F489078

General Info

Members Datasets Scaffolds Average Seq Length
1051 350 2102 226

Family's Representative Sequence

Representative Sequence 3300016635|Ga0183361_10388|Ga0183361_103883
Length 273
Sequence MSPIYVAIDTPDLARAKAIATRTRTHVGGIKLGLEFFCAHGQHGVHEMAKLGLPIFLDLKLHDIPNTVAKAIQALGPLEPAILTVHASGGRAMLEDAKAAAPLNTKVVAVTMLTSLDADDLTATGITGNAHDQVLRLTDLAHEAGIDGIVCSGEEVRAAKTAWPKGFFVVPGVRPANGSAGEVTPLDVASARGWTRGELAFDGRRLDDLLSAMNRYSATQLRLGTPALASLKVSGSFRAGDQEALARALAQGWNLRVERTGAHELTLLPGLTR

Samples

Sample ID Description Type Environment
1 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
229 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
310 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
311 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
312 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
313 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
314 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
315 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
316 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
333 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
334 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
335 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
336 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
337 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
338 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
339 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
340 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
341 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
342 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
343 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
344 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
345 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
346 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
347 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
348 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
349 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
350 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0.38
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 3.9
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0183361_10388 3300016635 Bacteria 1861
2 MBSR1b_contig_9270608 2162886012 Bacteria 933
3 JGI24740J21852_10007532 3300001979 Bacteria 4415
4 JGI24739J22299_10001888 3300001989 Bacteria 8002
5 JGI24739J22299_10011197 3300001989 Bacteria 3314
6 JGI24739J22299_10105797 3300001989 Bacteria 847
7 JGI24737J22298_10011471 3300001990 Bacteria 2904
8 JGI24737J22298_10024773 3300001990 Bacteria 1899
9 JGI24735J21928_10012758 3300002067 Bacteria 2653
10 JGI24750J21931_1000040 3300002070 Bacteria 17215
11 JGI24748J21848_1000053 3300002074 Bacteria 50665
12 JGI24738J21930_10001400 3300002075 Bacteria 6687
13 JGI24738J21930_10006399 3300002075 Bacteria 2766
14 JGI24034J26672_10000036 3300002239 Bacteria 84333
15 JGI24742J22300_10007088 3300002244 Bacteria 1847
16 JGI24742J22300_10020974 3300002244 Bacteria 1115
17 Ga0055525_1000090 3300003759 Bacteria 141071
18 Ga0055542_1000037 3300003762 Bacteria 225640
19 Ga0055529_1000042 3300003763 Bacteria 225663
20 Ga0055529_1000109 3300003763 Bacteria 121019
21 Ga0055537_1001792 3300003773 Bacteria 7821
22 Ga0055524_1000088 3300003775 Bacteria 116065
23 Ga0055536_1007592 3300003781 Bacteria 4820
24 Ga0055534_1013906 3300003784 Bacteria 1527
25 Ga0055530_10000025 3300003791 Bacteria 130359
26 Ga0055530_10000035 3300003791 Bacteria 117598
27 Ga0055531_10000016 3300003794 Bacteria 181898
28 Ga0055531_10004589 3300003794 Bacteria 8331
29 Ga0065165_1007535 3300005262 Bacteria 5318
30 Ga0065165_1018553 3300005262 Bacteria 2514
31 Ga0065715_10113548 3300005293 Bacteria 2485
32 Ga0070658_10000130 3300005327 Bacteria 66295
33 Ga0070658_10000900 3300005327 Bacteria 25471
34 Ga0070658_10002242 3300005327 Bacteria 16214
35 Ga0070658_10009847 3300005327 Bacteria 7678
36 Ga0070658_10024569 3300005327 Bacteria 4833
37 Ga0070658_10036221 3300005327 Bacteria 3976
38 Ga0070658_10265687 3300005327 Bacteria 1458
39 Ga0070658_10487024 3300005327 Bacteria 1064
40 Ga0070658_10554360 3300005327 Bacteria 995
41 Ga0070658_10632852 3300005327 Bacteria 928
42 Ga0070676_10029154 3300005328 Bacteria 3138
43 Ga0070676_10034351 3300005328 Bacteria 2912
44 Ga0070676_10044919 3300005328 Bacteria 2572
45 Ga0070683_100000909 3300005329 Bacteria 22014
46 Ga0070683_100004703 3300005329 Bacteria 11283
47 Ga0070683_100037865 3300005329 Bacteria 4417
48 Ga0070690_100000093 3300005330 Bacteria 44990
49 Ga0070690_100247187 3300005330 Bacteria 1260
50 Ga0070670_100010512 3300005331 Bacteria 7902
51 Ga0070670_100022355 3300005331 Bacteria 5444
52 Ga0070670_100031101 3300005331 Bacteria 4597
53 Ga0070670_100032146 3300005331 Bacteria 4519
54 Ga0070670_100034083 3300005331 Bacteria 4383
55 Ga0070670_100036011 3300005331 Bacteria 4260
56 Ga0070670_100172841 3300005331 Bacteria 1874
57 Ga0070677_10002217 3300005333 Bacteria 6200
58 Ga0070677_10013962 3300005333 Bacteria 2821
59 Ga0068869_100519972 3300005334 Bacteria 996
60 Ga0070666_10000009 3300005335 Bacteria 279209
61 Ga0070666_10000841 3300005335 Bacteria 18619
62 Ga0070666_10024779 3300005335 Bacteria 3911
63 Ga0070666_10029789 3300005335 Bacteria 3591
64 Ga0070666_10100086 3300005335 Bacteria 1996
65 Ga0070680_100000845 3300005336 Bacteria 21681
66 Ga0070682_100026285 3300005337 Bacteria 3483
67 Ga0070682_100049377 3300005337 Bacteria 2623
68 Ga0068868_100031844 3300005338 Bacteria 4054
69 Ga0068868_100122759 3300005338 Bacteria 2119
70 Ga0070660_100000262 3300005339 Bacteria 34906
71 Ga0070660_100000920 3300005339 Bacteria 19670
72 Ga0070660_100007546 3300005339 Bacteria 7578
73 Ga0070660_100009198 3300005339 Bacteria 6942
74 Ga0070660_100081066 3300005339 Bacteria 2547
75 Ga0070660_100180911 3300005339 Bacteria 1706
76 Ga0070689_100042910 3300005340 Bacteria 3474
77 Ga0070691_10066178 3300005341 Bacteria 1746
78 Ga0070687_100089873 3300005343 Bacteria 1696
79 Ga0070661_100000206 3300005344 Bacteria 48811
80 Ga0070661_100002437 3300005344 Bacteria 12778
81 Ga0070661_100003493 3300005344 Bacteria 10819
82 Ga0070661_100006185 3300005344 Bacteria 8254
83 Ga0070661_100022050 3300005344 Bacteria 4556
84 Ga0070661_100041146 3300005344 Bacteria 3372
85 Ga0070661_100094403 3300005344 Bacteria 2217
86 Ga0070661_100137929 3300005344 Bacteria 1836
87 Ga0070661_100237669 3300005344 Bacteria 1402
88 Ga0070692_10003007 3300005345 Bacteria 6718
89 Ga0070692_10055882 3300005345 Bacteria 2065
90 Ga0070668_100000024 3300005347 Bacteria 94452
91 Ga0070668_100007160 3300005347 Bacteria 8268
92 Ga0070668_100017307 3300005347 Bacteria 5397
93 Ga0070668_100127817 3300005347 Bacteria 2037
94 Ga0070668_100185247 3300005347 Bacteria 1702
95 Ga0070668_100321406 3300005347 Bacteria 1303
96 Ga0070668_100503325 3300005347 Bacteria 1049
97 Ga0070669_100000103 3300005353 Bacteria 81387
98 Ga0070669_100005253 3300005353 Bacteria 9348
99 Ga0070669_100012635 3300005353 Bacteria 5993
100 Ga0070675_100001629 3300005354 Bacteria 16565
101 Ga0070675_100001950 3300005354 Bacteria 15280
102 Ga0070675_100013398 3300005354 Bacteria 6444
103 Ga0070671_100000021 3300005355 Bacteria 127093
104 Ga0070671_100001277 3300005355 Bacteria 18890
105 Ga0070671_100002080 3300005355 Bacteria 15415
106 Ga0070671_100014082 3300005355 Bacteria 6457
107 Ga0070671_100091674 3300005355 Bacteria 2546
108 Ga0070671_100141024 3300005355 Bacteria 2034
109 Ga0070674_100000399 3300005356 Bacteria 21812
110 Ga0070674_100013191 3300005356 Bacteria 5100
111 Ga0070674_100037619 3300005356 Bacteria 3256
112 Ga0070674_100413192 3300005356 Bacteria 1105
113 Ga0070673_100003118 3300005364 Bacteria 10264
114 Ga0070673_100137241 3300005364 Bacteria 2060
115 Ga0070673_100160748 3300005364 Bacteria 1910
116 Ga0070673_100185000 3300005364 Bacteria 1785
117 Ga0070673_100200888 3300005364 Bacteria 1717
118 Ga0070673_100703043 3300005364 Bacteria 928
119 Ga0070688_100103994 3300005365 Bacteria 1877
120 Ga0070659_100000883 3300005366 Bacteria 21917
121 Ga0070659_100023869 3300005366 Bacteria 4684
122 Ga0070659_100046093 3300005366 Bacteria 3417
123 Ga0070659_100090934 3300005366 Bacteria 2446
124 Ga0070659_100107239 3300005366 Bacteria 2252
125 Ga0070659_100166998 3300005366 Bacteria 1801
126 Ga0070667_100000009 3300005367 Bacteria 281488
127 Ga0070667_100000067 3300005367 Bacteria 133023
128 Ga0070667_100006344 3300005367 Bacteria 9830
129 Ga0070667_100007570 3300005367 Bacteria 9011
130 Ga0070667_100010670 3300005367 Bacteria 7589
131 Ga0070667_100013814 3300005367 Bacteria 6676
132 Ga0070667_100046370 3300005367 Bacteria 3656
133 Ga0070667_100117444 3300005367 Bacteria 2311
134 Ga0070667_100241459 3300005367 Bacteria 1613
135 Ga0070663_100002587 3300005455 Bacteria 10221
136 Ga0070663_100004559 3300005455 Bacteria 8165
137 Ga0070663_100030185 3300005455 Bacteria 3712
138 Ga0070663_100059039 3300005455 Bacteria 2757
139 Ga0070678_100004816 3300005456 Bacteria 7702
140 Ga0070678_100078788 3300005456 Bacteria 2490
141 Ga0070678_100585179 3300005456 Bacteria 995
142 Ga0070662_100000107 3300005457 Bacteria 46051
143 Ga0070662_100002201 3300005457 Bacteria 11962
144 Ga0070662_100004739 3300005457 Bacteria 8618
145 Ga0070662_100025833 3300005457 Bacteria 4060
146 Ga0070662_100077769 3300005457 Bacteria 2463
147 Ga0070662_100081039 3300005457 Bacteria 2417
148 Ga0070662_100404074 3300005457 Bacteria 1128
149 Ga0070662_100746574 3300005457 Bacteria 830
150 Ga0070681_10232066 3300005458 Bacteria 1760
151 Ga0070681_10281615 3300005458 Bacteria 1573
152 Ga0068867_100030848 3300005459 Bacteria 3867
153 Ga0068867_100063135 3300005459 Bacteria 2753
154 Ga0068867_100184443 3300005459 Bacteria 1661
155 Ga0070685_10000076 3300005466 Bacteria 59090
156 Ga0070685_10192999 3300005466 Bacteria 1319
157 Ga0070684_100025416 3300005535 Bacteria 4978
158 Ga0070684_100534137 3300005535 Bacteria 1087
159 Ga0068853_100000172 3300005539 Bacteria 45090
160 Ga0068853_100014481 3300005539 Bacteria 6460
161 Ga0068853_100034278 3300005539 Bacteria 4309
162 Ga0068853_100210874 3300005539 Bacteria 1770
163 Ga0068853_100568520 3300005539 Bacteria 1075
164 Ga0068853_100710606 3300005539 Bacteria 959
165 Ga0070672_100002032 3300005543 Bacteria 12729
166 Ga0070672_100009625 3300005543 Bacteria 6669
167 Ga0070672_100167242 3300005543 Bacteria 1827
168 Ga0070672_100987255 3300005543 Bacteria 746
169 Ga0070686_100000018 3300005544 Bacteria 140685
170 Ga0070686_100000338 3300005544 Bacteria 30239
171 Ga0070696_100006864 3300005546 Bacteria 7597
172 Ga0070696_100186978 3300005546 Bacteria 1540
173 Ga0070693_100000773 3300005547 Bacteria 14093
174 Ga0070693_100018727 3300005547 Bacteria 3621
175 Ga0070693_100109294 3300005547 Bacteria 1698
176 Ga0070665_100000071 3300005548 Bacteria 200675
177 Ga0070665_100000535 3300005548 Bacteria 53560
178 Ga0070665_100001716 3300005548 Bacteria 25115
179 Ga0070665_100040003 3300005548 Bacteria 4714
180 Ga0070665_100190843 3300005548 Bacteria 2050
181 Ga0068855_100000353 3300005563 Bacteria 56776
182 Ga0068855_100002937 3300005563 Bacteria 20836
183 Ga0068855_100044728 3300005563 Bacteria 5239
184 Ga0068855_100070358 3300005563 Bacteria 4070
185 Ga0068855_100142423 3300005563 Bacteria 2731
186 Ga0068855_100223913 3300005563 Bacteria 2108
187 Ga0068855_100476346 3300005563 Bacteria 1359
188 Ga0070664_100001030 3300005564 Bacteria 21904
189 Ga0070664_100002325 3300005564 Bacteria 15268
190 Ga0070664_100036792 3300005564 Bacteria 4112
191 Ga0070664_100054610 3300005564 Bacteria 3389
192 Ga0070664_100150353 3300005564 Bacteria 2055
193 Ga0070664_100217544 3300005564 Bacteria 1708
194 Ga0068857_100048552 3300005577 Bacteria 3768
195 Ga0068857_100058927 3300005577 Bacteria 3410
196 Ga0068857_100085132 3300005577 Bacteria 2825
197 Ga0068857_100128661 3300005577 Bacteria 2283
198 Ga0068857_100148009 3300005577 Bacteria 2126
199 Ga0068857_100183492 3300005577 Bacteria 1904
200 Ga0068854_100006682 3300005578 Bacteria 7352
201 Ga0068854_100007103 3300005578 Bacteria 7149
202 Ga0068854_100017720 3300005578 Bacteria 4770
203 Ga0068854_100019474 3300005578 Bacteria 4574
204 Ga0068854_100097573 3300005578 Bacteria 2197
205 Ga0068854_100361375 3300005578 Bacteria 1191
206 Ga0068856_100000364 3300005614 Bacteria 49715
207 Ga0068856_100023360 3300005614 Bacteria 6011
208 Ga0068856_100029387 3300005614 Bacteria 5369
209 Ga0068856_100413572 3300005614 Bacteria 1369
210 Ga0068852_100002792 3300005616 Bacteria 12100
211 Ga0068852_100106625 3300005616 Bacteria 2540
212 Ga0068852_100333537 3300005616 Bacteria 1476
213 Ga0068852_100899897 3300005616 Bacteria 902
214 Ga0068859_100008763 3300005617 Bacteria 10215
215 Ga0068859_100015868 3300005617 Bacteria 7569
216 Ga0068859_100037843 3300005617 Bacteria 4842
217 Ga0068859_100039235 3300005617 Bacteria 4750
218 Ga0068859_100048958 3300005617 Bacteria 4245
219 Ga0068859_100175138 3300005617 Bacteria 2227
220 Ga0068859_100806907 3300005617 Bacteria 1026
221 Ga0068859_100871614 3300005617 Bacteria 986
222 Ga0068864_100005184 3300005618 Bacteria 10673
223 Ga0068864_100010361 3300005618 Bacteria 7699
224 Ga0068864_100014914 3300005618 Bacteria 6456
225 Ga0068864_100027563 3300005618 Bacteria 4799
226 Ga0068864_100144106 3300005618 Bacteria 2152
227 Ga0068864_100241615 3300005618 Bacteria 1673
228 Ga0068861_100003501 3300005719 Bacteria 10427
229 Ga0068861_100007076 3300005719 Bacteria 7676
230 Ga0068851_10007809 3300005834 Bacteria 4925
231 Ga0068851_10009438 3300005834 Bacteria 4537
232 Ga0068851_10019346 3300005834 Bacteria 3290
233 Ga0068851_10021307 3300005834 Bacteria 3147
234 Ga0068851_10025374 3300005834 Bacteria 2907
235 Ga0068851_10049352 3300005834 Bacteria 2134
236 Ga0068851_10053891 3300005834 Bacteria 2048
237 Ga0068870_10141042 3300005840 Bacteria 1410
238 Ga0068870_10405295 3300005840 Bacteria 888
239 Ga0068863_100000038 3300005841 Bacteria 161477
240 Ga0068863_100000323 3300005841 Bacteria 48685
241 Ga0068863_100005444 3300005841 Bacteria 12541
242 Ga0068863_100015715 3300005841 Bacteria 7268
243 Ga0068863_100807437 3300005841 Bacteria 936
244 Ga0068858_100000273 3300005842 Bacteria 55482
245 Ga0068858_100001634 3300005842 Bacteria 22875
246 Ga0068858_100002083 3300005842 Bacteria 20331
247 Ga0068858_100002738 3300005842 Bacteria 17727
248 Ga0068858_100028846 3300005842 Bacteria 5153
249 Ga0068858_100070318 3300005842 Bacteria 3244
250 Ga0068858_100735640 3300005842 Bacteria 961
251 Ga0068860_100000022 3300005843 Bacteria 279209
252 Ga0068860_100000036 3300005843 Bacteria 234917
253 Ga0068860_100120599 3300005843 Bacteria 2511
254 Ga0068860_100330140 3300005843 Bacteria 1498
255 Ga0068860_100563547 3300005843 Bacteria 1142
256 Ga0068862_100000602 3300005844 Bacteria 37405
257 Ga0068862_100003209 3300005844 Bacteria 14172
258 Ga0068862_100053506 3300005844 Bacteria 3456
259 Ga0068862_100055854 3300005844 Bacteria 3383
260 Ga0068862_100069724 3300005844 Bacteria 3035
261 Ga0068862_100129742 3300005844 Bacteria 2229
262 Ga0068862_100205502 3300005844 Bacteria 1777
263 Ga0081455_10000088 3300005937 Bacteria 98815
264 Ga0081539_10013221 3300005985 Bacteria 6243
265 Ga0081539_10040482 3300005985 Bacteria 2734
266 Ga0075364_10100936 3300006051 Bacteria 1921
267 Ga0097621_100122269 3300006237 Bacteria 2209
268 Ga0097621_100233582 3300006237 Bacteria 1606
269 Ga0068871_100034831 3300006358 Bacteria 3997
270 Ga0068871_100277443 3300006358 Bacteria 1465
271 Ga0075431_100890910 3300006847 Bacteria 860
272 Ga0097620_100008763 3300006931 Bacteria 10215
273 Ga0097620_100015868 3300006931 Bacteria 7569
274 Ga0097620_100037844 3300006931 Bacteria 4842
275 Ga0097620_100039234 3300006931 Bacteria 4750
276 Ga0097620_100048958 3300006931 Bacteria 4245
277 Ga0097620_100175133 3300006931 Bacteria 2227
278 Ga0097620_100806888 3300006931 Bacteria 1026
279 Ga0097620_100871506 3300006931 Bacteria 986
280 Ga0105250_10094929 3300009092 Bacteria 1215
281 Ga0105240_10023904 3300009093 Bacteria 8071
282 Ga0105245_10012230 3300009098 Bacteria 7467
283 Ga0105247_10081996 3300009101 Bacteria 2035
284 Ga0105243_10000189 3300009148 Bacteria 71593
285 Ga0105243_10090604 3300009148 Bacteria 2517
286 Ga0105243_10286735 3300009148 Bacteria 1486
287 Ga0105241_10007791 3300009174 Bacteria 7876
288 Ga0105241_10185502 3300009174 Bacteria 1728
289 Ga0105248_10000238 3300009177 Bacteria 63658
290 Ga0105248_10005888 3300009177 Bacteria 13475
291 Ga0105248_10040846 3300009177 Bacteria 5200
292 Ga0105248_10099746 3300009177 Bacteria 3272
293 Ga0105248_10148887 3300009177 Bacteria 2641
294 Ga0105248_10177059 3300009177 Bacteria 2403
295 Ga0105237_10033081 3300009545 Bacteria 5237
296 Ga0105237_10114209 3300009545 Bacteria 2693
297 Ga0105237_10168815 3300009545 Bacteria 2187
298 Ga0105238_10052224 3300009551 Bacteria 4109
299 Ga0105238_10121827 3300009551 Bacteria 2587
300 Ga0105238_10167439 3300009551 Bacteria 2173
301 Ga0105238_10183425 3300009551 Bacteria 2069
302 Ga0105238_10495371 3300009551 Bacteria 1222
303 Ga0105238_10850609 3300009551 Bacteria 929
304 Ga0105249_10000014 3300009553 Bacteria 283274
305 Ga0105249_10030951 3300009553 Bacteria 4838
306 Ga0105239_10308172 3300010375 Bacteria 1784
307 Ga0157326_1007113 3300012513 Bacteria 1205
308 Ga0157373_10010055 3300013100 Bacteria 6971
309 Ga0157373_10012668 3300013100 Bacteria 6201
310 Ga0157373_10127981 3300013100 Bacteria 1786
311 Ga0157373_10171284 3300013100 Bacteria 1527
312 Ga0157371_10002630 3300013102 Bacteria 17029
313 Ga0157371_10003977 3300013102 Bacteria 13103
314 Ga0157371_10053767 3300013102 Bacteria 2860
315 Ga0157371_10055425 3300013102 Bacteria 2813
316 Ga0157371_10150757 3300013102 Bacteria 1658
317 Ga0157370_10026506 3300013104 Bacteria 5722
318 Ga0157370_10026732 3300013104 Bacteria 5693
319 Ga0157370_10051979 3300013104 Bacteria 3913
320 Ga0157370_10310099 3300013104 Bacteria 1456
321 Ga0157370_10545842 3300013104 Bacteria 1063
322 Ga0157369_10001687 3300013105 Bacteria 26951
323 Ga0157369_10214909 3300013105 Bacteria 2014
324 Ga0157374_10021678 3300013296 Bacteria 5721
325 Ga0157374_10031141 3300013296 Bacteria 4846
326 Ga0157374_10108439 3300013296 Bacteria 2669
327 Ga0157378_10114034 3300013297 Bacteria 2482
328 Ga0157378_10297873 3300013297 Bacteria 1560
329 Ga0157378_10556164 3300013297 Bacteria 1153
330 Ga0163162_10467934 3300013306 Bacteria 1392
331 Ga0157372_10019954 3300013307 Bacteria 7225
332 Ga0157372_10109565 3300013307 Bacteria 3162
333 Ga0157372_10273467 3300013307 Bacteria 1963
334 Ga0157372_11027802 3300013307 Bacteria 954
335 Ga0157375_10000628 3300013308 Bacteria 31364
336 Ga0157375_10119697 3300013308 Bacteria 2741
337 Ga0157375_10269701 3300013308 Bacteria 1864
338 Ga0157514_103401 3300013874 Bacteria 764
339 Ga0163163_10000543 3300014325 Bacteria 33382
340 Ga0163163_10087718 3300014325 Bacteria 3122
341 Ga0163163_10103156 3300014325 Bacteria 2876
342 Ga0163163_10350471 3300014325 Bacteria 1532
343 Ga0157380_10001003 3300014326 Bacteria 17954
344 Ga0157380_10008537 3300014326 Bacteria 7321
345 Ga0157380_10014580 3300014326 Bacteria 5755
346 Ga0157380_10801091 3300014326 Bacteria 959
347 Ga0182008_10021234 3300014497 Bacteria 3336
348 Ga0157377_10253359 3300014745 Bacteria 1142
349 Ga0157379_10006699 3300014968 Bacteria 9950
350 Ga0157379_10122031 3300014968 Bacteria 2344
351 Ga0157379_10403823 3300014968 Bacteria 1256
352 Ga0157379_10579306 3300014968 Bacteria 1046
353 Ga0183363_1001 3300015690 Bacteria 611534
354 Ga0163161_10000186 3300017792 Bacteria 57200
355 Ga0163161_10102221 3300017792 Bacteria 2134
356 Ga0163161_10218475 3300017792 Bacteria 1475
357 Ga0197907_11157279 3300020069 Bacteria 1211
358 Ga0206354_11427625 3300020081 Bacteria 719
359 Ga0206353_10171510 3300020082 Bacteria 1152
360 Ga0206353_10359237 3300020082 Bacteria 10066
361 Ga0213875_10000135 3300021388 Bacteria 82147
362 Ga0207672_1001640 3300025223 Bacteria 1593
363 Ga0209147_100356 3300025229 Bacteria 32955
364 Ga0209563_100111 3300025230 Bacteria 141123
365 Ga0207425_1001404 3300025245 Bacteria 10133
366 Ga0209646_1007013 3300025246 Bacteria 1864
367 Ga0209148_1000026 3300025254 Bacteria 629213
368 Ga0209233_1000154 3300025261 Bacteria 169616
369 Ga0209565_1000010 3300025263 Bacteria 687724
370 Ga0209455_1000005 3300025272 Bacteria 1416756
371 Ga0209455_1005809 3300025272 Bacteria 3743
372 Ga0209673_1009048 3300025273 Bacteria 4361
373 Ga0209675_1000076 3300025291 Bacteria 159428
374 Ga0209676_1001366 3300025292 Bacteria 23983
375 Ga0209025_1011886 3300025294 Bacteria 5666
376 Ga0209758_1005853 3300025297 Bacteria 9179
377 Ga0209050_1000026 3300025298 Bacteria 499134
378 Ga0209050_1000042 3300025298 Bacteria 402842
379 Ga0209050_1006998 3300025298 Bacteria 6488
380 Ga0209256_1000034 3300025299 Bacteria 388475
381 Ga0209257_1000009 3300025304 Bacteria 1205047
382 Ga0209257_1001581 3300025304 Bacteria 26237
383 Ga0209257_1002892 3300025304 Bacteria 15945
384 Ga0207697_10001097 3300025315 Bacteria 14929
385 Ga0207697_10022784 3300025315 Bacteria 2565
386 Ga0207656_10008288 3300025321 Bacteria 3818
387 Ga0207656_10019810 3300025321 Bacteria 2664
388 Ga0207656_10020644 3300025321 Bacteria 2621
389 Ga0207656_10021992 3300025321 Bacteria 2554
390 Ga0207656_10024035 3300025321 Bacteria 2460
391 Ga0207656_10060602 3300025321 Bacteria 1659
392 Ga0207656_10224129 3300025321 Bacteria 914
393 Ga0207696_1091820 3300025711 Bacteria 832
394 Ga0207713_1070306 3300025735 Bacteria 1294
395 Ga0207682_10000194 3300025893 Bacteria 27727
396 Ga0207682_10002083 3300025893 Bacteria 9053
397 Ga0207710_10044147 3300025900 Bacteria 1984
398 Ga0207688_10060473 3300025901 Bacteria 2134
399 Ga0207688_10172111 3300025901 Bacteria 1288
400 Ga0207688_10201185 3300025901 Bacteria 1194
401 Ga0207680_10000007 3300025903 Bacteria 623574
402 Ga0207680_10024818 3300025903 Bacteria 3296
403 Ga0207680_10076175 3300025903 Bacteria 2094
404 Ga0207680_10164108 3300025903 Bacteria 1492
405 Ga0207647_10000331 3300025904 Bacteria 38861
406 Ga0207647_10000910 3300025904 Bacteria 22876
407 Ga0207647_10026357 3300025904 Bacteria 3804
408 Ga0207647_10029798 3300025904 Bacteria 3526
409 Ga0207647_10052077 3300025904 Bacteria 2528
410 Ga0207647_10123956 3300025904 Bacteria 1522
411 Ga0207645_10017693 3300025907 Bacteria 4700
412 Ga0207645_10028598 3300025907 Bacteria 3597
413 Ga0207645_10103563 3300025907 Bacteria 1838
414 Ga0207645_10125767 3300025907 Bacteria 1666
415 Ga0207705_10000371 3300025909 Bacteria 40611
416 Ga0207705_10000574 3300025909 Bacteria 30782
417 Ga0207705_10003366 3300025909 Bacteria 12152
418 Ga0207705_10005390 3300025909 Bacteria 9567
419 Ga0207705_10011112 3300025909 Bacteria 6529
420 Ga0207705_10011202 3300025909 Bacteria 6500
421 Ga0207705_10016709 3300025909 Bacteria 5254
422 Ga0207705_10027000 3300025909 Bacteria 4092
423 Ga0207705_10072700 3300025909 Bacteria 2495
424 Ga0207705_10431785 3300025909 Bacteria 1020
425 Ga0207705_10574330 3300025909 Bacteria 876
426 Ga0207654_10000535 3300025911 Bacteria 21712
427 Ga0207654_10003712 3300025911 Bacteria 7705
428 Ga0207654_10214010 3300025911 Bacteria 1275
429 Ga0207707_10300612 3300025912 Bacteria 1388
430 Ga0207695_10001498 3300025913 Bacteria 38870
431 Ga0207695_10035150 3300025913 Bacteria 5439
432 Ga0207671_10000350 3300025914 Bacteria 66648
433 Ga0207671_10058972 3300025914 Bacteria 2846
434 Ga0207671_10147925 3300025914 Bacteria 1813
435 Ga0207660_10147610 3300025917 Bacteria 1804
436 Ga0207657_10000643 3300025919 Bacteria 37091
437 Ga0207657_10000812 3300025919 Bacteria 32998
438 Ga0207657_10000863 3300025919 Bacteria 31953
439 Ga0207657_10002760 3300025919 Bacteria 18909
440 Ga0207657_10011178 3300025919 Bacteria 8925
441 Ga0207657_10024384 3300025919 Bacteria 5603
442 Ga0207649_10000362 3300025920 Bacteria 34070
443 Ga0207649_10000616 3300025920 Bacteria 24069
444 Ga0207649_10075022 3300025920 Bacteria 2172
445 Ga0207649_10358290 3300025920 Bacteria 1081
446 Ga0207652_10492762 3300025921 Bacteria 1103
447 Ga0207681_10000350 3300025923 Bacteria 33064
448 Ga0207681_10021734 3300025923 Bacteria 4083
449 Ga0207681_10024615 3300025923 Bacteria 3864
450 Ga0207681_10339766 3300025923 Bacteria 1199
451 Ga0207694_10000447 3300025924 Bacteria 38252
452 Ga0207694_10005672 3300025924 Bacteria 9577
453 Ga0207694_10016303 3300025924 Bacteria 5608
454 Ga0207694_10040182 3300025924 Bacteria 3601
455 Ga0207694_10203459 3300025924 Bacteria 1611
456 Ga0207650_10001426 3300025925 Bacteria 17233
457 Ga0207650_10004509 3300025925 Bacteria 9523
458 Ga0207650_10008489 3300025925 Bacteria 7013
459 Ga0207650_10033119 3300025925 Bacteria 3740
460 Ga0207650_10039258 3300025925 Bacteria 3460
461 Ga0207650_10039837 3300025925 Bacteria 3435
462 Ga0207650_10070980 3300025925 Bacteria 2619
463 Ga0207650_10103465 3300025925 Bacteria 2196
464 Ga0207650_10133882 3300025925 Bacteria 1942
465 Ga0207650_10135172 3300025925 Bacteria 1933
466 Ga0207650_10375769 3300025925 Bacteria 1173
467 Ga0207659_10002145 3300025926 Bacteria 11711
468 Ga0207659_10010381 3300025926 Bacteria 5853
469 Ga0207659_10012707 3300025926 Bacteria 5371
470 Ga0207659_10040896 3300025926 Bacteria 3245
471 Ga0207659_10275058 3300025926 Bacteria 1375
472 Ga0207659_10554699 3300025926 Bacteria 977
473 Ga0207687_10079352 3300025927 Bacteria 2366
474 Ga0207644_10000054 3300025931 Bacteria 86116
475 Ga0207644_10009169 3300025931 Bacteria 6488
476 Ga0207644_10013046 3300025931 Bacteria 5531
477 Ga0207644_10014265 3300025931 Bacteria 5314
478 Ga0207644_10023854 3300025931 Bacteria 4195
479 Ga0207644_10027350 3300025931 Bacteria 3939
480 Ga0207644_10085888 3300025931 Bacteria 2335
481 Ga0207644_10430254 3300025931 Bacteria 1082
482 Ga0207690_10000062 3300025932 Bacteria 96511
483 Ga0207690_10004520 3300025932 Bacteria 8221
484 Ga0207690_10011926 3300025932 Bacteria 5197
485 Ga0207690_10165436 3300025932 Bacteria 1653
486 Ga0207690_10172850 3300025932 Bacteria 1620
487 Ga0207690_10181450 3300025932 Bacteria 1585
488 Ga0207690_10311300 3300025932 Bacteria 1235
489 Ga0207706_10000211 3300025933 Bacteria 63984
490 Ga0207706_10000842 3300025933 Bacteria 31703
491 Ga0207706_10002689 3300025933 Bacteria 17328
492 Ga0207706_10012861 3300025933 Bacteria 7617
493 Ga0207706_10020765 3300025933 Bacteria 5900
494 Ga0207706_10021856 3300025933 Bacteria 5743
495 Ga0207706_10025533 3300025933 Bacteria 5292
496 Ga0207706_10113738 3300025933 Bacteria 2380
497 Ga0207706_10127556 3300025933 Bacteria 2237
498 Ga0207709_10001974 3300025935 Bacteria 13395
499 Ga0207709_10796070 3300025935 Bacteria 763
500 Ga0207670_10003472 3300025936 Bacteria 8361
501 Ga0207669_10000146 3300025937 Bacteria 34125
502 Ga0207669_10002460 3300025937 Bacteria 7902
503 Ga0207669_10008651 3300025937 Bacteria 4792
504 Ga0207669_10053271 3300025937 Bacteria 2436
505 Ga0207691_10001025 3300025940 Bacteria 27647
506 Ga0207691_10001329 3300025940 Bacteria 24679
507 Ga0207691_10021857 3300025940 Bacteria 6038
508 Ga0207691_10043703 3300025940 Bacteria 4128
509 Ga0207691_10295940 3300025940 Bacteria 1391
510 Ga0207691_10334618 3300025940 Bacteria 1297
511 Ga0207711_10001768 3300025941 Bacteria 19796
512 Ga0207711_10004434 3300025941 Bacteria 11963
513 Ga0207711_10015580 3300025941 Bacteria 6310
514 Ga0207711_10016865 3300025941 Bacteria 6066
515 Ga0207711_10021214 3300025941 Bacteria 5425
516 Ga0207689_10676791 3300025942 Bacteria 870
517 Ga0207661_10003356 3300025944 Bacteria 11115
518 Ga0207661_10027159 3300025944 Bacteria 4370
519 Ga0207661_10163530 3300025944 Bacteria 1932
520 Ga0207679_10002801 3300025945 Bacteria 10808
521 Ga0207679_10018962 3300025945 Bacteria 4616
522 Ga0207679_10046229 3300025945 Bacteria 3154
523 Ga0207679_10523774 3300025945 Bacteria 1060
524 Ga0207667_10000010 3300025949 Bacteria 477432
525 Ga0207667_10000237 3300025949 Bacteria 77017
526 Ga0207667_10007822 3300025949 Bacteria 12775
527 Ga0207667_10012966 3300025949 Bacteria 9570
528 Ga0207667_10013405 3300025949 Bacteria 9379
529 Ga0207667_10088032 3300025949 Bacteria 3212
530 Ga0207667_10167386 3300025949 Bacteria 2259
531 Ga0207667_10177609 3300025949 Bacteria 2187
532 Ga0207667_10229948 3300025949 Bacteria 1899
533 Ga0207651_10011320 3300025960 Bacteria 4990
534 Ga0207651_10124320 3300025960 Bacteria 1963
535 Ga0207651_10151913 3300025960 Bacteria 1804
536 Ga0207651_10190822 3300025960 Bacteria 1634
537 Ga0207651_10247865 3300025960 Bacteria 1455
538 Ga0207712_10000004 3300025961 Bacteria 614655
539 Ga0207712_10140329 3300025961 Bacteria 1853
540 Ga0207668_10000396 3300025972 Bacteria 27513
541 Ga0207668_10002501 3300025972 Bacteria 10730
542 Ga0207668_10012476 3300025972 Bacteria 5202
543 Ga0207668_10028544 3300025972 Bacteria 3649
544 Ga0207668_10048393 3300025972 Bacteria 2918
545 Ga0207668_10137860 3300025972 Bacteria 1872
546 Ga0207668_10611988 3300025972 Bacteria 950
547 Ga0207640_10001641 3300025981 Bacteria 11988
548 Ga0207640_10004927 3300025981 Bacteria 7253
549 Ga0207640_10006739 3300025981 Bacteria 6316
550 Ga0207640_10006892 3300025981 Bacteria 6248
551 Ga0207640_10033042 3300025981 Bacteria 3214
552 Ga0207640_10387118 3300025981 Bacteria 1135
553 Ga0207658_10000009 3300025986 Bacteria 264118
554 Ga0207658_10000089 3300025986 Bacteria 100308
555 Ga0207658_10000260 3300025986 Bacteria 55292
556 Ga0207658_10004234 3300025986 Bacteria 9995
557 Ga0207658_10014864 3300025986 Bacteria 5333
558 Ga0207658_10018905 3300025986 Bacteria 4765
559 Ga0207658_10026183 3300025986 Bacteria 4087
560 Ga0207658_10054241 3300025986 Bacteria 2965
561 Ga0207658_10632501 3300025986 Bacteria 963
562 Ga0207677_10099806 3300026023 Bacteria 2133
563 Ga0207703_10000782 3300026035 Bacteria 31303
564 Ga0207703_10001276 3300026035 Bacteria 23365
565 Ga0207703_10016040 3300026035 Bacteria 5843
566 Ga0207703_10056022 3300026035 Bacteria 3209
567 Ga0207703_10057934 3300026035 Bacteria 3160
568 Ga0207703_10316193 3300026035 Bacteria 1429
569 Ga0207703_10391174 3300026035 Bacteria 1288
570 Ga0207639_10000991 3300026041 Bacteria 19346
571 Ga0207639_10005330 3300026041 Bacteria 8685
572 Ga0207639_10038615 3300026041 Bacteria 3552
573 Ga0207639_10520120 3300026041 Bacteria 1090
574 Ga0207639_10564668 3300026041 Bacteria 1046
575 Ga0207678_10001933 3300026067 Bacteria 18903
576 Ga0207678_10002497 3300026067 Bacteria 16733
577 Ga0207678_10003065 3300026067 Bacteria 15105
578 Ga0207678_10007193 3300026067 Bacteria 9867
579 Ga0207678_10047108 3300026067 Bacteria 3728
580 Ga0207678_10299345 3300026067 Bacteria 1382
581 Ga0207702_10000566 3300026078 Bacteria 41185
582 Ga0207702_10001681 3300026078 Bacteria 21845
583 Ga0207702_10016992 3300026078 Bacteria 6021
584 Ga0207702_10039984 3300026078 Bacteria 3931
585 Ga0207702_10230382 3300026078 Bacteria 1731
586 Ga0207702_10637398 3300026078 Bacteria 1047
587 Ga0207641_10000060 3300026088 Bacteria 161514
588 Ga0207641_10018839 3300026088 Bacteria 5660
589 Ga0207641_10028115 3300026088 Bacteria 4644
590 Ga0207641_10044818 3300026088 Bacteria 3720
591 Ga0207641_10081534 3300026088 Bacteria 2809
592 Ga0207648_10032233 3300026089 Bacteria 4628
593 Ga0207648_10174859 3300026089 Bacteria 1899
594 Ga0207676_10000635 3300026095 Bacteria 28333
595 Ga0207676_10001746 3300026095 Bacteria 15973
596 Ga0207676_10020125 3300026095 Bacteria 4878
597 Ga0207676_10034351 3300026095 Bacteria 3839
598 Ga0207676_10132939 3300026095 Bacteria 2118
599 Ga0207674_10000151 3300026116 Bacteria 81529
600 Ga0207674_10010668 3300026116 Bacteria 10390
601 Ga0207674_10042894 3300026116 Bacteria 4668
602 Ga0207674_10072141 3300026116 Bacteria 3469
603 Ga0207674_10313039 3300026116 Bacteria 1519
604 Ga0207675_100000370 3300026118 Bacteria 43070
605 Ga0207675_100004634 3300026118 Bacteria 13247
606 Ga0207683_10000320 3300026121 Bacteria 43863
607 Ga0207683_10003294 3300026121 Bacteria 14080
608 Ga0207683_10103890 3300026121 Bacteria 2538
609 Ga0207683_10302137 3300026121 Bacteria 1464
610 Ga0207683_10552265 3300026121 Bacteria 1065
611 Ga0207698_10000745 3300026142 Bacteria 18894
612 Ga0207698_10011138 3300026142 Bacteria 5816
613 Ga0207698_10027114 3300026142 Bacteria 4063
614 Ga0207698_10180552 3300026142 Bacteria 1869
615 Ga0207698_10498465 3300026142 Bacteria 1185
616 Ga0209974_10010447 3300027876 Bacteria 3132
617 Ga0268266_10000002 3300028379 Bacteria 3059047
618 Ga0268266_10000040 3300028379 Bacteria 323843
619 Ga0268266_10003923 3300028379 Bacteria 14460
620 Ga0268266_10146564 3300028379 Bacteria 2123
621 Ga0268265_10000334 3300028380 Bacteria 51202
622 Ga0268265_10021329 3300028380 Bacteria 4536
623 Ga0268265_10068567 3300028380 Bacteria 2751
624 Ga0268265_10078003 3300028380 Bacteria 2604
625 Ga0268265_10200743 3300028380 Bacteria 1730
626 Ga0268265_10325692 3300028380 Bacteria 1394
627 Ga0268265_10493357 3300028380 Bacteria 1152
628 Ga0268264_10000001 3300028381 Bacteria 1221000
629 Ga0268264_10000003 3300028381 Bacteria 1141976
630 Ga0268264_10011776 3300028381 Bacteria 7211
631 Ga0268264_10197513 3300028381 Bacteria 1838
632 Ga0268264_10605843 3300028381 Bacteria 1080
633 Ga0268264_10644939 3300028381 Bacteria 1047
634 Ga0307517_10207634 3300028786 Bacteria 1212
635 Ga0314311_1200227 3300030733 Bacteria 1508
636 Ga0316182_1241414 3300030745 Bacteria 2300
637 Ga0307408_100024521 3300031548 Bacteria 4120
638 Ga0307408_100051443 3300031548 Bacteria 2967
639 Ga0307408_100055172 3300031548 Bacteria 2875
640 Ga0307408_100091095 3300031548 Bacteria 2302
641 Ga0307408_100146626 3300031548 Bacteria 1858
642 Ga0307408_100153382 3300031548 Bacteria 1821
643 Ga0307508_10000502 3300031616 Bacteria 46831
644 Ga0307405_10023676 3300031731 Bacteria 3494
645 Ga0307405_10040673 3300031731 Bacteria 2817
646 Ga0307405_10071862 3300031731 Bacteria 2228
647 Ga0307405_10107998 3300031731 Bacteria 1879
648 Ga0307405_10116894 3300031731 Bacteria 1817
649 Ga0307405_10127604 3300031731 Bacteria 1752
650 Ga0307405_10160251 3300031731 Bacteria 1592
651 Ga0307405_10258434 3300031731 Bacteria 1299
652 Ga0307405_10259461 3300031731 Bacteria 1297
653 Ga0307405_10552042 3300031731 Bacteria 932
654 Ga0307405_10941395 3300031731 Bacteria 733
655 Ga0307413_10016497 3300031824 Bacteria 3817
656 Ga0307413_10022445 3300031824 Bacteria 3401
657 Ga0307413_10037915 3300031824 Bacteria 2788
658 Ga0307413_10040073 3300031824 Bacteria 2730
659 Ga0307413_10065225 3300031824 Bacteria 2266
660 Ga0307413_10067396 3300031824 Bacteria 2238
661 Ga0307413_10090135 3300031824 Bacteria 1994
662 Ga0307413_10111302 3300031824 Bacteria 1833
663 Ga0307413_10174663 3300031824 Bacteria 1525
664 Ga0307413_10196809 3300031824 Bacteria 1452
665 Ga0307413_10252863 3300031824 Bacteria 1308
666 Ga0307413_10380215 3300031824 Bacteria 1100
667 Ga0307413_10526138 3300031824 Bacteria 954
668 Ga0307410_10001231 3300031852 Bacteria 11376
669 Ga0307410_10007751 3300031852 Bacteria 5900
670 Ga0307410_10040715 3300031852 Bacteria 3059
671 Ga0307410_10077290 3300031852 Bacteria 2326
672 Ga0307410_10268727 3300031852 Bacteria 1333
673 Ga0307410_10297583 3300031852 Bacteria 1272
674 Ga0307410_10392310 3300031852 Bacteria 1119
675 Ga0307410_10760315 3300031852 Bacteria 821
676 Ga0307406_10003693 3300031901 Bacteria 8333
677 Ga0307406_10017892 3300031901 Bacteria 4134
678 Ga0307406_10029442 3300031901 Bacteria 3326
679 Ga0307406_10050544 3300031901 Bacteria 2636
680 Ga0307406_10073651 3300031901 Bacteria 2246
681 Ga0307406_10103180 3300031901 Bacteria 1947
682 Ga0307406_10193739 3300031901 Bacteria 1490
683 Ga0307406_10281779 3300031901 Bacteria 1268
684 Ga0307406_10514222 3300031901 Bacteria 973
685 Ga0307407_10002684 3300031903 Bacteria 7053
686 Ga0307407_10011104 3300031903 Bacteria 4274
687 Ga0307407_10029834 3300031903 Bacteria 2935
688 Ga0307407_10050144 3300031903 Bacteria 2387
689 Ga0307407_10062053 3300031903 Bacteria 2187
690 Ga0307407_10064463 3300031903 Bacteria 2153
691 Ga0307407_10067224 3300031903 Bacteria 2117
692 Ga0307407_10085218 3300031903 Bacteria 1922
693 Ga0307407_10209939 3300031903 Bacteria 1310
694 Ga0307412_10002430 3300031911 Bacteria 10359
695 Ga0307412_10003973 3300031911 Bacteria 8241
696 Ga0307412_10005581 3300031911 Bacteria 7063
697 Ga0307412_10009356 3300031911 Bacteria 5619
698 Ga0307412_10021302 3300031911 Bacteria 3957
699 Ga0307412_10088691 3300031911 Bacteria 2158
700 Ga0307412_10106562 3300031911 Bacteria 1993
701 Ga0307412_10126645 3300031911 Bacteria 1848
702 Ga0307412_10216734 3300031911 Bacteria 1465
703 Ga0307412_10272749 3300031911 Bacteria 1324
704 Ga0307412_10297259 3300031911 Bacteria 1274
705 Ga0307412_10376504 3300031911 Bacteria 1148
706 Ga0307409_100010106 3300031995 Bacteria 5841
707 Ga0307409_100030703 3300031995 Bacteria 3865
708 Ga0307409_100047279 3300031995 Bacteria 3264
709 Ga0307409_100053721 3300031995 Bacteria 3097
710 Ga0307409_100100309 3300031995 Bacteria 2399
711 Ga0307409_100109283 3300031995 Bacteria 2315
712 Ga0307409_100156370 3300031995 Bacteria 1987
713 Ga0307409_100186386 3300031995 Bacteria 1842
714 Ga0307409_100298492 3300031995 Bacteria 1497
715 Ga0307409_100429763 3300031995 Bacteria 1269
716 Ga0307409_100519111 3300031995 Bacteria 1163
717 Ga0307409_100646973 3300031995 Bacteria 1050
718 Ga0307409_100708690 3300031995 Bacteria 1006
719 Ga0307409_100944018 3300031995 Bacteria 878
720 Ga0307416_100004113 3300032002 Bacteria 8710
721 Ga0307416_100006047 3300032002 Bacteria 7534
722 Ga0307416_100026184 3300032002 Bacteria 4292
723 Ga0307416_100072603 3300032002 Bacteria 2865
724 Ga0307416_100224862 3300032002 Bacteria 1803
725 Ga0307416_100234242 3300032002 Bacteria 1773
726 Ga0307416_100345804 3300032002 Bacteria 1502
727 Ga0307416_100439189 3300032002 Bacteria 1354
728 Ga0307416_101050668 3300032002 Bacteria 918
729 Ga0307416_101118805 3300032002 Bacteria 892
730 Ga0307414_10002312 3300032004 Bacteria 9958
731 Ga0307414_10011801 3300032004 Bacteria 5141
732 Ga0307414_10028854 3300032004 Bacteria 3603
733 Ga0307414_10050558 3300032004 Bacteria 2879
734 Ga0307414_10057244 3300032004 Bacteria 2739
735 Ga0307414_10107896 3300032004 Bacteria 2111
736 Ga0307414_10110170 3300032004 Bacteria 2093
737 Ga0307414_10165989 3300032004 Bacteria 1760
738 Ga0307414_10172611 3300032004 Bacteria 1730
739 Ga0307414_10196075 3300032004 Bacteria 1638
740 Ga0307414_10197792 3300032004 Bacteria 1632
741 Ga0307414_10215673 3300032004 Bacteria 1572
742 Ga0307414_10234500 3300032004 Bacteria 1515
743 Ga0307414_10318887 3300032004 Bacteria 1322
744 Ga0307414_10329833 3300032004 Bacteria 1302
745 Ga0307414_10393776 3300032004 Bacteria 1201
746 Ga0307414_10419583 3300032004 Bacteria 1166
747 Ga0307414_10509386 3300032004 Bacteria 1066
748 Ga0307411_10002021 3300032005 Bacteria 8698
749 Ga0307411_10014118 3300032005 Bacteria 4434
750 Ga0307411_10014508 3300032005 Bacteria 4387
751 Ga0307411_10025043 3300032005 Bacteria 3567
752 Ga0307411_10025664 3300032005 Bacteria 3535
753 Ga0307411_10027712 3300032005 Bacteria 3432
754 Ga0307411_10044894 3300032005 Bacteria 2839
755 Ga0307411_10048557 3300032005 Bacteria 2751
756 Ga0307411_10116512 3300032005 Bacteria 1923
757 Ga0307411_10194232 3300032005 Bacteria 1552
758 Ga0307411_10259244 3300032005 Bacteria 1372
759 Ga0307411_10319283 3300032005 Bacteria 1253
760 Ga0307411_10369194 3300032005 Bacteria 1176
761 Ga0307411_10546365 3300032005 Bacteria 987
762 Ga0307411_10555057 3300032005 Bacteria 980
763 Ga0307411_10617230 3300032005 Bacteria 934
764 Ga0307411_10904753 3300032005 Bacteria 784
765 Ga0307411_11026108 3300032005 Bacteria 740
766 Ga0307415_100004103 3300032126 Bacteria 7511
767 Ga0307415_100007815 3300032126 Bacteria 5876
768 Ga0307415_100025508 3300032126 Bacteria 3711
769 Ga0307415_100048787 3300032126 Bacteria 2858
770 Ga0307415_100052963 3300032126 Bacteria 2762
771 Ga0307415_100267055 3300032126 Bacteria 1399
772 Ga0307415_100331369 3300032126 Bacteria 1274
773 Ga0307415_100389566 3300032126 Bacteria 1186
774 Ga0307415_100689379 3300032126 Bacteria 920
775 Ga0307510_10016704 3300033180 Bacteria 8660
776 Ga0373930_0011487 3300034816 Bacteria 1599
777 Ga0373940_0030745 3300035088 Bacteria 1430
778 Ga0373931_0012035 3300035691 Bacteria 4188
779 Ga0395899_0027780 3300037312 Bacteria 4262
780 Ga0395899_0102638 3300037312 Bacteria 2063
781 Ga0395899_0103359 3300037312 Bacteria 2055
782 Ga0395899_0216410 3300037312 Bacteria 1329
783 Ga0395900_0023899 3300037418 Bacteria 6254
784 Ga0395900_0039180 3300037418 Bacteria 4883
785 Ga0395900_0057645 3300037418 Bacteria 3999
786 Ga0395900_0079628 3300037418 Bacteria 3367
787 Ga0395900_0160367 3300037418 Bacteria 2294
788 Ga0395900_0265770 3300037418 Bacteria 1711
789 Ga0395900_1052435 3300037418 Bacteria 732
790 Ga0395898_0013098 3300037466 Bacteria 8551
791 Ga0395898_0104052 3300037466 Bacteria 2723
792 Ga0395898_0125151 3300037466 Bacteria 2462
793 Ga0395898_0141825 3300037466 Bacteria 2300
794 Ga0395898_0679852 3300037466 Bacteria 971
795 Ga0395905_0007161 3300037471 Bacteria 11146
796 Ga0395905_0009344 3300037471 Bacteria 9586
797 Ga0395905_0010965 3300037471 Bacteria 8772
798 Ga0395905_0013098 3300037471 Bacteria 7961
799 Ga0395905_0037694 3300037471 Bacteria 4537
800 Ga0395905_0087947 3300037471 Bacteria 2913
801 Ga0395905_0117404 3300037471 Bacteria 2500
802 Ga0395905_0153318 3300037471 Bacteria 2167
803 Ga0395905_0166669 3300037471 Bacteria 2070
804 Ga0395905_0168040 3300037471 Bacteria 2061
805 Ga0395905_0259897 3300037471 Bacteria 1621
806 Ga0395905_0329726 3300037471 Bacteria 1416
807 Ga0395905_0342481 3300037471 Bacteria 1386
808 Ga0395905_0482592 3300037471 Bacteria 1139
809 Ga0395905_0557119 3300037471 Bacteria 1047
810 Ga0436364_0121302 3300037853 Bacteria 3322
811 Ga0436364_0589111 3300037853 Bacteria 899
812 Ga0436364_1211536 3300037853 Bacteria 67143
813 Ga0395901_0014168 3300038443 Bacteria 8119
814 Ga0395901_0014555 3300038443 Bacteria 7998
815 Ga0395901_0088632 3300038443 Bacteria 3236
816 Ga0395901_0103619 3300038443 Bacteria 2985
817 Ga0395901_0251798 3300038443 Bacteria 1840
818 Ga0395901_0311493 3300038443 Bacteria 1630
819 Ga0395901_0518349 3300038443 Bacteria 1211
820 Ga0395901_0703223 3300038443 Bacteria 1008
821 Ga0395901_0744225 3300038443 Bacteria 974
822 Ga0395901_0997603 3300038443 Bacteria 813
823 Ga0436365_0462153 3300039437 Bacteria 1853
824 Ga0436363_0248894 3300039450 Bacteria 1074
825 Ga0439439_0024432 3300041406 Bacteria 1517
826 Ga0439461_0020618 3300041410 Bacteria 1306
827 Ga0439465_0005807 3300041413 Bacteria 3928
828 Ga0439465_0015938 3300041413 Bacteria 2343
829 Ga0451841_0395847 3300041498 Bacteria 1698
830 Ga0439431_0011022 3300041997 Bacteria 2060
831 Ga0439445_0001557 3300042004 Bacteria 4988
832 Ga0439445_0013042 3300042004 Bacteria 2006
833 Ga0439432_000604 3300042006 Bacteria 13487
834 Ga0439432_054175 3300042006 Bacteria 1246
835 Ga0439457_003188 3300042014 Bacteria 4519
836 Ga0439462_0024284 3300042015 Bacteria 1592
837 Ga0450923_027672 3300042125 Bacteria 1141
838 Ga0450890_029546 3300042127 Bacteria 775
839 Ga0439446_0021794 3300042156 Bacteria 1812
840 Ga0439434_0004412 3300042435 Bacteria 4113
841 Ga0466972_0100290 3300044658 Bacteria 1370
842 Ga0466973_0216352 3300044659 Bacteria 1399
843 Ga0451576_0000023 3300045051 Bacteria 477965
844 Ga0466967_0024326 3300045976 Bacteria 4978
845 Ga0495617_014419 3300046452 Bacteria 2687
846 Ga0495627_000135 3300046453 Bacteria 87716
847 Ga0495627_001558 3300046453 Bacteria 13044
848 Ga0495627_054758 3300046453 Bacteria 1192
849 Ga0495629_0063955 3300046459 Bacteria 2569
850 Ga0495638_0000494 3300046460 Bacteria 46930
851 Ga0495650_0000370 3300046471 Bacteria 78408
852 Ga0495650_0000949 3300046471 Bacteria 33507
853 Ga0495650_0046226 3300046471 Bacteria 1828
854 Ga0495584_0096366 3300046491 Bacteria 1494
855 Ga0495585_0007357 3300046492 Bacteria 6749
856 Ga0495596_0018839 3300046500 Bacteria 2842
857 Ga0495583_0000599 3300046506 Bacteria 49004
858 Ga0495583_0010632 3300046506 Bacteria 5351
859 Ga0495583_0049011 3300046506 Bacteria 1936
860 Ga0495583_0082768 3300046506 Bacteria 1392
861 Ga0495606_0007638 3300046507 Bacteria 9606
862 Ga0495610_0001021 3300046512 Bacteria 25765
863 Ga0495616_0070033 3300046513 Bacteria 1699
864 Ga0495631_0035802 3300046518 Bacteria 2219
865 Ga0495631_0054374 3300046518 Bacteria 1746
866 Ga0495632_0000042 3300046519 Bacteria 145186
867 Ga0495632_0134119 3300046519 Bacteria 1151
868 Ga0495637_0026962 3300046520 Bacteria 2574
869 Ga0495637_0072070 3300046520 Bacteria 1392
870 Ga0495643_0001290 3300046522 Bacteria 23913
871 Ga0495643_0011373 3300046522 Bacteria 5424
872 Ga0495643_0077672 3300046522 Bacteria 1734
873 Ga0495643_0091841 3300046522 Bacteria 1565
874 Ga0495643_0123362 3300046522 Bacteria 1307
875 Ga0495648_0000069 3300046524 Bacteria 136934
876 Ga0495648_0008874 3300046524 Bacteria 7860
877 Ga0495663_0000015 3300046525 Bacteria 145185
878 Ga0495663_0010615 3300046525 Bacteria 2562
879 Ga0495663_0013816 3300046525 Bacteria 2258
880 Ga0495663_0078836 3300046525 Bacteria 1058
881 Ga0495642_0035685 3300046528 Bacteria 2007
882 Ga0495598_0012034 3300046537 Bacteria 2112
883 Ga0495621_0002969 3300046539 Bacteria 4625
884 Ga0495621_0004588 3300046539 Bacteria 3901
885 Ga0495597_0072441 3300046542 Bacteria 1482
886 Ga0495633_0000222 3300046558 Bacteria 70418
887 Ga0495633_0001836 3300046558 Bacteria 15611
888 Ga0495633_0023041 3300046558 Bacteria 3088
889 Ga0495668_0000258 3300046616 Bacteria 75022
890 Ga0495668_0039514 3300046616 Bacteria 2634
891 Ga0495668_0114435 3300046616 Bacteria 1475
892 Ga0495611_0042942 3300046648 Bacteria 2020
893 Ga0495625_0002466 3300046660 Bacteria 19994
894 Ga0495625_0014661 3300046660 Bacteria 6243
895 Ga0495625_0044603 3300046660 Bacteria 3209
896 Ga0495625_0089099 3300046660 Bacteria 2136
897 Ga0495625_0167451 3300046660 Bacteria 1468
898 Ga0495625_0240699 3300046660 Bacteria 1178
899 Ga0495661_0274765 3300046665 Bacteria 851
900 Ga0495669_0000038 3300046684 Bacteria 93166
901 Ga0495669_0003083 3300046684 Bacteria 6851
902 Ga0495669_0025929 3300046684 Bacteria 2560
903 Ga0495669_0099819 3300046684 Bacteria 1347
904 Ga0495669_0241557 3300046684 Bacteria 867
905 Ga0495649_0088005 3300046694 Bacteria 1657
906 Ga0495600_0000810 3300046809 Bacteria 16604
907 Ga0495660_0165790 3300046810 Bacteria 1080
908 Ga0495636_0099636 3300047318 Bacteria 1269
909 Ga0495636_0135136 3300047318 Bacteria 1099
910 Ga0495683_0002404 3300047323 Bacteria 11331
911 Ga0495687_000045 3300047443 Bacteria 211968
912 Ga0495687_000089 3300047443 Bacteria 141448
913 Ga0495677_0168244 3300047445 Bacteria 847
914 Ga0495685_059253 3300047447 Bacteria 1292
915 Ga0495681_0000214 3300047470 Bacteria 48192
916 Ga0495681_0019228 3300047470 Bacteria 3736
917 Ga0495681_0046060 3300047470 Bacteria 2082
918 Ga0495686_0000120 3300047472 Bacteria 164638
919 Ga0495686_0032629 3300047472 Bacteria 3368
920 Ga0495686_0041072 3300047472 Bacteria 2947
921 Ga0495686_0062330 3300047472 Bacteria 2313
922 Ga0495686_0121477 3300047472 Bacteria 1556
923 Ga0495686_0180570 3300047472 Bacteria 1223
924 Ga0495686_0226021 3300047472 Bacteria 1062
925 Ga0495615_0097741 3300048090 Bacteria 826
926 Ga0496101_0158126 3300048904 Bacteria 1737
927 Ga0496102_0000067 3300048905 Bacteria 156790
928 Ga0496102_0028068 3300048905 Bacteria 5029
929 Ga0496102_0032743 3300048905 Bacteria 4671
930 Ga0496103_0000207 3300048906 Bacteria 58942
931 Ga0496103_0143347 3300048906 Bacteria 1529
932 Ga0496103_0547267 3300048906 Bacteria 739
933 Ga0496104_0033027 3300048907 Bacteria 4818
934 Ga0496105_0024491 3300048908 Bacteria 4903
935 Ga0496105_0100461 3300048908 Bacteria 2389
936 Ga0496105_0163192 3300048908 Bacteria 1829
937 Ga0496106_0159352 3300048909 Bacteria 1784
938 Ga0496107_0023801 3300048910 Bacteria 4329
939 Ga0496107_0120087 3300048910 Bacteria 1936
940 Ga0496107_0134206 3300048910 Bacteria 1829
941 Ga0496107_0154011 3300048910 Bacteria 1701
942 Ga0496107_0267133 3300048910 Bacteria 1273
943 Ga0496107_0463358 3300048910 Bacteria 941
944 Ga0496108_0006067 3300048911 Bacteria 9772
945 Ga0496108_0007631 3300048911 Bacteria 8762
946 Ga0496108_0366058 3300048911 Bacteria 1258
947 Ga0496109_0030175 3300048912 Bacteria 4860
948 Ga0496109_0243687 3300048912 Bacteria 1692
949 Ga0496109_0442002 3300048912 Bacteria 1228
950 Ga0496110_0023986 3300048913 Bacteria 5196
951 Ga0496110_0051335 3300048913 Bacteria 3623
952 Ga0496110_0056647 3300048913 Bacteria 3449
953 Ga0496110_0135478 3300048913 Bacteria 2225
954 Ga0496110_0194912 3300048913 Bacteria 1840
955 Ga0496111_0022953 3300048914 Bacteria 4375
956 Ga0496111_0023502 3300048914 Bacteria 4328
957 Ga0496111_0028546 3300048914 Bacteria 3954
958 Ga0496111_0033889 3300048914 Bacteria 3643
959 Ga0496111_0509169 3300048914 Bacteria 886
960 Ga0496112_0021106 3300048915 Bacteria 6187
961 Ga0496112_0570541 3300048915 Bacteria 1064
962 Ga0496113_0000705 3300048916 Bacteria 17089
963 Ga0496113_0065990 3300048916 Bacteria 2740
964 Ga0496115_0000545 3300048918 Bacteria 29339
965 Ga0496115_0000988 3300048918 Bacteria 20593
966 Ga0496116_0006885 3300048919 Bacteria 10205
967 Ga0496116_0126249 3300048919 Bacteria 1469
968 Ga0496117_0000114 3300048920 Bacteria 180658
969 Ga0496117_0007295 3300048920 Bacteria 10861
970 Ga0496117_0278124 3300048920 Bacteria 898
971 Ga0496118_0000082 3300048921 Bacteria 185820
972 Ga0496118_0182920 3300048921 Bacteria 1264
973 Ga0496119_0005868 3300048922 Bacteria 11594
974 Ga0496120_0039633 3300048923 Bacteria 2777
975 Ga0496121_0000176 3300048924 Bacteria 142585
976 Ga0496121_0000758 3300048924 Bacteria 59289
977 Ga0496121_0054911 3300048924 Bacteria 3324
978 Ga0496121_0175555 3300048924 Bacteria 1551
979 Ga0496122_0003335 3300048925 Bacteria 21202
980 Ga0496122_0020364 3300048925 Bacteria 5997
981 Ga0496123_0008153 3300048926 Bacteria 9668
982 Ga0496123_0095913 3300048926 Bacteria 1743
983 Ga0496123_0303066 3300048926 Bacteria 762
984 Ga0496124_0000068 3300048927 Bacteria 221819
985 Ga0496124_0000485 3300048927 Bacteria 68201
986 Ga0496124_0007723 3300048927 Bacteria 11370
987 Ga0496124_0043506 3300048927 Bacteria 3861
988 Ga0496124_0150770 3300048927 Bacteria 1824
989 Ga0496124_0423920 3300048927 Bacteria 916
990 Ga0496125_0000219 3300048928 Bacteria 116721
991 Ga0496125_0074499 3300048928 Bacteria 2632
992 Ga0496125_0078881 3300048928 Bacteria 2528
993 Ga0496125_0090787 3300048928 Bacteria 2291
994 Ga0496126_0000157 3300048929 Bacteria 156203
995 Ga0496126_0143995 3300048929 Bacteria 2049
996 Ga0501032_0086055 3300049569 Bacteria 2089
997 Ga0501033_0328313 3300049570 Bacteria 1074
998 Ga0501034_0895489 3300049571 Bacteria 775
999 Ga0501043_0015371 3300049579 Bacteria 5995
1000 Ga0501047_0002789 3300049581 Bacteria 16594
1001 Ga0501048_0183562 3300049582 Bacteria 1483
1002 Ga0501067_0149342 3300049583 Bacteria 1302
1003 Ga0501068_0266857 3300049584 Bacteria 1092
1004 Ga0501069_0322599 3300049585 Bacteria 908
1005 Ga0501211_000257 3300049658 Bacteria 4747
1006 Ga0501217_004510 3300049661 Bacteria 2866
1007 Ga0501223_000015 3300049663 Bacteria 68826
1008 Ga0501235_000918 3300049669 Bacteria 6076
1009 Ga0501235_012969 3300049669 Bacteria 1834
1010 Ga0501239_007460 3300049672 Bacteria 1147
1011 Ga0501243_026933 3300049675 Bacteria 969
1012 Ga0501246_000230 3300049676 Bacteria 3755
1013 Ga0501249_002428 3300049679 Bacteria 3767
1014 Ga0501249_013520 3300049679 Bacteria 1735
1015 Ga0501225_0000069 3300049705 Bacteria 33699
1016 Ga0501268_001960 3300049765 Bacteria 2641
1017 Ga0501268_007170 3300049765 Bacteria 1657
1018 nmdc:mga00v17_180954_c1 3300050491 Bacteria 1360
1019 nmdc:mga06r32_6152_c1 3300050510 Bacteria 10773
1020 Ga0500610_0000053 3300053079 Bacteria 36671
1021 Ga0500643_001510 3300053087 Bacteria 13306
1022 Ga0500643_029577 3300053087 Bacteria 1684
1023 Ga0500562_021733 3300053108 Bacteria 1671
1024 Ga0500595_003686 3300053119 Bacteria 7076
1025 Ga0500642_0000288 3300053130 Bacteria 18351
1026 Ga0500658_0000187 3300053134 Bacteria 29373
1027 Ga0500658_0001123 3300053134 Bacteria 10945
1028 Ga0500559_0017358 3300053136 Bacteria 3039
1029 Ga0500573_0000016 3300053140 Bacteria 182675
1030 Ga0500616_0020321 3300053153 Bacteria 3731
1031 Ga0500636_0011437 3300053177 Bacteria 5196
1032 Ga0500645_000008 3300053730 Bacteria 212254
1033 Ga0500596_008956 3300053735 Bacteria 1577
1034 Ga0500661_044367 3300055283 Bacteria 789
1035 2600202594 2599185354 Bacteria 4398675
1036 2643823539 2643221560 Bacteria 4801179
1037 2753764387 2751185897 Bacteria 5322941
1038 2830076733 2830075706 Bacteria 3855215
1039 2848299154 2848297114 Bacteria 3608511
1040 2879166822 2879163058 Bacteria 4223965
1041 2885431127 2885429604 Bacteria 3642894
1042 2896430894 2896429255 Bacteria 2557483
1043 2919711014 2919709256 Bacteria 4318106
1044 2928027388 2928027323 Bacteria 4382488
1045 2946787711 2946787523 Bacteria 4366789
1046 2984558310 2984555340 Bacteria 4247089
1047 2984567310 2984564862 Bacteria 4339992
1048 2990269172 2990265787 Bacteria 3943888
1049 2993358376 2993356040 Bacteria 4247105
1050 2993694877 2993693658 Bacteria 4040749
1051 8057103463 8057101203 Bacteria 5034064
1052 Ga0183361_10388
1053 MBSR1b_contig_9270608
1054 JGI24740J21852_10007532
1055 JGI24739J22299_10001888
1056 JGI24739J22299_10011197
1057 JGI24739J22299_10105797
1058 JGI24737J22298_10011471
1059 JGI24737J22298_10024773
1060 JGI24735J21928_10012758
1061 JGI24750J21931_1000040
1062 JGI24748J21848_1000053
1063 JGI24738J21930_10001400
1064 JGI24738J21930_10006399
1065 JGI24034J26672_10000036
1066 JGI24742J22300_10007088
1067 JGI24742J22300_10020974
1068 Ga0055525_1000090
1069 Ga0055542_1000037
1070 Ga0055529_1000042
1071 Ga0055529_1000109
1072 Ga0055537_1001792
1073 Ga0055524_1000088
1074 Ga0055536_1007592
1075 Ga0055534_1013906
1076 Ga0055530_10000025
1077 Ga0055530_10000035
1078 Ga0055531_10000016
1079 Ga0055531_10004589
1080 Ga0065165_1007535
1081 Ga0065165_1018553
1082 Ga0065715_10113548
1083 Ga0070658_10000130
1084 Ga0070658_10000900
1085 Ga0070658_10002242
1086 Ga0070658_10009847
1087 Ga0070658_10024569
1088 Ga0070658_10036221
1089 Ga0070658_10265687
1090 Ga0070658_10487024
1091 Ga0070658_10554360
1092 Ga0070658_10632852
1093 Ga0070676_10029154
1094 Ga0070676_10034351
1095 Ga0070676_10044919
1096 Ga0070683_100000909
1097 Ga0070683_100004703
1098 Ga0070683_100037865
1099 Ga0070690_100000093
1100 Ga0070690_100247187
1101 Ga0070670_100010512
1102 Ga0070670_100022355
1103 Ga0070670_100031101
1104 Ga0070670_100032146
1105 Ga0070670_100034083
1106 Ga0070670_100036011
1107 Ga0070670_100172841
1108 Ga0070677_10002217
1109 Ga0070677_10013962
1110 Ga0068869_100519972
1111 Ga0070666_10000009
1112 Ga0070666_10000841
1113 Ga0070666_10024779
1114 Ga0070666_10029789
1115 Ga0070666_10100086
1116 Ga0070680_100000845
1117 Ga0070682_100026285
1118 Ga0070682_100049377
1119 Ga0068868_100031844
1120 Ga0068868_100122759
1121 Ga0070660_100000262
1122 Ga0070660_100000920
1123 Ga0070660_100007546
1124 Ga0070660_100009198
1125 Ga0070660_100081066
1126 Ga0070660_100180911
1127 Ga0070689_100042910
1128 Ga0070691_10066178
1129 Ga0070687_100089873
1130 Ga0070661_100000206
1131 Ga0070661_100002437
1132 Ga0070661_100003493
1133 Ga0070661_100006185
1134 Ga0070661_100022050
1135 Ga0070661_100041146
1136 Ga0070661_100094403
1137 Ga0070661_100137929
1138 Ga0070661_100237669
1139 Ga0070692_10003007
1140 Ga0070692_10055882
1141 Ga0070668_100000024
1142 Ga0070668_100007160
1143 Ga0070668_100017307
1144 Ga0070668_100127817
1145 Ga0070668_100185247
1146 Ga0070668_100321406
1147 Ga0070668_100503325
1148 Ga0070669_100000103
1149 Ga0070669_100005253
1150 Ga0070669_100012635
1151 Ga0070675_100001629
1152 Ga0070675_100001950
1153 Ga0070675_100013398
1154 Ga0070671_100000021
1155 Ga0070671_100001277
1156 Ga0070671_100002080
1157 Ga0070671_100014082
1158 Ga0070671_100091674
1159 Ga0070671_100141024
1160 Ga0070674_100000399
1161 Ga0070674_100013191
1162 Ga0070674_100037619
1163 Ga0070674_100413192
1164 Ga0070673_100003118
1165 Ga0070673_100137241
1166 Ga0070673_100160748
1167 Ga0070673_100185000
1168 Ga0070673_100200888
1169 Ga0070673_100703043
1170 Ga0070688_100103994
1171 Ga0070659_100000883
1172 Ga0070659_100023869
1173 Ga0070659_100046093
1174 Ga0070659_100090934
1175 Ga0070659_100107239
1176 Ga0070659_100166998
1177 Ga0070667_100000009
1178 Ga0070667_100000067
1179 Ga0070667_100006344
1180 Ga0070667_100007570
1181 Ga0070667_100010670
1182 Ga0070667_100013814
1183 Ga0070667_100046370
1184 Ga0070667_100117444
1185 Ga0070667_100241459
1186 Ga0070663_100002587
1187 Ga0070663_100004559
1188 Ga0070663_100030185
1189 Ga0070663_100059039
1190 Ga0070678_100004816
1191 Ga0070678_100078788
1192 Ga0070678_100585179
1193 Ga0070662_100000107
1194 Ga0070662_100002201
1195 Ga0070662_100004739
1196 Ga0070662_100025833
1197 Ga0070662_100077769
1198 Ga0070662_100081039
1199 Ga0070662_100404074
1200 Ga0070662_100746574
1201 Ga0070681_10232066
1202 Ga0070681_10281615
1203 Ga0068867_100030848
1204 Ga0068867_100063135
1205 Ga0068867_100184443
1206 Ga0070685_10000076
1207 Ga0070685_10192999
1208 Ga0070684_100025416
1209 Ga0070684_100534137
1210 Ga0068853_100000172
1211 Ga0068853_100014481
1212 Ga0068853_100034278
1213 Ga0068853_100210874
1214 Ga0068853_100568520
1215 Ga0068853_100710606
1216 Ga0070672_100002032
1217 Ga0070672_100009625
1218 Ga0070672_100167242
1219 Ga0070672_100987255
1220 Ga0070686_100000018
1221 Ga0070686_100000338
1222 Ga0070696_100006864
1223 Ga0070696_100186978
1224 Ga0070693_100000773
1225 Ga0070693_100018727
1226 Ga0070693_100109294
1227 Ga0070665_100000071
1228 Ga0070665_100000535
1229 Ga0070665_100001716
1230 Ga0070665_100040003
1231 Ga0070665_100190843
1232 Ga0068855_100000353
1233 Ga0068855_100002937
1234 Ga0068855_100044728
1235 Ga0068855_100070358
1236 Ga0068855_100142423
1237 Ga0068855_100223913
1238 Ga0068855_100476346
1239 Ga0070664_100001030
1240 Ga0070664_100002325
1241 Ga0070664_100036792
1242 Ga0070664_100054610
1243 Ga0070664_100150353
1244 Ga0070664_100217544
1245 Ga0068857_100048552
1246 Ga0068857_100058927
1247 Ga0068857_100085132
1248 Ga0068857_100128661
1249 Ga0068857_100148009
1250 Ga0068857_100183492
1251 Ga0068854_100006682
1252 Ga0068854_100007103
1253 Ga0068854_100017720
1254 Ga0068854_100019474
1255 Ga0068854_100097573
1256 Ga0068854_100361375
1257 Ga0068856_100000364
1258 Ga0068856_100023360
1259 Ga0068856_100029387
1260 Ga0068856_100413572
1261 Ga0068852_100002792
1262 Ga0068852_100106625
1263 Ga0068852_100333537
1264 Ga0068852_100899897
1265 Ga0068859_100008763
1266 Ga0068859_100015868
1267 Ga0068859_100037843
1268 Ga0068859_100039235
1269 Ga0068859_100048958
1270 Ga0068859_100175138
1271 Ga0068859_100806907
1272 Ga0068859_100871614
1273 Ga0068864_100005184
1274 Ga0068864_100010361
1275 Ga0068864_100014914
1276 Ga0068864_100027563
1277 Ga0068864_100144106
1278 Ga0068864_100241615
1279 Ga0068861_100003501
1280 Ga0068861_100007076
1281 Ga0068851_10007809
1282 Ga0068851_10009438
1283 Ga0068851_10019346
1284 Ga0068851_10021307
1285 Ga0068851_10025374
1286 Ga0068851_10049352
1287 Ga0068851_10053891
1288 Ga0068870_10141042
1289 Ga0068870_10405295
1290 Ga0068863_100000038
1291 Ga0068863_100000323
1292 Ga0068863_100005444
1293 Ga0068863_100015715
1294 Ga0068863_100807437
1295 Ga0068858_100000273
1296 Ga0068858_100001634
1297 Ga0068858_100002083
1298 Ga0068858_100002738
1299 Ga0068858_100028846
1300 Ga0068858_100070318
1301 Ga0068858_100735640
1302 Ga0068860_100000022
1303 Ga0068860_100000036
1304 Ga0068860_100120599
1305 Ga0068860_100330140
1306 Ga0068860_100563547
1307 Ga0068862_100000602
1308 Ga0068862_100003209
1309 Ga0068862_100053506
1310 Ga0068862_100055854
1311 Ga0068862_100069724
1312 Ga0068862_100129742
1313 Ga0068862_100205502
1314 Ga0081455_10000088
1315 Ga0081539_10013221
1316 Ga0081539_10040482
1317 Ga0075364_10100936
1318 Ga0097621_100122269
1319 Ga0097621_100233582
1320 Ga0068871_100034831
1321 Ga0068871_100277443
1322 Ga0075431_100890910
1323 Ga0097620_100008763
1324 Ga0097620_100015868
1325 Ga0097620_100037844
1326 Ga0097620_100039234
1327 Ga0097620_100048958
1328 Ga0097620_100175133
1329 Ga0097620_100806888
1330 Ga0097620_100871506
1331 Ga0105250_10094929
1332 Ga0105240_10023904
1333 Ga0105245_10012230
1334 Ga0105247_10081996
1335 Ga0105243_10000189
1336 Ga0105243_10090604
1337 Ga0105243_10286735
1338 Ga0105241_10007791
1339 Ga0105241_10185502
1340 Ga0105248_10000238
1341 Ga0105248_10005888
1342 Ga0105248_10040846
1343 Ga0105248_10099746
1344 Ga0105248_10148887
1345 Ga0105248_10177059
1346 Ga0105237_10033081
1347 Ga0105237_10114209
1348 Ga0105237_10168815
1349 Ga0105238_10052224
1350 Ga0105238_10121827
1351 Ga0105238_10167439
1352 Ga0105238_10183425
1353 Ga0105238_10495371
1354 Ga0105238_10850609
1355 Ga0105249_10000014
1356 Ga0105249_10030951
1357 Ga0105239_10308172
1358 Ga0157326_1007113
1359 Ga0157373_10010055
1360 Ga0157373_10012668
1361 Ga0157373_10127981
1362 Ga0157373_10171284
1363 Ga0157371_10002630
1364 Ga0157371_10003977
1365 Ga0157371_10053767
1366 Ga0157371_10055425
1367 Ga0157371_10150757
1368 Ga0157370_10026506
1369 Ga0157370_10026732
1370 Ga0157370_10051979
1371 Ga0157370_10310099
1372 Ga0157370_10545842
1373 Ga0157369_10001687
1374 Ga0157369_10214909
1375 Ga0157374_10021678
1376 Ga0157374_10031141
1377 Ga0157374_10108439
1378 Ga0157378_10114034
1379 Ga0157378_10297873
1380 Ga0157378_10556164
1381 Ga0163162_10467934
1382 Ga0157372_10019954
1383 Ga0157372_10109565
1384 Ga0157372_10273467
1385 Ga0157372_11027802
1386 Ga0157375_10000628
1387 Ga0157375_10119697
1388 Ga0157375_10269701
1389 Ga0157514_103401
1390 Ga0163163_10000543
1391 Ga0163163_10087718
1392 Ga0163163_10103156
1393 Ga0163163_10350471
1394 Ga0157380_10001003
1395 Ga0157380_10008537
1396 Ga0157380_10014580
1397 Ga0157380_10801091
1398 Ga0182008_10021234
1399 Ga0157377_10253359
1400 Ga0157379_10006699
1401 Ga0157379_10122031
1402 Ga0157379_10403823
1403 Ga0157379_10579306
1404 Ga0183363_1001
1405 Ga0163161_10000186
1406 Ga0163161_10102221
1407 Ga0163161_10218475
1408 Ga0197907_11157279
1409 Ga0206354_11427625
1410 Ga0206353_10171510
1411 Ga0206353_10359237
1412 Ga0213875_10000135
1413 Ga0207672_1001640
1414 Ga0209147_100356
1415 Ga0209563_100111
1416 Ga0207425_1001404
1417 Ga0209646_1007013
1418 Ga0209148_1000026
1419 Ga0209233_1000154
1420 Ga0209565_1000010
1421 Ga0209455_1000005
1422 Ga0209455_1005809
1423 Ga0209673_1009048
1424 Ga0209675_1000076
1425 Ga0209676_1001366
1426 Ga0209025_1011886
1427 Ga0209758_1005853
1428 Ga0209050_1000026
1429 Ga0209050_1000042
1430 Ga0209050_1006998
1431 Ga0209256_1000034
1432 Ga0209257_1000009
1433 Ga0209257_1001581
1434 Ga0209257_1002892
1435 Ga0207697_10001097
1436 Ga0207697_10022784
1437 Ga0207656_10008288
1438 Ga0207656_10019810
1439 Ga0207656_10020644
1440 Ga0207656_10021992
1441 Ga0207656_10024035
1442 Ga0207656_10060602
1443 Ga0207656_10224129
1444 Ga0207696_1091820
1445 Ga0207713_1070306
1446 Ga0207682_10000194
1447 Ga0207682_10002083
1448 Ga0207710_10044147
1449 Ga0207688_10060473
1450 Ga0207688_10172111
1451 Ga0207688_10201185
1452 Ga0207680_10000007
1453 Ga0207680_10024818
1454 Ga0207680_10076175
1455 Ga0207680_10164108
1456 Ga0207647_10000331
1457 Ga0207647_10000910
1458 Ga0207647_10026357
1459 Ga0207647_10029798
1460 Ga0207647_10052077
1461 Ga0207647_10123956
1462 Ga0207645_10017693
1463 Ga0207645_10028598
1464 Ga0207645_10103563
1465 Ga0207645_10125767
1466 Ga0207705_10000371
1467 Ga0207705_10000574
1468 Ga0207705_10003366
1469 Ga0207705_10005390
1470 Ga0207705_10011112
1471 Ga0207705_10011202
1472 Ga0207705_10016709
1473 Ga0207705_10027000
1474 Ga0207705_10072700
1475 Ga0207705_10431785
1476 Ga0207705_10574330
1477 Ga0207654_10000535
1478 Ga0207654_10003712
1479 Ga0207654_10214010
1480 Ga0207707_10300612
1481 Ga0207695_10001498
1482 Ga0207695_10035150
1483 Ga0207671_10000350
1484 Ga0207671_10058972
1485 Ga0207671_10147925
1486 Ga0207660_10147610
1487 Ga0207657_10000643
1488 Ga0207657_10000812
1489 Ga0207657_10000863
1490 Ga0207657_10002760
1491 Ga0207657_10011178
1492 Ga0207657_10024384
1493 Ga0207649_10000362
1494 Ga0207649_10000616
1495 Ga0207649_10075022
1496 Ga0207649_10358290
1497 Ga0207652_10492762
1498 Ga0207681_10000350
1499 Ga0207681_10021734
1500 Ga0207681_10024615
1501 Ga0207681_10339766
1502 Ga0207694_10000447
1503 Ga0207694_10005672
1504 Ga0207694_10016303
1505 Ga0207694_10040182
1506 Ga0207694_10203459
1507 Ga0207650_10001426
1508 Ga0207650_10004509
1509 Ga0207650_10008489
1510 Ga0207650_10033119
1511 Ga0207650_10039258
1512 Ga0207650_10039837
1513 Ga0207650_10070980
1514 Ga0207650_10103465
1515 Ga0207650_10133882
1516 Ga0207650_10135172
1517 Ga0207650_10375769
1518 Ga0207659_10002145
1519 Ga0207659_10010381
1520 Ga0207659_10012707
1521 Ga0207659_10040896
1522 Ga0207659_10275058
1523 Ga0207659_10554699
1524 Ga0207687_10079352
1525 Ga0207644_10000054
1526 Ga0207644_10009169
1527 Ga0207644_10013046
1528 Ga0207644_10014265
1529 Ga0207644_10023854
1530 Ga0207644_10027350
1531 Ga0207644_10085888
1532 Ga0207644_10430254
1533 Ga0207690_10000062
1534 Ga0207690_10004520
1535 Ga0207690_10011926
1536 Ga0207690_10165436
1537 Ga0207690_10172850
1538 Ga0207690_10181450
1539 Ga0207690_10311300
1540 Ga0207706_10000211
1541 Ga0207706_10000842
1542 Ga0207706_10002689
1543 Ga0207706_10012861
1544 Ga0207706_10020765
1545 Ga0207706_10021856
1546 Ga0207706_10025533
1547 Ga0207706_10113738
1548 Ga0207706_10127556
1549 Ga0207709_10001974
1550 Ga0207709_10796070
1551 Ga0207670_10003472
1552 Ga0207669_10000146
1553 Ga0207669_10002460
1554 Ga0207669_10008651
1555 Ga0207669_10053271
1556 Ga0207691_10001025
1557 Ga0207691_10001329
1558 Ga0207691_10021857
1559 Ga0207691_10043703
1560 Ga0207691_10295940
1561 Ga0207691_10334618
1562 Ga0207711_10001768
1563 Ga0207711_10004434
1564 Ga0207711_10015580
1565 Ga0207711_10016865
1566 Ga0207711_10021214
1567 Ga0207689_10676791
1568 Ga0207661_10003356
1569 Ga0207661_10027159
1570 Ga0207661_10163530
1571 Ga0207679_10002801
1572 Ga0207679_10018962
1573 Ga0207679_10046229
1574 Ga0207679_10523774
1575 Ga0207667_10000010
1576 Ga0207667_10000237
1577 Ga0207667_10007822
1578 Ga0207667_10012966
1579 Ga0207667_10013405
1580 Ga0207667_10088032
1581 Ga0207667_10167386
1582 Ga0207667_10177609
1583 Ga0207667_10229948
1584 Ga0207651_10011320
1585 Ga0207651_10124320
1586 Ga0207651_10151913
1587 Ga0207651_10190822
1588 Ga0207651_10247865
1589 Ga0207712_10000004
1590 Ga0207712_10140329
1591 Ga0207668_10000396
1592 Ga0207668_10002501
1593 Ga0207668_10012476
1594 Ga0207668_10028544
1595 Ga0207668_10048393
1596 Ga0207668_10137860
1597 Ga0207668_10611988
1598 Ga0207640_10001641
1599 Ga0207640_10004927
1600 Ga0207640_10006739
1601 Ga0207640_10006892
1602 Ga0207640_10033042
1603 Ga0207640_10387118
1604 Ga0207658_10000009
1605 Ga0207658_10000089
1606 Ga0207658_10000260
1607 Ga0207658_10004234
1608 Ga0207658_10014864
1609 Ga0207658_10018905
1610 Ga0207658_10026183
1611 Ga0207658_10054241
1612 Ga0207658_10632501
1613 Ga0207677_10099806
1614 Ga0207703_10000782
1615 Ga0207703_10001276
1616 Ga0207703_10016040
1617 Ga0207703_10056022
1618 Ga0207703_10057934
1619 Ga0207703_10316193
1620 Ga0207703_10391174
1621 Ga0207639_10000991
1622 Ga0207639_10005330
1623 Ga0207639_10038615
1624 Ga0207639_10520120
1625 Ga0207639_10564668
1626 Ga0207678_10001933
1627 Ga0207678_10002497
1628 Ga0207678_10003065
1629 Ga0207678_10007193
1630 Ga0207678_10047108
1631 Ga0207678_10299345
1632 Ga0207702_10000566
1633 Ga0207702_10001681
1634 Ga0207702_10016992
1635 Ga0207702_10039984
1636 Ga0207702_10230382
1637 Ga0207702_10637398
1638 Ga0207641_10000060
1639 Ga0207641_10018839
1640 Ga0207641_10028115
1641 Ga0207641_10044818
1642 Ga0207641_10081534
1643 Ga0207648_10032233
1644 Ga0207648_10174859
1645 Ga0207676_10000635
1646 Ga0207676_10001746
1647 Ga0207676_10020125
1648 Ga0207676_10034351
1649 Ga0207676_10132939
1650 Ga0207674_10000151
1651 Ga0207674_10010668
1652 Ga0207674_10042894
1653 Ga0207674_10072141
1654 Ga0207674_10313039
1655 Ga0207675_100000370
1656 Ga0207675_100004634
1657 Ga0207683_10000320
1658 Ga0207683_10003294
1659 Ga0207683_10103890
1660 Ga0207683_10302137
1661 Ga0207683_10552265
1662 Ga0207698_10000745
1663 Ga0207698_10011138
1664 Ga0207698_10027114
1665 Ga0207698_10180552
1666 Ga0207698_10498465
1667 Ga0209974_10010447
1668 Ga0268266_10000002
1669 Ga0268266_10000040
1670 Ga0268266_10003923
1671 Ga0268266_10146564
1672 Ga0268265_10000334
1673 Ga0268265_10021329
1674 Ga0268265_10068567
1675 Ga0268265_10078003
1676 Ga0268265_10200743
1677 Ga0268265_10325692
1678 Ga0268265_10493357
1679 Ga0268264_10000001
1680 Ga0268264_10000003
1681 Ga0268264_10011776
1682 Ga0268264_10197513
1683 Ga0268264_10605843
1684 Ga0268264_10644939
1685 Ga0307517_10207634
1686 Ga0314311_1200227
1687 Ga0316182_1241414
1688 Ga0307408_100024521
1689 Ga0307408_100051443
1690 Ga0307408_100055172
1691 Ga0307408_100091095
1692 Ga0307408_100146626
1693 Ga0307408_100153382
1694 Ga0307508_10000502
1695 Ga0307405_10023676
1696 Ga0307405_10040673
1697 Ga0307405_10071862
1698 Ga0307405_10107998
1699 Ga0307405_10116894
1700 Ga0307405_10127604
1701 Ga0307405_10160251
1702 Ga0307405_10258434
1703 Ga0307405_10259461
1704 Ga0307405_10552042
1705 Ga0307405_10941395
1706 Ga0307413_10016497
1707 Ga0307413_10022445
1708 Ga0307413_10037915
1709 Ga0307413_10040073
1710 Ga0307413_10065225
1711 Ga0307413_10067396
1712 Ga0307413_10090135
1713 Ga0307413_10111302
1714 Ga0307413_10174663
1715 Ga0307413_10196809
1716 Ga0307413_10252863
1717 Ga0307413_10380215
1718 Ga0307413_10526138
1719 Ga0307410_10001231
1720 Ga0307410_10007751
1721 Ga0307410_10040715
1722 Ga0307410_10077290
1723 Ga0307410_10268727
1724 Ga0307410_10297583
1725 Ga0307410_10392310
1726 Ga0307410_10760315
1727 Ga0307406_10003693
1728 Ga0307406_10017892
1729 Ga0307406_10029442
1730 Ga0307406_10050544
1731 Ga0307406_10073651
1732 Ga0307406_10103180
1733 Ga0307406_10193739
1734 Ga0307406_10281779
1735 Ga0307406_10514222
1736 Ga0307407_10002684
1737 Ga0307407_10011104
1738 Ga0307407_10029834
1739 Ga0307407_10050144
1740 Ga0307407_10062053
1741 Ga0307407_10064463
1742 Ga0307407_10067224
1743 Ga0307407_10085218
1744 Ga0307407_10209939
1745 Ga0307412_10002430
1746 Ga0307412_10003973
1747 Ga0307412_10005581
1748 Ga0307412_10009356
1749 Ga0307412_10021302
1750 Ga0307412_10088691
1751 Ga0307412_10106562
1752 Ga0307412_10126645
1753 Ga0307412_10216734
1754 Ga0307412_10272749
1755 Ga0307412_10297259
1756 Ga0307412_10376504
1757 Ga0307409_100010106
1758 Ga0307409_100030703
1759 Ga0307409_100047279
1760 Ga0307409_100053721
1761 Ga0307409_100100309
1762 Ga0307409_100109283
1763 Ga0307409_100156370
1764 Ga0307409_100186386
1765 Ga0307409_100298492
1766 Ga0307409_100429763
1767 Ga0307409_100519111
1768 Ga0307409_100646973
1769 Ga0307409_100708690
1770 Ga0307409_100944018
1771 Ga0307416_100004113
1772 Ga0307416_100006047
1773 Ga0307416_100026184
1774 Ga0307416_100072603
1775 Ga0307416_100224862
1776 Ga0307416_100234242
1777 Ga0307416_100345804
1778 Ga0307416_100439189
1779 Ga0307416_101050668
1780 Ga0307416_101118805
1781 Ga0307414_10002312
1782 Ga0307414_10011801
1783 Ga0307414_10028854
1784 Ga0307414_10050558
1785 Ga0307414_10057244
1786 Ga0307414_10107896
1787 Ga0307414_10110170
1788 Ga0307414_10165989
1789 Ga0307414_10172611
1790 Ga0307414_10196075
1791 Ga0307414_10197792
1792 Ga0307414_10215673
1793 Ga0307414_10234500
1794 Ga0307414_10318887
1795 Ga0307414_10329833
1796 Ga0307414_10393776
1797 Ga0307414_10419583
1798 Ga0307414_10509386
1799 Ga0307411_10002021
1800 Ga0307411_10014118
1801 Ga0307411_10014508
1802 Ga0307411_10025043
1803 Ga0307411_10025664
1804 Ga0307411_10027712
1805 Ga0307411_10044894
1806 Ga0307411_10048557
1807 Ga0307411_10116512
1808 Ga0307411_10194232
1809 Ga0307411_10259244
1810 Ga0307411_10319283
1811 Ga0307411_10369194
1812 Ga0307411_10546365
1813 Ga0307411_10555057
1814 Ga0307411_10617230
1815 Ga0307411_10904753
1816 Ga0307411_11026108
1817 Ga0307415_100004103
1818 Ga0307415_100007815
1819 Ga0307415_100025508
1820 Ga0307415_100048787
1821 Ga0307415_100052963
1822 Ga0307415_100267055
1823 Ga0307415_100331369
1824 Ga0307415_100389566
1825 Ga0307415_100689379
1826 Ga0307510_10016704
1827 Ga0373930_0011487
1828 Ga0373940_0030745
1829 Ga0373931_0012035
1830 Ga0395899_0027780
1831 Ga0395899_0102638
1832 Ga0395899_0103359
1833 Ga0395899_0216410
1834 Ga0395900_0023899
1835 Ga0395900_0039180
1836 Ga0395900_0057645
1837 Ga0395900_0079628
1838 Ga0395900_0160367
1839 Ga0395900_0265770
1840 Ga0395900_1052435
1841 Ga0395898_0013098
1842 Ga0395898_0104052
1843 Ga0395898_0125151
1844 Ga0395898_0141825
1845 Ga0395898_0679852
1846 Ga0395905_0007161
1847 Ga0395905_0009344
1848 Ga0395905_0010965
1849 Ga0395905_0013098
1850 Ga0395905_0037694
1851 Ga0395905_0087947
1852 Ga0395905_0117404
1853 Ga0395905_0153318
1854 Ga0395905_0166669
1855 Ga0395905_0168040
1856 Ga0395905_0259897
1857 Ga0395905_0329726
1858 Ga0395905_0342481
1859 Ga0395905_0482592
1860 Ga0395905_0557119
1861 Ga0436364_0121302
1862 Ga0436364_0589111
1863 Ga0436364_1211536
1864 Ga0395901_0014168
1865 Ga0395901_0014555
1866 Ga0395901_0088632
1867 Ga0395901_0103619
1868 Ga0395901_0251798
1869 Ga0395901_0311493
1870 Ga0395901_0518349
1871 Ga0395901_0703223
1872 Ga0395901_0744225
1873 Ga0395901_0997603
1874 Ga0436365_0462153
1875 Ga0436363_0248894
1876 Ga0439439_0024432
1877 Ga0439461_0020618
1878 Ga0439465_0005807
1879 Ga0439465_0015938
1880 Ga0451841_0395847
1881 Ga0439431_0011022
1882 Ga0439445_0001557
1883 Ga0439445_0013042
1884 Ga0439432_000604
1885 Ga0439432_054175
1886 Ga0439457_003188
1887 Ga0439462_0024284
1888 Ga0450923_027672
1889 Ga0450890_029546
1890 Ga0439446_0021794
1891 Ga0439434_0004412
1892 Ga0466972_0100290
1893 Ga0466973_0216352
1894 Ga0451576_0000023
1895 Ga0466967_0024326
1896 Ga0495617_014419
1897 Ga0495627_000135
1898 Ga0495627_001558
1899 Ga0495627_054758
1900 Ga0495629_0063955
1901 Ga0495638_0000494
1902 Ga0495650_0000370
1903 Ga0495650_0000949
1904 Ga0495650_0046226
1905 Ga0495584_0096366
1906 Ga0495585_0007357
1907 Ga0495596_0018839
1908 Ga0495583_0000599
1909 Ga0495583_0010632
1910 Ga0495583_0049011
1911 Ga0495583_0082768
1912 Ga0495606_0007638
1913 Ga0495610_0001021
1914 Ga0495616_0070033
1915 Ga0495631_0035802
1916 Ga0495631_0054374
1917 Ga0495632_0000042
1918 Ga0495632_0134119
1919 Ga0495637_0026962
1920 Ga0495637_0072070
1921 Ga0495643_0001290
1922 Ga0495643_0011373
1923 Ga0495643_0077672
1924 Ga0495643_0091841
1925 Ga0495643_0123362
1926 Ga0495648_0000069
1927 Ga0495648_0008874
1928 Ga0495663_0000015
1929 Ga0495663_0010615
1930 Ga0495663_0013816
1931 Ga0495663_0078836
1932 Ga0495642_0035685
1933 Ga0495598_0012034
1934 Ga0495621_0002969
1935 Ga0495621_0004588
1936 Ga0495597_0072441
1937 Ga0495633_0000222
1938 Ga0495633_0001836
1939 Ga0495633_0023041
1940 Ga0495668_0000258
1941 Ga0495668_0039514
1942 Ga0495668_0114435
1943 Ga0495611_0042942
1944 Ga0495625_0002466
1945 Ga0495625_0014661
1946 Ga0495625_0044603
1947 Ga0495625_0089099
1948 Ga0495625_0167451
1949 Ga0495625_0240699
1950 Ga0495661_0274765
1951 Ga0495669_0000038
1952 Ga0495669_0003083
1953 Ga0495669_0025929
1954 Ga0495669_0099819
1955 Ga0495669_0241557
1956 Ga0495649_0088005
1957 Ga0495600_0000810
1958 Ga0495660_0165790
1959 Ga0495636_0099636
1960 Ga0495636_0135136
1961 Ga0495683_0002404
1962 Ga0495687_000045
1963 Ga0495687_000089
1964 Ga0495677_0168244
1965 Ga0495685_059253
1966 Ga0495681_0000214
1967 Ga0495681_0019228
1968 Ga0495681_0046060
1969 Ga0495686_0000120
1970 Ga0495686_0032629
1971 Ga0495686_0041072
1972 Ga0495686_0062330
1973 Ga0495686_0121477
1974 Ga0495686_0180570
1975 Ga0495686_0226021
1976 Ga0495615_0097741
1977 Ga0496101_0158126
1978 Ga0496102_0000067
1979 Ga0496102_0028068
1980 Ga0496102_0032743
1981 Ga0496103_0000207
1982 Ga0496103_0143347
1983 Ga0496103_0547267
1984 Ga0496104_0033027
1985 Ga0496105_0024491
1986 Ga0496105_0100461
1987 Ga0496105_0163192
1988 Ga0496106_0159352
1989 Ga0496107_0023801
1990 Ga0496107_0120087
1991 Ga0496107_0134206
1992 Ga0496107_0154011
1993 Ga0496107_0267133
1994 Ga0496107_0463358
1995 Ga0496108_0006067
1996 Ga0496108_0007631
1997 Ga0496108_0366058
1998 Ga0496109_0030175
1999 Ga0496109_0243687
2000 Ga0496109_0442002
2001 Ga0496110_0023986
2002 Ga0496110_0051335
2003 Ga0496110_0056647
2004 Ga0496110_0135478
2005 Ga0496110_0194912
2006 Ga0496111_0022953
2007 Ga0496111_0023502
2008 Ga0496111_0028546
2009 Ga0496111_0033889
2010 Ga0496111_0509169
2011 Ga0496112_0021106
2012 Ga0496112_0570541
2013 Ga0496113_0000705
2014 Ga0496113_0065990
2015 Ga0496115_0000545
2016 Ga0496115_0000988
2017 Ga0496116_0006885
2018 Ga0496116_0126249
2019 Ga0496117_0000114
2020 Ga0496117_0007295
2021 Ga0496117_0278124
2022 Ga0496118_0000082
2023 Ga0496118_0182920
2024 Ga0496119_0005868
2025 Ga0496120_0039633
2026 Ga0496121_0000176
2027 Ga0496121_0000758
2028 Ga0496121_0054911
2029 Ga0496121_0175555
2030 Ga0496122_0003335
2031 Ga0496122_0020364
2032 Ga0496123_0008153
2033 Ga0496123_0095913
2034 Ga0496123_0303066
2035 Ga0496124_0000068
2036 Ga0496124_0000485
2037 Ga0496124_0007723
2038 Ga0496124_0043506
2039 Ga0496124_0150770
2040 Ga0496124_0423920
2041 Ga0496125_0000219
2042 Ga0496125_0074499
2043 Ga0496125_0078881
2044 Ga0496125_0090787
2045 Ga0496126_0000157
2046 Ga0496126_0143995
2047 Ga0501032_0086055
2048 Ga0501033_0328313
2049 Ga0501034_0895489
2050 Ga0501043_0015371
2051 Ga0501047_0002789
2052 Ga0501048_0183562
2053 Ga0501067_0149342
2054 Ga0501068_0266857
2055 Ga0501069_0322599
2056 Ga0501211_000257
2057 Ga0501217_004510
2058 Ga0501223_000015
2059 Ga0501235_000918
2060 Ga0501235_012969
2061 Ga0501239_007460
2062 Ga0501243_026933
2063 Ga0501246_000230
2064 Ga0501249_002428
2065 Ga0501249_013520
2066 Ga0501225_0000069
2067 Ga0501268_001960
2068 Ga0501268_007170
2069 nmdc:mga00v17_180954_c1
2070 nmdc:mga06r32_6152_c1
2071 Ga0500610_0000053
2072 Ga0500643_001510
2073 Ga0500643_029577
2074 Ga0500562_021733
2075 Ga0500595_003686
2076 Ga0500642_0000288
2077 Ga0500658_0000187
2078 Ga0500658_0001123
2079 Ga0500559_0017358
2080 Ga0500573_0000016
2081 Ga0500616_0020321
2082 Ga0500636_0011437
2083 Ga0500645_000008
2084 Ga0500596_008956
2085 Ga0500661_044367
2086 2600202594
2087 2643823539
2088 2753764387
2089 2830076733
2090 2848299154
2091 2879166822
2092 2885431127
2093 2896430894
2094 2919711014
2095 2928027388
2096 2946787711
2097 2984558310
2098 2984567310
2099 2990269172
2100 2993358376
2101 2993694877
2102 8057103463

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

2

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9341 3 224
8cso-assembly1.cif.gz_B crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9322 5 223
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9222 3 224
8cso-assembly5.cif.gz_I crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9213 5 224
3uwq-assembly1.cif.gz_A 1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump) 0.9208 1 224
ID Description Score Start End Superfamily
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9121 5 224 3.20.20.70
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9064 3 224 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9001 5 224 3.20.20.70
3ldvB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8873 1 224 3.20.20.70
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8871 3 224 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3B8XJQ7-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9833 3 101 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7Y2L251-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9808 142 222 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7Y1YAQ0-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.978 149 223 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7X5ZVS7-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9776 3 224 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A1E4JEA8-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9762 1 224 GO:0004590
GO:0005829
GO:0006207
GO:0044205

Map