F489078
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1051 | 350 | 2102 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300016635|Ga0183361_10388|Ga0183361_103883 |
| Length | 273 |
| Sequence | MSPIYVAIDTPDLARAKAIATRTRTHVGGIKLGLEFFCAHGQHGVHEMAKLGLPIFLDLKLHDIPNTVAKAIQALGPLEPAILTVHASGGRAMLEDAKAAAPLNTKVVAVTMLTSLDADDLTATGITGNAHDQVLRLTDLAHEAGIDGIVCSGEEVRAAKTAWPKGFFVVPGVRPANGSAGEVTPLDVASARGWTRGELAFDGRRLDDLLSAMNRYSATQLRLGTPALASLKVSGSFRAGDQEALARALAQGWNLRVERTGAHELTLLPGLTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 193 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 220 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 223 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 224 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 225 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 229 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 230 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 293 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 310 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 311 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 315 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 316 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 319 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 324 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 325 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 326 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 333 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 334 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 335 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 336 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 337 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 338 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 339 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 340 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 341 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 342 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 343 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 344 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 345 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 346 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 347 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 348 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 349 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 350 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98 |
| Metatranscriptomes | 0.38 |
| Isolates | 1.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.48 |
| Bulb | 0 |
| Endosphere | 4.85 |
| Nodule | 0 |
| Rhizoplane | 3.9 |
| Rhizosphere | 86.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0183361_10388 | 3300016635 | Bacteria | 1861 |
| 2 | MBSR1b_contig_9270608 | 2162886012 | Bacteria | 933 |
| 3 | JGI24740J21852_10007532 | 3300001979 | Bacteria | 4415 |
| 4 | JGI24739J22299_10001888 | 3300001989 | Bacteria | 8002 |
| 5 | JGI24739J22299_10011197 | 3300001989 | Bacteria | 3314 |
| 6 | JGI24739J22299_10105797 | 3300001989 | Bacteria | 847 |
| 7 | JGI24737J22298_10011471 | 3300001990 | Bacteria | 2904 |
| 8 | JGI24737J22298_10024773 | 3300001990 | Bacteria | 1899 |
| 9 | JGI24735J21928_10012758 | 3300002067 | Bacteria | 2653 |
| 10 | JGI24750J21931_1000040 | 3300002070 | Bacteria | 17215 |
| 11 | JGI24748J21848_1000053 | 3300002074 | Bacteria | 50665 |
| 12 | JGI24738J21930_10001400 | 3300002075 | Bacteria | 6687 |
| 13 | JGI24738J21930_10006399 | 3300002075 | Bacteria | 2766 |
| 14 | JGI24034J26672_10000036 | 3300002239 | Bacteria | 84333 |
| 15 | JGI24742J22300_10007088 | 3300002244 | Bacteria | 1847 |
| 16 | JGI24742J22300_10020974 | 3300002244 | Bacteria | 1115 |
| 17 | Ga0055525_1000090 | 3300003759 | Bacteria | 141071 |
| 18 | Ga0055542_1000037 | 3300003762 | Bacteria | 225640 |
| 19 | Ga0055529_1000042 | 3300003763 | Bacteria | 225663 |
| 20 | Ga0055529_1000109 | 3300003763 | Bacteria | 121019 |
| 21 | Ga0055537_1001792 | 3300003773 | Bacteria | 7821 |
| 22 | Ga0055524_1000088 | 3300003775 | Bacteria | 116065 |
| 23 | Ga0055536_1007592 | 3300003781 | Bacteria | 4820 |
| 24 | Ga0055534_1013906 | 3300003784 | Bacteria | 1527 |
| 25 | Ga0055530_10000025 | 3300003791 | Bacteria | 130359 |
| 26 | Ga0055530_10000035 | 3300003791 | Bacteria | 117598 |
| 27 | Ga0055531_10000016 | 3300003794 | Bacteria | 181898 |
| 28 | Ga0055531_10004589 | 3300003794 | Bacteria | 8331 |
| 29 | Ga0065165_1007535 | 3300005262 | Bacteria | 5318 |
| 30 | Ga0065165_1018553 | 3300005262 | Bacteria | 2514 |
| 31 | Ga0065715_10113548 | 3300005293 | Bacteria | 2485 |
| 32 | Ga0070658_10000130 | 3300005327 | Bacteria | 66295 |
| 33 | Ga0070658_10000900 | 3300005327 | Bacteria | 25471 |
| 34 | Ga0070658_10002242 | 3300005327 | Bacteria | 16214 |
| 35 | Ga0070658_10009847 | 3300005327 | Bacteria | 7678 |
| 36 | Ga0070658_10024569 | 3300005327 | Bacteria | 4833 |
| 37 | Ga0070658_10036221 | 3300005327 | Bacteria | 3976 |
| 38 | Ga0070658_10265687 | 3300005327 | Bacteria | 1458 |
| 39 | Ga0070658_10487024 | 3300005327 | Bacteria | 1064 |
| 40 | Ga0070658_10554360 | 3300005327 | Bacteria | 995 |
| 41 | Ga0070658_10632852 | 3300005327 | Bacteria | 928 |
| 42 | Ga0070676_10029154 | 3300005328 | Bacteria | 3138 |
| 43 | Ga0070676_10034351 | 3300005328 | Bacteria | 2912 |
| 44 | Ga0070676_10044919 | 3300005328 | Bacteria | 2572 |
| 45 | Ga0070683_100000909 | 3300005329 | Bacteria | 22014 |
| 46 | Ga0070683_100004703 | 3300005329 | Bacteria | 11283 |
| 47 | Ga0070683_100037865 | 3300005329 | Bacteria | 4417 |
| 48 | Ga0070690_100000093 | 3300005330 | Bacteria | 44990 |
| 49 | Ga0070690_100247187 | 3300005330 | Bacteria | 1260 |
| 50 | Ga0070670_100010512 | 3300005331 | Bacteria | 7902 |
| 51 | Ga0070670_100022355 | 3300005331 | Bacteria | 5444 |
| 52 | Ga0070670_100031101 | 3300005331 | Bacteria | 4597 |
| 53 | Ga0070670_100032146 | 3300005331 | Bacteria | 4519 |
| 54 | Ga0070670_100034083 | 3300005331 | Bacteria | 4383 |
| 55 | Ga0070670_100036011 | 3300005331 | Bacteria | 4260 |
| 56 | Ga0070670_100172841 | 3300005331 | Bacteria | 1874 |
| 57 | Ga0070677_10002217 | 3300005333 | Bacteria | 6200 |
| 58 | Ga0070677_10013962 | 3300005333 | Bacteria | 2821 |
| 59 | Ga0068869_100519972 | 3300005334 | Bacteria | 996 |
| 60 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 61 | Ga0070666_10000841 | 3300005335 | Bacteria | 18619 |
| 62 | Ga0070666_10024779 | 3300005335 | Bacteria | 3911 |
| 63 | Ga0070666_10029789 | 3300005335 | Bacteria | 3591 |
| 64 | Ga0070666_10100086 | 3300005335 | Bacteria | 1996 |
| 65 | Ga0070680_100000845 | 3300005336 | Bacteria | 21681 |
| 66 | Ga0070682_100026285 | 3300005337 | Bacteria | 3483 |
| 67 | Ga0070682_100049377 | 3300005337 | Bacteria | 2623 |
| 68 | Ga0068868_100031844 | 3300005338 | Bacteria | 4054 |
| 69 | Ga0068868_100122759 | 3300005338 | Bacteria | 2119 |
| 70 | Ga0070660_100000262 | 3300005339 | Bacteria | 34906 |
| 71 | Ga0070660_100000920 | 3300005339 | Bacteria | 19670 |
| 72 | Ga0070660_100007546 | 3300005339 | Bacteria | 7578 |
| 73 | Ga0070660_100009198 | 3300005339 | Bacteria | 6942 |
| 74 | Ga0070660_100081066 | 3300005339 | Bacteria | 2547 |
| 75 | Ga0070660_100180911 | 3300005339 | Bacteria | 1706 |
| 76 | Ga0070689_100042910 | 3300005340 | Bacteria | 3474 |
| 77 | Ga0070691_10066178 | 3300005341 | Bacteria | 1746 |
| 78 | Ga0070687_100089873 | 3300005343 | Bacteria | 1696 |
| 79 | Ga0070661_100000206 | 3300005344 | Bacteria | 48811 |
| 80 | Ga0070661_100002437 | 3300005344 | Bacteria | 12778 |
| 81 | Ga0070661_100003493 | 3300005344 | Bacteria | 10819 |
| 82 | Ga0070661_100006185 | 3300005344 | Bacteria | 8254 |
| 83 | Ga0070661_100022050 | 3300005344 | Bacteria | 4556 |
| 84 | Ga0070661_100041146 | 3300005344 | Bacteria | 3372 |
| 85 | Ga0070661_100094403 | 3300005344 | Bacteria | 2217 |
| 86 | Ga0070661_100137929 | 3300005344 | Bacteria | 1836 |
| 87 | Ga0070661_100237669 | 3300005344 | Bacteria | 1402 |
| 88 | Ga0070692_10003007 | 3300005345 | Bacteria | 6718 |
| 89 | Ga0070692_10055882 | 3300005345 | Bacteria | 2065 |
| 90 | Ga0070668_100000024 | 3300005347 | Bacteria | 94452 |
| 91 | Ga0070668_100007160 | 3300005347 | Bacteria | 8268 |
| 92 | Ga0070668_100017307 | 3300005347 | Bacteria | 5397 |
| 93 | Ga0070668_100127817 | 3300005347 | Bacteria | 2037 |
| 94 | Ga0070668_100185247 | 3300005347 | Bacteria | 1702 |
| 95 | Ga0070668_100321406 | 3300005347 | Bacteria | 1303 |
| 96 | Ga0070668_100503325 | 3300005347 | Bacteria | 1049 |
| 97 | Ga0070669_100000103 | 3300005353 | Bacteria | 81387 |
| 98 | Ga0070669_100005253 | 3300005353 | Bacteria | 9348 |
| 99 | Ga0070669_100012635 | 3300005353 | Bacteria | 5993 |
| 100 | Ga0070675_100001629 | 3300005354 | Bacteria | 16565 |
| 101 | Ga0070675_100001950 | 3300005354 | Bacteria | 15280 |
| 102 | Ga0070675_100013398 | 3300005354 | Bacteria | 6444 |
| 103 | Ga0070671_100000021 | 3300005355 | Bacteria | 127093 |
| 104 | Ga0070671_100001277 | 3300005355 | Bacteria | 18890 |
| 105 | Ga0070671_100002080 | 3300005355 | Bacteria | 15415 |
| 106 | Ga0070671_100014082 | 3300005355 | Bacteria | 6457 |
| 107 | Ga0070671_100091674 | 3300005355 | Bacteria | 2546 |
| 108 | Ga0070671_100141024 | 3300005355 | Bacteria | 2034 |
| 109 | Ga0070674_100000399 | 3300005356 | Bacteria | 21812 |
| 110 | Ga0070674_100013191 | 3300005356 | Bacteria | 5100 |
| 111 | Ga0070674_100037619 | 3300005356 | Bacteria | 3256 |
| 112 | Ga0070674_100413192 | 3300005356 | Bacteria | 1105 |
| 113 | Ga0070673_100003118 | 3300005364 | Bacteria | 10264 |
| 114 | Ga0070673_100137241 | 3300005364 | Bacteria | 2060 |
| 115 | Ga0070673_100160748 | 3300005364 | Bacteria | 1910 |
| 116 | Ga0070673_100185000 | 3300005364 | Bacteria | 1785 |
| 117 | Ga0070673_100200888 | 3300005364 | Bacteria | 1717 |
| 118 | Ga0070673_100703043 | 3300005364 | Bacteria | 928 |
| 119 | Ga0070688_100103994 | 3300005365 | Bacteria | 1877 |
| 120 | Ga0070659_100000883 | 3300005366 | Bacteria | 21917 |
| 121 | Ga0070659_100023869 | 3300005366 | Bacteria | 4684 |
| 122 | Ga0070659_100046093 | 3300005366 | Bacteria | 3417 |
| 123 | Ga0070659_100090934 | 3300005366 | Bacteria | 2446 |
| 124 | Ga0070659_100107239 | 3300005366 | Bacteria | 2252 |
| 125 | Ga0070659_100166998 | 3300005366 | Bacteria | 1801 |
| 126 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 127 | Ga0070667_100000067 | 3300005367 | Bacteria | 133023 |
| 128 | Ga0070667_100006344 | 3300005367 | Bacteria | 9830 |
| 129 | Ga0070667_100007570 | 3300005367 | Bacteria | 9011 |
| 130 | Ga0070667_100010670 | 3300005367 | Bacteria | 7589 |
| 131 | Ga0070667_100013814 | 3300005367 | Bacteria | 6676 |
| 132 | Ga0070667_100046370 | 3300005367 | Bacteria | 3656 |
| 133 | Ga0070667_100117444 | 3300005367 | Bacteria | 2311 |
| 134 | Ga0070667_100241459 | 3300005367 | Bacteria | 1613 |
| 135 | Ga0070663_100002587 | 3300005455 | Bacteria | 10221 |
| 136 | Ga0070663_100004559 | 3300005455 | Bacteria | 8165 |
| 137 | Ga0070663_100030185 | 3300005455 | Bacteria | 3712 |
| 138 | Ga0070663_100059039 | 3300005455 | Bacteria | 2757 |
| 139 | Ga0070678_100004816 | 3300005456 | Bacteria | 7702 |
| 140 | Ga0070678_100078788 | 3300005456 | Bacteria | 2490 |
| 141 | Ga0070678_100585179 | 3300005456 | Bacteria | 995 |
| 142 | Ga0070662_100000107 | 3300005457 | Bacteria | 46051 |
| 143 | Ga0070662_100002201 | 3300005457 | Bacteria | 11962 |
| 144 | Ga0070662_100004739 | 3300005457 | Bacteria | 8618 |
| 145 | Ga0070662_100025833 | 3300005457 | Bacteria | 4060 |
| 146 | Ga0070662_100077769 | 3300005457 | Bacteria | 2463 |
| 147 | Ga0070662_100081039 | 3300005457 | Bacteria | 2417 |
| 148 | Ga0070662_100404074 | 3300005457 | Bacteria | 1128 |
| 149 | Ga0070662_100746574 | 3300005457 | Bacteria | 830 |
| 150 | Ga0070681_10232066 | 3300005458 | Bacteria | 1760 |
| 151 | Ga0070681_10281615 | 3300005458 | Bacteria | 1573 |
| 152 | Ga0068867_100030848 | 3300005459 | Bacteria | 3867 |
| 153 | Ga0068867_100063135 | 3300005459 | Bacteria | 2753 |
| 154 | Ga0068867_100184443 | 3300005459 | Bacteria | 1661 |
| 155 | Ga0070685_10000076 | 3300005466 | Bacteria | 59090 |
| 156 | Ga0070685_10192999 | 3300005466 | Bacteria | 1319 |
| 157 | Ga0070684_100025416 | 3300005535 | Bacteria | 4978 |
| 158 | Ga0070684_100534137 | 3300005535 | Bacteria | 1087 |
| 159 | Ga0068853_100000172 | 3300005539 | Bacteria | 45090 |
| 160 | Ga0068853_100014481 | 3300005539 | Bacteria | 6460 |
| 161 | Ga0068853_100034278 | 3300005539 | Bacteria | 4309 |
| 162 | Ga0068853_100210874 | 3300005539 | Bacteria | 1770 |
| 163 | Ga0068853_100568520 | 3300005539 | Bacteria | 1075 |
| 164 | Ga0068853_100710606 | 3300005539 | Bacteria | 959 |
| 165 | Ga0070672_100002032 | 3300005543 | Bacteria | 12729 |
| 166 | Ga0070672_100009625 | 3300005543 | Bacteria | 6669 |
| 167 | Ga0070672_100167242 | 3300005543 | Bacteria | 1827 |
| 168 | Ga0070672_100987255 | 3300005543 | Bacteria | 746 |
| 169 | Ga0070686_100000018 | 3300005544 | Bacteria | 140685 |
| 170 | Ga0070686_100000338 | 3300005544 | Bacteria | 30239 |
| 171 | Ga0070696_100006864 | 3300005546 | Bacteria | 7597 |
| 172 | Ga0070696_100186978 | 3300005546 | Bacteria | 1540 |
| 173 | Ga0070693_100000773 | 3300005547 | Bacteria | 14093 |
| 174 | Ga0070693_100018727 | 3300005547 | Bacteria | 3621 |
| 175 | Ga0070693_100109294 | 3300005547 | Bacteria | 1698 |
| 176 | Ga0070665_100000071 | 3300005548 | Bacteria | 200675 |
| 177 | Ga0070665_100000535 | 3300005548 | Bacteria | 53560 |
| 178 | Ga0070665_100001716 | 3300005548 | Bacteria | 25115 |
| 179 | Ga0070665_100040003 | 3300005548 | Bacteria | 4714 |
| 180 | Ga0070665_100190843 | 3300005548 | Bacteria | 2050 |
| 181 | Ga0068855_100000353 | 3300005563 | Bacteria | 56776 |
| 182 | Ga0068855_100002937 | 3300005563 | Bacteria | 20836 |
| 183 | Ga0068855_100044728 | 3300005563 | Bacteria | 5239 |
| 184 | Ga0068855_100070358 | 3300005563 | Bacteria | 4070 |
| 185 | Ga0068855_100142423 | 3300005563 | Bacteria | 2731 |
| 186 | Ga0068855_100223913 | 3300005563 | Bacteria | 2108 |
| 187 | Ga0068855_100476346 | 3300005563 | Bacteria | 1359 |
| 188 | Ga0070664_100001030 | 3300005564 | Bacteria | 21904 |
| 189 | Ga0070664_100002325 | 3300005564 | Bacteria | 15268 |
| 190 | Ga0070664_100036792 | 3300005564 | Bacteria | 4112 |
| 191 | Ga0070664_100054610 | 3300005564 | Bacteria | 3389 |
| 192 | Ga0070664_100150353 | 3300005564 | Bacteria | 2055 |
| 193 | Ga0070664_100217544 | 3300005564 | Bacteria | 1708 |
| 194 | Ga0068857_100048552 | 3300005577 | Bacteria | 3768 |
| 195 | Ga0068857_100058927 | 3300005577 | Bacteria | 3410 |
| 196 | Ga0068857_100085132 | 3300005577 | Bacteria | 2825 |
| 197 | Ga0068857_100128661 | 3300005577 | Bacteria | 2283 |
| 198 | Ga0068857_100148009 | 3300005577 | Bacteria | 2126 |
| 199 | Ga0068857_100183492 | 3300005577 | Bacteria | 1904 |
| 200 | Ga0068854_100006682 | 3300005578 | Bacteria | 7352 |
| 201 | Ga0068854_100007103 | 3300005578 | Bacteria | 7149 |
| 202 | Ga0068854_100017720 | 3300005578 | Bacteria | 4770 |
| 203 | Ga0068854_100019474 | 3300005578 | Bacteria | 4574 |
| 204 | Ga0068854_100097573 | 3300005578 | Bacteria | 2197 |
| 205 | Ga0068854_100361375 | 3300005578 | Bacteria | 1191 |
| 206 | Ga0068856_100000364 | 3300005614 | Bacteria | 49715 |
| 207 | Ga0068856_100023360 | 3300005614 | Bacteria | 6011 |
| 208 | Ga0068856_100029387 | 3300005614 | Bacteria | 5369 |
| 209 | Ga0068856_100413572 | 3300005614 | Bacteria | 1369 |
| 210 | Ga0068852_100002792 | 3300005616 | Bacteria | 12100 |
| 211 | Ga0068852_100106625 | 3300005616 | Bacteria | 2540 |
| 212 | Ga0068852_100333537 | 3300005616 | Bacteria | 1476 |
| 213 | Ga0068852_100899897 | 3300005616 | Bacteria | 902 |
| 214 | Ga0068859_100008763 | 3300005617 | Bacteria | 10215 |
| 215 | Ga0068859_100015868 | 3300005617 | Bacteria | 7569 |
| 216 | Ga0068859_100037843 | 3300005617 | Bacteria | 4842 |
| 217 | Ga0068859_100039235 | 3300005617 | Bacteria | 4750 |
| 218 | Ga0068859_100048958 | 3300005617 | Bacteria | 4245 |
| 219 | Ga0068859_100175138 | 3300005617 | Bacteria | 2227 |
| 220 | Ga0068859_100806907 | 3300005617 | Bacteria | 1026 |
| 221 | Ga0068859_100871614 | 3300005617 | Bacteria | 986 |
| 222 | Ga0068864_100005184 | 3300005618 | Bacteria | 10673 |
| 223 | Ga0068864_100010361 | 3300005618 | Bacteria | 7699 |
| 224 | Ga0068864_100014914 | 3300005618 | Bacteria | 6456 |
| 225 | Ga0068864_100027563 | 3300005618 | Bacteria | 4799 |
| 226 | Ga0068864_100144106 | 3300005618 | Bacteria | 2152 |
| 227 | Ga0068864_100241615 | 3300005618 | Bacteria | 1673 |
| 228 | Ga0068861_100003501 | 3300005719 | Bacteria | 10427 |
| 229 | Ga0068861_100007076 | 3300005719 | Bacteria | 7676 |
| 230 | Ga0068851_10007809 | 3300005834 | Bacteria | 4925 |
| 231 | Ga0068851_10009438 | 3300005834 | Bacteria | 4537 |
| 232 | Ga0068851_10019346 | 3300005834 | Bacteria | 3290 |
| 233 | Ga0068851_10021307 | 3300005834 | Bacteria | 3147 |
| 234 | Ga0068851_10025374 | 3300005834 | Bacteria | 2907 |
| 235 | Ga0068851_10049352 | 3300005834 | Bacteria | 2134 |
| 236 | Ga0068851_10053891 | 3300005834 | Bacteria | 2048 |
| 237 | Ga0068870_10141042 | 3300005840 | Bacteria | 1410 |
| 238 | Ga0068870_10405295 | 3300005840 | Bacteria | 888 |
| 239 | Ga0068863_100000038 | 3300005841 | Bacteria | 161477 |
| 240 | Ga0068863_100000323 | 3300005841 | Bacteria | 48685 |
| 241 | Ga0068863_100005444 | 3300005841 | Bacteria | 12541 |
| 242 | Ga0068863_100015715 | 3300005841 | Bacteria | 7268 |
| 243 | Ga0068863_100807437 | 3300005841 | Bacteria | 936 |
| 244 | Ga0068858_100000273 | 3300005842 | Bacteria | 55482 |
| 245 | Ga0068858_100001634 | 3300005842 | Bacteria | 22875 |
| 246 | Ga0068858_100002083 | 3300005842 | Bacteria | 20331 |
| 247 | Ga0068858_100002738 | 3300005842 | Bacteria | 17727 |
| 248 | Ga0068858_100028846 | 3300005842 | Bacteria | 5153 |
| 249 | Ga0068858_100070318 | 3300005842 | Bacteria | 3244 |
| 250 | Ga0068858_100735640 | 3300005842 | Bacteria | 961 |
| 251 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 252 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 253 | Ga0068860_100120599 | 3300005843 | Bacteria | 2511 |
| 254 | Ga0068860_100330140 | 3300005843 | Bacteria | 1498 |
| 255 | Ga0068860_100563547 | 3300005843 | Bacteria | 1142 |
| 256 | Ga0068862_100000602 | 3300005844 | Bacteria | 37405 |
| 257 | Ga0068862_100003209 | 3300005844 | Bacteria | 14172 |
| 258 | Ga0068862_100053506 | 3300005844 | Bacteria | 3456 |
| 259 | Ga0068862_100055854 | 3300005844 | Bacteria | 3383 |
| 260 | Ga0068862_100069724 | 3300005844 | Bacteria | 3035 |
| 261 | Ga0068862_100129742 | 3300005844 | Bacteria | 2229 |
| 262 | Ga0068862_100205502 | 3300005844 | Bacteria | 1777 |
| 263 | Ga0081455_10000088 | 3300005937 | Bacteria | 98815 |
| 264 | Ga0081539_10013221 | 3300005985 | Bacteria | 6243 |
| 265 | Ga0081539_10040482 | 3300005985 | Bacteria | 2734 |
| 266 | Ga0075364_10100936 | 3300006051 | Bacteria | 1921 |
| 267 | Ga0097621_100122269 | 3300006237 | Bacteria | 2209 |
| 268 | Ga0097621_100233582 | 3300006237 | Bacteria | 1606 |
| 269 | Ga0068871_100034831 | 3300006358 | Bacteria | 3997 |
| 270 | Ga0068871_100277443 | 3300006358 | Bacteria | 1465 |
| 271 | Ga0075431_100890910 | 3300006847 | Bacteria | 860 |
| 272 | Ga0097620_100008763 | 3300006931 | Bacteria | 10215 |
| 273 | Ga0097620_100015868 | 3300006931 | Bacteria | 7569 |
| 274 | Ga0097620_100037844 | 3300006931 | Bacteria | 4842 |
| 275 | Ga0097620_100039234 | 3300006931 | Bacteria | 4750 |
| 276 | Ga0097620_100048958 | 3300006931 | Bacteria | 4245 |
| 277 | Ga0097620_100175133 | 3300006931 | Bacteria | 2227 |
| 278 | Ga0097620_100806888 | 3300006931 | Bacteria | 1026 |
| 279 | Ga0097620_100871506 | 3300006931 | Bacteria | 986 |
| 280 | Ga0105250_10094929 | 3300009092 | Bacteria | 1215 |
| 281 | Ga0105240_10023904 | 3300009093 | Bacteria | 8071 |
| 282 | Ga0105245_10012230 | 3300009098 | Bacteria | 7467 |
| 283 | Ga0105247_10081996 | 3300009101 | Bacteria | 2035 |
| 284 | Ga0105243_10000189 | 3300009148 | Bacteria | 71593 |
| 285 | Ga0105243_10090604 | 3300009148 | Bacteria | 2517 |
| 286 | Ga0105243_10286735 | 3300009148 | Bacteria | 1486 |
| 287 | Ga0105241_10007791 | 3300009174 | Bacteria | 7876 |
| 288 | Ga0105241_10185502 | 3300009174 | Bacteria | 1728 |
| 289 | Ga0105248_10000238 | 3300009177 | Bacteria | 63658 |
| 290 | Ga0105248_10005888 | 3300009177 | Bacteria | 13475 |
| 291 | Ga0105248_10040846 | 3300009177 | Bacteria | 5200 |
| 292 | Ga0105248_10099746 | 3300009177 | Bacteria | 3272 |
| 293 | Ga0105248_10148887 | 3300009177 | Bacteria | 2641 |
| 294 | Ga0105248_10177059 | 3300009177 | Bacteria | 2403 |
| 295 | Ga0105237_10033081 | 3300009545 | Bacteria | 5237 |
| 296 | Ga0105237_10114209 | 3300009545 | Bacteria | 2693 |
| 297 | Ga0105237_10168815 | 3300009545 | Bacteria | 2187 |
| 298 | Ga0105238_10052224 | 3300009551 | Bacteria | 4109 |
| 299 | Ga0105238_10121827 | 3300009551 | Bacteria | 2587 |
| 300 | Ga0105238_10167439 | 3300009551 | Bacteria | 2173 |
| 301 | Ga0105238_10183425 | 3300009551 | Bacteria | 2069 |
| 302 | Ga0105238_10495371 | 3300009551 | Bacteria | 1222 |
| 303 | Ga0105238_10850609 | 3300009551 | Bacteria | 929 |
| 304 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 305 | Ga0105249_10030951 | 3300009553 | Bacteria | 4838 |
| 306 | Ga0105239_10308172 | 3300010375 | Bacteria | 1784 |
| 307 | Ga0157326_1007113 | 3300012513 | Bacteria | 1205 |
| 308 | Ga0157373_10010055 | 3300013100 | Bacteria | 6971 |
| 309 | Ga0157373_10012668 | 3300013100 | Bacteria | 6201 |
| 310 | Ga0157373_10127981 | 3300013100 | Bacteria | 1786 |
| 311 | Ga0157373_10171284 | 3300013100 | Bacteria | 1527 |
| 312 | Ga0157371_10002630 | 3300013102 | Bacteria | 17029 |
| 313 | Ga0157371_10003977 | 3300013102 | Bacteria | 13103 |
| 314 | Ga0157371_10053767 | 3300013102 | Bacteria | 2860 |
| 315 | Ga0157371_10055425 | 3300013102 | Bacteria | 2813 |
| 316 | Ga0157371_10150757 | 3300013102 | Bacteria | 1658 |
| 317 | Ga0157370_10026506 | 3300013104 | Bacteria | 5722 |
| 318 | Ga0157370_10026732 | 3300013104 | Bacteria | 5693 |
| 319 | Ga0157370_10051979 | 3300013104 | Bacteria | 3913 |
| 320 | Ga0157370_10310099 | 3300013104 | Bacteria | 1456 |
| 321 | Ga0157370_10545842 | 3300013104 | Bacteria | 1063 |
| 322 | Ga0157369_10001687 | 3300013105 | Bacteria | 26951 |
| 323 | Ga0157369_10214909 | 3300013105 | Bacteria | 2014 |
| 324 | Ga0157374_10021678 | 3300013296 | Bacteria | 5721 |
| 325 | Ga0157374_10031141 | 3300013296 | Bacteria | 4846 |
| 326 | Ga0157374_10108439 | 3300013296 | Bacteria | 2669 |
| 327 | Ga0157378_10114034 | 3300013297 | Bacteria | 2482 |
| 328 | Ga0157378_10297873 | 3300013297 | Bacteria | 1560 |
| 329 | Ga0157378_10556164 | 3300013297 | Bacteria | 1153 |
| 330 | Ga0163162_10467934 | 3300013306 | Bacteria | 1392 |
| 331 | Ga0157372_10019954 | 3300013307 | Bacteria | 7225 |
| 332 | Ga0157372_10109565 | 3300013307 | Bacteria | 3162 |
| 333 | Ga0157372_10273467 | 3300013307 | Bacteria | 1963 |
| 334 | Ga0157372_11027802 | 3300013307 | Bacteria | 954 |
| 335 | Ga0157375_10000628 | 3300013308 | Bacteria | 31364 |
| 336 | Ga0157375_10119697 | 3300013308 | Bacteria | 2741 |
| 337 | Ga0157375_10269701 | 3300013308 | Bacteria | 1864 |
| 338 | Ga0157514_103401 | 3300013874 | Bacteria | 764 |
| 339 | Ga0163163_10000543 | 3300014325 | Bacteria | 33382 |
| 340 | Ga0163163_10087718 | 3300014325 | Bacteria | 3122 |
| 341 | Ga0163163_10103156 | 3300014325 | Bacteria | 2876 |
| 342 | Ga0163163_10350471 | 3300014325 | Bacteria | 1532 |
| 343 | Ga0157380_10001003 | 3300014326 | Bacteria | 17954 |
| 344 | Ga0157380_10008537 | 3300014326 | Bacteria | 7321 |
| 345 | Ga0157380_10014580 | 3300014326 | Bacteria | 5755 |
| 346 | Ga0157380_10801091 | 3300014326 | Bacteria | 959 |
| 347 | Ga0182008_10021234 | 3300014497 | Bacteria | 3336 |
| 348 | Ga0157377_10253359 | 3300014745 | Bacteria | 1142 |
| 349 | Ga0157379_10006699 | 3300014968 | Bacteria | 9950 |
| 350 | Ga0157379_10122031 | 3300014968 | Bacteria | 2344 |
| 351 | Ga0157379_10403823 | 3300014968 | Bacteria | 1256 |
| 352 | Ga0157379_10579306 | 3300014968 | Bacteria | 1046 |
| 353 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 354 | Ga0163161_10000186 | 3300017792 | Bacteria | 57200 |
| 355 | Ga0163161_10102221 | 3300017792 | Bacteria | 2134 |
| 356 | Ga0163161_10218475 | 3300017792 | Bacteria | 1475 |
| 357 | Ga0197907_11157279 | 3300020069 | Bacteria | 1211 |
| 358 | Ga0206354_11427625 | 3300020081 | Bacteria | 719 |
| 359 | Ga0206353_10171510 | 3300020082 | Bacteria | 1152 |
| 360 | Ga0206353_10359237 | 3300020082 | Bacteria | 10066 |
| 361 | Ga0213875_10000135 | 3300021388 | Bacteria | 82147 |
| 362 | Ga0207672_1001640 | 3300025223 | Bacteria | 1593 |
| 363 | Ga0209147_100356 | 3300025229 | Bacteria | 32955 |
| 364 | Ga0209563_100111 | 3300025230 | Bacteria | 141123 |
| 365 | Ga0207425_1001404 | 3300025245 | Bacteria | 10133 |
| 366 | Ga0209646_1007013 | 3300025246 | Bacteria | 1864 |
| 367 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 368 | Ga0209233_1000154 | 3300025261 | Bacteria | 169616 |
| 369 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 370 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 371 | Ga0209455_1005809 | 3300025272 | Bacteria | 3743 |
| 372 | Ga0209673_1009048 | 3300025273 | Bacteria | 4361 |
| 373 | Ga0209675_1000076 | 3300025291 | Bacteria | 159428 |
| 374 | Ga0209676_1001366 | 3300025292 | Bacteria | 23983 |
| 375 | Ga0209025_1011886 | 3300025294 | Bacteria | 5666 |
| 376 | Ga0209758_1005853 | 3300025297 | Bacteria | 9179 |
| 377 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 378 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 379 | Ga0209050_1006998 | 3300025298 | Bacteria | 6488 |
| 380 | Ga0209256_1000034 | 3300025299 | Bacteria | 388475 |
| 381 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 382 | Ga0209257_1001581 | 3300025304 | Bacteria | 26237 |
| 383 | Ga0209257_1002892 | 3300025304 | Bacteria | 15945 |
| 384 | Ga0207697_10001097 | 3300025315 | Bacteria | 14929 |
| 385 | Ga0207697_10022784 | 3300025315 | Bacteria | 2565 |
| 386 | Ga0207656_10008288 | 3300025321 | Bacteria | 3818 |
| 387 | Ga0207656_10019810 | 3300025321 | Bacteria | 2664 |
| 388 | Ga0207656_10020644 | 3300025321 | Bacteria | 2621 |
| 389 | Ga0207656_10021992 | 3300025321 | Bacteria | 2554 |
| 390 | Ga0207656_10024035 | 3300025321 | Bacteria | 2460 |
| 391 | Ga0207656_10060602 | 3300025321 | Bacteria | 1659 |
| 392 | Ga0207656_10224129 | 3300025321 | Bacteria | 914 |
| 393 | Ga0207696_1091820 | 3300025711 | Bacteria | 832 |
| 394 | Ga0207713_1070306 | 3300025735 | Bacteria | 1294 |
| 395 | Ga0207682_10000194 | 3300025893 | Bacteria | 27727 |
| 396 | Ga0207682_10002083 | 3300025893 | Bacteria | 9053 |
| 397 | Ga0207710_10044147 | 3300025900 | Bacteria | 1984 |
| 398 | Ga0207688_10060473 | 3300025901 | Bacteria | 2134 |
| 399 | Ga0207688_10172111 | 3300025901 | Bacteria | 1288 |
| 400 | Ga0207688_10201185 | 3300025901 | Bacteria | 1194 |
| 401 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 402 | Ga0207680_10024818 | 3300025903 | Bacteria | 3296 |
| 403 | Ga0207680_10076175 | 3300025903 | Bacteria | 2094 |
| 404 | Ga0207680_10164108 | 3300025903 | Bacteria | 1492 |
| 405 | Ga0207647_10000331 | 3300025904 | Bacteria | 38861 |
| 406 | Ga0207647_10000910 | 3300025904 | Bacteria | 22876 |
| 407 | Ga0207647_10026357 | 3300025904 | Bacteria | 3804 |
| 408 | Ga0207647_10029798 | 3300025904 | Bacteria | 3526 |
| 409 | Ga0207647_10052077 | 3300025904 | Bacteria | 2528 |
| 410 | Ga0207647_10123956 | 3300025904 | Bacteria | 1522 |
| 411 | Ga0207645_10017693 | 3300025907 | Bacteria | 4700 |
| 412 | Ga0207645_10028598 | 3300025907 | Bacteria | 3597 |
| 413 | Ga0207645_10103563 | 3300025907 | Bacteria | 1838 |
| 414 | Ga0207645_10125767 | 3300025907 | Bacteria | 1666 |
| 415 | Ga0207705_10000371 | 3300025909 | Bacteria | 40611 |
| 416 | Ga0207705_10000574 | 3300025909 | Bacteria | 30782 |
| 417 | Ga0207705_10003366 | 3300025909 | Bacteria | 12152 |
| 418 | Ga0207705_10005390 | 3300025909 | Bacteria | 9567 |
| 419 | Ga0207705_10011112 | 3300025909 | Bacteria | 6529 |
| 420 | Ga0207705_10011202 | 3300025909 | Bacteria | 6500 |
| 421 | Ga0207705_10016709 | 3300025909 | Bacteria | 5254 |
| 422 | Ga0207705_10027000 | 3300025909 | Bacteria | 4092 |
| 423 | Ga0207705_10072700 | 3300025909 | Bacteria | 2495 |
| 424 | Ga0207705_10431785 | 3300025909 | Bacteria | 1020 |
| 425 | Ga0207705_10574330 | 3300025909 | Bacteria | 876 |
| 426 | Ga0207654_10000535 | 3300025911 | Bacteria | 21712 |
| 427 | Ga0207654_10003712 | 3300025911 | Bacteria | 7705 |
| 428 | Ga0207654_10214010 | 3300025911 | Bacteria | 1275 |
| 429 | Ga0207707_10300612 | 3300025912 | Bacteria | 1388 |
| 430 | Ga0207695_10001498 | 3300025913 | Bacteria | 38870 |
| 431 | Ga0207695_10035150 | 3300025913 | Bacteria | 5439 |
| 432 | Ga0207671_10000350 | 3300025914 | Bacteria | 66648 |
| 433 | Ga0207671_10058972 | 3300025914 | Bacteria | 2846 |
| 434 | Ga0207671_10147925 | 3300025914 | Bacteria | 1813 |
| 435 | Ga0207660_10147610 | 3300025917 | Bacteria | 1804 |
| 436 | Ga0207657_10000643 | 3300025919 | Bacteria | 37091 |
| 437 | Ga0207657_10000812 | 3300025919 | Bacteria | 32998 |
| 438 | Ga0207657_10000863 | 3300025919 | Bacteria | 31953 |
| 439 | Ga0207657_10002760 | 3300025919 | Bacteria | 18909 |
| 440 | Ga0207657_10011178 | 3300025919 | Bacteria | 8925 |
| 441 | Ga0207657_10024384 | 3300025919 | Bacteria | 5603 |
| 442 | Ga0207649_10000362 | 3300025920 | Bacteria | 34070 |
| 443 | Ga0207649_10000616 | 3300025920 | Bacteria | 24069 |
| 444 | Ga0207649_10075022 | 3300025920 | Bacteria | 2172 |
| 445 | Ga0207649_10358290 | 3300025920 | Bacteria | 1081 |
| 446 | Ga0207652_10492762 | 3300025921 | Bacteria | 1103 |
| 447 | Ga0207681_10000350 | 3300025923 | Bacteria | 33064 |
| 448 | Ga0207681_10021734 | 3300025923 | Bacteria | 4083 |
| 449 | Ga0207681_10024615 | 3300025923 | Bacteria | 3864 |
| 450 | Ga0207681_10339766 | 3300025923 | Bacteria | 1199 |
| 451 | Ga0207694_10000447 | 3300025924 | Bacteria | 38252 |
| 452 | Ga0207694_10005672 | 3300025924 | Bacteria | 9577 |
| 453 | Ga0207694_10016303 | 3300025924 | Bacteria | 5608 |
| 454 | Ga0207694_10040182 | 3300025924 | Bacteria | 3601 |
| 455 | Ga0207694_10203459 | 3300025924 | Bacteria | 1611 |
| 456 | Ga0207650_10001426 | 3300025925 | Bacteria | 17233 |
| 457 | Ga0207650_10004509 | 3300025925 | Bacteria | 9523 |
| 458 | Ga0207650_10008489 | 3300025925 | Bacteria | 7013 |
| 459 | Ga0207650_10033119 | 3300025925 | Bacteria | 3740 |
| 460 | Ga0207650_10039258 | 3300025925 | Bacteria | 3460 |
| 461 | Ga0207650_10039837 | 3300025925 | Bacteria | 3435 |
| 462 | Ga0207650_10070980 | 3300025925 | Bacteria | 2619 |
| 463 | Ga0207650_10103465 | 3300025925 | Bacteria | 2196 |
| 464 | Ga0207650_10133882 | 3300025925 | Bacteria | 1942 |
| 465 | Ga0207650_10135172 | 3300025925 | Bacteria | 1933 |
| 466 | Ga0207650_10375769 | 3300025925 | Bacteria | 1173 |
| 467 | Ga0207659_10002145 | 3300025926 | Bacteria | 11711 |
| 468 | Ga0207659_10010381 | 3300025926 | Bacteria | 5853 |
| 469 | Ga0207659_10012707 | 3300025926 | Bacteria | 5371 |
| 470 | Ga0207659_10040896 | 3300025926 | Bacteria | 3245 |
| 471 | Ga0207659_10275058 | 3300025926 | Bacteria | 1375 |
| 472 | Ga0207659_10554699 | 3300025926 | Bacteria | 977 |
| 473 | Ga0207687_10079352 | 3300025927 | Bacteria | 2366 |
| 474 | Ga0207644_10000054 | 3300025931 | Bacteria | 86116 |
| 475 | Ga0207644_10009169 | 3300025931 | Bacteria | 6488 |
| 476 | Ga0207644_10013046 | 3300025931 | Bacteria | 5531 |
| 477 | Ga0207644_10014265 | 3300025931 | Bacteria | 5314 |
| 478 | Ga0207644_10023854 | 3300025931 | Bacteria | 4195 |
| 479 | Ga0207644_10027350 | 3300025931 | Bacteria | 3939 |
| 480 | Ga0207644_10085888 | 3300025931 | Bacteria | 2335 |
| 481 | Ga0207644_10430254 | 3300025931 | Bacteria | 1082 |
| 482 | Ga0207690_10000062 | 3300025932 | Bacteria | 96511 |
| 483 | Ga0207690_10004520 | 3300025932 | Bacteria | 8221 |
| 484 | Ga0207690_10011926 | 3300025932 | Bacteria | 5197 |
| 485 | Ga0207690_10165436 | 3300025932 | Bacteria | 1653 |
| 486 | Ga0207690_10172850 | 3300025932 | Bacteria | 1620 |
| 487 | Ga0207690_10181450 | 3300025932 | Bacteria | 1585 |
| 488 | Ga0207690_10311300 | 3300025932 | Bacteria | 1235 |
| 489 | Ga0207706_10000211 | 3300025933 | Bacteria | 63984 |
| 490 | Ga0207706_10000842 | 3300025933 | Bacteria | 31703 |
| 491 | Ga0207706_10002689 | 3300025933 | Bacteria | 17328 |
| 492 | Ga0207706_10012861 | 3300025933 | Bacteria | 7617 |
| 493 | Ga0207706_10020765 | 3300025933 | Bacteria | 5900 |
| 494 | Ga0207706_10021856 | 3300025933 | Bacteria | 5743 |
| 495 | Ga0207706_10025533 | 3300025933 | Bacteria | 5292 |
| 496 | Ga0207706_10113738 | 3300025933 | Bacteria | 2380 |
| 497 | Ga0207706_10127556 | 3300025933 | Bacteria | 2237 |
| 498 | Ga0207709_10001974 | 3300025935 | Bacteria | 13395 |
| 499 | Ga0207709_10796070 | 3300025935 | Bacteria | 763 |
| 500 | Ga0207670_10003472 | 3300025936 | Bacteria | 8361 |
| 501 | Ga0207669_10000146 | 3300025937 | Bacteria | 34125 |
| 502 | Ga0207669_10002460 | 3300025937 | Bacteria | 7902 |
| 503 | Ga0207669_10008651 | 3300025937 | Bacteria | 4792 |
| 504 | Ga0207669_10053271 | 3300025937 | Bacteria | 2436 |
| 505 | Ga0207691_10001025 | 3300025940 | Bacteria | 27647 |
| 506 | Ga0207691_10001329 | 3300025940 | Bacteria | 24679 |
| 507 | Ga0207691_10021857 | 3300025940 | Bacteria | 6038 |
| 508 | Ga0207691_10043703 | 3300025940 | Bacteria | 4128 |
| 509 | Ga0207691_10295940 | 3300025940 | Bacteria | 1391 |
| 510 | Ga0207691_10334618 | 3300025940 | Bacteria | 1297 |
| 511 | Ga0207711_10001768 | 3300025941 | Bacteria | 19796 |
| 512 | Ga0207711_10004434 | 3300025941 | Bacteria | 11963 |
| 513 | Ga0207711_10015580 | 3300025941 | Bacteria | 6310 |
| 514 | Ga0207711_10016865 | 3300025941 | Bacteria | 6066 |
| 515 | Ga0207711_10021214 | 3300025941 | Bacteria | 5425 |
| 516 | Ga0207689_10676791 | 3300025942 | Bacteria | 870 |
| 517 | Ga0207661_10003356 | 3300025944 | Bacteria | 11115 |
| 518 | Ga0207661_10027159 | 3300025944 | Bacteria | 4370 |
| 519 | Ga0207661_10163530 | 3300025944 | Bacteria | 1932 |
| 520 | Ga0207679_10002801 | 3300025945 | Bacteria | 10808 |
| 521 | Ga0207679_10018962 | 3300025945 | Bacteria | 4616 |
| 522 | Ga0207679_10046229 | 3300025945 | Bacteria | 3154 |
| 523 | Ga0207679_10523774 | 3300025945 | Bacteria | 1060 |
| 524 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 525 | Ga0207667_10000237 | 3300025949 | Bacteria | 77017 |
| 526 | Ga0207667_10007822 | 3300025949 | Bacteria | 12775 |
| 527 | Ga0207667_10012966 | 3300025949 | Bacteria | 9570 |
| 528 | Ga0207667_10013405 | 3300025949 | Bacteria | 9379 |
| 529 | Ga0207667_10088032 | 3300025949 | Bacteria | 3212 |
| 530 | Ga0207667_10167386 | 3300025949 | Bacteria | 2259 |
| 531 | Ga0207667_10177609 | 3300025949 | Bacteria | 2187 |
| 532 | Ga0207667_10229948 | 3300025949 | Bacteria | 1899 |
| 533 | Ga0207651_10011320 | 3300025960 | Bacteria | 4990 |
| 534 | Ga0207651_10124320 | 3300025960 | Bacteria | 1963 |
| 535 | Ga0207651_10151913 | 3300025960 | Bacteria | 1804 |
| 536 | Ga0207651_10190822 | 3300025960 | Bacteria | 1634 |
| 537 | Ga0207651_10247865 | 3300025960 | Bacteria | 1455 |
| 538 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 539 | Ga0207712_10140329 | 3300025961 | Bacteria | 1853 |
| 540 | Ga0207668_10000396 | 3300025972 | Bacteria | 27513 |
| 541 | Ga0207668_10002501 | 3300025972 | Bacteria | 10730 |
| 542 | Ga0207668_10012476 | 3300025972 | Bacteria | 5202 |
| 543 | Ga0207668_10028544 | 3300025972 | Bacteria | 3649 |
| 544 | Ga0207668_10048393 | 3300025972 | Bacteria | 2918 |
| 545 | Ga0207668_10137860 | 3300025972 | Bacteria | 1872 |
| 546 | Ga0207668_10611988 | 3300025972 | Bacteria | 950 |
| 547 | Ga0207640_10001641 | 3300025981 | Bacteria | 11988 |
| 548 | Ga0207640_10004927 | 3300025981 | Bacteria | 7253 |
| 549 | Ga0207640_10006739 | 3300025981 | Bacteria | 6316 |
| 550 | Ga0207640_10006892 | 3300025981 | Bacteria | 6248 |
| 551 | Ga0207640_10033042 | 3300025981 | Bacteria | 3214 |
| 552 | Ga0207640_10387118 | 3300025981 | Bacteria | 1135 |
| 553 | Ga0207658_10000009 | 3300025986 | Bacteria | 264118 |
| 554 | Ga0207658_10000089 | 3300025986 | Bacteria | 100308 |
| 555 | Ga0207658_10000260 | 3300025986 | Bacteria | 55292 |
| 556 | Ga0207658_10004234 | 3300025986 | Bacteria | 9995 |
| 557 | Ga0207658_10014864 | 3300025986 | Bacteria | 5333 |
| 558 | Ga0207658_10018905 | 3300025986 | Bacteria | 4765 |
| 559 | Ga0207658_10026183 | 3300025986 | Bacteria | 4087 |
| 560 | Ga0207658_10054241 | 3300025986 | Bacteria | 2965 |
| 561 | Ga0207658_10632501 | 3300025986 | Bacteria | 963 |
| 562 | Ga0207677_10099806 | 3300026023 | Bacteria | 2133 |
| 563 | Ga0207703_10000782 | 3300026035 | Bacteria | 31303 |
| 564 | Ga0207703_10001276 | 3300026035 | Bacteria | 23365 |
| 565 | Ga0207703_10016040 | 3300026035 | Bacteria | 5843 |
| 566 | Ga0207703_10056022 | 3300026035 | Bacteria | 3209 |
| 567 | Ga0207703_10057934 | 3300026035 | Bacteria | 3160 |
| 568 | Ga0207703_10316193 | 3300026035 | Bacteria | 1429 |
| 569 | Ga0207703_10391174 | 3300026035 | Bacteria | 1288 |
| 570 | Ga0207639_10000991 | 3300026041 | Bacteria | 19346 |
| 571 | Ga0207639_10005330 | 3300026041 | Bacteria | 8685 |
| 572 | Ga0207639_10038615 | 3300026041 | Bacteria | 3552 |
| 573 | Ga0207639_10520120 | 3300026041 | Bacteria | 1090 |
| 574 | Ga0207639_10564668 | 3300026041 | Bacteria | 1046 |
| 575 | Ga0207678_10001933 | 3300026067 | Bacteria | 18903 |
| 576 | Ga0207678_10002497 | 3300026067 | Bacteria | 16733 |
| 577 | Ga0207678_10003065 | 3300026067 | Bacteria | 15105 |
| 578 | Ga0207678_10007193 | 3300026067 | Bacteria | 9867 |
| 579 | Ga0207678_10047108 | 3300026067 | Bacteria | 3728 |
| 580 | Ga0207678_10299345 | 3300026067 | Bacteria | 1382 |
| 581 | Ga0207702_10000566 | 3300026078 | Bacteria | 41185 |
| 582 | Ga0207702_10001681 | 3300026078 | Bacteria | 21845 |
| 583 | Ga0207702_10016992 | 3300026078 | Bacteria | 6021 |
| 584 | Ga0207702_10039984 | 3300026078 | Bacteria | 3931 |
| 585 | Ga0207702_10230382 | 3300026078 | Bacteria | 1731 |
| 586 | Ga0207702_10637398 | 3300026078 | Bacteria | 1047 |
| 587 | Ga0207641_10000060 | 3300026088 | Bacteria | 161514 |
| 588 | Ga0207641_10018839 | 3300026088 | Bacteria | 5660 |
| 589 | Ga0207641_10028115 | 3300026088 | Bacteria | 4644 |
| 590 | Ga0207641_10044818 | 3300026088 | Bacteria | 3720 |
| 591 | Ga0207641_10081534 | 3300026088 | Bacteria | 2809 |
| 592 | Ga0207648_10032233 | 3300026089 | Bacteria | 4628 |
| 593 | Ga0207648_10174859 | 3300026089 | Bacteria | 1899 |
| 594 | Ga0207676_10000635 | 3300026095 | Bacteria | 28333 |
| 595 | Ga0207676_10001746 | 3300026095 | Bacteria | 15973 |
| 596 | Ga0207676_10020125 | 3300026095 | Bacteria | 4878 |
| 597 | Ga0207676_10034351 | 3300026095 | Bacteria | 3839 |
| 598 | Ga0207676_10132939 | 3300026095 | Bacteria | 2118 |
| 599 | Ga0207674_10000151 | 3300026116 | Bacteria | 81529 |
| 600 | Ga0207674_10010668 | 3300026116 | Bacteria | 10390 |
| 601 | Ga0207674_10042894 | 3300026116 | Bacteria | 4668 |
| 602 | Ga0207674_10072141 | 3300026116 | Bacteria | 3469 |
| 603 | Ga0207674_10313039 | 3300026116 | Bacteria | 1519 |
| 604 | Ga0207675_100000370 | 3300026118 | Bacteria | 43070 |
| 605 | Ga0207675_100004634 | 3300026118 | Bacteria | 13247 |
| 606 | Ga0207683_10000320 | 3300026121 | Bacteria | 43863 |
| 607 | Ga0207683_10003294 | 3300026121 | Bacteria | 14080 |
| 608 | Ga0207683_10103890 | 3300026121 | Bacteria | 2538 |
| 609 | Ga0207683_10302137 | 3300026121 | Bacteria | 1464 |
| 610 | Ga0207683_10552265 | 3300026121 | Bacteria | 1065 |
| 611 | Ga0207698_10000745 | 3300026142 | Bacteria | 18894 |
| 612 | Ga0207698_10011138 | 3300026142 | Bacteria | 5816 |
| 613 | Ga0207698_10027114 | 3300026142 | Bacteria | 4063 |
| 614 | Ga0207698_10180552 | 3300026142 | Bacteria | 1869 |
| 615 | Ga0207698_10498465 | 3300026142 | Bacteria | 1185 |
| 616 | Ga0209974_10010447 | 3300027876 | Bacteria | 3132 |
| 617 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 618 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 619 | Ga0268266_10003923 | 3300028379 | Bacteria | 14460 |
| 620 | Ga0268266_10146564 | 3300028379 | Bacteria | 2123 |
| 621 | Ga0268265_10000334 | 3300028380 | Bacteria | 51202 |
| 622 | Ga0268265_10021329 | 3300028380 | Bacteria | 4536 |
| 623 | Ga0268265_10068567 | 3300028380 | Bacteria | 2751 |
| 624 | Ga0268265_10078003 | 3300028380 | Bacteria | 2604 |
| 625 | Ga0268265_10200743 | 3300028380 | Bacteria | 1730 |
| 626 | Ga0268265_10325692 | 3300028380 | Bacteria | 1394 |
| 627 | Ga0268265_10493357 | 3300028380 | Bacteria | 1152 |
| 628 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 629 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 630 | Ga0268264_10011776 | 3300028381 | Bacteria | 7211 |
| 631 | Ga0268264_10197513 | 3300028381 | Bacteria | 1838 |
| 632 | Ga0268264_10605843 | 3300028381 | Bacteria | 1080 |
| 633 | Ga0268264_10644939 | 3300028381 | Bacteria | 1047 |
| 634 | Ga0307517_10207634 | 3300028786 | Bacteria | 1212 |
| 635 | Ga0314311_1200227 | 3300030733 | Bacteria | 1508 |
| 636 | Ga0316182_1241414 | 3300030745 | Bacteria | 2300 |
| 637 | Ga0307408_100024521 | 3300031548 | Bacteria | 4120 |
| 638 | Ga0307408_100051443 | 3300031548 | Bacteria | 2967 |
| 639 | Ga0307408_100055172 | 3300031548 | Bacteria | 2875 |
| 640 | Ga0307408_100091095 | 3300031548 | Bacteria | 2302 |
| 641 | Ga0307408_100146626 | 3300031548 | Bacteria | 1858 |
| 642 | Ga0307408_100153382 | 3300031548 | Bacteria | 1821 |
| 643 | Ga0307508_10000502 | 3300031616 | Bacteria | 46831 |
| 644 | Ga0307405_10023676 | 3300031731 | Bacteria | 3494 |
| 645 | Ga0307405_10040673 | 3300031731 | Bacteria | 2817 |
| 646 | Ga0307405_10071862 | 3300031731 | Bacteria | 2228 |
| 647 | Ga0307405_10107998 | 3300031731 | Bacteria | 1879 |
| 648 | Ga0307405_10116894 | 3300031731 | Bacteria | 1817 |
| 649 | Ga0307405_10127604 | 3300031731 | Bacteria | 1752 |
| 650 | Ga0307405_10160251 | 3300031731 | Bacteria | 1592 |
| 651 | Ga0307405_10258434 | 3300031731 | Bacteria | 1299 |
| 652 | Ga0307405_10259461 | 3300031731 | Bacteria | 1297 |
| 653 | Ga0307405_10552042 | 3300031731 | Bacteria | 932 |
| 654 | Ga0307405_10941395 | 3300031731 | Bacteria | 733 |
| 655 | Ga0307413_10016497 | 3300031824 | Bacteria | 3817 |
| 656 | Ga0307413_10022445 | 3300031824 | Bacteria | 3401 |
| 657 | Ga0307413_10037915 | 3300031824 | Bacteria | 2788 |
| 658 | Ga0307413_10040073 | 3300031824 | Bacteria | 2730 |
| 659 | Ga0307413_10065225 | 3300031824 | Bacteria | 2266 |
| 660 | Ga0307413_10067396 | 3300031824 | Bacteria | 2238 |
| 661 | Ga0307413_10090135 | 3300031824 | Bacteria | 1994 |
| 662 | Ga0307413_10111302 | 3300031824 | Bacteria | 1833 |
| 663 | Ga0307413_10174663 | 3300031824 | Bacteria | 1525 |
| 664 | Ga0307413_10196809 | 3300031824 | Bacteria | 1452 |
| 665 | Ga0307413_10252863 | 3300031824 | Bacteria | 1308 |
| 666 | Ga0307413_10380215 | 3300031824 | Bacteria | 1100 |
| 667 | Ga0307413_10526138 | 3300031824 | Bacteria | 954 |
| 668 | Ga0307410_10001231 | 3300031852 | Bacteria | 11376 |
| 669 | Ga0307410_10007751 | 3300031852 | Bacteria | 5900 |
| 670 | Ga0307410_10040715 | 3300031852 | Bacteria | 3059 |
| 671 | Ga0307410_10077290 | 3300031852 | Bacteria | 2326 |
| 672 | Ga0307410_10268727 | 3300031852 | Bacteria | 1333 |
| 673 | Ga0307410_10297583 | 3300031852 | Bacteria | 1272 |
| 674 | Ga0307410_10392310 | 3300031852 | Bacteria | 1119 |
| 675 | Ga0307410_10760315 | 3300031852 | Bacteria | 821 |
| 676 | Ga0307406_10003693 | 3300031901 | Bacteria | 8333 |
| 677 | Ga0307406_10017892 | 3300031901 | Bacteria | 4134 |
| 678 | Ga0307406_10029442 | 3300031901 | Bacteria | 3326 |
| 679 | Ga0307406_10050544 | 3300031901 | Bacteria | 2636 |
| 680 | Ga0307406_10073651 | 3300031901 | Bacteria | 2246 |
| 681 | Ga0307406_10103180 | 3300031901 | Bacteria | 1947 |
| 682 | Ga0307406_10193739 | 3300031901 | Bacteria | 1490 |
| 683 | Ga0307406_10281779 | 3300031901 | Bacteria | 1268 |
| 684 | Ga0307406_10514222 | 3300031901 | Bacteria | 973 |
| 685 | Ga0307407_10002684 | 3300031903 | Bacteria | 7053 |
| 686 | Ga0307407_10011104 | 3300031903 | Bacteria | 4274 |
| 687 | Ga0307407_10029834 | 3300031903 | Bacteria | 2935 |
| 688 | Ga0307407_10050144 | 3300031903 | Bacteria | 2387 |
| 689 | Ga0307407_10062053 | 3300031903 | Bacteria | 2187 |
| 690 | Ga0307407_10064463 | 3300031903 | Bacteria | 2153 |
| 691 | Ga0307407_10067224 | 3300031903 | Bacteria | 2117 |
| 692 | Ga0307407_10085218 | 3300031903 | Bacteria | 1922 |
| 693 | Ga0307407_10209939 | 3300031903 | Bacteria | 1310 |
| 694 | Ga0307412_10002430 | 3300031911 | Bacteria | 10359 |
| 695 | Ga0307412_10003973 | 3300031911 | Bacteria | 8241 |
| 696 | Ga0307412_10005581 | 3300031911 | Bacteria | 7063 |
| 697 | Ga0307412_10009356 | 3300031911 | Bacteria | 5619 |
| 698 | Ga0307412_10021302 | 3300031911 | Bacteria | 3957 |
| 699 | Ga0307412_10088691 | 3300031911 | Bacteria | 2158 |
| 700 | Ga0307412_10106562 | 3300031911 | Bacteria | 1993 |
| 701 | Ga0307412_10126645 | 3300031911 | Bacteria | 1848 |
| 702 | Ga0307412_10216734 | 3300031911 | Bacteria | 1465 |
| 703 | Ga0307412_10272749 | 3300031911 | Bacteria | 1324 |
| 704 | Ga0307412_10297259 | 3300031911 | Bacteria | 1274 |
| 705 | Ga0307412_10376504 | 3300031911 | Bacteria | 1148 |
| 706 | Ga0307409_100010106 | 3300031995 | Bacteria | 5841 |
| 707 | Ga0307409_100030703 | 3300031995 | Bacteria | 3865 |
| 708 | Ga0307409_100047279 | 3300031995 | Bacteria | 3264 |
| 709 | Ga0307409_100053721 | 3300031995 | Bacteria | 3097 |
| 710 | Ga0307409_100100309 | 3300031995 | Bacteria | 2399 |
| 711 | Ga0307409_100109283 | 3300031995 | Bacteria | 2315 |
| 712 | Ga0307409_100156370 | 3300031995 | Bacteria | 1987 |
| 713 | Ga0307409_100186386 | 3300031995 | Bacteria | 1842 |
| 714 | Ga0307409_100298492 | 3300031995 | Bacteria | 1497 |
| 715 | Ga0307409_100429763 | 3300031995 | Bacteria | 1269 |
| 716 | Ga0307409_100519111 | 3300031995 | Bacteria | 1163 |
| 717 | Ga0307409_100646973 | 3300031995 | Bacteria | 1050 |
| 718 | Ga0307409_100708690 | 3300031995 | Bacteria | 1006 |
| 719 | Ga0307409_100944018 | 3300031995 | Bacteria | 878 |
| 720 | Ga0307416_100004113 | 3300032002 | Bacteria | 8710 |
| 721 | Ga0307416_100006047 | 3300032002 | Bacteria | 7534 |
| 722 | Ga0307416_100026184 | 3300032002 | Bacteria | 4292 |
| 723 | Ga0307416_100072603 | 3300032002 | Bacteria | 2865 |
| 724 | Ga0307416_100224862 | 3300032002 | Bacteria | 1803 |
| 725 | Ga0307416_100234242 | 3300032002 | Bacteria | 1773 |
| 726 | Ga0307416_100345804 | 3300032002 | Bacteria | 1502 |
| 727 | Ga0307416_100439189 | 3300032002 | Bacteria | 1354 |
| 728 | Ga0307416_101050668 | 3300032002 | Bacteria | 918 |
| 729 | Ga0307416_101118805 | 3300032002 | Bacteria | 892 |
| 730 | Ga0307414_10002312 | 3300032004 | Bacteria | 9958 |
| 731 | Ga0307414_10011801 | 3300032004 | Bacteria | 5141 |
| 732 | Ga0307414_10028854 | 3300032004 | Bacteria | 3603 |
| 733 | Ga0307414_10050558 | 3300032004 | Bacteria | 2879 |
| 734 | Ga0307414_10057244 | 3300032004 | Bacteria | 2739 |
| 735 | Ga0307414_10107896 | 3300032004 | Bacteria | 2111 |
| 736 | Ga0307414_10110170 | 3300032004 | Bacteria | 2093 |
| 737 | Ga0307414_10165989 | 3300032004 | Bacteria | 1760 |
| 738 | Ga0307414_10172611 | 3300032004 | Bacteria | 1730 |
| 739 | Ga0307414_10196075 | 3300032004 | Bacteria | 1638 |
| 740 | Ga0307414_10197792 | 3300032004 | Bacteria | 1632 |
| 741 | Ga0307414_10215673 | 3300032004 | Bacteria | 1572 |
| 742 | Ga0307414_10234500 | 3300032004 | Bacteria | 1515 |
| 743 | Ga0307414_10318887 | 3300032004 | Bacteria | 1322 |
| 744 | Ga0307414_10329833 | 3300032004 | Bacteria | 1302 |
| 745 | Ga0307414_10393776 | 3300032004 | Bacteria | 1201 |
| 746 | Ga0307414_10419583 | 3300032004 | Bacteria | 1166 |
| 747 | Ga0307414_10509386 | 3300032004 | Bacteria | 1066 |
| 748 | Ga0307411_10002021 | 3300032005 | Bacteria | 8698 |
| 749 | Ga0307411_10014118 | 3300032005 | Bacteria | 4434 |
| 750 | Ga0307411_10014508 | 3300032005 | Bacteria | 4387 |
| 751 | Ga0307411_10025043 | 3300032005 | Bacteria | 3567 |
| 752 | Ga0307411_10025664 | 3300032005 | Bacteria | 3535 |
| 753 | Ga0307411_10027712 | 3300032005 | Bacteria | 3432 |
| 754 | Ga0307411_10044894 | 3300032005 | Bacteria | 2839 |
| 755 | Ga0307411_10048557 | 3300032005 | Bacteria | 2751 |
| 756 | Ga0307411_10116512 | 3300032005 | Bacteria | 1923 |
| 757 | Ga0307411_10194232 | 3300032005 | Bacteria | 1552 |
| 758 | Ga0307411_10259244 | 3300032005 | Bacteria | 1372 |
| 759 | Ga0307411_10319283 | 3300032005 | Bacteria | 1253 |
| 760 | Ga0307411_10369194 | 3300032005 | Bacteria | 1176 |
| 761 | Ga0307411_10546365 | 3300032005 | Bacteria | 987 |
| 762 | Ga0307411_10555057 | 3300032005 | Bacteria | 980 |
| 763 | Ga0307411_10617230 | 3300032005 | Bacteria | 934 |
| 764 | Ga0307411_10904753 | 3300032005 | Bacteria | 784 |
| 765 | Ga0307411_11026108 | 3300032005 | Bacteria | 740 |
| 766 | Ga0307415_100004103 | 3300032126 | Bacteria | 7511 |
| 767 | Ga0307415_100007815 | 3300032126 | Bacteria | 5876 |
| 768 | Ga0307415_100025508 | 3300032126 | Bacteria | 3711 |
| 769 | Ga0307415_100048787 | 3300032126 | Bacteria | 2858 |
| 770 | Ga0307415_100052963 | 3300032126 | Bacteria | 2762 |
| 771 | Ga0307415_100267055 | 3300032126 | Bacteria | 1399 |
| 772 | Ga0307415_100331369 | 3300032126 | Bacteria | 1274 |
| 773 | Ga0307415_100389566 | 3300032126 | Bacteria | 1186 |
| 774 | Ga0307415_100689379 | 3300032126 | Bacteria | 920 |
| 775 | Ga0307510_10016704 | 3300033180 | Bacteria | 8660 |
| 776 | Ga0373930_0011487 | 3300034816 | Bacteria | 1599 |
| 777 | Ga0373940_0030745 | 3300035088 | Bacteria | 1430 |
| 778 | Ga0373931_0012035 | 3300035691 | Bacteria | 4188 |
| 779 | Ga0395899_0027780 | 3300037312 | Bacteria | 4262 |
| 780 | Ga0395899_0102638 | 3300037312 | Bacteria | 2063 |
| 781 | Ga0395899_0103359 | 3300037312 | Bacteria | 2055 |
| 782 | Ga0395899_0216410 | 3300037312 | Bacteria | 1329 |
| 783 | Ga0395900_0023899 | 3300037418 | Bacteria | 6254 |
| 784 | Ga0395900_0039180 | 3300037418 | Bacteria | 4883 |
| 785 | Ga0395900_0057645 | 3300037418 | Bacteria | 3999 |
| 786 | Ga0395900_0079628 | 3300037418 | Bacteria | 3367 |
| 787 | Ga0395900_0160367 | 3300037418 | Bacteria | 2294 |
| 788 | Ga0395900_0265770 | 3300037418 | Bacteria | 1711 |
| 789 | Ga0395900_1052435 | 3300037418 | Bacteria | 732 |
| 790 | Ga0395898_0013098 | 3300037466 | Bacteria | 8551 |
| 791 | Ga0395898_0104052 | 3300037466 | Bacteria | 2723 |
| 792 | Ga0395898_0125151 | 3300037466 | Bacteria | 2462 |
| 793 | Ga0395898_0141825 | 3300037466 | Bacteria | 2300 |
| 794 | Ga0395898_0679852 | 3300037466 | Bacteria | 971 |
| 795 | Ga0395905_0007161 | 3300037471 | Bacteria | 11146 |
| 796 | Ga0395905_0009344 | 3300037471 | Bacteria | 9586 |
| 797 | Ga0395905_0010965 | 3300037471 | Bacteria | 8772 |
| 798 | Ga0395905_0013098 | 3300037471 | Bacteria | 7961 |
| 799 | Ga0395905_0037694 | 3300037471 | Bacteria | 4537 |
| 800 | Ga0395905_0087947 | 3300037471 | Bacteria | 2913 |
| 801 | Ga0395905_0117404 | 3300037471 | Bacteria | 2500 |
| 802 | Ga0395905_0153318 | 3300037471 | Bacteria | 2167 |
| 803 | Ga0395905_0166669 | 3300037471 | Bacteria | 2070 |
| 804 | Ga0395905_0168040 | 3300037471 | Bacteria | 2061 |
| 805 | Ga0395905_0259897 | 3300037471 | Bacteria | 1621 |
| 806 | Ga0395905_0329726 | 3300037471 | Bacteria | 1416 |
| 807 | Ga0395905_0342481 | 3300037471 | Bacteria | 1386 |
| 808 | Ga0395905_0482592 | 3300037471 | Bacteria | 1139 |
| 809 | Ga0395905_0557119 | 3300037471 | Bacteria | 1047 |
| 810 | Ga0436364_0121302 | 3300037853 | Bacteria | 3322 |
| 811 | Ga0436364_0589111 | 3300037853 | Bacteria | 899 |
| 812 | Ga0436364_1211536 | 3300037853 | Bacteria | 67143 |
| 813 | Ga0395901_0014168 | 3300038443 | Bacteria | 8119 |
| 814 | Ga0395901_0014555 | 3300038443 | Bacteria | 7998 |
| 815 | Ga0395901_0088632 | 3300038443 | Bacteria | 3236 |
| 816 | Ga0395901_0103619 | 3300038443 | Bacteria | 2985 |
| 817 | Ga0395901_0251798 | 3300038443 | Bacteria | 1840 |
| 818 | Ga0395901_0311493 | 3300038443 | Bacteria | 1630 |
| 819 | Ga0395901_0518349 | 3300038443 | Bacteria | 1211 |
| 820 | Ga0395901_0703223 | 3300038443 | Bacteria | 1008 |
| 821 | Ga0395901_0744225 | 3300038443 | Bacteria | 974 |
| 822 | Ga0395901_0997603 | 3300038443 | Bacteria | 813 |
| 823 | Ga0436365_0462153 | 3300039437 | Bacteria | 1853 |
| 824 | Ga0436363_0248894 | 3300039450 | Bacteria | 1074 |
| 825 | Ga0439439_0024432 | 3300041406 | Bacteria | 1517 |
| 826 | Ga0439461_0020618 | 3300041410 | Bacteria | 1306 |
| 827 | Ga0439465_0005807 | 3300041413 | Bacteria | 3928 |
| 828 | Ga0439465_0015938 | 3300041413 | Bacteria | 2343 |
| 829 | Ga0451841_0395847 | 3300041498 | Bacteria | 1698 |
| 830 | Ga0439431_0011022 | 3300041997 | Bacteria | 2060 |
| 831 | Ga0439445_0001557 | 3300042004 | Bacteria | 4988 |
| 832 | Ga0439445_0013042 | 3300042004 | Bacteria | 2006 |
| 833 | Ga0439432_000604 | 3300042006 | Bacteria | 13487 |
| 834 | Ga0439432_054175 | 3300042006 | Bacteria | 1246 |
| 835 | Ga0439457_003188 | 3300042014 | Bacteria | 4519 |
| 836 | Ga0439462_0024284 | 3300042015 | Bacteria | 1592 |
| 837 | Ga0450923_027672 | 3300042125 | Bacteria | 1141 |
| 838 | Ga0450890_029546 | 3300042127 | Bacteria | 775 |
| 839 | Ga0439446_0021794 | 3300042156 | Bacteria | 1812 |
| 840 | Ga0439434_0004412 | 3300042435 | Bacteria | 4113 |
| 841 | Ga0466972_0100290 | 3300044658 | Bacteria | 1370 |
| 842 | Ga0466973_0216352 | 3300044659 | Bacteria | 1399 |
| 843 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 844 | Ga0466967_0024326 | 3300045976 | Bacteria | 4978 |
| 845 | Ga0495617_014419 | 3300046452 | Bacteria | 2687 |
| 846 | Ga0495627_000135 | 3300046453 | Bacteria | 87716 |
| 847 | Ga0495627_001558 | 3300046453 | Bacteria | 13044 |
| 848 | Ga0495627_054758 | 3300046453 | Bacteria | 1192 |
| 849 | Ga0495629_0063955 | 3300046459 | Bacteria | 2569 |
| 850 | Ga0495638_0000494 | 3300046460 | Bacteria | 46930 |
| 851 | Ga0495650_0000370 | 3300046471 | Bacteria | 78408 |
| 852 | Ga0495650_0000949 | 3300046471 | Bacteria | 33507 |
| 853 | Ga0495650_0046226 | 3300046471 | Bacteria | 1828 |
| 854 | Ga0495584_0096366 | 3300046491 | Bacteria | 1494 |
| 855 | Ga0495585_0007357 | 3300046492 | Bacteria | 6749 |
| 856 | Ga0495596_0018839 | 3300046500 | Bacteria | 2842 |
| 857 | Ga0495583_0000599 | 3300046506 | Bacteria | 49004 |
| 858 | Ga0495583_0010632 | 3300046506 | Bacteria | 5351 |
| 859 | Ga0495583_0049011 | 3300046506 | Bacteria | 1936 |
| 860 | Ga0495583_0082768 | 3300046506 | Bacteria | 1392 |
| 861 | Ga0495606_0007638 | 3300046507 | Bacteria | 9606 |
| 862 | Ga0495610_0001021 | 3300046512 | Bacteria | 25765 |
| 863 | Ga0495616_0070033 | 3300046513 | Bacteria | 1699 |
| 864 | Ga0495631_0035802 | 3300046518 | Bacteria | 2219 |
| 865 | Ga0495631_0054374 | 3300046518 | Bacteria | 1746 |
| 866 | Ga0495632_0000042 | 3300046519 | Bacteria | 145186 |
| 867 | Ga0495632_0134119 | 3300046519 | Bacteria | 1151 |
| 868 | Ga0495637_0026962 | 3300046520 | Bacteria | 2574 |
| 869 | Ga0495637_0072070 | 3300046520 | Bacteria | 1392 |
| 870 | Ga0495643_0001290 | 3300046522 | Bacteria | 23913 |
| 871 | Ga0495643_0011373 | 3300046522 | Bacteria | 5424 |
| 872 | Ga0495643_0077672 | 3300046522 | Bacteria | 1734 |
| 873 | Ga0495643_0091841 | 3300046522 | Bacteria | 1565 |
| 874 | Ga0495643_0123362 | 3300046522 | Bacteria | 1307 |
| 875 | Ga0495648_0000069 | 3300046524 | Bacteria | 136934 |
| 876 | Ga0495648_0008874 | 3300046524 | Bacteria | 7860 |
| 877 | Ga0495663_0000015 | 3300046525 | Bacteria | 145185 |
| 878 | Ga0495663_0010615 | 3300046525 | Bacteria | 2562 |
| 879 | Ga0495663_0013816 | 3300046525 | Bacteria | 2258 |
| 880 | Ga0495663_0078836 | 3300046525 | Bacteria | 1058 |
| 881 | Ga0495642_0035685 | 3300046528 | Bacteria | 2007 |
| 882 | Ga0495598_0012034 | 3300046537 | Bacteria | 2112 |
| 883 | Ga0495621_0002969 | 3300046539 | Bacteria | 4625 |
| 884 | Ga0495621_0004588 | 3300046539 | Bacteria | 3901 |
| 885 | Ga0495597_0072441 | 3300046542 | Bacteria | 1482 |
| 886 | Ga0495633_0000222 | 3300046558 | Bacteria | 70418 |
| 887 | Ga0495633_0001836 | 3300046558 | Bacteria | 15611 |
| 888 | Ga0495633_0023041 | 3300046558 | Bacteria | 3088 |
| 889 | Ga0495668_0000258 | 3300046616 | Bacteria | 75022 |
| 890 | Ga0495668_0039514 | 3300046616 | Bacteria | 2634 |
| 891 | Ga0495668_0114435 | 3300046616 | Bacteria | 1475 |
| 892 | Ga0495611_0042942 | 3300046648 | Bacteria | 2020 |
| 893 | Ga0495625_0002466 | 3300046660 | Bacteria | 19994 |
| 894 | Ga0495625_0014661 | 3300046660 | Bacteria | 6243 |
| 895 | Ga0495625_0044603 | 3300046660 | Bacteria | 3209 |
| 896 | Ga0495625_0089099 | 3300046660 | Bacteria | 2136 |
| 897 | Ga0495625_0167451 | 3300046660 | Bacteria | 1468 |
| 898 | Ga0495625_0240699 | 3300046660 | Bacteria | 1178 |
| 899 | Ga0495661_0274765 | 3300046665 | Bacteria | 851 |
| 900 | Ga0495669_0000038 | 3300046684 | Bacteria | 93166 |
| 901 | Ga0495669_0003083 | 3300046684 | Bacteria | 6851 |
| 902 | Ga0495669_0025929 | 3300046684 | Bacteria | 2560 |
| 903 | Ga0495669_0099819 | 3300046684 | Bacteria | 1347 |
| 904 | Ga0495669_0241557 | 3300046684 | Bacteria | 867 |
| 905 | Ga0495649_0088005 | 3300046694 | Bacteria | 1657 |
| 906 | Ga0495600_0000810 | 3300046809 | Bacteria | 16604 |
| 907 | Ga0495660_0165790 | 3300046810 | Bacteria | 1080 |
| 908 | Ga0495636_0099636 | 3300047318 | Bacteria | 1269 |
| 909 | Ga0495636_0135136 | 3300047318 | Bacteria | 1099 |
| 910 | Ga0495683_0002404 | 3300047323 | Bacteria | 11331 |
| 911 | Ga0495687_000045 | 3300047443 | Bacteria | 211968 |
| 912 | Ga0495687_000089 | 3300047443 | Bacteria | 141448 |
| 913 | Ga0495677_0168244 | 3300047445 | Bacteria | 847 |
| 914 | Ga0495685_059253 | 3300047447 | Bacteria | 1292 |
| 915 | Ga0495681_0000214 | 3300047470 | Bacteria | 48192 |
| 916 | Ga0495681_0019228 | 3300047470 | Bacteria | 3736 |
| 917 | Ga0495681_0046060 | 3300047470 | Bacteria | 2082 |
| 918 | Ga0495686_0000120 | 3300047472 | Bacteria | 164638 |
| 919 | Ga0495686_0032629 | 3300047472 | Bacteria | 3368 |
| 920 | Ga0495686_0041072 | 3300047472 | Bacteria | 2947 |
| 921 | Ga0495686_0062330 | 3300047472 | Bacteria | 2313 |
| 922 | Ga0495686_0121477 | 3300047472 | Bacteria | 1556 |
| 923 | Ga0495686_0180570 | 3300047472 | Bacteria | 1223 |
| 924 | Ga0495686_0226021 | 3300047472 | Bacteria | 1062 |
| 925 | Ga0495615_0097741 | 3300048090 | Bacteria | 826 |
| 926 | Ga0496101_0158126 | 3300048904 | Bacteria | 1737 |
| 927 | Ga0496102_0000067 | 3300048905 | Bacteria | 156790 |
| 928 | Ga0496102_0028068 | 3300048905 | Bacteria | 5029 |
| 929 | Ga0496102_0032743 | 3300048905 | Bacteria | 4671 |
| 930 | Ga0496103_0000207 | 3300048906 | Bacteria | 58942 |
| 931 | Ga0496103_0143347 | 3300048906 | Bacteria | 1529 |
| 932 | Ga0496103_0547267 | 3300048906 | Bacteria | 739 |
| 933 | Ga0496104_0033027 | 3300048907 | Bacteria | 4818 |
| 934 | Ga0496105_0024491 | 3300048908 | Bacteria | 4903 |
| 935 | Ga0496105_0100461 | 3300048908 | Bacteria | 2389 |
| 936 | Ga0496105_0163192 | 3300048908 | Bacteria | 1829 |
| 937 | Ga0496106_0159352 | 3300048909 | Bacteria | 1784 |
| 938 | Ga0496107_0023801 | 3300048910 | Bacteria | 4329 |
| 939 | Ga0496107_0120087 | 3300048910 | Bacteria | 1936 |
| 940 | Ga0496107_0134206 | 3300048910 | Bacteria | 1829 |
| 941 | Ga0496107_0154011 | 3300048910 | Bacteria | 1701 |
| 942 | Ga0496107_0267133 | 3300048910 | Bacteria | 1273 |
| 943 | Ga0496107_0463358 | 3300048910 | Bacteria | 941 |
| 944 | Ga0496108_0006067 | 3300048911 | Bacteria | 9772 |
| 945 | Ga0496108_0007631 | 3300048911 | Bacteria | 8762 |
| 946 | Ga0496108_0366058 | 3300048911 | Bacteria | 1258 |
| 947 | Ga0496109_0030175 | 3300048912 | Bacteria | 4860 |
| 948 | Ga0496109_0243687 | 3300048912 | Bacteria | 1692 |
| 949 | Ga0496109_0442002 | 3300048912 | Bacteria | 1228 |
| 950 | Ga0496110_0023986 | 3300048913 | Bacteria | 5196 |
| 951 | Ga0496110_0051335 | 3300048913 | Bacteria | 3623 |
| 952 | Ga0496110_0056647 | 3300048913 | Bacteria | 3449 |
| 953 | Ga0496110_0135478 | 3300048913 | Bacteria | 2225 |
| 954 | Ga0496110_0194912 | 3300048913 | Bacteria | 1840 |
| 955 | Ga0496111_0022953 | 3300048914 | Bacteria | 4375 |
| 956 | Ga0496111_0023502 | 3300048914 | Bacteria | 4328 |
| 957 | Ga0496111_0028546 | 3300048914 | Bacteria | 3954 |
| 958 | Ga0496111_0033889 | 3300048914 | Bacteria | 3643 |
| 959 | Ga0496111_0509169 | 3300048914 | Bacteria | 886 |
| 960 | Ga0496112_0021106 | 3300048915 | Bacteria | 6187 |
| 961 | Ga0496112_0570541 | 3300048915 | Bacteria | 1064 |
| 962 | Ga0496113_0000705 | 3300048916 | Bacteria | 17089 |
| 963 | Ga0496113_0065990 | 3300048916 | Bacteria | 2740 |
| 964 | Ga0496115_0000545 | 3300048918 | Bacteria | 29339 |
| 965 | Ga0496115_0000988 | 3300048918 | Bacteria | 20593 |
| 966 | Ga0496116_0006885 | 3300048919 | Bacteria | 10205 |
| 967 | Ga0496116_0126249 | 3300048919 | Bacteria | 1469 |
| 968 | Ga0496117_0000114 | 3300048920 | Bacteria | 180658 |
| 969 | Ga0496117_0007295 | 3300048920 | Bacteria | 10861 |
| 970 | Ga0496117_0278124 | 3300048920 | Bacteria | 898 |
| 971 | Ga0496118_0000082 | 3300048921 | Bacteria | 185820 |
| 972 | Ga0496118_0182920 | 3300048921 | Bacteria | 1264 |
| 973 | Ga0496119_0005868 | 3300048922 | Bacteria | 11594 |
| 974 | Ga0496120_0039633 | 3300048923 | Bacteria | 2777 |
| 975 | Ga0496121_0000176 | 3300048924 | Bacteria | 142585 |
| 976 | Ga0496121_0000758 | 3300048924 | Bacteria | 59289 |
| 977 | Ga0496121_0054911 | 3300048924 | Bacteria | 3324 |
| 978 | Ga0496121_0175555 | 3300048924 | Bacteria | 1551 |
| 979 | Ga0496122_0003335 | 3300048925 | Bacteria | 21202 |
| 980 | Ga0496122_0020364 | 3300048925 | Bacteria | 5997 |
| 981 | Ga0496123_0008153 | 3300048926 | Bacteria | 9668 |
| 982 | Ga0496123_0095913 | 3300048926 | Bacteria | 1743 |
| 983 | Ga0496123_0303066 | 3300048926 | Bacteria | 762 |
| 984 | Ga0496124_0000068 | 3300048927 | Bacteria | 221819 |
| 985 | Ga0496124_0000485 | 3300048927 | Bacteria | 68201 |
| 986 | Ga0496124_0007723 | 3300048927 | Bacteria | 11370 |
| 987 | Ga0496124_0043506 | 3300048927 | Bacteria | 3861 |
| 988 | Ga0496124_0150770 | 3300048927 | Bacteria | 1824 |
| 989 | Ga0496124_0423920 | 3300048927 | Bacteria | 916 |
| 990 | Ga0496125_0000219 | 3300048928 | Bacteria | 116721 |
| 991 | Ga0496125_0074499 | 3300048928 | Bacteria | 2632 |
| 992 | Ga0496125_0078881 | 3300048928 | Bacteria | 2528 |
| 993 | Ga0496125_0090787 | 3300048928 | Bacteria | 2291 |
| 994 | Ga0496126_0000157 | 3300048929 | Bacteria | 156203 |
| 995 | Ga0496126_0143995 | 3300048929 | Bacteria | 2049 |
| 996 | Ga0501032_0086055 | 3300049569 | Bacteria | 2089 |
| 997 | Ga0501033_0328313 | 3300049570 | Bacteria | 1074 |
| 998 | Ga0501034_0895489 | 3300049571 | Bacteria | 775 |
| 999 | Ga0501043_0015371 | 3300049579 | Bacteria | 5995 |
| 1000 | Ga0501047_0002789 | 3300049581 | Bacteria | 16594 |
| 1001 | Ga0501048_0183562 | 3300049582 | Bacteria | 1483 |
| 1002 | Ga0501067_0149342 | 3300049583 | Bacteria | 1302 |
| 1003 | Ga0501068_0266857 | 3300049584 | Bacteria | 1092 |
| 1004 | Ga0501069_0322599 | 3300049585 | Bacteria | 908 |
| 1005 | Ga0501211_000257 | 3300049658 | Bacteria | 4747 |
| 1006 | Ga0501217_004510 | 3300049661 | Bacteria | 2866 |
| 1007 | Ga0501223_000015 | 3300049663 | Bacteria | 68826 |
| 1008 | Ga0501235_000918 | 3300049669 | Bacteria | 6076 |
| 1009 | Ga0501235_012969 | 3300049669 | Bacteria | 1834 |
| 1010 | Ga0501239_007460 | 3300049672 | Bacteria | 1147 |
| 1011 | Ga0501243_026933 | 3300049675 | Bacteria | 969 |
| 1012 | Ga0501246_000230 | 3300049676 | Bacteria | 3755 |
| 1013 | Ga0501249_002428 | 3300049679 | Bacteria | 3767 |
| 1014 | Ga0501249_013520 | 3300049679 | Bacteria | 1735 |
| 1015 | Ga0501225_0000069 | 3300049705 | Bacteria | 33699 |
| 1016 | Ga0501268_001960 | 3300049765 | Bacteria | 2641 |
| 1017 | Ga0501268_007170 | 3300049765 | Bacteria | 1657 |
| 1018 | nmdc:mga00v17_180954_c1 | 3300050491 | Bacteria | 1360 |
| 1019 | nmdc:mga06r32_6152_c1 | 3300050510 | Bacteria | 10773 |
| 1020 | Ga0500610_0000053 | 3300053079 | Bacteria | 36671 |
| 1021 | Ga0500643_001510 | 3300053087 | Bacteria | 13306 |
| 1022 | Ga0500643_029577 | 3300053087 | Bacteria | 1684 |
| 1023 | Ga0500562_021733 | 3300053108 | Bacteria | 1671 |
| 1024 | Ga0500595_003686 | 3300053119 | Bacteria | 7076 |
| 1025 | Ga0500642_0000288 | 3300053130 | Bacteria | 18351 |
| 1026 | Ga0500658_0000187 | 3300053134 | Bacteria | 29373 |
| 1027 | Ga0500658_0001123 | 3300053134 | Bacteria | 10945 |
| 1028 | Ga0500559_0017358 | 3300053136 | Bacteria | 3039 |
| 1029 | Ga0500573_0000016 | 3300053140 | Bacteria | 182675 |
| 1030 | Ga0500616_0020321 | 3300053153 | Bacteria | 3731 |
| 1031 | Ga0500636_0011437 | 3300053177 | Bacteria | 5196 |
| 1032 | Ga0500645_000008 | 3300053730 | Bacteria | 212254 |
| 1033 | Ga0500596_008956 | 3300053735 | Bacteria | 1577 |
| 1034 | Ga0500661_044367 | 3300055283 | Bacteria | 789 |
| 1035 | 2600202594 | 2599185354 | Bacteria | 4398675 |
| 1036 | 2643823539 | 2643221560 | Bacteria | 4801179 |
| 1037 | 2753764387 | 2751185897 | Bacteria | 5322941 |
| 1038 | 2830076733 | 2830075706 | Bacteria | 3855215 |
| 1039 | 2848299154 | 2848297114 | Bacteria | 3608511 |
| 1040 | 2879166822 | 2879163058 | Bacteria | 4223965 |
| 1041 | 2885431127 | 2885429604 | Bacteria | 3642894 |
| 1042 | 2896430894 | 2896429255 | Bacteria | 2557483 |
| 1043 | 2919711014 | 2919709256 | Bacteria | 4318106 |
| 1044 | 2928027388 | 2928027323 | Bacteria | 4382488 |
| 1045 | 2946787711 | 2946787523 | Bacteria | 4366789 |
| 1046 | 2984558310 | 2984555340 | Bacteria | 4247089 |
| 1047 | 2984567310 | 2984564862 | Bacteria | 4339992 |
| 1048 | 2990269172 | 2990265787 | Bacteria | 3943888 |
| 1049 | 2993358376 | 2993356040 | Bacteria | 4247105 |
| 1050 | 2993694877 | 2993693658 | Bacteria | 4040749 |
| 1051 | 8057103463 | 8057101203 | Bacteria | 5034064 |
| 1052 | Ga0183361_10388 | |||
| 1053 | MBSR1b_contig_9270608 | |||
| 1054 | JGI24740J21852_10007532 | |||
| 1055 | JGI24739J22299_10001888 | |||
| 1056 | JGI24739J22299_10011197 | |||
| 1057 | JGI24739J22299_10105797 | |||
| 1058 | JGI24737J22298_10011471 | |||
| 1059 | JGI24737J22298_10024773 | |||
| 1060 | JGI24735J21928_10012758 | |||
| 1061 | JGI24750J21931_1000040 | |||
| 1062 | JGI24748J21848_1000053 | |||
| 1063 | JGI24738J21930_10001400 | |||
| 1064 | JGI24738J21930_10006399 | |||
| 1065 | JGI24034J26672_10000036 | |||
| 1066 | JGI24742J22300_10007088 | |||
| 1067 | JGI24742J22300_10020974 | |||
| 1068 | Ga0055525_1000090 | |||
| 1069 | Ga0055542_1000037 | |||
| 1070 | Ga0055529_1000042 | |||
| 1071 | Ga0055529_1000109 | |||
| 1072 | Ga0055537_1001792 | |||
| 1073 | Ga0055524_1000088 | |||
| 1074 | Ga0055536_1007592 | |||
| 1075 | Ga0055534_1013906 | |||
| 1076 | Ga0055530_10000025 | |||
| 1077 | Ga0055530_10000035 | |||
| 1078 | Ga0055531_10000016 | |||
| 1079 | Ga0055531_10004589 | |||
| 1080 | Ga0065165_1007535 | |||
| 1081 | Ga0065165_1018553 | |||
| 1082 | Ga0065715_10113548 | |||
| 1083 | Ga0070658_10000130 | |||
| 1084 | Ga0070658_10000900 | |||
| 1085 | Ga0070658_10002242 | |||
| 1086 | Ga0070658_10009847 | |||
| 1087 | Ga0070658_10024569 | |||
| 1088 | Ga0070658_10036221 | |||
| 1089 | Ga0070658_10265687 | |||
| 1090 | Ga0070658_10487024 | |||
| 1091 | Ga0070658_10554360 | |||
| 1092 | Ga0070658_10632852 | |||
| 1093 | Ga0070676_10029154 | |||
| 1094 | Ga0070676_10034351 | |||
| 1095 | Ga0070676_10044919 | |||
| 1096 | Ga0070683_100000909 | |||
| 1097 | Ga0070683_100004703 | |||
| 1098 | Ga0070683_100037865 | |||
| 1099 | Ga0070690_100000093 | |||
| 1100 | Ga0070690_100247187 | |||
| 1101 | Ga0070670_100010512 | |||
| 1102 | Ga0070670_100022355 | |||
| 1103 | Ga0070670_100031101 | |||
| 1104 | Ga0070670_100032146 | |||
| 1105 | Ga0070670_100034083 | |||
| 1106 | Ga0070670_100036011 | |||
| 1107 | Ga0070670_100172841 | |||
| 1108 | Ga0070677_10002217 | |||
| 1109 | Ga0070677_10013962 | |||
| 1110 | Ga0068869_100519972 | |||
| 1111 | Ga0070666_10000009 | |||
| 1112 | Ga0070666_10000841 | |||
| 1113 | Ga0070666_10024779 | |||
| 1114 | Ga0070666_10029789 | |||
| 1115 | Ga0070666_10100086 | |||
| 1116 | Ga0070680_100000845 | |||
| 1117 | Ga0070682_100026285 | |||
| 1118 | Ga0070682_100049377 | |||
| 1119 | Ga0068868_100031844 | |||
| 1120 | Ga0068868_100122759 | |||
| 1121 | Ga0070660_100000262 | |||
| 1122 | Ga0070660_100000920 | |||
| 1123 | Ga0070660_100007546 | |||
| 1124 | Ga0070660_100009198 | |||
| 1125 | Ga0070660_100081066 | |||
| 1126 | Ga0070660_100180911 | |||
| 1127 | Ga0070689_100042910 | |||
| 1128 | Ga0070691_10066178 | |||
| 1129 | Ga0070687_100089873 | |||
| 1130 | Ga0070661_100000206 | |||
| 1131 | Ga0070661_100002437 | |||
| 1132 | Ga0070661_100003493 | |||
| 1133 | Ga0070661_100006185 | |||
| 1134 | Ga0070661_100022050 | |||
| 1135 | Ga0070661_100041146 | |||
| 1136 | Ga0070661_100094403 | |||
| 1137 | Ga0070661_100137929 | |||
| 1138 | Ga0070661_100237669 | |||
| 1139 | Ga0070692_10003007 | |||
| 1140 | Ga0070692_10055882 | |||
| 1141 | Ga0070668_100000024 | |||
| 1142 | Ga0070668_100007160 | |||
| 1143 | Ga0070668_100017307 | |||
| 1144 | Ga0070668_100127817 | |||
| 1145 | Ga0070668_100185247 | |||
| 1146 | Ga0070668_100321406 | |||
| 1147 | Ga0070668_100503325 | |||
| 1148 | Ga0070669_100000103 | |||
| 1149 | Ga0070669_100005253 | |||
| 1150 | Ga0070669_100012635 | |||
| 1151 | Ga0070675_100001629 | |||
| 1152 | Ga0070675_100001950 | |||
| 1153 | Ga0070675_100013398 | |||
| 1154 | Ga0070671_100000021 | |||
| 1155 | Ga0070671_100001277 | |||
| 1156 | Ga0070671_100002080 | |||
| 1157 | Ga0070671_100014082 | |||
| 1158 | Ga0070671_100091674 | |||
| 1159 | Ga0070671_100141024 | |||
| 1160 | Ga0070674_100000399 | |||
| 1161 | Ga0070674_100013191 | |||
| 1162 | Ga0070674_100037619 | |||
| 1163 | Ga0070674_100413192 | |||
| 1164 | Ga0070673_100003118 | |||
| 1165 | Ga0070673_100137241 | |||
| 1166 | Ga0070673_100160748 | |||
| 1167 | Ga0070673_100185000 | |||
| 1168 | Ga0070673_100200888 | |||
| 1169 | Ga0070673_100703043 | |||
| 1170 | Ga0070688_100103994 | |||
| 1171 | Ga0070659_100000883 | |||
| 1172 | Ga0070659_100023869 | |||
| 1173 | Ga0070659_100046093 | |||
| 1174 | Ga0070659_100090934 | |||
| 1175 | Ga0070659_100107239 | |||
| 1176 | Ga0070659_100166998 | |||
| 1177 | Ga0070667_100000009 | |||
| 1178 | Ga0070667_100000067 | |||
| 1179 | Ga0070667_100006344 | |||
| 1180 | Ga0070667_100007570 | |||
| 1181 | Ga0070667_100010670 | |||
| 1182 | Ga0070667_100013814 | |||
| 1183 | Ga0070667_100046370 | |||
| 1184 | Ga0070667_100117444 | |||
| 1185 | Ga0070667_100241459 | |||
| 1186 | Ga0070663_100002587 | |||
| 1187 | Ga0070663_100004559 | |||
| 1188 | Ga0070663_100030185 | |||
| 1189 | Ga0070663_100059039 | |||
| 1190 | Ga0070678_100004816 | |||
| 1191 | Ga0070678_100078788 | |||
| 1192 | Ga0070678_100585179 | |||
| 1193 | Ga0070662_100000107 | |||
| 1194 | Ga0070662_100002201 | |||
| 1195 | Ga0070662_100004739 | |||
| 1196 | Ga0070662_100025833 | |||
| 1197 | Ga0070662_100077769 | |||
| 1198 | Ga0070662_100081039 | |||
| 1199 | Ga0070662_100404074 | |||
| 1200 | Ga0070662_100746574 | |||
| 1201 | Ga0070681_10232066 | |||
| 1202 | Ga0070681_10281615 | |||
| 1203 | Ga0068867_100030848 | |||
| 1204 | Ga0068867_100063135 | |||
| 1205 | Ga0068867_100184443 | |||
| 1206 | Ga0070685_10000076 | |||
| 1207 | Ga0070685_10192999 | |||
| 1208 | Ga0070684_100025416 | |||
| 1209 | Ga0070684_100534137 | |||
| 1210 | Ga0068853_100000172 | |||
| 1211 | Ga0068853_100014481 | |||
| 1212 | Ga0068853_100034278 | |||
| 1213 | Ga0068853_100210874 | |||
| 1214 | Ga0068853_100568520 | |||
| 1215 | Ga0068853_100710606 | |||
| 1216 | Ga0070672_100002032 | |||
| 1217 | Ga0070672_100009625 | |||
| 1218 | Ga0070672_100167242 | |||
| 1219 | Ga0070672_100987255 | |||
| 1220 | Ga0070686_100000018 | |||
| 1221 | Ga0070686_100000338 | |||
| 1222 | Ga0070696_100006864 | |||
| 1223 | Ga0070696_100186978 | |||
| 1224 | Ga0070693_100000773 | |||
| 1225 | Ga0070693_100018727 | |||
| 1226 | Ga0070693_100109294 | |||
| 1227 | Ga0070665_100000071 | |||
| 1228 | Ga0070665_100000535 | |||
| 1229 | Ga0070665_100001716 | |||
| 1230 | Ga0070665_100040003 | |||
| 1231 | Ga0070665_100190843 | |||
| 1232 | Ga0068855_100000353 | |||
| 1233 | Ga0068855_100002937 | |||
| 1234 | Ga0068855_100044728 | |||
| 1235 | Ga0068855_100070358 | |||
| 1236 | Ga0068855_100142423 | |||
| 1237 | Ga0068855_100223913 | |||
| 1238 | Ga0068855_100476346 | |||
| 1239 | Ga0070664_100001030 | |||
| 1240 | Ga0070664_100002325 | |||
| 1241 | Ga0070664_100036792 | |||
| 1242 | Ga0070664_100054610 | |||
| 1243 | Ga0070664_100150353 | |||
| 1244 | Ga0070664_100217544 | |||
| 1245 | Ga0068857_100048552 | |||
| 1246 | Ga0068857_100058927 | |||
| 1247 | Ga0068857_100085132 | |||
| 1248 | Ga0068857_100128661 | |||
| 1249 | Ga0068857_100148009 | |||
| 1250 | Ga0068857_100183492 | |||
| 1251 | Ga0068854_100006682 | |||
| 1252 | Ga0068854_100007103 | |||
| 1253 | Ga0068854_100017720 | |||
| 1254 | Ga0068854_100019474 | |||
| 1255 | Ga0068854_100097573 | |||
| 1256 | Ga0068854_100361375 | |||
| 1257 | Ga0068856_100000364 | |||
| 1258 | Ga0068856_100023360 | |||
| 1259 | Ga0068856_100029387 | |||
| 1260 | Ga0068856_100413572 | |||
| 1261 | Ga0068852_100002792 | |||
| 1262 | Ga0068852_100106625 | |||
| 1263 | Ga0068852_100333537 | |||
| 1264 | Ga0068852_100899897 | |||
| 1265 | Ga0068859_100008763 | |||
| 1266 | Ga0068859_100015868 | |||
| 1267 | Ga0068859_100037843 | |||
| 1268 | Ga0068859_100039235 | |||
| 1269 | Ga0068859_100048958 | |||
| 1270 | Ga0068859_100175138 | |||
| 1271 | Ga0068859_100806907 | |||
| 1272 | Ga0068859_100871614 | |||
| 1273 | Ga0068864_100005184 | |||
| 1274 | Ga0068864_100010361 | |||
| 1275 | Ga0068864_100014914 | |||
| 1276 | Ga0068864_100027563 | |||
| 1277 | Ga0068864_100144106 | |||
| 1278 | Ga0068864_100241615 | |||
| 1279 | Ga0068861_100003501 | |||
| 1280 | Ga0068861_100007076 | |||
| 1281 | Ga0068851_10007809 | |||
| 1282 | Ga0068851_10009438 | |||
| 1283 | Ga0068851_10019346 | |||
| 1284 | Ga0068851_10021307 | |||
| 1285 | Ga0068851_10025374 | |||
| 1286 | Ga0068851_10049352 | |||
| 1287 | Ga0068851_10053891 | |||
| 1288 | Ga0068870_10141042 | |||
| 1289 | Ga0068870_10405295 | |||
| 1290 | Ga0068863_100000038 | |||
| 1291 | Ga0068863_100000323 | |||
| 1292 | Ga0068863_100005444 | |||
| 1293 | Ga0068863_100015715 | |||
| 1294 | Ga0068863_100807437 | |||
| 1295 | Ga0068858_100000273 | |||
| 1296 | Ga0068858_100001634 | |||
| 1297 | Ga0068858_100002083 | |||
| 1298 | Ga0068858_100002738 | |||
| 1299 | Ga0068858_100028846 | |||
| 1300 | Ga0068858_100070318 | |||
| 1301 | Ga0068858_100735640 | |||
| 1302 | Ga0068860_100000022 | |||
| 1303 | Ga0068860_100000036 | |||
| 1304 | Ga0068860_100120599 | |||
| 1305 | Ga0068860_100330140 | |||
| 1306 | Ga0068860_100563547 | |||
| 1307 | Ga0068862_100000602 | |||
| 1308 | Ga0068862_100003209 | |||
| 1309 | Ga0068862_100053506 | |||
| 1310 | Ga0068862_100055854 | |||
| 1311 | Ga0068862_100069724 | |||
| 1312 | Ga0068862_100129742 | |||
| 1313 | Ga0068862_100205502 | |||
| 1314 | Ga0081455_10000088 | |||
| 1315 | Ga0081539_10013221 | |||
| 1316 | Ga0081539_10040482 | |||
| 1317 | Ga0075364_10100936 | |||
| 1318 | Ga0097621_100122269 | |||
| 1319 | Ga0097621_100233582 | |||
| 1320 | Ga0068871_100034831 | |||
| 1321 | Ga0068871_100277443 | |||
| 1322 | Ga0075431_100890910 | |||
| 1323 | Ga0097620_100008763 | |||
| 1324 | Ga0097620_100015868 | |||
| 1325 | Ga0097620_100037844 | |||
| 1326 | Ga0097620_100039234 | |||
| 1327 | Ga0097620_100048958 | |||
| 1328 | Ga0097620_100175133 | |||
| 1329 | Ga0097620_100806888 | |||
| 1330 | Ga0097620_100871506 | |||
| 1331 | Ga0105250_10094929 | |||
| 1332 | Ga0105240_10023904 | |||
| 1333 | Ga0105245_10012230 | |||
| 1334 | Ga0105247_10081996 | |||
| 1335 | Ga0105243_10000189 | |||
| 1336 | Ga0105243_10090604 | |||
| 1337 | Ga0105243_10286735 | |||
| 1338 | Ga0105241_10007791 | |||
| 1339 | Ga0105241_10185502 | |||
| 1340 | Ga0105248_10000238 | |||
| 1341 | Ga0105248_10005888 | |||
| 1342 | Ga0105248_10040846 | |||
| 1343 | Ga0105248_10099746 | |||
| 1344 | Ga0105248_10148887 | |||
| 1345 | Ga0105248_10177059 | |||
| 1346 | Ga0105237_10033081 | |||
| 1347 | Ga0105237_10114209 | |||
| 1348 | Ga0105237_10168815 | |||
| 1349 | Ga0105238_10052224 | |||
| 1350 | Ga0105238_10121827 | |||
| 1351 | Ga0105238_10167439 | |||
| 1352 | Ga0105238_10183425 | |||
| 1353 | Ga0105238_10495371 | |||
| 1354 | Ga0105238_10850609 | |||
| 1355 | Ga0105249_10000014 | |||
| 1356 | Ga0105249_10030951 | |||
| 1357 | Ga0105239_10308172 | |||
| 1358 | Ga0157326_1007113 | |||
| 1359 | Ga0157373_10010055 | |||
| 1360 | Ga0157373_10012668 | |||
| 1361 | Ga0157373_10127981 | |||
| 1362 | Ga0157373_10171284 | |||
| 1363 | Ga0157371_10002630 | |||
| 1364 | Ga0157371_10003977 | |||
| 1365 | Ga0157371_10053767 | |||
| 1366 | Ga0157371_10055425 | |||
| 1367 | Ga0157371_10150757 | |||
| 1368 | Ga0157370_10026506 | |||
| 1369 | Ga0157370_10026732 | |||
| 1370 | Ga0157370_10051979 | |||
| 1371 | Ga0157370_10310099 | |||
| 1372 | Ga0157370_10545842 | |||
| 1373 | Ga0157369_10001687 | |||
| 1374 | Ga0157369_10214909 | |||
| 1375 | Ga0157374_10021678 | |||
| 1376 | Ga0157374_10031141 | |||
| 1377 | Ga0157374_10108439 | |||
| 1378 | Ga0157378_10114034 | |||
| 1379 | Ga0157378_10297873 | |||
| 1380 | Ga0157378_10556164 | |||
| 1381 | Ga0163162_10467934 | |||
| 1382 | Ga0157372_10019954 | |||
| 1383 | Ga0157372_10109565 | |||
| 1384 | Ga0157372_10273467 | |||
| 1385 | Ga0157372_11027802 | |||
| 1386 | Ga0157375_10000628 | |||
| 1387 | Ga0157375_10119697 | |||
| 1388 | Ga0157375_10269701 | |||
| 1389 | Ga0157514_103401 | |||
| 1390 | Ga0163163_10000543 | |||
| 1391 | Ga0163163_10087718 | |||
| 1392 | Ga0163163_10103156 | |||
| 1393 | Ga0163163_10350471 | |||
| 1394 | Ga0157380_10001003 | |||
| 1395 | Ga0157380_10008537 | |||
| 1396 | Ga0157380_10014580 | |||
| 1397 | Ga0157380_10801091 | |||
| 1398 | Ga0182008_10021234 | |||
| 1399 | Ga0157377_10253359 | |||
| 1400 | Ga0157379_10006699 | |||
| 1401 | Ga0157379_10122031 | |||
| 1402 | Ga0157379_10403823 | |||
| 1403 | Ga0157379_10579306 | |||
| 1404 | Ga0183363_1001 | |||
| 1405 | Ga0163161_10000186 | |||
| 1406 | Ga0163161_10102221 | |||
| 1407 | Ga0163161_10218475 | |||
| 1408 | Ga0197907_11157279 | |||
| 1409 | Ga0206354_11427625 | |||
| 1410 | Ga0206353_10171510 | |||
| 1411 | Ga0206353_10359237 | |||
| 1412 | Ga0213875_10000135 | |||
| 1413 | Ga0207672_1001640 | |||
| 1414 | Ga0209147_100356 | |||
| 1415 | Ga0209563_100111 | |||
| 1416 | Ga0207425_1001404 | |||
| 1417 | Ga0209646_1007013 | |||
| 1418 | Ga0209148_1000026 | |||
| 1419 | Ga0209233_1000154 | |||
| 1420 | Ga0209565_1000010 | |||
| 1421 | Ga0209455_1000005 | |||
| 1422 | Ga0209455_1005809 | |||
| 1423 | Ga0209673_1009048 | |||
| 1424 | Ga0209675_1000076 | |||
| 1425 | Ga0209676_1001366 | |||
| 1426 | Ga0209025_1011886 | |||
| 1427 | Ga0209758_1005853 | |||
| 1428 | Ga0209050_1000026 | |||
| 1429 | Ga0209050_1000042 | |||
| 1430 | Ga0209050_1006998 | |||
| 1431 | Ga0209256_1000034 | |||
| 1432 | Ga0209257_1000009 | |||
| 1433 | Ga0209257_1001581 | |||
| 1434 | Ga0209257_1002892 | |||
| 1435 | Ga0207697_10001097 | |||
| 1436 | Ga0207697_10022784 | |||
| 1437 | Ga0207656_10008288 | |||
| 1438 | Ga0207656_10019810 | |||
| 1439 | Ga0207656_10020644 | |||
| 1440 | Ga0207656_10021992 | |||
| 1441 | Ga0207656_10024035 | |||
| 1442 | Ga0207656_10060602 | |||
| 1443 | Ga0207656_10224129 | |||
| 1444 | Ga0207696_1091820 | |||
| 1445 | Ga0207713_1070306 | |||
| 1446 | Ga0207682_10000194 | |||
| 1447 | Ga0207682_10002083 | |||
| 1448 | Ga0207710_10044147 | |||
| 1449 | Ga0207688_10060473 | |||
| 1450 | Ga0207688_10172111 | |||
| 1451 | Ga0207688_10201185 | |||
| 1452 | Ga0207680_10000007 | |||
| 1453 | Ga0207680_10024818 | |||
| 1454 | Ga0207680_10076175 | |||
| 1455 | Ga0207680_10164108 | |||
| 1456 | Ga0207647_10000331 | |||
| 1457 | Ga0207647_10000910 | |||
| 1458 | Ga0207647_10026357 | |||
| 1459 | Ga0207647_10029798 | |||
| 1460 | Ga0207647_10052077 | |||
| 1461 | Ga0207647_10123956 | |||
| 1462 | Ga0207645_10017693 | |||
| 1463 | Ga0207645_10028598 | |||
| 1464 | Ga0207645_10103563 | |||
| 1465 | Ga0207645_10125767 | |||
| 1466 | Ga0207705_10000371 | |||
| 1467 | Ga0207705_10000574 | |||
| 1468 | Ga0207705_10003366 | |||
| 1469 | Ga0207705_10005390 | |||
| 1470 | Ga0207705_10011112 | |||
| 1471 | Ga0207705_10011202 | |||
| 1472 | Ga0207705_10016709 | |||
| 1473 | Ga0207705_10027000 | |||
| 1474 | Ga0207705_10072700 | |||
| 1475 | Ga0207705_10431785 | |||
| 1476 | Ga0207705_10574330 | |||
| 1477 | Ga0207654_10000535 | |||
| 1478 | Ga0207654_10003712 | |||
| 1479 | Ga0207654_10214010 | |||
| 1480 | Ga0207707_10300612 | |||
| 1481 | Ga0207695_10001498 | |||
| 1482 | Ga0207695_10035150 | |||
| 1483 | Ga0207671_10000350 | |||
| 1484 | Ga0207671_10058972 | |||
| 1485 | Ga0207671_10147925 | |||
| 1486 | Ga0207660_10147610 | |||
| 1487 | Ga0207657_10000643 | |||
| 1488 | Ga0207657_10000812 | |||
| 1489 | Ga0207657_10000863 | |||
| 1490 | Ga0207657_10002760 | |||
| 1491 | Ga0207657_10011178 | |||
| 1492 | Ga0207657_10024384 | |||
| 1493 | Ga0207649_10000362 | |||
| 1494 | Ga0207649_10000616 | |||
| 1495 | Ga0207649_10075022 | |||
| 1496 | Ga0207649_10358290 | |||
| 1497 | Ga0207652_10492762 | |||
| 1498 | Ga0207681_10000350 | |||
| 1499 | Ga0207681_10021734 | |||
| 1500 | Ga0207681_10024615 | |||
| 1501 | Ga0207681_10339766 | |||
| 1502 | Ga0207694_10000447 | |||
| 1503 | Ga0207694_10005672 | |||
| 1504 | Ga0207694_10016303 | |||
| 1505 | Ga0207694_10040182 | |||
| 1506 | Ga0207694_10203459 | |||
| 1507 | Ga0207650_10001426 | |||
| 1508 | Ga0207650_10004509 | |||
| 1509 | Ga0207650_10008489 | |||
| 1510 | Ga0207650_10033119 | |||
| 1511 | Ga0207650_10039258 | |||
| 1512 | Ga0207650_10039837 | |||
| 1513 | Ga0207650_10070980 | |||
| 1514 | Ga0207650_10103465 | |||
| 1515 | Ga0207650_10133882 | |||
| 1516 | Ga0207650_10135172 | |||
| 1517 | Ga0207650_10375769 | |||
| 1518 | Ga0207659_10002145 | |||
| 1519 | Ga0207659_10010381 | |||
| 1520 | Ga0207659_10012707 | |||
| 1521 | Ga0207659_10040896 | |||
| 1522 | Ga0207659_10275058 | |||
| 1523 | Ga0207659_10554699 | |||
| 1524 | Ga0207687_10079352 | |||
| 1525 | Ga0207644_10000054 | |||
| 1526 | Ga0207644_10009169 | |||
| 1527 | Ga0207644_10013046 | |||
| 1528 | Ga0207644_10014265 | |||
| 1529 | Ga0207644_10023854 | |||
| 1530 | Ga0207644_10027350 | |||
| 1531 | Ga0207644_10085888 | |||
| 1532 | Ga0207644_10430254 | |||
| 1533 | Ga0207690_10000062 | |||
| 1534 | Ga0207690_10004520 | |||
| 1535 | Ga0207690_10011926 | |||
| 1536 | Ga0207690_10165436 | |||
| 1537 | Ga0207690_10172850 | |||
| 1538 | Ga0207690_10181450 | |||
| 1539 | Ga0207690_10311300 | |||
| 1540 | Ga0207706_10000211 | |||
| 1541 | Ga0207706_10000842 | |||
| 1542 | Ga0207706_10002689 | |||
| 1543 | Ga0207706_10012861 | |||
| 1544 | Ga0207706_10020765 | |||
| 1545 | Ga0207706_10021856 | |||
| 1546 | Ga0207706_10025533 | |||
| 1547 | Ga0207706_10113738 | |||
| 1548 | Ga0207706_10127556 | |||
| 1549 | Ga0207709_10001974 | |||
| 1550 | Ga0207709_10796070 | |||
| 1551 | Ga0207670_10003472 | |||
| 1552 | Ga0207669_10000146 | |||
| 1553 | Ga0207669_10002460 | |||
| 1554 | Ga0207669_10008651 | |||
| 1555 | Ga0207669_10053271 | |||
| 1556 | Ga0207691_10001025 | |||
| 1557 | Ga0207691_10001329 | |||
| 1558 | Ga0207691_10021857 | |||
| 1559 | Ga0207691_10043703 | |||
| 1560 | Ga0207691_10295940 | |||
| 1561 | Ga0207691_10334618 | |||
| 1562 | Ga0207711_10001768 | |||
| 1563 | Ga0207711_10004434 | |||
| 1564 | Ga0207711_10015580 | |||
| 1565 | Ga0207711_10016865 | |||
| 1566 | Ga0207711_10021214 | |||
| 1567 | Ga0207689_10676791 | |||
| 1568 | Ga0207661_10003356 | |||
| 1569 | Ga0207661_10027159 | |||
| 1570 | Ga0207661_10163530 | |||
| 1571 | Ga0207679_10002801 | |||
| 1572 | Ga0207679_10018962 | |||
| 1573 | Ga0207679_10046229 | |||
| 1574 | Ga0207679_10523774 | |||
| 1575 | Ga0207667_10000010 | |||
| 1576 | Ga0207667_10000237 | |||
| 1577 | Ga0207667_10007822 | |||
| 1578 | Ga0207667_10012966 | |||
| 1579 | Ga0207667_10013405 | |||
| 1580 | Ga0207667_10088032 | |||
| 1581 | Ga0207667_10167386 | |||
| 1582 | Ga0207667_10177609 | |||
| 1583 | Ga0207667_10229948 | |||
| 1584 | Ga0207651_10011320 | |||
| 1585 | Ga0207651_10124320 | |||
| 1586 | Ga0207651_10151913 | |||
| 1587 | Ga0207651_10190822 | |||
| 1588 | Ga0207651_10247865 | |||
| 1589 | Ga0207712_10000004 | |||
| 1590 | Ga0207712_10140329 | |||
| 1591 | Ga0207668_10000396 | |||
| 1592 | Ga0207668_10002501 | |||
| 1593 | Ga0207668_10012476 | |||
| 1594 | Ga0207668_10028544 | |||
| 1595 | Ga0207668_10048393 | |||
| 1596 | Ga0207668_10137860 | |||
| 1597 | Ga0207668_10611988 | |||
| 1598 | Ga0207640_10001641 | |||
| 1599 | Ga0207640_10004927 | |||
| 1600 | Ga0207640_10006739 | |||
| 1601 | Ga0207640_10006892 | |||
| 1602 | Ga0207640_10033042 | |||
| 1603 | Ga0207640_10387118 | |||
| 1604 | Ga0207658_10000009 | |||
| 1605 | Ga0207658_10000089 | |||
| 1606 | Ga0207658_10000260 | |||
| 1607 | Ga0207658_10004234 | |||
| 1608 | Ga0207658_10014864 | |||
| 1609 | Ga0207658_10018905 | |||
| 1610 | Ga0207658_10026183 | |||
| 1611 | Ga0207658_10054241 | |||
| 1612 | Ga0207658_10632501 | |||
| 1613 | Ga0207677_10099806 | |||
| 1614 | Ga0207703_10000782 | |||
| 1615 | Ga0207703_10001276 | |||
| 1616 | Ga0207703_10016040 | |||
| 1617 | Ga0207703_10056022 | |||
| 1618 | Ga0207703_10057934 | |||
| 1619 | Ga0207703_10316193 | |||
| 1620 | Ga0207703_10391174 | |||
| 1621 | Ga0207639_10000991 | |||
| 1622 | Ga0207639_10005330 | |||
| 1623 | Ga0207639_10038615 | |||
| 1624 | Ga0207639_10520120 | |||
| 1625 | Ga0207639_10564668 | |||
| 1626 | Ga0207678_10001933 | |||
| 1627 | Ga0207678_10002497 | |||
| 1628 | Ga0207678_10003065 | |||
| 1629 | Ga0207678_10007193 | |||
| 1630 | Ga0207678_10047108 | |||
| 1631 | Ga0207678_10299345 | |||
| 1632 | Ga0207702_10000566 | |||
| 1633 | Ga0207702_10001681 | |||
| 1634 | Ga0207702_10016992 | |||
| 1635 | Ga0207702_10039984 | |||
| 1636 | Ga0207702_10230382 | |||
| 1637 | Ga0207702_10637398 | |||
| 1638 | Ga0207641_10000060 | |||
| 1639 | Ga0207641_10018839 | |||
| 1640 | Ga0207641_10028115 | |||
| 1641 | Ga0207641_10044818 | |||
| 1642 | Ga0207641_10081534 | |||
| 1643 | Ga0207648_10032233 | |||
| 1644 | Ga0207648_10174859 | |||
| 1645 | Ga0207676_10000635 | |||
| 1646 | Ga0207676_10001746 | |||
| 1647 | Ga0207676_10020125 | |||
| 1648 | Ga0207676_10034351 | |||
| 1649 | Ga0207676_10132939 | |||
| 1650 | Ga0207674_10000151 | |||
| 1651 | Ga0207674_10010668 | |||
| 1652 | Ga0207674_10042894 | |||
| 1653 | Ga0207674_10072141 | |||
| 1654 | Ga0207674_10313039 | |||
| 1655 | Ga0207675_100000370 | |||
| 1656 | Ga0207675_100004634 | |||
| 1657 | Ga0207683_10000320 | |||
| 1658 | Ga0207683_10003294 | |||
| 1659 | Ga0207683_10103890 | |||
| 1660 | Ga0207683_10302137 | |||
| 1661 | Ga0207683_10552265 | |||
| 1662 | Ga0207698_10000745 | |||
| 1663 | Ga0207698_10011138 | |||
| 1664 | Ga0207698_10027114 | |||
| 1665 | Ga0207698_10180552 | |||
| 1666 | Ga0207698_10498465 | |||
| 1667 | Ga0209974_10010447 | |||
| 1668 | Ga0268266_10000002 | |||
| 1669 | Ga0268266_10000040 | |||
| 1670 | Ga0268266_10003923 | |||
| 1671 | Ga0268266_10146564 | |||
| 1672 | Ga0268265_10000334 | |||
| 1673 | Ga0268265_10021329 | |||
| 1674 | Ga0268265_10068567 | |||
| 1675 | Ga0268265_10078003 | |||
| 1676 | Ga0268265_10200743 | |||
| 1677 | Ga0268265_10325692 | |||
| 1678 | Ga0268265_10493357 | |||
| 1679 | Ga0268264_10000001 | |||
| 1680 | Ga0268264_10000003 | |||
| 1681 | Ga0268264_10011776 | |||
| 1682 | Ga0268264_10197513 | |||
| 1683 | Ga0268264_10605843 | |||
| 1684 | Ga0268264_10644939 | |||
| 1685 | Ga0307517_10207634 | |||
| 1686 | Ga0314311_1200227 | |||
| 1687 | Ga0316182_1241414 | |||
| 1688 | Ga0307408_100024521 | |||
| 1689 | Ga0307408_100051443 | |||
| 1690 | Ga0307408_100055172 | |||
| 1691 | Ga0307408_100091095 | |||
| 1692 | Ga0307408_100146626 | |||
| 1693 | Ga0307408_100153382 | |||
| 1694 | Ga0307508_10000502 | |||
| 1695 | Ga0307405_10023676 | |||
| 1696 | Ga0307405_10040673 | |||
| 1697 | Ga0307405_10071862 | |||
| 1698 | Ga0307405_10107998 | |||
| 1699 | Ga0307405_10116894 | |||
| 1700 | Ga0307405_10127604 | |||
| 1701 | Ga0307405_10160251 | |||
| 1702 | Ga0307405_10258434 | |||
| 1703 | Ga0307405_10259461 | |||
| 1704 | Ga0307405_10552042 | |||
| 1705 | Ga0307405_10941395 | |||
| 1706 | Ga0307413_10016497 | |||
| 1707 | Ga0307413_10022445 | |||
| 1708 | Ga0307413_10037915 | |||
| 1709 | Ga0307413_10040073 | |||
| 1710 | Ga0307413_10065225 | |||
| 1711 | Ga0307413_10067396 | |||
| 1712 | Ga0307413_10090135 | |||
| 1713 | Ga0307413_10111302 | |||
| 1714 | Ga0307413_10174663 | |||
| 1715 | Ga0307413_10196809 | |||
| 1716 | Ga0307413_10252863 | |||
| 1717 | Ga0307413_10380215 | |||
| 1718 | Ga0307413_10526138 | |||
| 1719 | Ga0307410_10001231 | |||
| 1720 | Ga0307410_10007751 | |||
| 1721 | Ga0307410_10040715 | |||
| 1722 | Ga0307410_10077290 | |||
| 1723 | Ga0307410_10268727 | |||
| 1724 | Ga0307410_10297583 | |||
| 1725 | Ga0307410_10392310 | |||
| 1726 | Ga0307410_10760315 | |||
| 1727 | Ga0307406_10003693 | |||
| 1728 | Ga0307406_10017892 | |||
| 1729 | Ga0307406_10029442 | |||
| 1730 | Ga0307406_10050544 | |||
| 1731 | Ga0307406_10073651 | |||
| 1732 | Ga0307406_10103180 | |||
| 1733 | Ga0307406_10193739 | |||
| 1734 | Ga0307406_10281779 | |||
| 1735 | Ga0307406_10514222 | |||
| 1736 | Ga0307407_10002684 | |||
| 1737 | Ga0307407_10011104 | |||
| 1738 | Ga0307407_10029834 | |||
| 1739 | Ga0307407_10050144 | |||
| 1740 | Ga0307407_10062053 | |||
| 1741 | Ga0307407_10064463 | |||
| 1742 | Ga0307407_10067224 | |||
| 1743 | Ga0307407_10085218 | |||
| 1744 | Ga0307407_10209939 | |||
| 1745 | Ga0307412_10002430 | |||
| 1746 | Ga0307412_10003973 | |||
| 1747 | Ga0307412_10005581 | |||
| 1748 | Ga0307412_10009356 | |||
| 1749 | Ga0307412_10021302 | |||
| 1750 | Ga0307412_10088691 | |||
| 1751 | Ga0307412_10106562 | |||
| 1752 | Ga0307412_10126645 | |||
| 1753 | Ga0307412_10216734 | |||
| 1754 | Ga0307412_10272749 | |||
| 1755 | Ga0307412_10297259 | |||
| 1756 | Ga0307412_10376504 | |||
| 1757 | Ga0307409_100010106 | |||
| 1758 | Ga0307409_100030703 | |||
| 1759 | Ga0307409_100047279 | |||
| 1760 | Ga0307409_100053721 | |||
| 1761 | Ga0307409_100100309 | |||
| 1762 | Ga0307409_100109283 | |||
| 1763 | Ga0307409_100156370 | |||
| 1764 | Ga0307409_100186386 | |||
| 1765 | Ga0307409_100298492 | |||
| 1766 | Ga0307409_100429763 | |||
| 1767 | Ga0307409_100519111 | |||
| 1768 | Ga0307409_100646973 | |||
| 1769 | Ga0307409_100708690 | |||
| 1770 | Ga0307409_100944018 | |||
| 1771 | Ga0307416_100004113 | |||
| 1772 | Ga0307416_100006047 | |||
| 1773 | Ga0307416_100026184 | |||
| 1774 | Ga0307416_100072603 | |||
| 1775 | Ga0307416_100224862 | |||
| 1776 | Ga0307416_100234242 | |||
| 1777 | Ga0307416_100345804 | |||
| 1778 | Ga0307416_100439189 | |||
| 1779 | Ga0307416_101050668 | |||
| 1780 | Ga0307416_101118805 | |||
| 1781 | Ga0307414_10002312 | |||
| 1782 | Ga0307414_10011801 | |||
| 1783 | Ga0307414_10028854 | |||
| 1784 | Ga0307414_10050558 | |||
| 1785 | Ga0307414_10057244 | |||
| 1786 | Ga0307414_10107896 | |||
| 1787 | Ga0307414_10110170 | |||
| 1788 | Ga0307414_10165989 | |||
| 1789 | Ga0307414_10172611 | |||
| 1790 | Ga0307414_10196075 | |||
| 1791 | Ga0307414_10197792 | |||
| 1792 | Ga0307414_10215673 | |||
| 1793 | Ga0307414_10234500 | |||
| 1794 | Ga0307414_10318887 | |||
| 1795 | Ga0307414_10329833 | |||
| 1796 | Ga0307414_10393776 | |||
| 1797 | Ga0307414_10419583 | |||
| 1798 | Ga0307414_10509386 | |||
| 1799 | Ga0307411_10002021 | |||
| 1800 | Ga0307411_10014118 | |||
| 1801 | Ga0307411_10014508 | |||
| 1802 | Ga0307411_10025043 | |||
| 1803 | Ga0307411_10025664 | |||
| 1804 | Ga0307411_10027712 | |||
| 1805 | Ga0307411_10044894 | |||
| 1806 | Ga0307411_10048557 | |||
| 1807 | Ga0307411_10116512 | |||
| 1808 | Ga0307411_10194232 | |||
| 1809 | Ga0307411_10259244 | |||
| 1810 | Ga0307411_10319283 | |||
| 1811 | Ga0307411_10369194 | |||
| 1812 | Ga0307411_10546365 | |||
| 1813 | Ga0307411_10555057 | |||
| 1814 | Ga0307411_10617230 | |||
| 1815 | Ga0307411_10904753 | |||
| 1816 | Ga0307411_11026108 | |||
| 1817 | Ga0307415_100004103 | |||
| 1818 | Ga0307415_100007815 | |||
| 1819 | Ga0307415_100025508 | |||
| 1820 | Ga0307415_100048787 | |||
| 1821 | Ga0307415_100052963 | |||
| 1822 | Ga0307415_100267055 | |||
| 1823 | Ga0307415_100331369 | |||
| 1824 | Ga0307415_100389566 | |||
| 1825 | Ga0307415_100689379 | |||
| 1826 | Ga0307510_10016704 | |||
| 1827 | Ga0373930_0011487 | |||
| 1828 | Ga0373940_0030745 | |||
| 1829 | Ga0373931_0012035 | |||
| 1830 | Ga0395899_0027780 | |||
| 1831 | Ga0395899_0102638 | |||
| 1832 | Ga0395899_0103359 | |||
| 1833 | Ga0395899_0216410 | |||
| 1834 | Ga0395900_0023899 | |||
| 1835 | Ga0395900_0039180 | |||
| 1836 | Ga0395900_0057645 | |||
| 1837 | Ga0395900_0079628 | |||
| 1838 | Ga0395900_0160367 | |||
| 1839 | Ga0395900_0265770 | |||
| 1840 | Ga0395900_1052435 | |||
| 1841 | Ga0395898_0013098 | |||
| 1842 | Ga0395898_0104052 | |||
| 1843 | Ga0395898_0125151 | |||
| 1844 | Ga0395898_0141825 | |||
| 1845 | Ga0395898_0679852 | |||
| 1846 | Ga0395905_0007161 | |||
| 1847 | Ga0395905_0009344 | |||
| 1848 | Ga0395905_0010965 | |||
| 1849 | Ga0395905_0013098 | |||
| 1850 | Ga0395905_0037694 | |||
| 1851 | Ga0395905_0087947 | |||
| 1852 | Ga0395905_0117404 | |||
| 1853 | Ga0395905_0153318 | |||
| 1854 | Ga0395905_0166669 | |||
| 1855 | Ga0395905_0168040 | |||
| 1856 | Ga0395905_0259897 | |||
| 1857 | Ga0395905_0329726 | |||
| 1858 | Ga0395905_0342481 | |||
| 1859 | Ga0395905_0482592 | |||
| 1860 | Ga0395905_0557119 | |||
| 1861 | Ga0436364_0121302 | |||
| 1862 | Ga0436364_0589111 | |||
| 1863 | Ga0436364_1211536 | |||
| 1864 | Ga0395901_0014168 | |||
| 1865 | Ga0395901_0014555 | |||
| 1866 | Ga0395901_0088632 | |||
| 1867 | Ga0395901_0103619 | |||
| 1868 | Ga0395901_0251798 | |||
| 1869 | Ga0395901_0311493 | |||
| 1870 | Ga0395901_0518349 | |||
| 1871 | Ga0395901_0703223 | |||
| 1872 | Ga0395901_0744225 | |||
| 1873 | Ga0395901_0997603 | |||
| 1874 | Ga0436365_0462153 | |||
| 1875 | Ga0436363_0248894 | |||
| 1876 | Ga0439439_0024432 | |||
| 1877 | Ga0439461_0020618 | |||
| 1878 | Ga0439465_0005807 | |||
| 1879 | Ga0439465_0015938 | |||
| 1880 | Ga0451841_0395847 | |||
| 1881 | Ga0439431_0011022 | |||
| 1882 | Ga0439445_0001557 | |||
| 1883 | Ga0439445_0013042 | |||
| 1884 | Ga0439432_000604 | |||
| 1885 | Ga0439432_054175 | |||
| 1886 | Ga0439457_003188 | |||
| 1887 | Ga0439462_0024284 | |||
| 1888 | Ga0450923_027672 | |||
| 1889 | Ga0450890_029546 | |||
| 1890 | Ga0439446_0021794 | |||
| 1891 | Ga0439434_0004412 | |||
| 1892 | Ga0466972_0100290 | |||
| 1893 | Ga0466973_0216352 | |||
| 1894 | Ga0451576_0000023 | |||
| 1895 | Ga0466967_0024326 | |||
| 1896 | Ga0495617_014419 | |||
| 1897 | Ga0495627_000135 | |||
| 1898 | Ga0495627_001558 | |||
| 1899 | Ga0495627_054758 | |||
| 1900 | Ga0495629_0063955 | |||
| 1901 | Ga0495638_0000494 | |||
| 1902 | Ga0495650_0000370 | |||
| 1903 | Ga0495650_0000949 | |||
| 1904 | Ga0495650_0046226 | |||
| 1905 | Ga0495584_0096366 | |||
| 1906 | Ga0495585_0007357 | |||
| 1907 | Ga0495596_0018839 | |||
| 1908 | Ga0495583_0000599 | |||
| 1909 | Ga0495583_0010632 | |||
| 1910 | Ga0495583_0049011 | |||
| 1911 | Ga0495583_0082768 | |||
| 1912 | Ga0495606_0007638 | |||
| 1913 | Ga0495610_0001021 | |||
| 1914 | Ga0495616_0070033 | |||
| 1915 | Ga0495631_0035802 | |||
| 1916 | Ga0495631_0054374 | |||
| 1917 | Ga0495632_0000042 | |||
| 1918 | Ga0495632_0134119 | |||
| 1919 | Ga0495637_0026962 | |||
| 1920 | Ga0495637_0072070 | |||
| 1921 | Ga0495643_0001290 | |||
| 1922 | Ga0495643_0011373 | |||
| 1923 | Ga0495643_0077672 | |||
| 1924 | Ga0495643_0091841 | |||
| 1925 | Ga0495643_0123362 | |||
| 1926 | Ga0495648_0000069 | |||
| 1927 | Ga0495648_0008874 | |||
| 1928 | Ga0495663_0000015 | |||
| 1929 | Ga0495663_0010615 | |||
| 1930 | Ga0495663_0013816 | |||
| 1931 | Ga0495663_0078836 | |||
| 1932 | Ga0495642_0035685 | |||
| 1933 | Ga0495598_0012034 | |||
| 1934 | Ga0495621_0002969 | |||
| 1935 | Ga0495621_0004588 | |||
| 1936 | Ga0495597_0072441 | |||
| 1937 | Ga0495633_0000222 | |||
| 1938 | Ga0495633_0001836 | |||
| 1939 | Ga0495633_0023041 | |||
| 1940 | Ga0495668_0000258 | |||
| 1941 | Ga0495668_0039514 | |||
| 1942 | Ga0495668_0114435 | |||
| 1943 | Ga0495611_0042942 | |||
| 1944 | Ga0495625_0002466 | |||
| 1945 | Ga0495625_0014661 | |||
| 1946 | Ga0495625_0044603 | |||
| 1947 | Ga0495625_0089099 | |||
| 1948 | Ga0495625_0167451 | |||
| 1949 | Ga0495625_0240699 | |||
| 1950 | Ga0495661_0274765 | |||
| 1951 | Ga0495669_0000038 | |||
| 1952 | Ga0495669_0003083 | |||
| 1953 | Ga0495669_0025929 | |||
| 1954 | Ga0495669_0099819 | |||
| 1955 | Ga0495669_0241557 | |||
| 1956 | Ga0495649_0088005 | |||
| 1957 | Ga0495600_0000810 | |||
| 1958 | Ga0495660_0165790 | |||
| 1959 | Ga0495636_0099636 | |||
| 1960 | Ga0495636_0135136 | |||
| 1961 | Ga0495683_0002404 | |||
| 1962 | Ga0495687_000045 | |||
| 1963 | Ga0495687_000089 | |||
| 1964 | Ga0495677_0168244 | |||
| 1965 | Ga0495685_059253 | |||
| 1966 | Ga0495681_0000214 | |||
| 1967 | Ga0495681_0019228 | |||
| 1968 | Ga0495681_0046060 | |||
| 1969 | Ga0495686_0000120 | |||
| 1970 | Ga0495686_0032629 | |||
| 1971 | Ga0495686_0041072 | |||
| 1972 | Ga0495686_0062330 | |||
| 1973 | Ga0495686_0121477 | |||
| 1974 | Ga0495686_0180570 | |||
| 1975 | Ga0495686_0226021 | |||
| 1976 | Ga0495615_0097741 | |||
| 1977 | Ga0496101_0158126 | |||
| 1978 | Ga0496102_0000067 | |||
| 1979 | Ga0496102_0028068 | |||
| 1980 | Ga0496102_0032743 | |||
| 1981 | Ga0496103_0000207 | |||
| 1982 | Ga0496103_0143347 | |||
| 1983 | Ga0496103_0547267 | |||
| 1984 | Ga0496104_0033027 | |||
| 1985 | Ga0496105_0024491 | |||
| 1986 | Ga0496105_0100461 | |||
| 1987 | Ga0496105_0163192 | |||
| 1988 | Ga0496106_0159352 | |||
| 1989 | Ga0496107_0023801 | |||
| 1990 | Ga0496107_0120087 | |||
| 1991 | Ga0496107_0134206 | |||
| 1992 | Ga0496107_0154011 | |||
| 1993 | Ga0496107_0267133 | |||
| 1994 | Ga0496107_0463358 | |||
| 1995 | Ga0496108_0006067 | |||
| 1996 | Ga0496108_0007631 | |||
| 1997 | Ga0496108_0366058 | |||
| 1998 | Ga0496109_0030175 | |||
| 1999 | Ga0496109_0243687 | |||
| 2000 | Ga0496109_0442002 | |||
| 2001 | Ga0496110_0023986 | |||
| 2002 | Ga0496110_0051335 | |||
| 2003 | Ga0496110_0056647 | |||
| 2004 | Ga0496110_0135478 | |||
| 2005 | Ga0496110_0194912 | |||
| 2006 | Ga0496111_0022953 | |||
| 2007 | Ga0496111_0023502 | |||
| 2008 | Ga0496111_0028546 | |||
| 2009 | Ga0496111_0033889 | |||
| 2010 | Ga0496111_0509169 | |||
| 2011 | Ga0496112_0021106 | |||
| 2012 | Ga0496112_0570541 | |||
| 2013 | Ga0496113_0000705 | |||
| 2014 | Ga0496113_0065990 | |||
| 2015 | Ga0496115_0000545 | |||
| 2016 | Ga0496115_0000988 | |||
| 2017 | Ga0496116_0006885 | |||
| 2018 | Ga0496116_0126249 | |||
| 2019 | Ga0496117_0000114 | |||
| 2020 | Ga0496117_0007295 | |||
| 2021 | Ga0496117_0278124 | |||
| 2022 | Ga0496118_0000082 | |||
| 2023 | Ga0496118_0182920 | |||
| 2024 | Ga0496119_0005868 | |||
| 2025 | Ga0496120_0039633 | |||
| 2026 | Ga0496121_0000176 | |||
| 2027 | Ga0496121_0000758 | |||
| 2028 | Ga0496121_0054911 | |||
| 2029 | Ga0496121_0175555 | |||
| 2030 | Ga0496122_0003335 | |||
| 2031 | Ga0496122_0020364 | |||
| 2032 | Ga0496123_0008153 | |||
| 2033 | Ga0496123_0095913 | |||
| 2034 | Ga0496123_0303066 | |||
| 2035 | Ga0496124_0000068 | |||
| 2036 | Ga0496124_0000485 | |||
| 2037 | Ga0496124_0007723 | |||
| 2038 | Ga0496124_0043506 | |||
| 2039 | Ga0496124_0150770 | |||
| 2040 | Ga0496124_0423920 | |||
| 2041 | Ga0496125_0000219 | |||
| 2042 | Ga0496125_0074499 | |||
| 2043 | Ga0496125_0078881 | |||
| 2044 | Ga0496125_0090787 | |||
| 2045 | Ga0496126_0000157 | |||
| 2046 | Ga0496126_0143995 | |||
| 2047 | Ga0501032_0086055 | |||
| 2048 | Ga0501033_0328313 | |||
| 2049 | Ga0501034_0895489 | |||
| 2050 | Ga0501043_0015371 | |||
| 2051 | Ga0501047_0002789 | |||
| 2052 | Ga0501048_0183562 | |||
| 2053 | Ga0501067_0149342 | |||
| 2054 | Ga0501068_0266857 | |||
| 2055 | Ga0501069_0322599 | |||
| 2056 | Ga0501211_000257 | |||
| 2057 | Ga0501217_004510 | |||
| 2058 | Ga0501223_000015 | |||
| 2059 | Ga0501235_000918 | |||
| 2060 | Ga0501235_012969 | |||
| 2061 | Ga0501239_007460 | |||
| 2062 | Ga0501243_026933 | |||
| 2063 | Ga0501246_000230 | |||
| 2064 | Ga0501249_002428 | |||
| 2065 | Ga0501249_013520 | |||
| 2066 | Ga0501225_0000069 | |||
| 2067 | Ga0501268_001960 | |||
| 2068 | Ga0501268_007170 | |||
| 2069 | nmdc:mga00v17_180954_c1 | |||
| 2070 | nmdc:mga06r32_6152_c1 | |||
| 2071 | Ga0500610_0000053 | |||
| 2072 | Ga0500643_001510 | |||
| 2073 | Ga0500643_029577 | |||
| 2074 | Ga0500562_021733 | |||
| 2075 | Ga0500595_003686 | |||
| 2076 | Ga0500642_0000288 | |||
| 2077 | Ga0500658_0000187 | |||
| 2078 | Ga0500658_0001123 | |||
| 2079 | Ga0500559_0017358 | |||
| 2080 | Ga0500573_0000016 | |||
| 2081 | Ga0500616_0020321 | |||
| 2082 | Ga0500636_0011437 | |||
| 2083 | Ga0500645_000008 | |||
| 2084 | Ga0500596_008956 | |||
| 2085 | Ga0500661_044367 | |||
| 2086 | 2600202594 | |||
| 2087 | 2643823539 | |||
| 2088 | 2753764387 | |||
| 2089 | 2830076733 | |||
| 2090 | 2848299154 | |||
| 2091 | 2879166822 | |||
| 2092 | 2885431127 | |||
| 2093 | 2896430894 | |||
| 2094 | 2919711014 | |||
| 2095 | 2928027388 | |||
| 2096 | 2946787711 | |||
| 2097 | 2984558310 | |||
| 2098 | 2984567310 | |||
| 2099 | 2990269172 | |||
| 2100 | 2993358376 | |||
| 2101 | 2993694877 | |||
| 2102 | 8057103463 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jjk-assembly1.cif.gz_A | selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group | 0.9341 | 3 | 224 |
| 8cso-assembly1.cif.gz_B | crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate | 0.9322 | 5 | 223 |
| 1jjk-assembly1.cif.gz_A | selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group | 0.9222 | 3 | 224 |
| 8cso-assembly5.cif.gz_I | crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate | 0.9213 | 5 | 224 |
| 3uwq-assembly1.cif.gz_A | 1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump) | 0.9208 | 1 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9121 | 5 | 224 | 3.20.20.70 |
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9064 | 3 | 224 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9001 | 5 | 224 | 3.20.20.70 |
| 3ldvB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8873 | 1 | 224 | 3.20.20.70 |
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8871 | 3 | 224 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8XJQ7-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) | 0.9833 | 3 | 101 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A7Y2L251-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) | 0.9808 | 142 | 222 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A7Y1YAQ0-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) | 0.978 | 149 | 223 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A7X5ZVS7-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9776 | 3 | 224 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A1E4JEA8-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9762 | 1 | 224 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |