 1942 |
| 162 | Ga0105245_10469844 | 3300009098 | Bacteria | 1269 |
| 163 | Ga0105245_11395317 | 3300009098 | Bacteria | 750 |
| 164 | Ga0105247_10000068 | 3300009101 | Bacteria | 118542 |
| 165 | Ga0105243_10547651 | 3300009148 | Bacteria | 1105 |
| 166 | Ga0105243_12091522 | 3300009148 | Bacteria | 602 |
| 167 | Ga0105243_12485258 | 3300009148 | Bacteria | 557 |
| 168 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 169 | Ga0105241_10041044 | 3300009174 | Bacteria | 3494 |
| 170 | Ga0105241_10220053 | 3300009174 | Bacteria | 1595 |
| 171 | Ga0105242_10000968 | 3300009176 | Bacteria | 22415 |
| 172 | Ga0105248_10231179 | 3300009177 | Bacteria | 2082 |
| 173 | Ga0105248_10393131 | 3300009177 | Bacteria | 1561 |
| 174 | Ga0105237_10000116 | 3300009545 | Bacteria | 111312 |
| 175 | Ga0105237_10007711 | 3300009545 | Bacteria | 11757 |
| 176 | Ga0105237_10046215 | 3300009545 | Bacteria | 4379 |
| 177 | Ga0105237_10207093 | 3300009545 | Bacteria | 1961 |
| 178 | Ga0105237_10227882 | 3300009545 | Bacteria | 1864 |
| 179 | Ga0105238_10013663 | 3300009551 | Bacteria | 8199 |
| 180 | Ga0105238_10022760 | 3300009551 | Bacteria | 6386 |
| 181 | Ga0105238_10175713 | 3300009551 | Bacteria | 2118 |
| 182 | Ga0105238_10224733 | 3300009551 | Bacteria | 1854 |
| 183 | Ga0105238_10293593 | 3300009551 | Bacteria | 1608 |
| 184 | Ga0105249_10548092 | 3300009553 | Bacteria | 1207 |
| 185 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 186 | Ga0105239_10009931 | 3300010375 | Bacteria | 10687 |
| 187 | Ga0105239_10442887 | 3300010375 | Bacteria | 1473 |
| 188 | Ga0105239_11417152 | 3300010375 | Bacteria | 802 |
| 189 | Ga0105246_10001023 | 3300011119 | Bacteria | 16075 |
| 190 | Ga0105246_10030389 | 3300011119 | Bacteria | 3567 |
| 191 | Ga0105246_10573517 | 3300011119 | Bacteria | 971 |
| 192 | Ga0157373_10004598 | 3300013100 | Bacteria | 10377 |
| 193 | Ga0157373_10009666 | 3300013100 | Bacteria | 7118 |
| 194 | Ga0157373_10012730 | 3300013100 | Bacteria | 6182 |
| 195 | Ga0157373_10015094 | 3300013100 | Bacteria | 5649 |
| 196 | Ga0157373_10017202 | 3300013100 | Bacteria | 5265 |
| 197 | Ga0157373_10019071 | 3300013100 | Bacteria | 4993 |
| 198 | Ga0157373_10037150 | 3300013100 | Bacteria | 3493 |
| 199 | Ga0157373_10040804 | 3300013100 | Bacteria | 3320 |
| 200 | Ga0157373_10058409 | 3300013100 | Bacteria | 2735 |
| 201 | Ga0157373_10294362 | 3300013100 | Bacteria | 1151 |
| 202 | Ga0157373_10451542 | 3300013100 | Bacteria | 925 |
| 203 | Ga0157373_10584233 | 3300013100 | Bacteria | 812 |
| 204 | Ga0157371_10000475 | 3300013102 | Bacteria | 49125 |
| 205 | Ga0157371_10001256 | 3300013102 | Bacteria | 26771 |
| 206 | Ga0157371_10001936 | 3300013102 | Bacteria | 20624 |
| 207 | Ga0157371_10004931 | 3300013102 | Bacteria | 11471 |
| 208 | Ga0157371_10010207 | 3300013102 | Bacteria | 7335 |
| 209 | Ga0157371_10154062 | 3300013102 | Bacteria | 1640 |
| 210 | Ga0157370_10000254 | 3300013104 | Bacteria | 67990 |
| 211 | Ga0157370_10000488 | 3300013104 | Bacteria | 49320 |
| 212 | Ga0157370_10004360 | 3300013104 | Bacteria | 16243 |
| 213 | Ga0157370_10004714 | 3300013104 | Bacteria | 15541 |
| 214 | Ga0157370_10004787 | 3300013104 | Bacteria | 15389 |
| 215 | Ga0157370_10510900 | 3300013104 | Bacteria | 1103 |
| 216 | Ga0157370_10899745 | 3300013104 | Bacteria | 803 |
| 217 | Ga0157370_11298682 | 3300013104 | Bacteria | 656 |
| 218 | Ga0157369_10000416 | 3300013105 | Bacteria | 56361 |
| 219 | Ga0157369_10004727 | 3300013105 | Bacteria | 16004 |
| 220 | Ga0157369_10005112 | 3300013105 | Bacteria | 15359 |
| 221 | Ga0157369_10006013 | 3300013105 | Bacteria | 14098 |
| 222 | Ga0157369_10014146 | 3300013105 | Bacteria | 9016 |
| 223 | Ga0157369_10078681 | 3300013105 | Bacteria | 3532 |
| 224 | Ga0157369_10160578 | 3300013105 | Bacteria | 2372 |
| 225 | Ga0157369_10200701 | 3300013105 | Bacteria | 2094 |
| 226 | Ga0157374_10000055 | 3300013296 | Bacteria | 120079 |
| 227 | Ga0163162_10669017 | 3300013306 | Bacteria | 1161 |
| 228 | Ga0163162_10715195 | 3300013306 | Bacteria | 1122 |
| 229 | Ga0163162_11193391 | 3300013306 | Bacteria | 863 |
| 230 | Ga0163162_11455597 | 3300013306 | Bacteria | 780 |
| 231 | Ga0157372_10001079 | 3300013307 | Bacteria | 29711 |
| 232 | Ga0157372_10003255 | 3300013307 | Bacteria | 17548 |
| 233 | Ga0157372_10040910 | 3300013307 | Bacteria | 5123 |
| 234 | Ga0157372_10360382 | 3300013307 | Bacteria | 1694 |
| 235 | Ga0157375_10007994 | 3300013308 | Bacteria | 9261 |
| 236 | Ga0157375_10009789 | 3300013308 | Bacteria | 8426 |
| 237 | Ga0163163_10032419 | 3300014325 | Bacteria | 5045 |
| 238 | Ga0182008_10001630 | 3300014497 | Bacteria | 14875 |
| 239 | Ga0182008_10010665 | 3300014497 | Bacteria | 4913 |
| 240 | Ga0182008_10027298 | 3300014497 | Bacteria | 2894 |
| 241 | Ga0182008_10570119 | 3300014497 | Bacteria | 631 |
| 242 | Ga0157379_10194662 | 3300014968 | Bacteria | 1832 |
| 243 | Ga0182006_1002847 | 3300015261 | Bacteria | 9216 |
| 244 | Ga0182006_1005072 | 3300015261 | Bacteria | 6331 |
| 245 | Ga0182006_1061982 | 3300015261 | Bacteria | 1408 |
| 246 | Ga0182007_10013391 | 3300015262 | Bacteria | 3129 |
| 247 | Ga0182007_10028446 | 3300015262 | Bacteria | 1920 |
| 248 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 249 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 250 | Ga0163161_10073716 | 3300017792 | Bacteria | 2502 |
| 251 | Ga0163161_10090589 | 3300017792 | Bacteria | 2263 |
| 252 | Ga0163161_10378166 | 3300017792 | Bacteria | 1131 |
| 253 | Ga0163161_10491351 | 3300017792 | Bacteria | 998 |
| 254 | Ga0163161_10778182 | 3300017792 | Bacteria | 803 |
| 255 | Ga0197907_10147544 | 3300020069 | Bacteria | 799 |
| 256 | Ga0197907_10992650 | 3300020069 | Bacteria | 1923 |
| 257 | Ga0197907_11106263 | 3300020069 | Bacteria | 789 |
| 258 | Ga0206356_10394404 | 3300020070 | Bacteria | 670 |
| 259 | Ga0206356_11348764 | 3300020070 | Bacteria | 875 |
| 260 | Ga0206356_11831093 | 3300020070 | Bacteria | 3815 |
| 261 | Ga0206349_1553031 | 3300020075 | Bacteria | 1857 |
| 262 | Ga0206349_1623260 | 3300020075 | Bacteria | 1133 |
| 263 | Ga0206355_1505466 | 3300020076 | Bacteria | 599 |
| 264 | Ga0206351_10373233 | 3300020077 | Bacteria | 657 |
| 265 | Ga0206351_10443943 | 3300020077 | Bacteria | 10368 |
| 266 | Ga0206351_10858175 | 3300020077 | Bacteria | 1347 |
| 267 | Ga0206352_11113405 | 3300020078 | Bacteria | 810 |
| 268 | Ga0206350_10052148 | 3300020080 | Bacteria | 2179 |
| 269 | Ga0206350_11518593 | 3300020080 | Bacteria | 2832 |
| 270 | Ga0206354_10692767 | 3300020081 | Bacteria | 2210 |
| 271 | Ga0206354_11639641 | 3300020081 | Bacteria | 1167 |
| 272 | Ga0206353_11895329 | 3300020082 | Bacteria | 3896 |
| 273 | Ga0154015_1288425 | 3300020610 | Bacteria | 723 |
| 274 | Ga0154015_1475337 | 3300020610 | Bacteria | 12803 |
| 275 | Ga0213872_10011976 | 3300021361 | Bacteria | 4092 |
| 276 | Ga0213872_10020982 | 3300021361 | Bacteria | 3008 |
| 277 | Ga0213876_10007089 | 3300021384 | Bacteria | 6107 |
| 278 | Ga0224712_10000038 | 3300022467 | Bacteria | 20134 |
| 279 | Ga0224712_10227102 | 3300022467 | Bacteria | 856 |
| 280 | Ga0224712_10591849 | 3300022467 | Bacteria | 541 |
| 281 | Ga0209784_100063 | 3300025224 | Bacteria | 159576 |
| 282 | Ga0209784_100851 | 3300025224 | Bacteria | 6716 |
| 283 | Ga0209566_100048 | 3300025225 | Bacteria | 241570 |
| 284 | Ga0209566_100376 | 3300025225 | Bacteria | 36803 |
| 285 | Ga0209566_100903 | 3300025225 | Bacteria | 14154 |
| 286 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 287 | Ga0209674_100071 | 3300025226 | Bacteria | 241568 |
| 288 | Ga0209674_100151 | 3300025226 | Bacteria | 95725 |
| 289 | Ga0209674_100218 | 3300025226 | Bacteria | 55386 |
| 290 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 291 | Ga0209672_100193 | 3300025228 | Bacteria | 49311 |
| 292 | Ga0209672_101163 | 3300025228 | Bacteria | 10774 |
| 293 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 294 | Ga0209563_100085 | 3300025230 | Bacteria | 186579 |
| 295 | Ga0209563_100132 | 3300025230 | Bacteria | 95059 |
| 296 | Ga0209563_108311 | 3300025230 | Bacteria | 1645 |
| 297 | Ga0207427_100049 | 3300025231 | Bacteria | 237504 |
| 298 | Ga0207427_100101 | 3300025231 | Bacteria | 120866 |
| 299 | Ga0207427_112703 | 3300025231 | Bacteria | 837 |
| 300 | Ga0209437_100083 | 3300025233 | Bacteria | 256005 |
| 301 | Ga0209437_100090 | 3300025233 | Bacteria | 247138 |
| 302 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 303 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 304 | Ga0209646_1000123 | 3300025246 | Bacteria | 142437 |
| 305 | Ga0209026_1008026 | 3300025250 | Bacteria | 2267 |
| 306 | Ga0209677_100040 | 3300025253 | Bacteria | 241568 |
| 307 | Ga0209677_108088 | 3300025253 | Bacteria | 2102 |
| 308 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 309 | Ga0209148_1000077 | 3300025254 | Bacteria | 298133 |
| 310 | Ga0209759_1001778 | 3300025256 | Bacteria | 10973 |
| 311 | Ga0209759_1004890 | 3300025256 | Bacteria | 4850 |
| 312 | Ga0209759_1006697 | 3300025256 | Bacteria | 3827 |
| 313 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 314 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 315 | Ga0209233_1035653 | 3300025261 | Bacteria | 1122 |
| 316 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 317 | Ga0209455_1000149 | 3300025272 | Bacteria | 131876 |
| 318 | Ga0209673_1036376 | 3300025273 | Bacteria | 1461 |
| 319 | Ga0209130_1037035 | 3300025284 | Bacteria | 965 |
| 320 | Ga0209675_1000260 | 3300025291 | Bacteria | 52208 |
| 321 | Ga0209676_1000141 | 3300025292 | Bacteria | 175894 |
| 322 | Ga0209025_1000824 | 3300025294 | Bacteria | 49441 |
| 323 | Ga0209025_1078115 | 3300025294 | Bacteria | 1138 |
| 324 | Ga0209564_1005964 | 3300025295 | Bacteria | 6742 |
| 325 | Ga0209051_1001387 | 3300025303 | Bacteria | 20871 |
| 326 | Ga0209051_1005756 | 3300025303 | Bacteria | 7150 |
| 327 | Ga0209051_1007639 | 3300025303 | Bacteria | 5880 |
| 328 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 329 | Ga0207655_1000191 | 3300025728 | Bacteria | 108382 |
| 330 | Ga0207655_1001845 | 3300025728 | Bacteria | 18324 |
| 331 | Ga0207655_1011090 | 3300025728 | Bacteria | 5401 |
| 332 | Ga0207655_1011357 | 3300025728 | Bacteria | 5307 |
| 333 | Ga0207655_1129099 | 3300025728 | Bacteria | 826 |
| 334 | Ga0207713_1000008 | 3300025735 | Bacteria | 553952 |
| 335 | Ga0207713_1000035 | 3300025735 | Bacteria | 263228 |
| 336 | Ga0207713_1000039 | 3300025735 | Bacteria | 247140 |
| 337 | Ga0207713_1000247 | 3300025735 | Bacteria | 68982 |
| 338 | Ga0207713_1000251 | 3300025735 | Bacteria | 68244 |
| 339 | Ga0207713_1000527 | 3300025735 | Bacteria | 38436 |
| 340 | Ga0207713_1007458 | 3300025735 | Bacteria | 6452 |
| 341 | Ga0207713_1029172 | 3300025735 | Bacteria | 2476 |
| 342 | Ga0207713_1076077 | 3300025735 | Bacteria | 1222 |
| 343 | Ga0207710_10000965 | 3300025900 | Bacteria | 15130 |
| 344 | Ga0207647_10000869 | 3300025904 | Bacteria | 23399 |
| 345 | Ga0207647_10007730 | 3300025904 | Bacteria | 7739 |
| 346 | Ga0207705_10000221 | 3300025909 | Bacteria | 56813 |
| 347 | Ga0207705_10025243 | 3300025909 | Bacteria | 4243 |
| 348 | Ga0207705_10642931 | 3300025909 | Bacteria | 825 |
| 349 | Ga0207684_10561007 | 3300025910 | Bacteria | 976 |
| 350 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 351 | Ga0207654_10315270 | 3300025911 | Bacteria | 1067 |
| 352 | Ga0207707_10023235 | 3300025912 | Bacteria | 5425 |
| 353 | Ga0207695_10000322 | 3300025913 | Bacteria | 114700 |
| 354 | Ga0207695_10000891 | 3300025913 | Bacteria | 54140 |
| 355 | Ga0207695_10004740 | 3300025913 | Bacteria | 18409 |
| 356 | Ga0207695_10005620 | 3300025913 | Bacteria | 16569 |
| 357 | Ga0207695_10223838 | 3300025913 | Bacteria | 1788 |
| 358 | Ga0207671_10000166 | 3300025914 | Bacteria | 102694 |
| 359 | Ga0207671_10009196 | 3300025914 | Bacteria | 8287 |
| 360 | Ga0207671_10272660 | 3300025914 | Bacteria | 1333 |
| 361 | Ga0207671_10396598 | 3300025914 | Bacteria | 1097 |
| 362 | Ga0207671_10726430 | 3300025914 | Bacteria | 789 |
| 363 | Ga0207657_10004640 | 3300025919 | Bacteria | 14511 |
| 364 | Ga0207657_10414991 | 3300025919 | Bacteria | 1058 |
| 365 | Ga0207657_10419695 | 3300025919 | Bacteria | 1051 |
| 366 | Ga0207657_10455717 | 3300025919 | Bacteria | 1003 |
| 367 | Ga0207649_10000051 | 3300025920 | Bacteria | 108386 |
| 368 | Ga0207649_10000056 | 3300025920 | Bacteria | 102891 |
| 369 | Ga0207652_10069744 | 3300025921 | Bacteria | 3052 |
| 370 | Ga0207694_10050284 | 3300025924 | Bacteria | 3227 |
| 371 | Ga0207694_10170343 | 3300025924 | Bacteria | 1763 |
| 372 | Ga0207694_10304344 | 3300025924 | Bacteria | 1313 |
| 373 | Ga0207687_10314075 | 3300025927 | Bacteria | 1266 |
| 374 | Ga0207690_10003937 | 3300025932 | Bacteria | 8783 |
| 375 | Ga0207690_10004321 | 3300025932 | Bacteria | 8391 |
| 376 | Ga0207690_10006220 | 3300025932 | Bacteria | 7069 |
| 377 | Ga0207690_10064138 | 3300025932 | Bacteria | 2507 |
| 378 | Ga0207690_10321448 | 3300025932 | Bacteria | 1216 |
| 379 | Ga0207706_10093119 | 3300025933 | Bacteria | 2650 |
| 380 | Ga0207686_10003389 | 3300025934 | Bacteria | 8560 |
| 381 | Ga0207711_10033801 | 3300025941 | Bacteria | 4329 |
| 382 | Ga0207711_10451953 | 3300025941 | Bacteria | 1196 |
| 383 | Ga0207679_10000036 | 3300025945 | Bacteria | 133834 |
| 384 | Ga0207679_10000042 | 3300025945 | Bacteria | 126099 |
| 385 | Ga0207667_10002443 | 3300025949 | Bacteria | 23225 |
| 386 | Ga0207667_10005486 | 3300025949 | Bacteria | 15464 |
| 387 | Ga0207667_10011114 | 3300025949 | Bacteria | 10482 |
| 388 | Ga0207667_10276743 | 3300025949 | Bacteria | 1715 |
| 389 | Ga0207640_10000165 | 3300025981 | Bacteria | 48028 |
| 390 | Ga0207640_10355993 | 3300025981 | Bacteria | 1178 |
| 391 | Ga0207658_11057384 | 3300025986 | Bacteria | 741 |
| 392 | Ga0207703_10008995 | 3300026035 | Bacteria | 7865 |
| 393 | Ga0207639_10006352 | 3300026041 | Bacteria | 8029 |
| 394 | Ga0207678_10000418 | 3300026067 | Bacteria | 38457 |
| 395 | Ga0207678_10318560 | 3300026067 | Bacteria | 1338 |
| 396 | Ga0207678_11133326 | 3300026067 | Bacteria | 693 |
| 397 | Ga0207708_10741807 | 3300026075 | Bacteria | 842 |
| 398 | Ga0207702_10000156 | 3300026078 | Bacteria | 80626 |
| 399 | Ga0207702_10251440 | 3300026078 | Bacteria | 1660 |
| 400 | Ga0207641_10256843 | 3300026088 | Bacteria | 1634 |
| 401 | Ga0207641_10610259 | 3300026088 | Bacteria | 1069 |
| 402 | Ga0207641_10986059 | 3300026088 | Bacteria | 839 |
| 403 | Ga0207676_10422220 | 3300026095 | Bacteria | 1251 |
| 404 | Ga0207674_10016655 | 3300026116 | Bacteria | 8036 |
| 405 | Ga0207674_10027147 | 3300026116 | Bacteria | 6063 |
| 406 | Ga0207674_10455083 | 3300026116 | Bacteria | 1237 |
| 407 | Ga0207683_10286242 | 3300026121 | Bacteria | 1506 |
| 408 | Ga0207698_10174421 | 3300026142 | Bacteria | 1897 |
| 409 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 410 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 411 | Ga0209281_1006445 | 3300027111 | Bacteria | 3062 |
| 412 | Ga0209371_1001252 | 3300027312 | Bacteria | 18113 |
| 413 | Ga0209371_1022973 | 3300027312 | Bacteria | 1479 |
| 414 | Ga0268266_10014158 | 3300028379 | Bacteria | 6863 |
| 415 | Ga0268266_10069682 | 3300028379 | Bacteria | 3048 |
| 416 | Ga0268266_10461316 | 3300028379 | Bacteria | 1209 |
| 417 | Ga0268266_10914033 | 3300028379 | Bacteria | 849 |
| 418 | Ga0268264_10322401 | 3300028381 | Bacteria | 1461 |
| 419 | Ga0268264_10455004 | 3300028381 | Bacteria | 1241 |
| 420 | Ga0265338_10000409 | 3300028800 | Bacteria | 76989 |
| 421 | Ga0268256_1001070 | 3300030500 | Bacteria | 18113 |
| 422 | Ga0268256_1025815 | 3300030500 | Bacteria | 1487 |
| 423 | Ga0265332_10015987 | 3300031238 | Bacteria | 3312 |
| 424 | Ga0265340_10055264 | 3300031247 | Bacteria | 1913 |
| 425 | Ga0265327_10007248 | 3300031251 | Bacteria | 8606 |
| 426 | Ga0265327_10044332 | 3300031251 | Bacteria | 2373 |
| 427 | Ga0265316_10080403 | 3300031344 | Bacteria | 2500 |
| 428 | Ga0307408_100000057 | 3300031548 | Bacteria | 135228 |
| 429 | Ga0307408_100199053 | 3300031548 | Bacteria | 1620 |
| 430 | Ga0316575_10102790 | 3300031665 | Bacteria | 1163 |
| 431 | Ga0316576_10001993 | 3300031727 | Bacteria | 11425 |
| 432 | Ga0316576_10134954 | 3300031727 | Bacteria | 1857 |
| 433 | Ga0316576_10138114 | 3300031727 | Bacteria | 1834 |
| 434 | Ga0316576_10399330 | 3300031727 | Bacteria | 1019 |
| 435 | Ga0316578_10035002 | 3300031728 | Bacteria | 2885 |
| 436 | Ga0316578_10176705 | 3300031728 | Bacteria | 1287 |
| 437 | Ga0307405_10000290 | 3300031731 | Bacteria | 18554 |
| 438 | Ga0316577_10127792 | 3300031733 | Bacteria | 1430 |
| 439 | Ga0307412_11148337 | 3300031911 | Bacteria | 693 |
| 440 | Ga0307409_101649132 | 3300031995 | Bacteria | 670 |
| 441 | Ga0307416_100724251 | 3300032002 | Bacteria | 1086 |
| 442 | Ga0307411_10790634 | 3300032005 | Bacteria | 835 |
| 443 | Ga0307411_11105722 | 3300032005 | Bacteria | 715 |
| 444 | Ga0316583_10090054 | 3300032133 | Unclassified | 1070 |
| 445 | Ga0316580_10054611 | 3300032139 | Bacteria | 1229 |
| 446 | Ga0307510_10072778 | 3300033180 | Bacteria | 3412 |
| 447 | Ga0373952_0003772 | 3300035092 | Bacteria | 2740 |
| 448 | Ga0373960_0128975 | 3300035121 | Bacteria | 846 |
| 449 | Ga0373946_0406299 | 3300035171 | Bacteria | 688 |
| 450 | Ga0316574_0006721 | 3300035398 | Bacteria | 6245 |
| 451 | Ga0316574_0016714 | 3300035398 | Bacteria | 4280 |
| 452 | Ga0316574_0046107 | 3300035398 | Bacteria | 2701 |
| 453 | Ga0316574_0233389 | 3300035398 | Bacteria | 1177 |
| 454 | Ga0373927_0016667 | 3300035695 | Unclassified | 4847 |
| 455 | Ga0373937_0534814 | 3300036401 | Bacteria | 1113 |
| 456 | Ga0316582_0029005 | 3300036647 | Bacteria | 3357 |
| 457 | Ga0316584_0026659 | 3300036712 | Bacteria | 4249 |
| 458 | Ga0373925_1175956 | 3300037068 | Bacteria | 630 |
| 459 | Ga0395899_0000008 | 3300037312 | Bacteria | 567572 |
| 460 | Ga0395899_0048201 | 3300037312 | Bacteria | 3171 |
| 461 | Ga0395899_0094739 | 3300037312 | Bacteria | 2160 |
| 462 | Ga0395899_0125574 | 3300037312 | Bacteria | 1835 |
| 463 | Ga0395900_0000055 | 3300037418 | Bacteria | 219875 |
| 464 | Ga0395900_0006242 | 3300037418 | Bacteria | 12437 |
| 465 | Ga0395900_0016169 | 3300037418 | Bacteria | 7600 |
| 466 | Ga0395900_0051529 | 3300037418 | Bacteria | 4239 |
| 467 | Ga0395900_0095300 | 3300037418 | Bacteria | 3058 |
| 468 | Ga0395900_0145236 | 3300037418 | Bacteria | 2426 |
| 469 | Ga0395900_0297831 | 3300037418 | Bacteria | 1600 |
| 470 | Ga0395900_0832452 | 3300037418 | Bacteria | 849 |
| 471 | Ga0395898_0000119 | 3300037466 | Bacteria | 209937 |
| 472 | Ga0395898_0001022 | 3300037466 | Bacteria | 43575 |
| 473 | Ga0395898_0007201 | 3300037466 | Bacteria | 11808 |
| 474 | Ga0395898_0020307 | 3300037466 | Bacteria | 6747 |
| 475 | Ga0395898_0860465 | 3300037466 | Bacteria | 846 |
| 476 | Ga0395905_0262289 | 3300037471 | Bacteria | 1613 |
| 477 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 478 | Ga0395901_0000186 | 3300038443 | Bacteria | 79718 |
| 479 | Ga0395901_0001409 | 3300038443 | Bacteria | 25099 |
| 480 | Ga0395901_0173956 | 3300038443 | Bacteria | 2258 |
| 481 | Ga0400491_10985 | 3300038727 | Bacteria | 1162 |
| 482 | Ga0400488_44502 | 3300038741 | Bacteria | 1692 |
| 483 | Ga0436365_1408969 | 3300039437 | Bacteria | 5160 |
| 484 | Ga0436361_0010589 | 3300039447 | Bacteria | 5514 |
| 485 | Ga0436361_0501243 | 3300039447 | Bacteria | 6465 |
| 486 | Ga0436363_1333172 | 3300039450 | Bacteria | 871 |
| 487 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 488 | Ga0439438_002554 | 3300041405 | Bacteria | 7721 |
| 489 | Ga0439466_0051614 | 3300041411 | Bacteria | 1346 |
| 490 | Ga0451787_594757 | 3300041441 | Bacteria | 611 |
| 491 | Ga0451789_0049916 | 3300041443 | Bacteria | 699 |
| 492 | Ga0451789_0367025 | 3300041443 | Bacteria | 879 |
| 493 | Ga0451789_0593989 | 3300041443 | Bacteria | 1388 |
| 494 | Ga0451791_1692585 | 3300041451 | Bacteria | 814 |
| 495 | Ga0451791_1902633 | 3300041451 | Bacteria | 1389 |
| 496 | Ga0451793_0781259 | 3300041452 | Bacteria | 3261 |
| 497 | Ga0451802_1107995 | 3300041460 | Bacteria | 939 |
| 498 | Ga0451837_0371420 | 3300041494 | Bacteria | 1756 |
| 499 | Ga0451837_1827207 | 3300041494 | Bacteria | 562 |
| 500 | Ga0451849_0288385 | 3300041505 | Bacteria | 586 |
| 501 | Ga0451849_1462733 | 3300041505 | Bacteria | 846 |
| 502 | Ga0451853_1680771 | 3300041512 | Bacteria | 1067 |
| 503 | Ga0439432_002253 | 3300042006 | Bacteria | 7279 |
| 504 | Ga0439432_006644 | 3300042006 | Bacteria | 4121 |
| 505 | Ga0439432_008403 | 3300042006 | Bacteria | 3626 |
| 506 | Ga0439432_023410 | 3300042006 | Bacteria | 2035 |
| 507 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 508 | Ga0439455_0075077 | 3300042012 | Bacteria | 913 |
| 509 | Ga0439463_003174 | 3300042016 | Bacteria | 4171 |
| 510 | Ga0450898_011463 | 3300042134 | Bacteria | 1452 |
| 511 | Ga0450898_032064 | 3300042134 | Bacteria | 968 |
| 512 | Ga0450899_021078 | 3300042135 | Bacteria | 762 |
| 513 | Ga0439459_0017919 | 3300042438 | Bacteria | 1325 |
| 514 | Ga0439464_0000909 | 3300042439 | Bacteria | 6624 |
| 515 | Ga0451577_0006045 | 3300042876 | Bacteria | 12178 |
| 516 | Ga0451577_0518351 | 3300042876 | Bacteria | 1082 |
| 517 | Ga0466986_0115117 | 3300044650 | Bacteria | 1845 |
| 518 | Ga0466969_0000949 | 3300044656 | Bacteria | 15630 |
| 519 | Ga0466969_0040127 | 3300044656 | Bacteria | 2346 |
| 520 | Ga0466972_0011622 | 3300044658 | Bacteria | 4420 |
| 521 | Ga0466972_0019262 | 3300044658 | Bacteria | 3412 |
| 522 | Ga0466972_0041080 | 3300044658 | Bacteria | 2252 |
| 523 | Ga0466973_0051992 | 3300044659 | Bacteria | 3778 |
| 524 | Ga0466974_0612504 | 3300044660 | Bacteria | 552 |
| 525 | Ga0466978_0056713 | 3300044671 | Bacteria | 2443 |
| 526 | Ga0466965_0000123 | 3300044683 | Bacteria | 21985 |
| 527 | Ga0466965_0011553 | 3300044683 | Bacteria | 4141 |
| 528 | Ga0466965_0017074 | 3300044683 | Bacteria | 3464 |
| 529 | Ga0466965_0017787 | 3300044683 | Bacteria | 3400 |
| 530 | Ga0466966_0009778 | 3300044684 | Bacteria | 6356 |
| 531 | Ga0466966_0014484 | 3300044684 | Bacteria | 5218 |
| 532 | Ga0466966_0069918 | 3300044684 | Bacteria | 2201 |
| 533 | Ga0466966_0171624 | 3300044684 | Bacteria | 1318 |
| 534 | Ga0466966_0324855 | 3300044684 | Bacteria | 924 |
| 535 | Ga0466961_0000097 | 3300044693 | Bacteria | 56628 |
| 536 | Ga0466961_0000735 | 3300044693 | Bacteria | 20551 |
| 537 | Ga0466961_0001194 | 3300044693 | Bacteria | 15981 |
| 538 | Ga0466961_0002073 | 3300044693 | Bacteria | 12496 |
| 539 | Ga0466961_0005590 | 3300044693 | Bacteria | 7940 |
| 540 | Ga0466961_0036998 | 3300044693 | Bacteria | 3132 |
| 541 | Ga0466961_0057586 | 3300044693 | Bacteria | 2473 |
| 542 | Ga0466963_0003740 | 3300044694 | Bacteria | 8761 |
| 543 | Ga0466963_0014644 | 3300044694 | Bacteria | 4840 |
| 544 | Ga0466963_0017489 | 3300044694 | Bacteria | 4469 |
| 545 | Ga0466963_0089612 | 3300044694 | Bacteria | 2093 |
| 546 | Ga0466963_0106889 | 3300044694 | Bacteria | 1919 |
| 547 | Ga0466964_0002945 | 3300044706 | Bacteria | 6149 |
| 548 | Ga0466964_0066415 | 3300044706 | Bacteria | 1513 |
| 549 | Ga0466964_0331019 | 3300044706 | Bacteria | 777 |
| 550 | Ga0453684_0019091 | 3300044712 | Bacteria | 10464 |
| 551 | Ga0453684_0104794 | 3300044712 | Bacteria | 3451 |
| 552 | Ga0466971_0000504 | 3300044719 | Bacteria | 15342 |
| 553 | Ga0466971_0011044 | 3300044719 | Bacteria | 3953 |
| 554 | Ga0466971_0012315 | 3300044719 | Bacteria | 3746 |
| 555 | Ga0466971_0023753 | 3300044719 | Bacteria | 2733 |
| 556 | Ga0466968_0009580 | 3300044735 | Bacteria | 3729 |
| 557 | Ga0466968_0024612 | 3300044735 | Bacteria | 2461 |
| 558 | Ga0466968_0037811 | 3300044735 | Bacteria | 2026 |
| 559 | Ga0466970_0006012 | 3300044765 | Bacteria | 6051 |
| 560 | Ga0466970_0007260 | 3300044765 | Bacteria | 5550 |
| 561 | Ga0466970_0011454 | 3300044765 | Bacteria | 4521 |
| 562 | Ga0466970_0383344 | 3300044765 | Bacteria | 800 |
| 563 | Ga0466957_0000539 | 3300044842 | Bacteria | 19128 |
| 564 | Ga0466957_0012295 | 3300044842 | Bacteria | 4956 |
| 565 | Ga0466957_0021793 | 3300044842 | Bacteria | 3776 |
| 566 | Ga0466957_0027935 | 3300044842 | Bacteria | 3355 |
| 567 | Ga0466957_0029906 | 3300044842 | Bacteria | 3250 |
| 568 | Ga0466957_0036640 | 3300044842 | Bacteria | 2950 |
| 569 | Ga0466957_0642565 | 3300044842 | Bacteria | 745 |
| 570 | Ga0466960_0230626 | 3300044901 | Bacteria | 1022 |
| 571 | Ga0466959_0001442 | 3300045049 | Bacteria | 14559 |
| 572 | Ga0466959_0004973 | 3300045049 | Bacteria | 9011 |
| 573 | Ga0466959_0014953 | 3300045049 | Bacteria | 5655 |
| 574 | Ga0466959_0038529 | 3300045049 | Bacteria | 3532 |
| 575 | Ga0466959_0101216 | 3300045049 | Bacteria | 2062 |
| 576 | Ga0451576_0018928 | 3300045051 | Bacteria | 7525 |
| 577 | Ga0451576_0023255 | 3300045051 | Bacteria | 6713 |
| 578 | Ga0451576_0217085 | 3300045051 | Bacteria | 1997 |
| 579 | Ga0451576_0500920 | 3300045051 | Bacteria | 1276 |
| 580 | Ga0451576_1333910 | 3300045051 | Bacteria | 747 |
| 581 | Ga0466958_0001102 | 3300045836 | Bacteria | 12464 |
| 582 | Ga0466958_0002984 | 3300045836 | Bacteria | 8670 |
| 583 | Ga0466958_0053691 | 3300045836 | Bacteria | 2443 |
| 584 | Ga0466958_0116312 | 3300045836 | Bacteria | 1671 |
| 585 | Ga0466958_0281368 | 3300045836 | Bacteria | 1066 |
| 586 | Ga0466958_0340708 | 3300045836 | Bacteria | 964 |
| 587 | Ga0466967_0036663 | 3300045976 | Bacteria | 4188 |
| 588 | Ga0466967_0191735 | 3300045976 | Bacteria | 1932 |
| 589 | Ga0466967_0245154 | 3300045976 | Bacteria | 1710 |
| 590 | Ga0466967_0731935 | 3300045976 | Bacteria | 980 |
| 591 | Ga0495627_000010 | 3300046453 | Bacteria | 381168 |
| 592 | Ga0495627_000122 | 3300046453 | Bacteria | 95389 |
| 593 | Ga0495627_002608 | 3300046453 | Bacteria | 8494 |
| 594 | Ga0495603_0016875 | 3300046455 | Bacteria | 4418 |
| 595 | Ga0495603_0392753 | 3300046455 | Bacteria | 795 |
| 596 | Ga0495591_000002 | 3300046458 | Bacteria | 455013 |
| 597 | Ga0495591_000074 | 3300046458 | Bacteria | 114062 |
| 598 | Ga0495591_009243 | 3300046458 | Bacteria | 3937 |
| 599 | Ga0495591_020595 | 3300046458 | Bacteria | 2174 |
| 600 | Ga0495629_0010284 | 3300046459 | Bacteria | 6814 |
| 601 | Ga0495629_0091158 | 3300046459 | Bacteria | 2127 |
| 602 | Ga0495641_0034199 | 3300046461 | Bacteria | 2404 |
| 603 | Ga0495653_0011577 | 3300046463 | Bacteria | 7201 |
| 604 | Ga0495653_0556152 | 3300046463 | Bacteria | 709 |
| 605 | Ga0495650_0005316 | 3300046471 | Bacteria | 8416 |
| 606 | Ga0495650_0022998 | 3300046471 | Bacteria | 2976 |
| 607 | Ga0495580_0002727 | 3300046472 | Bacteria | 15255 |
| 608 | Ga0495582_0003165 | 3300046473 | Bacteria | 9239 |
| 609 | Ga0495605_0000011 | 3300046474 | Bacteria | 314856 |
| 610 | Ga0495605_0000091 | 3300046474 | Bacteria | 115482 |
| 611 | Ga0495605_0000165 | 3300046474 | Bacteria | 83731 |
| 612 | Ga0495605_0002402 | 3300046474 | Bacteria | 11590 |
| 613 | Ga0495605_0011078 | 3300046474 | Bacteria | 5038 |
| 614 | Ga0495605_0012709 | 3300046474 | Bacteria | 4663 |
| 615 | Ga0495605_0061469 | 3300046474 | Bacteria | 1797 |
| 616 | Ga0495605_0079840 | 3300046474 | Bacteria | 1532 |
| 617 | Ga0495639_0300996 | 3300046475 | Bacteria | 800 |
| 618 | Ga0495664_0009421 | 3300046477 | Bacteria | 5464 |
| 619 | Ga0495584_0300011 | 3300046491 | Bacteria | 816 |
| 620 | Ga0495594_0002962 | 3300046499 | Bacteria | 8804 |
| 621 | Ga0495607_0000085 | 3300046501 | Bacteria | 96340 |
| 622 | Ga0495607_0000118 | 3300046501 | Bacteria | 83429 |
| 623 | Ga0495607_0000139 | 3300046501 | Bacteria | 76715 |
| 624 | Ga0495607_0001121 | 3300046501 | Bacteria | 24280 |
| 625 | Ga0495607_0003540 | 3300046501 | Bacteria | 11892 |
| 626 | Ga0495607_0006107 | 3300046501 | Bacteria | 8521 |
| 627 | Ga0495607_0019157 | 3300046501 | Bacteria | 4351 |
| 628 | Ga0495607_0060080 | 3300046501 | Bacteria | 2165 |
| 629 | Ga0495583_0000047 | 3300046506 | Bacteria | 217720 |
| 630 | Ga0495583_0000427 | 3300046506 | Bacteria | 63612 |
| 631 | Ga0495583_0001904 | 3300046506 | Bacteria | 19329 |
| 632 | Ga0495583_0011560 | 3300046506 | Bacteria | 5061 |
| 633 | Ga0495583_0014225 | 3300046506 | Bacteria | 4399 |
| 634 | Ga0495583_0026526 | 3300046506 | Bacteria | 2870 |
| 635 | Ga0495606_0000287 | 3300046507 | Bacteria | 87639 |
| 636 | Ga0495606_0020108 | 3300046507 | Bacteria | 4936 |
| 637 | Ga0495606_0077902 | 3300046507 | Bacteria | 2069 |
| 638 | Ga0495610_0017331 | 3300046512 | Bacteria | 4109 |
| 639 | Ga0495610_0018874 | 3300046512 | Bacteria | 3877 |
| 640 | Ga0495610_0020704 | 3300046512 | Bacteria | 3644 |
| 641 | Ga0495610_0276577 | 3300046512 | Bacteria | 655 |
| 642 | Ga0495620_0000081 | 3300046515 | Bacteria | 80343 |
| 643 | Ga0495620_0000575 | 3300046515 | Bacteria | 23138 |
| 644 | Ga0495620_0001331 | 3300046515 | Bacteria | 15000 |
| 645 | Ga0495620_0194871 | 3300046515 | Bacteria | 780 |
| 646 | Ga0495628_0014240 | 3300046516 | Bacteria | 6672 |
| 647 | Ga0495630_0009921 | 3300046517 | Bacteria | 6858 |
| 648 | Ga0495631_0001943 | 3300046518 | Bacteria | 12119 |
| 649 | Ga0495631_0032931 | 3300046518 | Bacteria | 2332 |
| 650 | Ga0495632_0001180 | 3300046519 | Bacteria | 22231 |
| 651 | Ga0495632_0002979 | 3300046519 | Bacteria | 12393 |
| 652 | Ga0495637_0000383 | 3300046520 | Bacteria | 33112 |
| 653 | Ga0495637_0003884 | 3300046520 | Bacteria | 7841 |
| 654 | Ga0495637_0013463 | 3300046520 | Bacteria | 3880 |
| 655 | Ga0495637_0016150 | 3300046520 | Bacteria | 3492 |
| 656 | Ga0495637_0075854 | 3300046520 | Bacteria | 1348 |
| 657 | Ga0495643_0023397 | 3300046522 | Bacteria | 3513 |
| 658 | Ga0495648_0001054 | 3300046524 | Bacteria | 27965 |
| 659 | Ga0495648_0020107 | 3300046524 | Bacteria | 4671 |
| 660 | Ga0495648_0024174 | 3300046524 | Bacteria | 4145 |
| 661 | Ga0495648_0242586 | 3300046524 | Bacteria | 875 |
| 662 | Ga0495666_0000312 | 3300046526 | Bacteria | 21158 |
| 663 | Ga0495652_0016164 | 3300046529 | Bacteria | 6672 |
| 664 | Ga0495654_0000564 | 3300046530 | Bacteria | 29827 |
| 665 | Ga0495654_0008722 | 3300046530 | Bacteria | 5584 |
| 666 | Ga0495654_0016822 | 3300046530 | Bacteria | 3852 |
| 667 | Ga0495654_0066536 | 3300046530 | Bacteria | 1717 |
| 668 | Ga0495654_0238301 | 3300046530 | Bacteria | 762 |
| 669 | Ga0495665_0001728 | 3300046531 | Bacteria | 11736 |
| 670 | Ga0495640_0018453 | 3300046533 | Bacteria | 5171 |
| 671 | Ga0495586_0003487 | 3300046535 | Bacteria | 8433 |
| 672 | Ga0495587_0008906 | 3300046536 | Bacteria | 6439 |
| 673 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 674 | Ga0495609_0000033 | 3300046538 | Bacteria | 208889 |
| 675 | Ga0495597_0000012 | 3300046542 | Bacteria | 212005 |
| 676 | Ga0495597_0002024 | 3300046542 | Bacteria | 13561 |
| 677 | Ga0495645_0004117 | 3300046543 | Bacteria | 9929 |
| 678 | Ga0495645_0148086 | 3300046543 | Bacteria | 1633 |
| 679 | Ga0495622_0001742 | 3300046557 | Bacteria | 10765 |
| 680 | Ga0495633_0000071 | 3300046558 | Bacteria | 132537 |
| 681 | Ga0495668_0014837 | 3300046616 | Bacteria | 4560 |
| 682 | Ga0495668_0032005 | 3300046616 | Bacteria | 2961 |
| 683 | Ga0495668_0060597 | 3300046616 | Bacteria | 2087 |
| 684 | Ga0495634_0013442 | 3300046642 | Bacteria | 5915 |
| 685 | Ga0495611_0003609 | 3300046648 | Bacteria | 6783 |
| 686 | Ga0495611_0008202 | 3300046648 | Bacteria | 4433 |
| 687 | Ga0495625_0030490 | 3300046660 | Bacteria | 4023 |
| 688 | Ga0495635_0010924 | 3300046663 | Bacteria | 6366 |
| 689 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 690 | Ga0495661_0000386 | 3300046665 | Bacteria | 47241 |
| 691 | Ga0495661_0009249 | 3300046665 | Bacteria | 6769 |
| 692 | Ga0495661_0011904 | 3300046665 | Bacteria | 5888 |
| 693 | Ga0495661_0064969 | 3300046665 | Bacteria | 2151 |
| 694 | Ga0495588_0007795 | 3300046674 | Bacteria | 4889 |
| 695 | Ga0495588_0056988 | 3300046674 | Bacteria | 2018 |
| 696 | Ga0495623_0012666 | 3300046679 | Bacteria | 5458 |
| 697 | Ga0495646_0010083 | 3300046680 | Bacteria | 6008 |
| 698 | Ga0495613_0013918 | 3300046689 | Bacteria | 5969 |
| 699 | Ga0495624_0005072 | 3300046690 | Bacteria | 9522 |
| 700 | Ga0495670_0012857 | 3300046691 | Bacteria | 4114 |
| 701 | Ga0495670_0292968 | 3300046691 | Bacteria | 871 |
| 702 | Ga0495671_0004767 | 3300046692 | Bacteria | 8012 |
| 703 | Ga0495671_0211666 | 3300046692 | Bacteria | 939 |
| 704 | Ga0495649_0211961 | 3300046694 | Bacteria | 1003 |
| 705 | Ga0495589_0001257 | 3300046794 | Bacteria | 15020 |
| 706 | Ga0495660_0001607 | 3300046810 | Bacteria | 15177 |
| 707 | Ga0495660_0028242 | 3300046810 | Bacteria | 3171 |
| 708 | Ga0495660_0040807 | 3300046810 | Bacteria | 2571 |
| 709 | Ga0495581_0002940 | 3300047315 | Bacteria | 9747 |
| 710 | Ga0495604_0019673 | 3300047317 | Bacteria | 5401 |
| 711 | Ga0495636_0031934 | 3300047318 | Bacteria | 2159 |
| 712 | Ga0495674_0010569 | 3300047319 | Bacteria | 8735 |
| 713 | Ga0495674_0029278 | 3300047319 | Bacteria | 5017 |
| 714 | Ga0495672_0008617 | 3300047320 | Bacteria | 7504 |
| 715 | Ga0495672_0017732 | 3300047320 | Bacteria | 4752 |
| 716 | Ga0495672_0069240 | 3300047320 | Bacteria | 2004 |
| 717 | Ga0495672_0104289 | 3300047320 | Bacteria | 1532 |
| 718 | Ga0495676_0023336 | 3300047321 | Bacteria | 5371 |
| 719 | Ga0495680_0015810 | 3300047322 | Bacteria | 6496 |
| 720 | Ga0495683_0000026 | 3300047323 | Bacteria | 154645 |
| 721 | Ga0495679_000586 | 3300047446 | Bacteria | 25086 |
| 722 | Ga0495679_000587 | 3300047446 | Bacteria | 25030 |
| 723 | Ga0495679_000960 | 3300047446 | Bacteria | 17862 |
| 724 | Ga0495679_002956 | 3300047446 | Bacteria | 8385 |
| 725 | Ga0495673_0000584 | 3300047469 | Bacteria | 36694 |
| 726 | Ga0495673_0000730 | 3300047469 | Bacteria | 31488 |
| 727 | Ga0495673_0001361 | 3300047469 | Bacteria | 19751 |
| 728 | Ga0495673_0016470 | 3300047469 | Bacteria | 3778 |
| 729 | Ga0495673_0022302 | 3300047469 | Bacteria | 3107 |
| 730 | Ga0495673_0039131 | 3300047469 | Bacteria | 2152 |
| 731 | Ga0495673_0097507 | 3300047469 | Bacteria | 1193 |
| 732 | Ga0495673_0198971 | 3300047469 | Bacteria | 750 |
| 733 | Ga0495681_0023649 | 3300047470 | Bacteria | 3258 |
| 734 | Ga0495681_0134198 | 3300047470 | Bacteria | 1051 |
| 735 | Ga0495686_0024032 | 3300047472 | Bacteria | 4008 |
| 736 | Ga0495593_0010775 | 3300047673 | Bacteria | 5270 |
| 737 | Ga0495602_0018226 | 3300048088 | Bacteria | 7019 |
| 738 | Ga0495602_0048561 | 3300048088 | Bacteria | 3812 |
| 739 | Ga0495614_0000551 | 3300048089 | Bacteria | 15510 |
| 740 | Ga0496100_0018396 | 3300048903 | Bacteria | 4144 |
| 741 | Ga0496100_0410562 | 3300048903 | Bacteria | 1033 |
| 742 | Ga0496101_0001896 | 3300048904 | Bacteria | 12628 |
| 743 | Ga0496101_0412702 | 3300048904 | Bacteria | 1064 |
| 744 | Ga0496102_0246783 | 3300048905 | Bacteria | 1683 |
| 745 | Ga0496103_0011943 | 3300048906 | Bacteria | 5157 |
| 746 | Ga0496104_0240177 | 3300048907 | Bacteria | 1724 |
| 747 | Ga0496104_0393800 | 3300048907 | Bacteria | 1297 |
| 748 | Ga0496104_1057475 | 3300048907 | Bacteria | 715 |
| 749 | Ga0496105_0012174 | 3300048908 | Bacteria | 6810 |
| 750 | Ga0496105_0799552 | 3300048908 | Bacteria | 717 |
| 751 | Ga0496107_0049341 | 3300048910 | Bacteria | 3033 |
| 752 | Ga0496108_0012474 | 3300048911 | Bacteria | 6920 |
| 753 | Ga0496110_0179385 | 3300048913 | Bacteria | 1923 |
| 754 | Ga0496111_0253487 | 3300048914 | Bacteria | 1306 |
| 755 | Ga0496111_0284801 | 3300048914 | Bacteria | 1226 |
| 756 | Ga0496112_0319321 | 3300048915 | Bacteria | 1497 |
| 757 | Ga0496113_0031776 | 3300048916 | Bacteria | 3834 |
| 758 | Ga0496113_0236052 | 3300048916 | Bacteria | 1459 |
| 759 | Ga0496114_0007017 | 3300048917 | Bacteria | 8886 |
| 760 | Ga0496114_1022837 | 3300048917 | Bacteria | 710 |
| 761 | Ga0496115_0000092 | 3300048918 | Bacteria | 83381 |
| 762 | Ga0496115_0055709 | 3300048918 | Bacteria | 3176 |
| 763 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 764 | Ga0496116_0000087 | 3300048919 | Bacteria | 217284 |
| 765 | Ga0496116_0041504 | 3300048919 | Bacteria | 3156 |
| 766 | Ga0496116_0046311 | 3300048919 | Bacteria | 2936 |
| 767 | Ga0496117_0000402 | 3300048920 | Bacteria | 73339 |
| 768 | Ga0496117_0000920 | 3300048920 | Bacteria | 45030 |
| 769 | Ga0496117_0003165 | 3300048920 | Bacteria | 19567 |
| 770 | Ga0496117_0030186 | 3300048920 | Bacteria | 4163 |
| 771 | Ga0496117_0065215 | 3300048920 | Bacteria | 2477 |
| 772 | Ga0496117_0126441 | 3300048920 | Bacteria | 1559 |
| 773 | Ga0496117_0301716 | 3300048920 | Bacteria | 847 |
| 774 | Ga0496118_0002911 | 3300048921 | Bacteria | 22252 |
| 775 | Ga0496118_0003489 | 3300048921 | Bacteria | 19729 |
| 776 | Ga0496118_0004037 | 3300048921 | Bacteria | 17839 |
| 777 | Ga0496118_0005114 | 3300048921 | Bacteria | 15073 |
| 778 | Ga0496118_0010824 | 3300048921 | Bacteria | 8984 |
| 779 | Ga0496118_0115037 | 3300048921 | Bacteria | 1772 |
| 780 | Ga0496119_0000113 | 3300048922 | Bacteria | 114626 |
| 781 | Ga0496119_0001146 | 3300048922 | Bacteria | 33275 |
| 782 | Ga0496119_0001595 | 3300048922 | Bacteria | 26958 |
| 783 | Ga0496120_0000510 | 3300048923 | Bacteria | 60563 |
| 784 | Ga0496120_0001436 | 3300048923 | Bacteria | 28628 |
| 785 | Ga0496120_0001526 | 3300048923 | Bacteria | 27270 |
| 786 | Ga0496120_0170324 | 3300048923 | Bacteria | 1077 |
| 787 | Ga0496121_0005286 | 3300048924 | Bacteria | 16631 |
| 788 | Ga0496121_0006741 | 3300048924 | Bacteria | 14094 |
| 789 | Ga0496121_0020650 | 3300048924 | Bacteria | 6502 |
| 790 | Ga0496121_0046031 | 3300048924 | Bacteria | 3739 |
| 791 | Ga0496121_0056800 | 3300048924 | Bacteria | 3248 |
| 792 | Ga0496121_0162105 | 3300048924 | Bacteria | 1634 |
| 793 | Ga0496121_0164678 | 3300048924 | Bacteria | 1617 |
| 794 | Ga0496122_0000292 | 3300048925 | Bacteria | 110793 |
| 795 | Ga0496122_0043371 | 3300048925 | Bacteria | 3525 |
| 796 | Ga0496122_0054388 | 3300048925 | Bacteria | 3007 |
| 797 | Ga0496122_0073108 | 3300048925 | Bacteria | 2433 |
| 798 | Ga0496123_0000037 | 3300048926 | Bacteria | 262238 |
| 799 | Ga0496123_0004344 | 3300048926 | Bacteria | 15001 |
| 800 | Ga0496123_0014959 | 3300048926 | Bacteria | 6396 |
| 801 | Ga0496123_0159298 | 3300048926 | Bacteria | 1205 |
| 802 | Ga0496123_0239841 | 3300048926 | Bacteria | 901 |
| 803 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 804 | Ga0496124_0000035 | 3300048927 | Bacteria | 318099 |
| 805 | Ga0496124_0003982 | 3300048927 | Bacteria | 17608 |
| 806 | Ga0496124_0015571 | 3300048927 | Bacteria | 7280 |
| 807 | Ga0496124_0046521 | 3300048927 | Bacteria | 3715 |
| 808 | Ga0496124_0066873 | 3300048927 | Bacteria | 2992 |
| 809 | Ga0496124_0068598 | 3300048927 | Bacteria | 2946 |
| 810 | Ga0496124_0103930 | 3300048927 | Bacteria | 2297 |
| 811 | Ga0496124_0121218 | 3300048927 | Bacteria | 2089 |
| 812 | Ga0496124_0141316 | 3300048927 | Bacteria | 1899 |
| 813 | Ga0496124_0378887 | 3300048927 | Bacteria | 990 |
| 814 | Ga0496125_0004619 | 3300048928 | Bacteria | 15739 |
| 815 | Ga0496125_0032944 | 3300048928 | Bacteria | 4594 |
| 816 | Ga0496125_0223604 | 3300048928 | Bacteria | 1210 |
| 817 | Ga0496125_0245156 | 3300048928 | Bacteria | 1134 |
| 818 | Ga0496126_0000160 | 3300048929 | Bacteria | 155144 |
| 819 | Ga0496126_0143083 | 3300048929 | Bacteria | 2056 |
| 820 | Ga0496126_0624746 | 3300048929 | Bacteria | 846 |
| 821 | Ga0495678_000068 | 3300049459 | Bacteria | 132090 |
| 822 | Ga0495678_000650 | 3300049459 | Bacteria | 31974 |
| 823 | Ga0495682_0000113 | 3300049460 | Bacteria | 69969 |
| 824 | Ga0501031_0004039 | 3300049568 | Bacteria | 9468 |
| 825 | Ga0501031_0037398 | 3300049568 | Bacteria | 3167 |
| 826 | Ga0501032_0001373 | 3300049569 | Bacteria | 19318 |
| 827 | Ga0501032_0006124 | 3300049569 | Bacteria | 8860 |
| 828 | Ga0501032_0081263 | 3300049569 | Bacteria | 2156 |
| 829 | Ga0501033_0000949 | 3300049570 | Bacteria | 26319 |
| 830 | Ga0501033_0061522 | 3300049570 | Bacteria | 2766 |
| 831 | Ga0501033_0138735 | 3300049570 | Bacteria | 1758 |
| 832 | Ga0501034_0010411 | 3300049571 | Bacteria | 9692 |
| 833 | Ga0501036_0018668 | 3300049572 | Bacteria | 5815 |
| 834 | Ga0501036_0035605 | 3300049572 | Bacteria | 4211 |
| 835 | Ga0501036_0118264 | 3300049572 | Bacteria | 2238 |
| 836 | Ga0501036_0687599 | 3300049572 | Bacteria | 846 |
| 837 | Ga0501037_0000474 | 3300049573 | Bacteria | 32555 |
| 838 | Ga0501037_0011730 | 3300049573 | Bacteria | 6452 |
| 839 | Ga0501037_0253146 | 3300049573 | Bacteria | 1232 |
| 840 | Ga0501037_0584106 | 3300049573 | Bacteria | 751 |
| 841 | Ga0501038_0008209 | 3300049574 | Bacteria | 9604 |
| 842 | Ga0501038_0011418 | 3300049574 | Bacteria | 8107 |
| 843 | Ga0501038_0023864 | 3300049574 | Bacteria | 5461 |
| 844 | Ga0501038_0051462 | 3300049574 | Bacteria | 3554 |
| 845 | Ga0501038_0052450 | 3300049574 | Bacteria | 3516 |
| 846 | Ga0501039_0002238 | 3300049575 | Bacteria | 14325 |
| 847 | Ga0501040_0003365 | 3300049576 | Bacteria | 10322 |
| 848 | Ga0501042_0012886 | 3300049578 | Bacteria | 5678 |
| 849 | Ga0501043_0007578 | 3300049579 | Bacteria | 8603 |
| 850 | Ga0501043_0014893 | 3300049579 | Bacteria | 6087 |
| 851 | Ga0501046_0002898 | 3300049580 | Bacteria | 15906 |
| 852 | Ga0501047_0076382 | 3300049581 | Bacteria | 3223 |
| 853 | Ga0501047_0140448 | 3300049581 | Bacteria | 2294 |
| 854 | Ga0501048_0036449 | 3300049582 | Bacteria | 3535 |
| 855 | Ga0501067_0230033 | 3300049583 | Bacteria | 1032 |
| 856 | Ga0501068_0002905 | 3300049584 | Bacteria | 9121 |
| 857 | Ga0501069_0002081 | 3300049585 | Bacteria | 10072 |
| 858 | Ga0501070_0035914 | 3300049586 | Bacteria | 4139 |
| 859 | Ga0501035_0001429 | 3300049822 | Bacteria | 24468 |
| 860 | Ga0501035_0007273 | 3300049822 | Bacteria | 10355 |
| 861 | Ga0501035_0009680 | 3300049822 | Bacteria | 8963 |
| 862 | Ga0501035_0593428 | 3300049822 | Bacteria | 903 |
| 863 | Ga0501044_0000111 | 3300049823 | Bacteria | 100080 |
| 864 | Ga0501044_0023765 | 3300049823 | Bacteria | 6517 |
| 865 | Ga0501044_0024664 | 3300049823 | Bacteria | 6380 |
| 866 | Ga0501044_0193960 | 3300049823 | Bacteria | 1992 |
| 867 | Ga0501044_0965423 | 3300049823 | Bacteria | 725 |
| 868 | Ga0501045_0003419 | 3300049824 | Bacteria | 10863 |
| 869 | nmdc:mga03683_170090_c1 | 3300050489 | Bacteria | 990 |
| 870 | nmdc:mga03683_277911_c1 | 3300050489 | Bacteria | 782 |
| 871 | nmdc:mga03683_63567_c1 | 3300050489 | Bacteria | 1565 |
| 872 | nmdc:mga03n38_106419_c1 | 3300050490 | Bacteria | 1360 |
| 873 | nmdc:mga03n38_32619_c1 | 3300050490 | Bacteria | 2209 |
| 874 | nmdc:mga03n38_98069_c1 | 3300050490 | Bacteria | 1409 |
| 875 | nmdc:mga00v17_174477_c1 | 3300050491 | Bacteria | 1386 |
| 876 | nmdc:mga00v17_650883_c1 | 3300050491 | Bacteria | 678 |
| 877 | nmdc:mga00v17_668693_c1 | 3300050491 | Bacteria | 667 |
| 878 | nmdc:mga00v17_9129_c1 | 3300050491 | Bacteria | 5355 |
| 879 | nmdc:mga0yw44_21321_c1 | 3300050492 | Bacteria | 3612 |
| 880 | nmdc:mga0yw44_455733_c1 | 3300050492 | Bacteria | 867 |
| 881 | nmdc:mga0yw44_97363_c1 | 3300050492 | Bacteria | 1869 |
| 882 | nmdc:mga0k408_318330_c1 | 3300050493 | Bacteria | 928 |
| 883 | nmdc:mga04h51_85156_c1 | 3300050495 | Bacteria | 1129 |
| 884 | nmdc:mga07m45_404952_c1 | 3300050496 | Bacteria | 792 |
| 885 | nmdc:mga0sz30_28020_c1 | 3300050516 | Bacteria | 2316 |
| 886 | Ga0500607_008349 | 3300053121 | Bacteria | 6303 |
| 887 | Ga0500559_0028159 | 3300053136 | Bacteria | 2400 |
| 888 | Ga0500559_0181460 | 3300053136 | Bacteria | 992 |
| 889 | Ga0500573_0143296 | 3300053140 | Bacteria | 1314 |
| 890 | Ga0500604_0021421 | 3300053151 | Bacteria | 1827 |
| 891 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 892 | Ga0500633_0202211 | 3300053160 | Bacteria | 743 |
| 893 | Ga0500636_0000128 | 3300053177 | Bacteria | 39607 |
| 894 | Ga0500637_0002322 | 3300053178 | Bacteria | 8424 |
| 895 | Ga0500625_102369 | 3300053729 | Bacteria | 1197 |
| 896 | Ga0500625_161555 | 3300053729 | Bacteria | 822 |
| 897 | Ga0590075_038713 | 3300059424 | Bacteria | 1217 |
| 898 | Ga0587088_023409 | 3300059508 | Bacteria | 1050 |
| 899 | Ga0587088_095037 | 3300059508 | Bacteria | 658 |
| 900 | Ga0587098_003652 | 3300059604 | Bacteria | 1401 |
| 901 | Ga0587098_021066 | 3300059604 | Bacteria | 829 |
| 902 | Ga0587067_008926 | 3300059640 | Bacteria | 1480 |
| 903 | Ga0587068_007455 | 3300059641 | Bacteria | 1560 |
| 904 | Ga0587072_005177 | 3300059643 | Bacteria | 1937 |
| 905 | Ga0587076_011071 | 3300059645 | Bacteria | 1318 |
| 906 | Ga0587079_036737 | 3300059647 | Bacteria | 970 |
| 907 | Ga0466962_0001736 | 3300061719 | Bacteria | 10248 |
| 908 | Ga0466962_0005524 | 3300061719 | Bacteria | 6073 |
| 909 | Ga0466962_0008013 | 3300061719 | Bacteria | 5066 |
| 910 | Ga0466962_0009252 | 3300061719 | Bacteria | 4719 |
| 911 | Ga0466962_0013511 | 3300061719 | Bacteria | 3930 |
| 912 | Ga0466962_0152877 | 3300061719 | Bacteria | 1120 |
| 913 | 2501081590 | 2501025502 | Bacteria | 9641094 |
| 914 | 2506578682 | 2506520007 | Bacteria | 5442880 |
| 915 | 2506583821 | 2506520008 | Bacteria | 5443009 |
| 916 | 2508852646 | 2508501071 | Bacteria | 5454741 |
| 917 | 2510282100 | 2510065053 | Bacteria | 5005518 |
| 918 | 2510291741 | 2510065055 | Bacteria | 5037935 |
| 919 | 2510310248 | 2510065058 | Bacteria | 5005894 |
| 920 | 2511085529 | 2510917013 | Bacteria | 9951648 |
| 921 | 2513556985 | 2513237082 | Bacteria | 8640282 |
| 922 | 2513564517 | 2513237083 | Bacteria | 8410967 |
| 923 | 2513954286 | 2513237150 | Bacteria | 6553639 |
| 924 | 2514043022 | 2513237165 | Bacteria | 6771773 |
| 925 | 2538426680 | 2537561728 | Bacteria | 5149301 |
| 926 | 2547695863 | 2547132181 | Bacteria | 4945084 |
| 927 | 2555262574 | 2554235234 | Bacteria | 5762085 |
| 928 | 2562462549 | 2561511199 | Bacteria | 5155034 |
| 929 | 2597031766 | 2596583598 | Bacteria | 5251611 |
| 930 | 2599409755 | 2599185169 | Bacteria | 5441380 |
| 931 | 2599446460 | 2599185178 | Bacteria | 5365746 |
| 932 | 2599881189 | 2599185288 | Bacteria | 6666191 |
| 933 | 2599925793 | 2599185299 | Bacteria | 4854625 |
| 934 | 2599949528 | 2599185303 | Bacteria | 6512725 |
| 935 | 2599971139 | 2599185307 | Bacteria | 6194719 |
| 936 | 2600444833 | 2600254954 | Bacteria | 5100516 |
| 937 | 2601521751 | 2600255254 | Bacteria | 5281859 |
| 938 | 2601526776 | 2600255255 | Bacteria | 5282785 |
| 939 | 2601613606 | 2600255280 | Bacteria | 5292309 |
| 940 | 2601618329 | 2600255281 | Bacteria | 5288753 |
| 941 | 2601624041 | 2600255283 | Bacteria | 6061572 |
| 942 | 2601643044 | 2600255287 | Bacteria | 5210468 |
| 943 | 2601647914 | 2600255288 | Bacteria | 5282738 |
| 944 | 2601651754 | 2600255289 | Bacteria | 5281907 |
| 945 | 2601657081 | 2600255290 | Bacteria | 5282218 |
| 946 | 2601662865 | 2600255291 | Bacteria | 5217298 |
| 947 | 2601695824 | 2600255298 | Bacteria | 5215185 |
| 948 | 2601700498 | 2600255299 | Bacteria | 5218662 |
| 949 | 2601704878 | 2600255300 | Bacteria | 5287774 |
| 950 | 2601709907 | 2600255301 | Bacteria | 5280532 |
| 951 | 2601714919 | 2600255302 | Bacteria | 5288235 |
| 952 | 2601720849 | 2600255303 | Bacteria | 5219315 |
| 953 | 2601725325 | 2600255304 | Bacteria | 5283973 |
| 954 | 2601729867 | 2600255305 | Bacteria | 5282329 |
| 955 | 2601734884 | 2600255306 | Bacteria | 5281613 |
| 956 | 2601739569 | 2600255307 | Bacteria | 5439064 |
| 957 | 2601750058 | 2600255309 | Bacteria | 5431045 |
| 958 | 2602011863 | 2600255389 | Bacteria | 5275336 |
| 959 | 2602017311 | 2600255392 | Bacteria | 5437392 |
| 960 | 2603660240 | 2602042052 | Bacteria | 5215873 |
| 961 | 2603665515 | 2602042053 | Bacteria | 5214361 |
| 962 | 2603837246 | 2602042103 | Bacteria | 5284714 |
| 963 | 2603842322 | 2602042104 | Bacteria | 5281639 |
| 964 | 2603847395 | 2602042105 | Bacteria | 5282303 |
| 965 | 2603852466 | 2602042106 | Bacteria | 5282744 |
| 966 | 2603864331 | 2602042109 | Bacteria | 5152801 |
| 967 | 2603870520 | 2602042110 | Bacteria | 5283285 |
| 968 | 2603875458 | 2602042111 | Bacteria | 5212080 |
| 969 | 2606047710 | 2603880178 | Bacteria | 5283018 |
| 970 | 2606069946 | 2603880184 | Bacteria | 5217896 |
| 971 | 2606145785 | 2603880202 | Bacteria | 5284684 |
| 972 | 2606175112 | 2603880211 | Bacteria | 5284226 |
| 973 | 2637225693 | 2636415599 | Bacteria | 5718434 |
| 974 | 2644485592 | 2643221687 | Bacteria | 6500351 |
| 975 | 2644621061 | 2643221713 | Bacteria | 6554480 |
| 976 | 2650899125 | 2648501693 | Bacteria | 5069560 |
| 977 | 2656279659 | 2654587920 | Bacteria | 5475511 |
| 978 | 2676406904 | 2675903046 | Bacteria | 5451247 |
| 979 | 2686353511 | 2684622997 | Bacteria | 4624240 |
| 980 | 2689445235 | 2687453601 | Bacteria | 5546041 |
| 981 | 2729145858 | 2728369097 | Bacteria | 4333476 |
| 982 | 2738687908 | 2738541271 | Bacteria | 5657310 |
| 983 | 2738707092 | 2738541274 | Bacteria | 6909446 |
| 984 | 2738810391 | 2738541294 | Bacteria | 6925949 |
| 985 | 2738897751 | 2738541309 | Bacteria | 6926455 |
| 986 | 2739263657 | 2738543016 | Bacteria | 5657564 |
| 987 | 2739333478 | 2738543028 | Bacteria | 6917070 |
| 988 | 2753569609 | 2751185846 | Bacteria | 7242164 |
| 989 | 2772439193 | 2772190666 | Bacteria | 5117644 |
| 990 | 2774132496 | 2773857672 | Bacteria | 4993178 |
| 991 | 2777023542 | 2775507074 | Bacteria | 5532402 |
| 992 | 2791921492 | 2791354903 | Bacteria | 4937680 |
| 993 | 2792313169 | 2791355010 | Bacteria | 4864581 |
| 994 | 2807177423 | 2806310673 | Bacteria | 4801221 |
| 995 | 2808978401 | 2808606385 | Bacteria | 6711065 |
| 996 | 2808994072 | 2808606388 | Bacteria | 6706662 |
| 997 | 2819623462 | 2818991450 | Bacteria | 6962147 |
| 998 | 2823423835 | 2823421272 | Bacteria | 5372474 |
| 999 | 2834030065 | 2834028612 | Bacteria | 6354979 |
| 1000 | 2834642911 | 2834641062 | Bacteria | 5559922 |
| 1001 | 2847799702 | 2847797336 | Bacteria | 5176640 |
| 1002 | 2852617573 | 2852612431 | Bacteria | 6885235 |
| 1003 | 2852672308 | 2852667396 | Bacteria | 6885555 |
| 1004 | 2854605359 | 2854601825 | Bacteria | 4797592 |
| 1005 | 2855199295 | 2855195626 | Bacteria | 4927512 |
| 1006 | 2856290931 | 2856287931 | Bacteria | 7223934 |
| 1007 | 2857363678 | 2857357740 | Bacteria | 9937880 |
| 1008 | 2858468802 | 2858466076 | Bacteria | 4722413 |
| 1009 | 2869554672 | 2869551831 | Bacteria | 5474685 |
| 1010 | 2885270705 | 2885266251 | Bacteria | 4796748 |
| 1011 | 2888369243 | 2888366609 | Bacteria | 5155009 |
| 1012 | 2888378387 | 2888373701 | Bacteria | 5098052 |
| 1013 | 2900052560 | 2900051742 | Bacteria | 4985156 |
| 1014 | 2900579509 | 2900577576 | Bacteria | 5438534 |
| 1015 | 2904513452 | 2904513164 | Bacteria | 5476410 |
| 1016 | 2908669598 | 2908669403 | Bacteria | 5740494 |
| 1017 | 2917835908 | 2917832318 | Bacteria | 5346010 |
| 1018 | 2919112201 | 2919108558 | Bacteria | 5897419 |
| 1019 | 2919125712 | 2919125081 | Bacteria | 5385106 |
| 1020 | 2919503577 | 2919501602 | Bacteria | 5286340 |
| 1021 | 2923527111 | 2923525760 | Bacteria | 4472324 |
| 1022 | 2926065851 | 2926063275 | Bacteria | 5285848 |
| 1023 | 2928061524 | 2928058823 | Bacteria | 5520022 |
| 1024 | 2928113607 | 2928108538 | Bacteria | 7360024 |
| 1025 | 2928140680 | 2928135762 | Bacteria | 7259641 |
| 1026 | 2928506203 | 2928503688 | Bacteria | 7268108 |
| 1027 | 2929192806 | 2929189879 | Bacteria | 5930554 |
| 1028 | 2937967819 | 2937967321 | Bacteria | 5094075 |
| 1029 | 2939609285 | 2939607340 | Bacteria | 4719256 |
| 1030 | 2946010155 | 2946006987 | Bacteria | 6705746 |
| 1031 | 2946031135 | 2946027586 | Bacteria | 6049274 |
| 1032 | 2969082680 | 2969079654 | Bacteria | 5439582 |
| 1033 | 2971824033 | 2971820967 | Bacteria | 5823634 |
| 1034 | 2974300107 | 2974298342 | Bacteria | 4840922 |
| 1035 | 2984496798 | 2984494565 | Bacteria | 5000175 |
| 1036 | 2984502488 | 2984499530 | Bacteria | 5020881 |
| 1037 | 2984508898 | 2984504281 | Bacteria | 5262371 |
| 1038 | 2984559754 | 2984559226 | Bacteria | 5683096 |
| 1039 | 2984597836 | 2984595703 | Bacteria | 5682994 |
| 1040 | 2990262215 | 2990261002 | Bacteria | 4919493 |
| 1041 | 640938155 | 640753048 | Bacteria | 5495657 |
| 1042 | 8003400864 | 8003400568 | Bacteria | 5535898 |
| 1043 | 8003960982 | 8003955200 | Bacteria | 8601927 |
| 1044 | 8004597178 | 8004592986 | Bacteria | 5122074 |
| 1045 | 8015397245 | 8015394850 | Bacteria | 5064660 |
| 1046 | 8016728808 | 8016728285 | Bacteria | 5263933 |
| 1047 | 8034964660 | 8034962539 | Bacteria | 4884839 |
| 1048 | 8054505948 | 8054503363 | Bacteria | 6101651 |
| 1049 | 8055090702 | 8055087960 | Bacteria | 4784273 |
| 1050 | 8055096657 | 8055092621 | Bacteria | 4873875 |
| 1051 | 8055098822 | 8055097453 | Bacteria | 4865496 |
| 1052 | 8055820592 | 8055817908 | Bacteria | 6609162 |
| 1053 | Ga0495660_0000328 | |||
| 1054 | SwRhRL2b_contig_1922412 | |||
| 1055 | JGI24741J21665_1000119 | |||
| 1056 | JGI24740J21852_10000217 | |||
| 1057 | JGI24740J21852_10000413 | |||
| 1058 | JGI24740J21852_10004138 | |||
| 1059 | JGI24735J21928_10000832 | |||
| 1060 | JGI24735J21928_10024157 | |||
| 1061 | JGI25156J39149_1011567 | |||
| 1062 | JGI25156J39149_1013119 | |||
| 1063 | JGI25162J39368_1002379 | |||
| 1064 | JGI25162J39368_1002589 | |||
| 1065 | JGI25154J39366_1005222 | |||
| 1066 | JGI25164J39214_1000557 | |||
| 1067 | JGI25164J39214_1000979 | |||
| 1068 | JGI25151J46595_10004250 | |||
| 1069 | JGI25165J46597_1000379 | |||
| 1070 | rootH1_10033773 | |||
| 1071 | rootH2_10013714 | |||
| 1072 | rootL2_10213623 | |||
| 1073 | rootH1_10317437 | |||
| 1074 | Ga0006556J51387_1023891 | |||
| 1075 | Ga0006558J51389_1024036 | |||
| 1076 | Ga0006560J51390_1018558 | |||
| 1077 | Ga0006554J51385_1035245 | |||
| 1078 | Ga0055539_1000148 | |||
| 1079 | Ga0055539_1009355 | |||
| 1080 | Ga0055533_1003082 | |||
| 1081 | Ga0055533_1004726 | |||
| 1082 | Ga0055532_1000072 | |||
| 1083 | Ga0055525_1000148 | |||
| 1084 | Ga0055525_1000463 | |||
| 1085 | Ga0055527_1000277 | |||
| 1086 | Ga0055527_1010338 | |||
| 1087 | Ga0055535_1000053 | |||
| 1088 | Ga0055535_1000584 | |||
| 1089 | Ga0055542_1000611 | |||
| 1090 | Ga0055542_1001477 | |||
| 1091 | Ga0055529_1000099 | |||
| 1092 | Ga0055529_1000795 | |||
| 1093 | Ga0055526_1070007 | |||
| 1094 | Ga0055536_1000044 | |||
| 1095 | Ga0055534_1003892 | |||
| 1096 | Ga0055540_1017394 | |||
| 1097 | Ga0055541_1000590 | |||
| 1098 | Ga0058692_1011178 | |||
| 1099 | Ga0065714_10005880 | |||
| 1100 | Ga0065714_10076967 | |||
| 1101 | Ga0065714_10366483 | |||
| 1102 | Ga0065704_10011691 | |||
| 1103 | Ga0065704_10073206 | |||
| 1104 | Ga0065704_10196990 | |||
| 1105 | Ga0065712_10072752 | |||
| 1106 | Ga0070658_10002504 | |||
| 1107 | Ga0070658_10087088 | |||
| 1108 | Ga0070658_10324445 | |||
| 1109 | Ga0070683_100210312 | |||
| 1110 | Ga0070670_100282481 | |||
| 1111 | Ga0070682_100002070 | |||
| 1112 | Ga0070682_100004557 | |||
| 1113 | Ga0070660_100002928 | |||
| 1114 | Ga0070660_100483575 | |||
| 1115 | Ga0070660_101256579 | |||
| 1116 | Ga0070691_10553996 | |||
| 1117 | Ga0070661_100000118 | |||
| 1118 | Ga0070661_100000322 | |||
| 1119 | Ga0070675_100713412 | |||
| 1120 | Ga0070674_100788030 | |||
| 1121 | Ga0070659_100018001 | |||
| 1122 | Ga0070659_100018699 | |||
| 1123 | Ga0070659_100044900 | |||
| 1124 | Ga0070659_100052789 | |||
| 1125 | Ga0070659_100072579 | |||
| 1126 | Ga0070667_100286151 | |||
| 1127 | Ga0070700_100721807 | |||
| 1128 | Ga0070708_100647424 | |||
| 1129 | Ga0070663_100000016 | |||
| 1130 | Ga0070663_100117785 | |||
| 1131 | Ga0070663_100249868 | |||
| 1132 | Ga0070663_100368886 | |||
| 1133 | Ga0070663_101105467 | |||
| 1134 | Ga0070678_100620852 | |||
| 1135 | Ga0070681_10029738 | |||
| 1136 | Ga0068867_100671489 | |||
| 1137 | Ga0070685_10471512 | |||
| 1138 | Ga0070706_100218277 | |||
| 1139 | Ga0070699_100169076 | |||
| 1140 | Ga0070679_100189384 | |||
| 1141 | Ga0070684_100567155 | |||
| 1142 | Ga0068853_100019581 | |||
| 1143 | Ga0070696_100378248 | |||
| 1144 | Ga0070665_100000718 | |||
| 1145 | Ga0070665_100165776 | |||
| 1146 | Ga0070665_100379760 | |||
| 1147 | Ga0068855_100001358 | |||
| 1148 | Ga0068855_100003246 | |||
| 1149 | Ga0068855_100012611 | |||
| 1150 | Ga0068855_100060560 | |||
| 1151 | Ga0070664_100000017 | |||
| 1152 | Ga0070664_100000044 | |||
| 1153 | Ga0068857_100161783 | |||
| 1154 | Ga0068857_100770071 | |||
| 1155 | Ga0068854_100000078 | |||
| 1156 | Ga0068854_100048274 | |||
| 1157 | Ga0068856_100003924 | |||
| 1158 | Ga0068856_100014214 | |||
| 1159 | Ga0068852_100243800 | |||
| 1160 | Ga0068859_100078016 | |||
| 1161 | Ga0068870_10799298 | |||
| 1162 | Ga0068863_100048608 | |||
| 1163 | Ga0068863_101346061 | |||
| 1164 | Ga0068858_100008871 | |||
| 1165 | Ga0068862_102104765 | |||
| 1166 | Ga0075365_10001272 | |||
| 1167 | Ga0075365_10014199 | |||
| 1168 | Ga0075365_10102872 | |||
| 1169 | Ga0075365_10201596 | |||
| 1170 | Ga0075368_10040896 | |||
| 1171 | Ga0075363_100032488 | |||
| 1172 | Ga0075363_100091273 | |||
| 1173 | Ga0075363_100173328 | |||
| 1174 | Ga0075364_10010070 | |||
| 1175 | Ga0075364_10023864 | |||
| 1176 | Ga0075364_10165642 | |||
| 1177 | Ga0075364_10329501 | |||
| 1178 | Ga0075364_10560327 | |||
| 1179 | Ga0075364_10563606 | |||
| 1180 | Ga0075362_10010642 | |||
| 1181 | Ga0075362_10578240 | |||
| 1182 | Ga0075367_10055586 | |||
| 1183 | Ga0075367_10312144 | |||
| 1184 | Ga0075367_10829194 | |||
| 1185 | Ga0075369_10003792 | |||
| 1186 | Ga0075369_10026537 | |||
| 1187 | Ga0075369_10055016 | |||
| 1188 | Ga0075369_10110140 | |||
| 1189 | Ga0075366_10261763 | |||
| 1190 | Ga0075366_10522608 | |||
| 1191 | Ga0075370_10412781 | |||
| 1192 | Ga0097620_100078014 | |||
| 1193 | Ga0079104_1000109 | |||
| 1194 | Ga0079104_1006466 | |||
| 1195 | Ga0105251_10000026 | |||
| 1196 | Ga0105251_10000050 | |||
| 1197 | Ga0105251_10001110 | |||
| 1198 | Ga0105251_10001214 | |||
| 1199 | Ga0105251_10001356 | |||
| 1200 | Ga0105251_10002532 | |||
| 1201 | Ga0105251_10005045 | |||
| 1202 | Ga0105251_10351192 | |||
| 1203 | Ga0105244_10000134 | |||
| 1204 | Ga0105244_10003992 | |||
| 1205 | Ga0105244_10006264 | |||
| 1206 | Ga0105244_10056969 | |||
| 1207 | Ga0105250_10005274 | |||
| 1208 | Ga0105240_10001607 | |||
| 1209 | Ga0105240_10006881 | |||
| 1210 | Ga0105240_10019958 | |||
| 1211 | Ga0105240_10168315 | |||
| 1212 | Ga0105240_10273986 | |||
| 1213 | Ga0105245_10469844 | |||
| 1214 | Ga0105245_11395317 | |||
| 1215 | Ga0105247_10000068 | |||
| 1216 | Ga0105243_10547651 | |||
| 1217 | Ga0105243_12091522 | |||
| 1218 | Ga0105243_12485258 | |||
| 1219 | Ga0105241_10000002 | |||
| 1220 | Ga0105241_10041044 | |||
| 1221 | Ga0105241_10220053 | |||
| 1222 | Ga0105242_10000968 | |||
| 1223 | Ga0105248_10231179 | |||
| 1224 | Ga0105248_10393131 | |||
| 1225 | Ga0105237_10000116 | |||
| 1226 | Ga0105237_10007711 | |||
| 1227 | Ga0105237_10046215 | |||
| 1228 | Ga0105237_10207093 | |||
| 1229 | Ga0105237_10227882 | |||
| 1230 | Ga0105238_10013663 | |||
| 1231 | Ga0105238_10022760 | |||
| 1232 | Ga0105238_10175713 | |||
| 1233 | Ga0105238_10224733 | |||
| 1234 | Ga0105238_10293593 | |||
| 1235 | Ga0105249_10548092 | |||
| 1236 | Ga0105239_10000033 | |||
| 1237 | Ga0105239_10009931 | |||
| 1238 | Ga0105239_10442887 | |||
| 1239 | Ga0105239_11417152 | |||
| 1240 | Ga0105246_10001023 | |||
| 1241 | Ga0105246_10030389 | |||
| 1242 | Ga0105246_10573517 | |||
| 1243 | Ga0157373_10004598 | |||
| 1244 | Ga0157373_10009666 | |||
| 1245 | Ga0157373_10012730 | |||
| 1246 | Ga0157373_10015094 | |||
| 1247 | Ga0157373_10017202 | |||
| 1248 | Ga0157373_10019071 | |||
| 1249 | Ga0157373_10037150 | |||
| 1250 | Ga0157373_10040804 | |||
| 1251 | Ga0157373_10058409 | |||
| 1252 | Ga0157373_10294362 | |||
| 1253 | Ga0157373_10451542 | |||
| 1254 | Ga0157373_10584233 | |||
| 1255 | Ga0157371_10000475 | |||
| 1256 | Ga0157371_10001256 | |||
| 1257 | Ga0157371_10001936 | |||
| 1258 | Ga0157371_10004931 | |||
| 1259 | Ga0157371_10010207 | |||
| 1260 | Ga0157371_10154062 | |||
| 1261 | Ga0157370_10000254 | |||
| 1262 | Ga0157370_10000488 | |||
| 1263 | Ga0157370_10004360 | |||
| 1264 | Ga0157370_10004714 | |||
| 1265 | Ga0157370_10004787 | |||
| 1266 | Ga0157370_10510900 | |||
| 1267 | Ga0157370_10899745 | |||
| 1268 | Ga0157370_11298682 | |||
| 1269 | Ga0157369_10000416 | |||
| 1270 | Ga0157369_10004727 | |||
| 1271 | Ga0157369_10005112 | |||
| 1272 | Ga0157369_10006013 | |||
| 1273 | Ga0157369_10014146 | |||
| 1274 | Ga0157369_10078681 | |||
| 1275 | Ga0157369_10160578 | |||
| 1276 | Ga0157369_10200701 | |||
| 1277 | Ga0157374_10000055 | |||
| 1278 | Ga0163162_10669017 | |||
| 1279 | Ga0163162_10715195 | |||
| 1280 | Ga0163162_11193391 | |||
| 1281 | Ga0163162_11455597 | |||
| 1282 | Ga0157372_10001079 | |||
| 1283 | Ga0157372_10003255 | |||
| 1284 | Ga0157372_10040910 | |||
| 1285 | Ga0157372_10360382 | |||
| 1286 | Ga0157375_10007994 | |||
| 1287 | Ga0157375_10009789 | |||
| 1288 | Ga0163163_10032419 | |||
| 1289 | Ga0182008_10001630 | |||
| 1290 | Ga0182008_10010665 | |||
| 1291 | Ga0182008_10027298 | |||
| 1292 | Ga0182008_10570119 | |||
| 1293 | Ga0157379_10194662 | |||
| 1294 | Ga0182006_1002847 | |||
| 1295 | Ga0182006_1005072 | |||
| 1296 | Ga0182006_1061982 | |||
| 1297 | Ga0182007_10013391 | |||
| 1298 | Ga0182007_10028446 | |||
| 1299 | Ga0183368_1003 | |||
| 1300 | Ga0163161_10000001 | |||
| 1301 | Ga0163161_10073716 | |||
| 1302 | Ga0163161_10090589 | |||
| 1303 | Ga0163161_10378166 | |||
| 1304 | Ga0163161_10491351 | |||
| 1305 | Ga0163161_10778182 | |||
| 1306 | Ga0197907_10147544 | |||
| 1307 | Ga0197907_10992650 | |||
| 1308 | Ga0197907_11106263 | |||
| 1309 | Ga0206356_10394404 | |||
| 1310 | Ga0206356_11348764 | |||
| 1311 | Ga0206356_11831093 | |||
| 1312 | Ga0206349_1553031 | |||
| 1313 | Ga0206349_1623260 | |||
| 1314 | Ga0206355_1505466 | |||
| 1315 | Ga0206351_10373233 | |||
| 1316 | Ga0206351_10443943 | |||
| 1317 | Ga0206351_10858175 | |||
| 1318 | Ga0206352_11113405 | |||
| 1319 | Ga0206350_10052148 | |||
| 1320 | Ga0206350_11518593 | |||
| 1321 | Ga0206354_10692767 | |||
| 1322 | Ga0206354_11639641 | |||
| 1323 | Ga0206353_11895329 | |||
| 1324 | Ga0154015_1288425 | |||
| 1325 | Ga0154015_1475337 | |||
| 1326 | Ga0213872_10011976 | |||
| 1327 | Ga0213872_10020982 | |||
| 1328 | Ga0213876_10007089 | |||
| 1329 | Ga0224712_10000038 | |||
| 1330 | Ga0224712_10227102 | |||
| 1331 | Ga0224712_10591849 | |||
| 1332 | Ga0209784_100063 | |||
| 1333 | Ga0209784_100851 | |||
| 1334 | Ga0209566_100048 | |||
| 1335 | Ga0209566_100376 | |||
| 1336 | Ga0209566_100903 | |||
| 1337 | Ga0209674_100033 | |||
| 1338 | Ga0209674_100071 | |||
| 1339 | Ga0209674_100151 | |||
| 1340 | Ga0209674_100218 | |||
| 1341 | Ga0209672_100004 | |||
| 1342 | Ga0209672_100193 | |||
| 1343 | Ga0209672_101163 | |||
| 1344 | Ga0209147_100002 | |||
| 1345 | Ga0209563_100085 | |||
| 1346 | Ga0209563_100132 | |||
| 1347 | Ga0209563_108311 | |||
| 1348 | Ga0207427_100049 | |||
| 1349 | Ga0207427_100101 | |||
| 1350 | Ga0207427_112703 | |||
| 1351 | Ga0209437_100083 | |||
| 1352 | Ga0209437_100090 | |||
| 1353 | Ga0209258_100002 | |||
| 1354 | Ga0209258_100003 | |||
| 1355 | Ga0209646_1000123 | |||
| 1356 | Ga0209026_1008026 | |||
| 1357 | Ga0209677_100040 | |||
| 1358 | Ga0209677_108088 | |||
| 1359 | Ga0209148_1000025 | |||
| 1360 | Ga0209148_1000077 | |||
| 1361 | Ga0209759_1001778 | |||
| 1362 | Ga0209759_1004890 | |||
| 1363 | Ga0209759_1006697 | |||
| 1364 | Ga0209233_1000075 | |||
| 1365 | Ga0209233_1000077 | |||
| 1366 | Ga0209233_1035653 | |||
| 1367 | Ga0209455_1000004 | |||
| 1368 | Ga0209455_1000149 | |||
| 1369 | Ga0209673_1036376 | |||
| 1370 | Ga0209130_1037035 | |||
| 1371 | Ga0209675_1000260 | |||
| 1372 | Ga0209676_1000141 | |||
| 1373 | Ga0209025_1000824 | |||
| 1374 | Ga0209025_1078115 | |||
| 1375 | Ga0209564_1005964 | |||
| 1376 | Ga0209051_1001387 | |||
| 1377 | Ga0209051_1005756 | |||
| 1378 | Ga0209051_1007639 | |||
| 1379 | Ga0207696_1000001 | |||
| 1380 | Ga0207655_1000191 | |||
| 1381 | Ga0207655_1001845 | |||
| 1382 | Ga0207655_1011090 | |||
| 1383 | Ga0207655_1011357 | |||
| 1384 | Ga0207655_1129099 | |||
| 1385 | Ga0207713_1000008 | |||
| 1386 | Ga0207713_1000035 | |||
| 1387 | Ga0207713_1000039 | |||
| 1388 | Ga0207713_1000247 | |||
| 1389 | Ga0207713_1000251 | |||
| 1390 | Ga0207713_1000527 | |||
| 1391 | Ga0207713_1007458 | |||
| 1392 | Ga0207713_1029172 | |||
| 1393 | Ga0207713_1076077 | |||
| 1394 | Ga0207710_10000965 | |||
| 1395 | Ga0207647_10000869 | |||
| 1396 | Ga0207647_10007730 | |||
| 1397 | Ga0207705_10000221 | |||
| 1398 | Ga0207705_10025243 | |||
| 1399 | Ga0207705_10642931 | |||
| 1400 | Ga0207684_10561007 | |||
| 1401 | Ga0207654_10000005 | |||
| 1402 | Ga0207654_10315270 | |||
| 1403 | Ga0207707_10023235 | |||
| 1404 | Ga0207695_10000322 | |||
| 1405 | Ga0207695_10000891 | |||
| 1406 | Ga0207695_10004740 | |||
| 1407 | Ga0207695_10005620 | |||
| 1408 | Ga0207695_10223838 | |||
| 1409 | Ga0207671_10000166 | |||
| 1410 | Ga0207671_10009196 | |||
| 1411 | Ga0207671_10272660 | |||
| 1412 | Ga0207671_10396598 | |||
| 1413 | Ga0207671_10726430 | |||
| 1414 | Ga0207657_10004640 | |||
| 1415 | Ga0207657_10414991 | |||
| 1416 | Ga0207657_10419695 | |||
| 1417 | Ga0207657_10455717 | |||
| 1418 | Ga0207649_10000051 | |||
| 1419 | Ga0207649_10000056 | |||
| 1420 | Ga0207652_10069744 | |||
| 1421 | Ga0207694_10050284 | |||
| 1422 | Ga0207694_10170343 | |||
| 1423 | Ga0207694_10304344 | |||
| 1424 | Ga0207687_10314075 | |||
| 1425 | Ga0207690_10003937 | |||
| 1426 | Ga0207690_10004321 | |||
| 1427 | Ga0207690_10006220 | |||
| 1428 | Ga0207690_10064138 | |||
| 1429 | Ga0207690_10321448 | |||
| 1430 | Ga0207706_10093119 | |||
| 1431 | Ga0207686_10003389 | |||
| 1432 | Ga0207711_10033801 | |||
| 1433 | Ga0207711_10451953 | |||
| 1434 | Ga0207679_10000036 | |||
| 1435 | Ga0207679_10000042 | |||
| 1436 | Ga0207667_10002443 | |||
| 1437 | Ga0207667_10005486 | |||
| 1438 | Ga0207667_10011114 | |||
| 1439 | Ga0207667_10276743 | |||
| 1440 | Ga0207640_10000165 | |||
| 1441 | Ga0207640_10355993 | |||
| 1442 | Ga0207658_11057384 | |||
| 1443 | Ga0207703_10008995 | |||
| 1444 | Ga0207639_10006352 | |||
| 1445 | Ga0207678_10000418 | |||
| 1446 | Ga0207678_10318560 | |||
| 1447 | Ga0207678_11133326 | |||
| 1448 | Ga0207708_10741807 | |||
| 1449 | Ga0207702_10000156 | |||
| 1450 | Ga0207702_10251440 | |||
| 1451 | Ga0207641_10256843 | |||
| 1452 | Ga0207641_10610259 | |||
| 1453 | Ga0207641_10986059 | |||
| 1454 | Ga0207676_10422220 | |||
| 1455 | Ga0207674_10016655 | |||
| 1456 | Ga0207674_10027147 | |||
| 1457 | Ga0207674_10455083 | |||
| 1458 | Ga0207683_10286242 | |||
| 1459 | Ga0207698_10174421 | |||
| 1460 | Ga0209281_1000003 | |||
| 1461 | Ga0209281_1000006 | |||
| 1462 | Ga0209281_1006445 | |||
| 1463 | Ga0209371_1001252 | |||
| 1464 | Ga0209371_1022973 | |||
| 1465 | Ga0268266_10014158 | |||
| 1466 | Ga0268266_10069682 | |||
| 1467 | Ga0268266_10461316 | |||
| 1468 | Ga0268266_10914033 | |||
| 1469 | Ga0268264_10322401 | |||
| 1470 | Ga0268264_10455004 | |||
| 1471 | Ga0265338_10000409 | |||
| 1472 | Ga0268256_1001070 | |||
| 1473 | Ga0268256_1025815 | |||
| 1474 | Ga0265332_10015987 | |||
| 1475 | Ga0265340_10055264 | |||
| 1476 | Ga0265327_10007248 | |||
| 1477 | Ga0265327_10044332 | |||
| 1478 | Ga0265316_10080403 | |||
| 1479 | Ga0307408_100000057 | |||
| 1480 | Ga0307408_100199053 | |||
| 1481 | Ga0316575_10102790 | |||
| 1482 | Ga0316576_10001993 | |||
| 1483 | Ga0316576_10134954 | |||
| 1484 | Ga0316576_10138114 | |||
| 1485 | Ga0316576_10399330 | |||
| 1486 | Ga0316578_10035002 | |||
| 1487 | Ga0316578_10176705 | |||
| 1488 | Ga0307405_10000290 | |||
| 1489 | Ga0316577_10127792 | |||
| 1490 | Ga0307412_11148337 | |||
| 1491 | Ga0307409_101649132 | |||
| 1492 | Ga0307416_100724251 | |||
| 1493 | Ga0307411_10790634 | |||
| 1494 | Ga0307411_11105722 | |||
| 1495 | Ga0316583_10090054 | |||
| 1496 | Ga0316580_10054611 | |||
| 1497 | Ga0307510_10072778 | |||
| 1498 | Ga0373952_0003772 | |||
| 1499 | Ga0373960_0128975 | |||
| 1500 | Ga0373946_0406299 | |||
| 1501 | Ga0316574_0006721 | |||
| 1502 | Ga0316574_0016714 | |||
| 1503 | Ga0316574_0046107 | |||
| 1504 | Ga0316574_0233389 | |||
| 1505 | Ga0373927_0016667 | |||
| 1506 | Ga0373937_0534814 | |||
| 1507 | Ga0316582_0029005 | |||
| 1508 | Ga0316584_0026659 | |||
| 1509 | Ga0373925_1175956 | |||
| 1510 | Ga0395899_0000008 | |||
| 1511 | Ga0395899_0048201 | |||
| 1512 | Ga0395899_0094739 | |||
| 1513 | Ga0395899_0125574 | |||
| 1514 | Ga0395900_0000055 | |||
| 1515 | Ga0395900_0006242 | |||
| 1516 | Ga0395900_0016169 | |||
| 1517 | Ga0395900_0051529 | |||
| 1518 | Ga0395900_0095300 | |||
| 1519 | Ga0395900_0145236 | |||
| 1520 | Ga0395900_0297831 | |||
| 1521 | Ga0395900_0832452 | |||
| 1522 | Ga0395898_0000119 | |||
| 1523 | Ga0395898_0001022 | |||
| 1524 | Ga0395898_0007201 | |||
| 1525 | Ga0395898_0020307 | |||
| 1526 | Ga0395898_0860465 | |||
| 1527 | Ga0395905_0262289 | |||
| 1528 | Ga0395901_0000003 | |||
| 1529 | Ga0395901_0000186 | |||
| 1530 | Ga0395901_0001409 | |||
| 1531 | Ga0395901_0173956 | |||
| 1532 | Ga0400491_10985 | |||
| 1533 | Ga0400488_44502 | |||
| 1534 | Ga0436365_1408969 | |||
| 1535 | Ga0436361_0010589 | |||
| 1536 | Ga0436361_0501243 | |||
| 1537 | Ga0436363_1333172 | |||
| 1538 | Ga0439438_000001 | |||
| 1539 | Ga0439438_002554 | |||
| 1540 | Ga0439466_0051614 | |||
| 1541 | Ga0451787_594757 | |||
| 1542 | Ga0451789_0049916 | |||
| 1543 | Ga0451789_0367025 | |||
| 1544 | Ga0451789_0593989 | |||
| 1545 | Ga0451791_1692585 | |||
| 1546 | Ga0451791_1902633 | |||
| 1547 | Ga0451793_0781259 | |||
| 1548 | Ga0451802_1107995 | |||
| 1549 | Ga0451837_0371420 | |||
| 1550 | Ga0451837_1827207 | |||
| 1551 | Ga0451849_0288385 | |||
| 1552 | Ga0451849_1462733 | |||
| 1553 | Ga0451853_1680771 | |||
| 1554 | Ga0439432_002253 | |||
| 1555 | Ga0439432_006644 | |||
| 1556 | Ga0439432_008403 | |||
| 1557 | Ga0439432_023410 | |||
| 1558 | Ga0439452_000001 | |||
| 1559 | Ga0439455_0075077 | |||
| 1560 | Ga0439463_003174 | |||
| 1561 | Ga0450898_011463 | |||
| 1562 | Ga0450898_032064 | |||
| 1563 | Ga0450899_021078 | |||
| 1564 | Ga0439459_0017919 | |||
| 1565 | Ga0439464_0000909 | |||
| 1566 | Ga0451577_0006045 | |||
| 1567 | Ga0451577_0518351 | |||
| 1568 | Ga0466986_0115117 | |||
| 1569 | Ga0466969_0000949 | |||
| 1570 | Ga0466969_0040127 | |||
| 1571 | Ga0466972_0011622 | |||
| 1572 | Ga0466972_0019262 | |||
| 1573 | Ga0466972_0041080 | |||
| 1574 | Ga0466973_0051992 | |||
| 1575 | Ga0466974_0612504 | |||
| 1576 | Ga0466978_0056713 | |||
| 1577 | Ga0466965_0000123 | |||
| 1578 | Ga0466965_0011553 | |||
| 1579 | Ga0466965_0017074 | |||
| 1580 | Ga0466965_0017787 | |||
| 1581 | Ga0466966_0009778 | |||
| 1582 | Ga0466966_0014484 | |||
| 1583 | Ga0466966_0069918 | |||
| 1584 | Ga0466966_0171624 | |||
| 1585 | Ga0466966_0324855 | |||
| 1586 | Ga0466961_0000097 | |||
| 1587 | Ga0466961_0000735 | |||
| 1588 | Ga0466961_0001194 | |||
| 1589 | Ga0466961_0002073 | |||
| 1590 | Ga0466961_0005590 | |||
| 1591 | Ga0466961_0036998 | |||
| 1592 | Ga0466961_0057586 | |||
| 1593 | Ga0466963_0003740 | |||
| 1594 | Ga0466963_0014644 | |||
| 1595 | Ga0466963_0017489 | |||
| 1596 | Ga0466963_0089612 | |||
| 1597 | Ga0466963_0106889 | |||
| 1598 | Ga0466964_0002945 | |||
| 1599 | Ga0466964_0066415 | |||
| 1600 | Ga0466964_0331019 | |||
| 1601 | Ga0453684_0019091 | |||
| 1602 | Ga0453684_0104794 | |||
| 1603 | Ga0466971_0000504 | |||
| 1604 | Ga0466971_0011044 | |||
| 1605 | Ga0466971_0012315 | |||
| 1606 | Ga0466971_0023753 | |||
| 1607 | Ga0466968_0009580 | |||
| 1608 | Ga0466968_0024612 | |||
| 1609 | Ga0466968_0037811 | |||
| 1610 | Ga0466970_0006012 | |||
| 1611 | Ga0466970_0007260 | |||
| 1612 | Ga0466970_0011454 | |||
| 1613 | Ga0466970_0383344 | |||
| 1614 | Ga0466957_0000539 | |||
| 1615 | Ga0466957_0012295 | |||
| 1616 | Ga0466957_0021793 | |||
| 1617 | Ga0466957_0027935 | |||
| 1618 | Ga0466957_0029906 | |||
| 1619 | Ga0466957_0036640 | |||
| 1620 | Ga0466957_0642565 | |||
| 1621 | Ga0466960_0230626 | |||
| 1622 | Ga0466959_0001442 | |||
| 1623 | Ga0466959_0004973 | |||
| 1624 | Ga0466959_0014953 | |||
| 1625 | Ga0466959_0038529 | |||
| 1626 | Ga0466959_0101216 | |||
| 1627 | Ga0451576_0018928 | |||
| 1628 | Ga0451576_0023255 | |||
| 1629 | Ga0451576_0217085 | |||
| 1630 | Ga0451576_0500920 | |||
| 1631 | Ga0451576_1333910 | |||
| 1632 | Ga0466958_0001102 | |||
| 1633 | Ga0466958_0002984 | |||
| 1634 | Ga0466958_0053691 | |||
| 1635 | Ga0466958_0116312 | |||
| 1636 | Ga0466958_0281368 | |||
| 1637 | Ga0466958_0340708 | |||
| 1638 | Ga0466967_0036663 | |||
| 1639 | Ga0466967_0191735 | |||
| 1640 | Ga0466967_0245154 | |||
| 1641 | Ga0466967_0731935 | |||
| 1642 | Ga0495627_000010 | |||
| 1643 | Ga0495627_000122 | |||
| 1644 | Ga0495627_002608 | |||
| 1645 | Ga0495603_0016875 | |||
| 1646 | Ga0495603_0392753 | |||
| 1647 | Ga0495591_000002 | |||
| 1648 | Ga0495591_000074 | |||
| 1649 | Ga0495591_009243 | |||
| 1650 | Ga0495591_020595 | |||
| 1651 | Ga0495629_0010284 | |||
| 1652 | Ga0495629_0091158 | |||
| 1653 | Ga0495641_0034199 | |||
| 1654 | Ga0495653_0011577 | |||
| 1655 | Ga0495653_0556152 | |||
| 1656 | Ga0495650_0005316 | |||
| 1657 | Ga0495650_0022998 | |||
| 1658 | Ga0495580_0002727 | |||
| 1659 | Ga0495582_0003165 | |||
| 1660 | Ga0495605_0000011 | |||
| 1661 | Ga0495605_0000091 | |||
| 1662 | Ga0495605_0000165 | |||
| 1663 | Ga0495605_0002402 | |||
| 1664 | Ga0495605_0011078 | |||
| 1665 | Ga0495605_0012709 | |||
| 1666 | Ga0495605_0061469 | |||
| 1667 | Ga0495605_0079840 | |||
| 1668 | Ga0495639_0300996 | |||
| 1669 | Ga0495664_0009421 | |||
| 1670 | Ga0495584_0300011 | |||
| 1671 | Ga0495594_0002962 | |||
| 1672 | Ga0495607_0000085 | |||
| 1673 | Ga0495607_0000118 | |||
| 1674 | Ga0495607_0000139 | |||
| 1675 | Ga0495607_0001121 | |||
| 1676 | Ga0495607_0003540 | |||
| 1677 | Ga0495607_0006107 | |||
| 1678 | Ga0495607_0019157 | |||
| 1679 | Ga0495607_0060080 | |||
| 1680 | Ga0495583_0000047 | |||
| 1681 | Ga0495583_0000427 | |||
| 1682 | Ga0495583_0001904 | |||
| 1683 | Ga0495583_0011560 | |||
| 1684 | Ga0495583_0014225 | |||
| 1685 | Ga0495583_0026526 | |||
| 1686 | Ga0495606_0000287 | |||
| 1687 | Ga0495606_0020108 | |||
| 1688 | Ga0495606_0077902 | |||
| 1689 | Ga0495610_0017331 | |||
| 1690 | Ga0495610_0018874 | |||
| 1691 | Ga0495610_0020704 | |||
| 1692 | Ga0495610_0276577 | |||
| 1693 | Ga0495620_0000081 | |||
| 1694 | Ga0495620_0000575 | |||
| 1695 | Ga0495620_0001331 | |||
| 1696 | Ga0495620_0194871 | |||
| 1697 | Ga0495628_0014240 | |||
| 1698 | Ga0495630_0009921 | |||
| 1699 | Ga0495631_0001943 | |||
| 1700 | Ga0495631_0032931 | |||
| 1701 | Ga0495632_0001180 | |||
| 1702 | Ga0495632_0002979 | |||
| 1703 | Ga0495637_0000383 | |||
| 1704 | Ga0495637_0003884 | |||
| 1705 | Ga0495637_0013463 | |||
| 1706 | Ga0495637_0016150 | |||
| 1707 | Ga0495637_0075854 | |||
| 1708 | Ga0495643_0023397 | |||
| 1709 | Ga0495648_0001054 | |||
| 1710 | Ga0495648_0020107 | |||
| 1711 | Ga0495648_0024174 | |||
| 1712 | Ga0495648_0242586 | |||
| 1713 | Ga0495666_0000312 | |||
| 1714 | Ga0495652_0016164 | |||
| 1715 | Ga0495654_0000564 | |||
| 1716 | Ga0495654_0008722 | |||
| 1717 | Ga0495654_0016822 | |||
| 1718 | Ga0495654_0066536 | |||
| 1719 | Ga0495654_0238301 | |||
| 1720 | Ga0495665_0001728 | |||
| 1721 | Ga0495640_0018453 | |||
| 1722 | Ga0495586_0003487 | |||
| 1723 | Ga0495587_0008906 | |||
| 1724 | Ga0495609_0000004 | |||
| 1725 | Ga0495609_0000033 | |||
| 1726 | Ga0495597_0000012 | |||
| 1727 | Ga0495597_0002024 | |||
| 1728 | Ga0495645_0004117 | |||
| 1729 | Ga0495645_0148086 | |||
| 1730 | Ga0495622_0001742 | |||
| 1731 | Ga0495633_0000071 | |||
| 1732 | Ga0495668_0014837 | |||
| 1733 | Ga0495668_0032005 | |||
| 1734 | Ga0495668_0060597 | |||
| 1735 | Ga0495634_0013442 | |||
| 1736 | Ga0495611_0003609 | |||
| 1737 | Ga0495611_0008202 | |||
| 1738 | Ga0495625_0030490 | |||
| 1739 | Ga0495635_0010924 | |||
| 1740 | Ga0495661_0000005 | |||
| 1741 | Ga0495661_0000386 | |||
| 1742 | Ga0495661_0009249 | |||
| 1743 | Ga0495661_0011904 | |||
| 1744 | Ga0495661_0064969 | |||
| 1745 | Ga0495588_0007795 | |||
| 1746 | Ga0495588_0056988 | |||
| 1747 | Ga0495623_0012666 | |||
| 1748 | Ga0495646_0010083 | |||
| 1749 | Ga0495613_0013918 | |||
| 1750 | Ga0495624_0005072 | |||
| 1751 | Ga0495670_0012857 | |||
| 1752 | Ga0495670_0292968 | |||
| 1753 | Ga0495671_0004767 | |||
| 1754 | Ga0495671_0211666 | |||
| 1755 | Ga0495649_0211961 | |||
| 1756 | Ga0495589_0001257 | |||
| 1757 | Ga0495660_0001607 | |||
| 1758 | Ga0495660_0028242 | |||
| 1759 | Ga0495660_0040807 | |||
| 1760 | Ga0495581_0002940 | |||
| 1761 | Ga0495604_0019673 | |||
| 1762 | Ga0495636_0031934 | |||
| 1763 | Ga0495674_0010569 | |||
| 1764 | Ga0495674_0029278 | |||
| 1765 | Ga0495672_0008617 | |||
| 1766 | Ga0495672_0017732 | |||
| 1767 | Ga0495672_0069240 | |||
| 1768 | Ga0495672_0104289 | |||
| 1769 | Ga0495676_0023336 | |||
| 1770 | Ga0495680_0015810 | |||
| 1771 | Ga0495683_0000026 | |||
| 1772 | Ga0495679_000586 | |||
| 1773 | Ga0495679_000587 | |||
| 1774 | Ga0495679_000960 | |||
| 1775 | Ga0495679_002956 | |||
| 1776 | Ga0495673_0000584 | |||
| 1777 | Ga0495673_0000730 | |||
| 1778 | Ga0495673_0001361 | |||
| 1779 | Ga0495673_0016470 | |||
| 1780 | Ga0495673_0022302 | |||
| 1781 | Ga0495673_0039131 | |||
| 1782 | Ga0495673_0097507 | |||
| 1783 | Ga0495673_0198971 | |||
| 1784 | Ga0495681_0023649 | |||
| 1785 | Ga0495681_0134198 | |||
| 1786 | Ga0495686_0024032 | |||
| 1787 | Ga0495593_0010775 | |||
| 1788 | Ga0495602_0018226 | |||
| 1789 | Ga0495602_0048561 | |||
| 1790 | Ga0495614_0000551 | |||
| 1791 | Ga0496100_0018396 | |||
| 1792 | Ga0496100_0410562 | |||
| 1793 | Ga0496101_0001896 | |||
| 1794 | Ga0496101_0412702 | |||
| 1795 | Ga0496102_0246783 | |||
| 1796 | Ga0496103_0011943 | |||
| 1797 | Ga0496104_0240177 | |||
| 1798 | Ga0496104_0393800 | |||
| 1799 | Ga0496104_1057475 | |||
| 1800 | Ga0496105_0012174 | |||
| 1801 | Ga0496105_0799552 | |||
| 1802 | Ga0496107_0049341 | |||
| 1803 | Ga0496108_0012474 | |||
| 1804 | Ga0496110_0179385 | |||
| 1805 | Ga0496111_0253487 | |||
| 1806 | Ga0496111_0284801 | |||
| 1807 | Ga0496112_0319321 | |||
| 1808 | Ga0496113_0031776 | |||
| 1809 | Ga0496113_0236052 | |||
| 1810 | Ga0496114_0007017 | |||
| 1811 | Ga0496114_1022837 | |||
| 1812 | Ga0496115_0000092 | |||
| 1813 | Ga0496115_0055709 | |||
| 1814 | Ga0496116_0000001 | |||
| 1815 | Ga0496116_0000087 | |||
| 1816 | Ga0496116_0041504 | |||
| 1817 | Ga0496116_0046311 | |||
| 1818 | Ga0496117_0000402 | |||
| 1819 | Ga0496117_0000920 | |||
| 1820 | Ga0496117_0003165 | |||
| 1821 | Ga0496117_0030186 | |||
| 1822 | Ga0496117_0065215 | |||
| 1823 | Ga0496117_0126441 | |||
| 1824 | Ga0496117_0301716 | |||
| 1825 | Ga0496118_0002911 | |||
| 1826 | Ga0496118_0003489 | |||
| 1827 | Ga0496118_0004037 | |||
| 1828 | Ga0496118_0005114 | |||
| 1829 | Ga0496118_0010824 | |||
| 1830 | Ga0496118_0115037 | |||
| 1831 | Ga0496119_0000113 | |||
| 1832 | Ga0496119_0001146 | |||
| 1833 | Ga0496119_0001595 | |||
| 1834 | Ga0496120_0000510 | |||
| 1835 | Ga0496120_0001436 | |||
| 1836 | Ga0496120_0001526 | |||
| 1837 | Ga0496120_0170324 | |||
| 1838 | Ga0496121_0005286 | |||
| 1839 | Ga0496121_0006741 | |||
| 1840 | Ga0496121_0020650 | |||
| 1841 | Ga0496121_0046031 | |||
| 1842 | Ga0496121_0056800 | |||
| 1843 | Ga0496121_0162105 | |||
| 1844 | Ga0496121_0164678 | |||
| 1845 | Ga0496122_0000292 | |||
| 1846 | Ga0496122_0043371 | |||
| 1847 | Ga0496122_0054388 | |||
| 1848 | Ga0496122_0073108 | |||
| 1849 | Ga0496123_0000037 | |||
| 1850 | Ga0496123_0004344 | |||
| 1851 | Ga0496123_0014959 | |||
| 1852 | Ga0496123_0159298 | |||
| 1853 | Ga0496123_0239841 | |||
| 1854 | Ga0496124_0000008 | |||
| 1855 | Ga0496124_0000035 | |||
| 1856 | Ga0496124_0003982 | |||
| 1857 | Ga0496124_0015571 | |||
| 1858 | Ga0496124_0046521 | |||
| 1859 | Ga0496124_0066873 | |||
| 1860 | Ga0496124_0068598 | |||
| 1861 | Ga0496124_0103930 | |||
| 1862 | Ga0496124_0121218 | |||
| 1863 | Ga0496124_0141316 | |||
| 1864 | Ga0496124_0378887 | |||
| 1865 | Ga0496125_0004619 | |||
| 1866 | Ga0496125_0032944 | |||
| 1867 | Ga0496125_0223604 | |||
| 1868 | Ga0496125_0245156 | |||
| 1869 | Ga0496126_0000160 | |||
| 1870 | Ga0496126_0143083 | |||
| 1871 | Ga0496126_0624746 | |||
| 1872 | Ga0495678_000068 | |||
| 1873 | Ga0495678_000650 | |||
| 1874 | Ga0495682_0000113 | |||
| 1875 | Ga0501031_0004039 | |||
| 1876 | Ga0501031_0037398 | |||
| 1877 | Ga0501032_0001373 | |||
| 1878 | Ga0501032_0006124 | |||
| 1879 | Ga0501032_0081263 | |||
| 1880 | Ga0501033_0000949 | |||
| 1881 | Ga0501033_0061522 | |||
| 1882 | Ga0501033_0138735 | |||
| 1883 | Ga0501034_0010411 | |||
| 1884 | Ga0501036_0018668 | |||
| 1885 | Ga0501036_0035605 | |||
| 1886 | Ga0501036_0118264 | |||
| 1887 | Ga0501036_0687599 | |||
| 1888 | Ga0501037_0000474 | |||
| 1889 | Ga0501037_0011730 | |||
| 1890 | Ga0501037_0253146 | |||
| 1891 | Ga0501037_0584106 | |||
| 1892 | Ga0501038_0008209 | |||
| 1893 | Ga0501038_0011418 | |||
| 1894 | Ga0501038_0023864 | |||
| 1895 | Ga0501038_0051462 | |||
| 1896 | Ga0501038_0052450 | |||
| 1897 | Ga0501039_0002238 | |||
| 1898 | Ga0501040_0003365 | |||
| 1899 | Ga0501042_0012886 | |||
| 1900 | Ga0501043_0007578 | |||
| 1901 | Ga0501043_0014893 | |||
| 1902 | Ga0501046_0002898 | |||
| 1903 | Ga0501047_0076382 | |||
| 1904 | Ga0501047_0140448 | |||
| 1905 | Ga0501048_0036449 | |||
| 1906 | Ga0501067_0230033 | |||
| 1907 | Ga0501068_0002905 | |||
| 1908 | Ga0501069_0002081 | |||
| 1909 | Ga0501070_0035914 | |||
| 1910 | Ga0501035_0001429 | |||
| 1911 | Ga0501035_0007273 | |||
| 1912 | Ga0501035_0009680 | |||
| 1913 | Ga0501035_0593428 | |||
| 1914 | Ga0501044_0000111 | |||
| 1915 | Ga0501044_0023765 | |||
| 1916 | Ga0501044_0024664 | |||
| 1917 | Ga0501044_0193960 | |||
| 1918 | Ga0501044_0965423 | |||
| 1919 | Ga0501045_0003419 | |||
| 1920 | nmdc:mga03683_170090_c1 | |||
| 1921 | nmdc:mga03683_277911_c1 | |||
| 1922 | nmdc:mga03683_63567_c1 | |||
| 1923 | nmdc:mga03n38_106419_c1 | |||
| 1924 | nmdc:mga03n38_32619_c1 | |||
| 1925 | nmdc:mga03n38_98069_c1 | |||
| 1926 | nmdc:mga00v17_174477_c1 | |||
| 1927 | nmdc:mga00v17_650883_c1 | |||
| 1928 | nmdc:mga00v17_668693_c1 | |||
| 1929 | nmdc:mga00v17_9129_c1 | |||
| 1930 | nmdc:mga0yw44_21321_c1 | |||
| 1931 | nmdc:mga0yw44_455733_c1 | |||
| 1932 | nmdc:mga0yw44_97363_c1 | |||
| 1933 | nmdc:mga0k408_318330_c1 | |||
| 1934 | nmdc:mga04h51_85156_c1 | |||
| 1935 | nmdc:mga07m45_404952_c1 | |||
| 1936 | nmdc:mga0sz30_28020_c1 | |||
| 1937 | Ga0500607_008349 | |||
| 1938 | Ga0500559_0028159 | |||
| 1939 | Ga0500559_0181460 | |||
| 1940 | Ga0500573_0143296 | |||
| 1941 | Ga0500604_0021421 | |||
| 1942 | Ga0500622_0000001 | |||
| 1943 | Ga0500633_0202211 | |||
| 1944 | Ga0500636_0000128 | |||
| 1945 | Ga0500637_0002322 | |||
| 1946 | Ga0500625_102369 | |||
| 1947 | Ga0500625_161555 | |||
| 1948 | Ga0590075_038713 | |||
| 1949 | Ga0587088_023409 | |||
| 1950 | Ga0587088_095037 | |||
| 1951 | Ga0587098_003652 | |||
| 1952 | Ga0587098_021066 | |||
| 1953 | Ga0587067_008926 | |||
| 1954 | Ga0587068_007455 | |||
| 1955 | Ga0587072_005177 | |||
| 1956 | Ga0587076_011071 | |||
| 1957 | Ga0587079_036737 | |||
| 1958 | Ga0466962_0001736 | |||
| 1959 | Ga0466962_0005524 | |||
| 1960 | Ga0466962_0008013 | |||
| 1961 | Ga0466962_0009252 | |||
| 1962 | Ga0466962_0013511 | |||
| 1963 | Ga0466962_0152877 | |||
| 1964 | 2501081590 | |||
| 1965 | 2506578682 | |||
| 1966 | 2506583821 | |||
| 1967 | 2508852646 | |||
| 1968 | 2510282100 | |||
| 1969 | 2510291741 | |||
| 1970 | 2510310248 | |||
| 1971 | 2511085529 | |||
| 1972 | 2513556985 | |||
| 1973 | 2513564517 | |||
| 1974 | 2513954286 | |||
| 1975 | 2514043022 | |||
| 1976 | 2538426680 | |||
| 1977 | 2547695863 | |||
| 1978 | 2555262574 | |||
| 1979 | 2562462549 | |||
| 1980 | 2597031766 | |||
| 1981 | 2599409755 | |||
| 1982 | 2599446460 | |||
| 1983 | 2599881189 | |||
| 1984 | 2599925793 | |||
| 1985 | 2599949528 | |||
| 1986 | 2599971139 | |||
| 1987 | 2600444833 | |||
| 1988 | 2601521751 | |||
| 1989 | 2601526776 | |||
| 1990 | 2601613606 | |||
| 1991 | 2601618329 | |||
| 1992 | 2601624041 | |||
| 1993 | 2601643044 | |||
| 1994 | 2601647914 | |||
| 1995 | 2601651754 | |||
| 1996 | 2601657081 | |||
| 1997 | 2601662865 | |||
| 1998 | 2601695824 | |||
| 1999 | 2601700498 | |||
| 2000 | 2601704878 | |||
| 2001 | 2601709907 | |||
| 2002 | 2601714919 | |||
| 2003 | 2601720849 | |||
| 2004 | 2601725325 | |||
| 2005 | 2601729867 | |||
| 2006 | 2601734884 | |||
| 2007 | 2601739569 | |||
| 2008 | 2601750058 | |||
| 2009 | 2602011863 | |||
| 2010 | 2602017311 | |||
| 2011 | 2603660240 | |||
| 2012 | 2603665515 | |||
| 2013 | 2603837246 | |||
| 2014 | 2603842322 | |||
| 2015 | 2603847395 | |||
| 2016 | 2603852466 | |||
| 2017 | 2603864331 | |||
| 2018 | 2603870520 | |||
| 2019 | 2603875458 | |||
| 2020 | 2606047710 | |||
| 2021 | 2606069946 | |||
| 2022 | 2606145785 | |||
| 2023 | 2606175112 | |||
| 2024 | 2637225693 | |||
| 2025 | 2644485592 | |||
| 2026 | 2644621061 | |||
| 2027 | 2650899125 | |||
| 2028 | 2656279659 | |||
| 2029 | 2676406904 | |||
| 2030 | 2686353511 | |||
| 2031 | 2689445235 | |||
| 2032 | 2729145858 | |||
| 2033 | 2738687908 | |||
| 2034 | 2738707092 | |||
| 2035 | 2738810391 | |||
| 2036 | 2738897751 | |||
| 2037 | 2739263657 | |||
| 2038 | 2739333478 | |||
| 2039 | 2753569609 | |||
| 2040 | 2772439193 | |||
| 2041 | 2774132496 | |||
| 2042 | 2777023542 | |||
| 2043 | 2791921492 | |||
| 2044 | 2792313169 | |||
| 2045 | 2807177423 | |||
| 2046 | 2808978401 | |||
| 2047 | 2808994072 | |||
| 2048 | 2819623462 | |||
| 2049 | 2823423835 | |||
| 2050 | 2834030065 | |||
| 2051 | 2834642911 | |||
| 2052 | 2847799702 | |||
| 2053 | 2852617573 | |||
| 2054 | 2852672308 | |||
| 2055 | 2854605359 | |||
| 2056 | 2855199295 | |||
| 2057 | 2856290931 | |||
| 2058 | 2857363678 | |||
| 2059 | 2858468802 | |||
| 2060 | 2869554672 | |||
| 2061 | 2885270705 | |||
| 2062 | 2888369243 | |||
| 2063 | 2888378387 | |||
| 2064 | 2900052560 | |||
| 2065 | 2900579509 | |||
| 2066 | 2904513452 | |||
| 2067 | 2908669598 | |||
| 2068 | 2917835908 | |||
| 2069 | 2919112201 | |||
| 2070 | 2919125712 | |||
| 2071 | 2919503577 | |||
| 2072 | 2923527111 | |||
| 2073 | 2926065851 | |||
| 2074 | 2928061524 | |||
| 2075 | 2928113607 | |||
| 2076 | 2928140680 | |||
| 2077 | 2928506203 | |||
| 2078 | 2929192806 | |||
| 2079 | 2937967819 | |||
| 2080 | 2939609285 | |||
| 2081 | 2946010155 | |||
| 2082 | 2946031135 | |||
| 2083 | 2969082680 | |||
| 2084 | 2971824033 | |||
| 2085 | 2974300107 | |||
| 2086 | 2984496798 | |||
| 2087 | 2984502488 | |||
| 2088 | 2984508898 | |||
| 2089 | 2984559754 | |||
| 2090 | 2984597836 | |||
| 2091 | 2990262215 | |||
| 2092 | 640938155 | |||
| 2093 | 8003400864 | |||
| 2094 | 8003960982 | |||
| 2095 | 8004597178 | |||
| 2096 | 8015397245 | |||
| 2097 | 8016728808 | |||
| 2098 | 8034964660 | |||
| 2099 | 8054505948 | |||
| 2100 | 8055090702 | |||
| 2101 | 8055096657 | |||
| 2102 | 8055098822 | |||
| 2103 | 8055820592 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i43-assembly1.cif.gz_A | escherichia coli thiol peroxidase (tpx) wild type disulfide form | 0.9812 | 2 | 168 |
| 1q98-assembly1.cif.gz_B | structure of a thiol peroxidase from haemophilus influenzae rd | 0.9756 | 5 | 166 |
| 3i43-assembly1.cif.gz_A | escherichia coli thiol peroxidase (tpx) wild type disulfide form | 0.9754 | 2 | 168 |
| 2xpe-assembly1.cif.gz_A | oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis | 0.9729 | 5 | 166 |
| 3hvx-assembly1.cif.gz_A-2 | escherichia coli thiol peroxidase (tpx) resolving cysteine to serine mutant (c95s) with an intermolecular disulfide bond | 0.9697 | 2 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xvqA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9526 | 12 | 166 | 3.40.30.10 |
| 4af2A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9407 | 1 | 168 | 3.40.30.10 |
| 4af2A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9354 | 1 | 168 | 3.40.30.10 |
| 1psqB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9125 | 5 | 167 | 3.40.30.10 |
| 1psqB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8964 | 5 | 167 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A098BXX0-F1-model_v4 | Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) | 0.9847 | 1 | 165 |
GO:0008379
|
| AF-Q3B4X6-F1-model_v4 | Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) | 0.9826 | 1 | 166 |
GO:0008379
|
| AF-A0A1M3ED54-F1-model_v4 | Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) | 0.9822 | 3 | 166 |
GO:0008379
|
| AF-A0A1T0ARY6-F1-model_v4 | Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) | 0.982 | 3 | 166 |
GO:0008379
|
| AF-I2DJQ9-F1-model_v4 | Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) | 0.9812 | 5 | 166 |
GO:0008379
|