F488998

General Info

Members Datasets Scaffolds Average Seq Length
1048 329 2096 218

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10116007|Ga0163161_101160072
Length 223
Sequence MLEEKLKKIKYQLSFHKLSIIKMPIIAPSLLSANYLQLQQDCDMLNASQADWFHLDVMDGRFVPNISFGPMLIEFFKKATTKICDVHLMIEEPERYTMEACRHLHRNIQQIKGLGMQAGVALNPHTPVESLKDVLADIDMVLIMSVNPGFGGQSFIPHTLNKIKQLRAMIDEQSLKVKIEIDGGVTLDNAASILAAGADVLVAGNTVFKSVNPAETISKLKSL

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
217 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
272 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
273 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
274 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
275 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
276 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
277 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
278 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
279 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
280 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
281 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
282 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
283 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
284 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
289 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
290 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
306 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
309 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
310 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
316 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
321 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
322 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
323 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
327 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
328 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
329 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.34
Nodule 0
Rhizoplane 0.38
Rhizosphere 90.84
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10116007 3300017792 Bacteria 2007
2 ARCol0yngRDRAFT_1002900 3300000652 Bacteria 1270
3 JGI24736J21556_1008050 3300001904 Unclassified 1757
4 JGI24739J22299_10000682 3300001989 Bacteria 12266
5 JGI24751J29686_10001386 3300002459 Bacteria 5090
6 JGI25153J46596_10009265 3300003215 Bacteria 4602
7 JGI25153J46596_10052922 3300003215 Unclassified 1152
8 rootH1_10086091 3300003316 Bacteria 5693
9 rootH2_10014568 3300003320 Bacteria 37185
10 rootH2_10042606 3300003320 Bacteria 5685
11 rootH2_10077502 3300003320 Bacteria 25078
12 rootH2_10084580 3300003320 Bacteria 2163
13 rootL2_10007556 3300003322 Bacteria 9857
14 rootL2_10245585 3300003322 Bacteria 1104
15 rootH1_10038857 3300003323 Unclassified 3923
16 rootH1_10072926 3300003323 Bacteria 8901
17 rootH1_10073999 3300003323 Bacteria 2457
18 JGI25160J50197_1000883 3300003354 Bacteria 15785
19 JGI25160J50197_1016652 3300003354 Bacteria 2360
20 Ga0055526_1016976 3300003771 Bacteria 2810
21 Ga0055528_1000481 3300003790 Bacteria 31687
22 Ga0055530_10067843 3300003791 Bacteria 777
23 Ga0055543_1016228 3300004625 Bacteria 1419
24 Ga0065165_1000228 3300005262 Bacteria 98736
25 Ga0065714_10124544 3300005288 Bacteria 1291
26 Ga0065704_10227980 3300005289 Bacteria 1052
27 Ga0065712_10014868 3300005290 Bacteria 2128
28 Ga0065712_10087928 3300005290 Bacteria 2541
29 Ga0065712_10137176 3300005290 Bacteria 1486
30 Ga0065712_10203207 3300005290 Bacteria 1089
31 Ga0065707_10016744 3300005295 Bacteria 1819
32 Ga0070658_10099229 3300005327 Bacteria 2406
33 Ga0070658_10117693 3300005327 Bacteria 2206
34 Ga0070658_10305196 3300005327 Bacteria 1358
35 Ga0070658_10545980 3300005327 Unclassified 1003
36 Ga0070658_10922590 3300005327 Bacteria 759
37 Ga0070676_10044940 3300005328 Bacteria 2572
38 Ga0070676_10124222 3300005328 Bacteria 1624
39 Ga0070676_10144146 3300005328 Bacteria 1519
40 Ga0070676_10224076 3300005328 Unclassified 1243
41 Ga0070683_100008791 3300005329 Bacteria 8588
42 Ga0070683_100039507 3300005329 Bacteria 4332
43 Ga0070683_100555264 3300005329 Bacteria 1098
44 Ga0070690_100016704 3300005330 Bacteria 4403
45 Ga0070670_100016861 3300005331 Bacteria 6269
46 Ga0070670_100055775 3300005331 Bacteria 3391
47 Ga0070670_100152746 3300005331 Bacteria 1998
48 Ga0070670_100164272 3300005331 Bacteria 1925
49 Ga0070670_100336416 3300005331 Bacteria 1325
50 Ga0070670_100558697 3300005331 Bacteria 1021
51 Ga0068869_100062872 3300005334 Bacteria 2725
52 Ga0068869_100165888 3300005334 Bacteria 1722
53 Ga0068869_100170468 3300005334 Bacteria 1700
54 Ga0068869_100319674 3300005334 Bacteria 1258
55 Ga0068869_100363721 3300005334 Bacteria 1182
56 Ga0070666_10001517 3300005335 Bacteria 14090
57 Ga0070666_10016406 3300005335 Unclassified 4739
58 Ga0070666_10019018 3300005335 Bacteria 4428
59 Ga0070666_10103090 3300005335 Bacteria 1968
60 Ga0070666_10494461 3300005335 Bacteria 886
61 Ga0070680_100223008 3300005336 Bacteria 1591
62 Ga0070680_100325911 3300005336 Bacteria 1304
63 Ga0070682_100000525 3300005337 Bacteria 23970
64 Ga0070682_100000549 3300005337 Bacteria 23315
65 Ga0070682_100066184 3300005337 Bacteria 2298
66 Ga0070682_100320427 3300005337 Bacteria 1145
67 Ga0068868_100016594 3300005338 Bacteria 5474
68 Ga0068868_100037301 3300005338 Bacteria 3767
69 Ga0068868_100146050 3300005338 Bacteria 1945
70 Ga0068868_100195259 3300005338 Unclassified 1685
71 Ga0068868_100284043 3300005338 Bacteria 1401
72 Ga0068868_100360829 3300005338 Bacteria 1246
73 Ga0070660_100015710 3300005339 Bacteria 5474
74 Ga0070660_100108535 3300005339 Bacteria 2206
75 Ga0070660_100290700 3300005339 Bacteria 1338
76 Ga0070660_100603244 3300005339 Bacteria 918
77 Ga0070689_100015893 3300005340 Bacteria 5499
78 Ga0070689_100036250 3300005340 Bacteria 3772
79 Ga0070689_100090910 3300005340 Bacteria 2406
80 Ga0070689_100152260 3300005340 Unclassified 1866
81 Ga0070691_10013755 3300005341 Bacteria 3712
82 Ga0070691_10192165 3300005341 Unclassified 1068
83 Ga0070687_100008860 3300005343 Unclassified 4279
84 Ga0070687_100113402 3300005343 Unclassified 1538
85 Ga0070661_100023553 3300005344 Bacteria 4414
86 Ga0070661_100058810 3300005344 Bacteria 2817
87 Ga0070668_100006539 3300005347 Bacteria 8638
88 Ga0070668_100032657 3300005347 Bacteria 3961
89 Ga0070668_100049425 3300005347 Bacteria 3236
90 Ga0070668_100066202 3300005347 Bacteria 2803
91 Ga0070668_100233594 3300005347 Bacteria 1521
92 Ga0070668_100374000 3300005347 Bacteria 1211
93 Ga0070668_100450350 3300005347 Bacteria 1106
94 Ga0070668_100544919 3300005347 Bacteria 1009
95 Ga0070669_100020363 3300005353 Unclassified 4738
96 Ga0070669_100172850 3300005353 Bacteria 1686
97 Ga0070669_100525274 3300005353 Bacteria 984
98 Ga0070675_100040664 3300005354 Bacteria 3797
99 Ga0070675_100162645 3300005354 Bacteria 1921
100 Ga0070675_100177324 3300005354 Bacteria 1841
101 Ga0070671_100058796 3300005355 Bacteria 3199
102 Ga0070671_100069049 3300005355 Bacteria 2947
103 Ga0070674_100005888 3300005356 Bacteria 7127
104 Ga0070674_100078074 3300005356 Bacteria 2359
105 Ga0070674_100124296 3300005356 Bacteria 1914
106 Ga0070674_100157342 3300005356 Bacteria 1721
107 Ga0070674_100188537 3300005356 Bacteria 1585
108 Ga0070674_100359509 3300005356 Bacteria 1178
109 Ga0070673_100012518 3300005364 Bacteria 5828
110 Ga0070673_100060556 3300005364 Bacteria 3000
111 Ga0070673_100151338 3300005364 Bacteria 1965
112 Ga0070673_100172631 3300005364 Bacteria 1846
113 Ga0070673_100239328 3300005364 Bacteria 1577
114 Ga0070673_100316430 3300005364 Bacteria 1378
115 Ga0070688_100016934 3300005365 Bacteria 4175
116 Ga0070688_100081906 3300005365 Bacteria 2091
117 Ga0070659_100011635 3300005366 Bacteria 6510
118 Ga0070659_100024976 3300005366 Bacteria 4585
119 Ga0070659_100084683 3300005366 Bacteria 2535
120 Ga0070667_100025205 3300005367 Bacteria 4943
121 Ga0070667_100277325 3300005367 Bacteria 1505
122 Ga0070667_100306751 3300005367 Bacteria 1430
123 Ga0070667_100337049 3300005367 Bacteria 1363
124 Ga0070713_100360684 3300005436 Bacteria 1350
125 Ga0070701_10320473 3300005438 Bacteria 959
126 Ga0070705_100203581 3300005440 Bacteria 1359
127 Ga0070700_100104436 3300005441 Bacteria 1872
128 Ga0070700_100286381 3300005441 Unclassified 1197
129 Ga0070663_100092978 3300005455 Bacteria 2237
130 Ga0070663_100348021 3300005455 Unclassified 1199
131 Ga0070663_100358522 3300005455 Bacteria 1182
132 Ga0070678_100042123 3300005456 Bacteria 3243
133 Ga0070678_100110704 3300005456 Unclassified 2148
134 Ga0070678_100217699 3300005456 Bacteria 1586
135 Ga0070678_100407376 3300005456 Bacteria 1183
136 Ga0070662_100017167 3300005457 Bacteria 4873
137 Ga0070662_100270784 3300005457 Bacteria 1371
138 Ga0070662_100661235 3300005457 Bacteria 882
139 Ga0070662_101067575 3300005457 Bacteria 692
140 Ga0070681_10029846 3300005458 Bacteria 5473
141 Ga0070681_10285741 3300005458 Bacteria 1560
142 Ga0070681_10483815 3300005458 Bacteria 1151
143 Ga0068867_100023813 3300005459 Bacteria 4386
144 Ga0068867_100024822 3300005459 Bacteria 4298
145 Ga0068867_100066329 3300005459 Bacteria 2688
146 Ga0068867_100078570 3300005459 Bacteria 2482
147 Ga0068867_100171923 3300005459 Unclassified 1717
148 Ga0068867_100226514 3300005459 Bacteria 1509
149 Ga0068867_100463992 3300005459 Bacteria 1082
150 Ga0068867_100622036 3300005459 Bacteria 944
151 Ga0070685_10005545 3300005466 Bacteria 6399
152 Ga0070685_10024336 3300005466 Bacteria 3324
153 Ga0070685_10131001 3300005466 Bacteria 1568
154 Ga0070698_100016231 3300005471 Bacteria 7861
155 Ga0070698_100017582 3300005471 Bacteria 7535
156 Ga0070698_100018248 3300005471 Bacteria 7389
157 Ga0070699_100256212 3300005518 Bacteria 1564
158 Ga0070679_100000367 3300005530 Bacteria 38344
159 Ga0070679_100003068 3300005530 Bacteria 15268
160 Ga0070679_100038459 3300005530 Bacteria 4756
161 Ga0070679_100647243 3300005530 Bacteria 1000
162 Ga0070684_100007425 3300005535 Bacteria 8518
163 Ga0070684_100029638 3300005535 Bacteria 4640
164 Ga0070684_100601592 3300005535 Bacteria 1022
165 Ga0070684_100752307 3300005535 Bacteria 910
166 Ga0068853_100000221 3300005539 Bacteria 40294
167 Ga0068853_100002087 3300005539 Bacteria 14818
168 Ga0068853_100019176 3300005539 Bacteria 5669
169 Ga0068853_100061272 3300005539 Bacteria 3254
170 Ga0068853_100073002 3300005539 Bacteria 2991
171 Ga0068853_100183339 3300005539 Bacteria 1899
172 Ga0068853_100199808 3300005539 Bacteria 1819
173 Ga0068853_100217559 3300005539 Bacteria 1743
174 Ga0068853_100393664 3300005539 Bacteria 1296
175 Ga0068853_100441005 3300005539 Bacteria 1224
176 Ga0068853_100872992 3300005539 Bacteria 863
177 Ga0070672_100001464 3300005543 Bacteria 14647
178 Ga0070672_100069744 3300005543 Bacteria 2792
179 Ga0070672_100093336 3300005543 Bacteria 2431
180 Ga0070672_100116709 3300005543 Bacteria 2181
181 Ga0070672_100134167 3300005543 Bacteria 2038
182 Ga0070672_100201353 3300005543 Bacteria 1665
183 Ga0070672_100293358 3300005543 Bacteria 1377
184 Ga0070672_100953589 3300005543 Bacteria 759
185 Ga0070686_100004288 3300005544 Bacteria 7859
186 Ga0070686_100065269 3300005544 Bacteria 2364
187 Ga0070686_100114670 3300005544 Bacteria 1841
188 Ga0070686_100369592 3300005544 Bacteria 1082
189 Ga0070686_100477613 3300005544 Bacteria 963
190 Ga0070686_100485530 3300005544 Unclassified 956
191 Ga0070686_100796273 3300005544 Bacteria 761
192 Ga0070696_100312735 3300005546 Bacteria 1206
193 Ga0070693_100003508 3300005547 Bacteria 7314
194 Ga0070665_100000001 3300005548 Bacteria 1083363
195 Ga0070665_100026357 3300005548 Bacteria 5855
196 Ga0068855_100004630 3300005563 Bacteria 16786
197 Ga0068855_100027234 3300005563 Bacteria 6839
198 Ga0068855_100035742 3300005563 Bacteria 5918
199 Ga0068855_100042983 3300005563 Bacteria 5355
200 Ga0068855_100108675 3300005563 Unclassified 3185
201 Ga0068855_100157104 3300005563 Bacteria 2583
202 Ga0068855_100468964 3300005563 Bacteria 1372
203 Ga0068855_100543839 3300005563 Bacteria 1258
204 Ga0070664_100008111 3300005564 Bacteria 8491
205 Ga0070664_100031077 3300005564 Bacteria 4459
206 Ga0070664_100208558 3300005564 Bacteria 1746
207 Ga0070664_100239557 3300005564 Bacteria 1628
208 Ga0070664_100295104 3300005564 Bacteria 1464
209 Ga0070664_100398592 3300005564 Bacteria 1258
210 Ga0070664_100467246 3300005564 Bacteria 1160
211 Ga0070664_100492630 3300005564 Unclassified 1129
212 Ga0068857_100001119 3300005577 Bacteria 20854
213 Ga0068857_100025593 3300005577 Bacteria 5196
214 Ga0068857_100046345 3300005577 Bacteria 3858
215 Ga0068857_100052392 3300005577 Bacteria 3621
216 Ga0068857_100114779 3300005577 Unclassified 2422
217 Ga0068857_100262825 3300005577 Bacteria 1584
218 Ga0068857_100503385 3300005577 Bacteria 1137
219 Ga0068854_100054032 3300005578 Bacteria 2887
220 Ga0068854_100065233 3300005578 Bacteria 2647
221 Ga0068854_100136104 3300005578 Bacteria 1881
222 Ga0068854_100337340 3300005578 Bacteria 1230
223 Ga0068856_100118539 3300005614 Bacteria 2648
224 Ga0068856_100152151 3300005614 Bacteria 2323
225 Ga0068856_100173437 3300005614 Bacteria 2169
226 Ga0070702_100658983 3300005615 Bacteria 793
227 Ga0068852_100000926 3300005616 Bacteria 19410
228 Ga0068852_100003421 3300005616 Bacteria 11085
229 Ga0068852_100054329 3300005616 Bacteria 3452
230 Ga0068852_100057379 3300005616 Bacteria 3369
231 Ga0068852_100079852 3300005616 Bacteria 2899
232 Ga0068852_100111034 3300005616 Bacteria 2492
233 Ga0068852_100193789 3300005616 Bacteria 1919
234 Ga0068852_100223230 3300005616 Unclassified 1793
235 Ga0068852_100272534 3300005616 Bacteria 1629
236 Ga0068852_100431225 3300005616 Bacteria 1302
237 Ga0068852_100519996 3300005616 Bacteria 1187
238 Ga0068852_100647203 3300005616 Bacteria 1064
239 Ga0068852_100876143 3300005616 Bacteria 914
240 Ga0068859_100000064 3300005617 Bacteria 104971
241 Ga0068859_100003888 3300005617 Bacteria 15253
242 Ga0068859_100143359 3300005617 Unclassified 2462
243 Ga0068859_100152314 3300005617 Bacteria 2388
244 Ga0068859_100157751 3300005617 Bacteria 2347
245 Ga0068859_100203886 3300005617 Bacteria 2063
246 Ga0068859_100270064 3300005617 Bacteria 1793
247 Ga0068859_100548803 3300005617 Bacteria 1250
248 Ga0068859_100551478 3300005617 Bacteria 1247
249 Ga0068859_100560121 3300005617 Bacteria 1237
250 Ga0068859_100749494 3300005617 Unclassified 1065
251 Ga0068859_100752512 3300005617 Unclassified 1063
252 Ga0068864_100014171 3300005618 Bacteria 6617
253 Ga0068864_100119793 3300005618 Bacteria 2352
254 Ga0068864_100154832 3300005618 Bacteria 2079
255 Ga0068864_100219107 3300005618 Bacteria 1755
256 Ga0068864_100223912 3300005618 Bacteria 1736
257 Ga0068864_100233513 3300005618 Bacteria 1702
258 Ga0068866_10051778 3300005718 Bacteria 2092
259 Ga0068866_10427075 3300005718 Bacteria 861
260 Ga0068866_10598124 3300005718 Bacteria 744
261 Ga0068861_100013578 3300005719 Bacteria 5701
262 Ga0068861_100014654 3300005719 Bacteria 5505
263 Ga0068861_100096436 3300005719 Bacteria 2343
264 Ga0068861_100098648 3300005719 Unclassified 2319
265 Ga0068861_100262160 3300005719 Bacteria 1480
266 Ga0068861_100303993 3300005719 Bacteria 1383
267 Ga0068861_100459601 3300005719 Bacteria 1142
268 Ga0068851_10014911 3300005834 Bacteria 3696
269 Ga0068851_10102731 3300005834 Bacteria 1518
270 Ga0068851_10168778 3300005834 Bacteria 1206
271 Ga0068851_10182705 3300005834 Bacteria 1162
272 Ga0068870_10013252 3300005840 Bacteria 3872
273 Ga0068870_10389570 3300005840 Bacteria 904
274 Ga0068863_100011703 3300005841 Bacteria 8484
275 Ga0068863_100020291 3300005841 Bacteria 6357
276 Ga0068863_100023194 3300005841 Bacteria 5931
277 Ga0068863_100045799 3300005841 Bacteria 4152
278 Ga0068863_100121175 3300005841 Bacteria 2494
279 Ga0068863_100163098 3300005841 Bacteria 2136
280 Ga0068863_100347479 3300005841 Bacteria 1444
281 Ga0068858_100148339 3300005842 Bacteria 2204
282 Ga0068858_100254842 3300005842 Unclassified 1667
283 Ga0068858_100553017 3300005842 Bacteria 1114
284 Ga0068858_101185375 3300005842 Bacteria 751
285 Ga0068860_100000046 3300005843 Bacteria 214800
286 Ga0068860_100003652 3300005843 Bacteria 15833
287 Ga0068860_100004779 3300005843 Bacteria 13804
288 Ga0068860_100008360 3300005843 Bacteria 10305
289 Ga0068860_100009074 3300005843 Bacteria 9898
290 Ga0068860_100021218 3300005843 Bacteria 6292
291 Ga0068860_100042273 3300005843 Bacteria 4354
292 Ga0068860_100054406 3300005843 Bacteria 3805
293 Ga0068860_100157678 3300005843 Bacteria 2188
294 Ga0068860_100235472 3300005843 Unclassified 1780
295 Ga0068862_100001846 3300005844 Bacteria 19205
296 Ga0068862_100025134 3300005844 Bacteria 5000
297 Ga0068862_100135139 3300005844 Bacteria 2185
298 Ga0068862_100305329 3300005844 Bacteria 1465
299 Ga0068862_100626314 3300005844 Bacteria 1035
300 Ga0068862_100724042 3300005844 Unclassified 966
301 Ga0081540_1007674 3300005983 Bacteria 7649
302 Ga0081539_10001598 3300005985 Bacteria 37363
303 Ga0081539_10068454 3300005985 Bacteria 1915
304 Ga0097621_100000974 3300006237 Bacteria 20059
305 Ga0097621_100010940 3300006237 Bacteria 6662
306 Ga0097621_100011820 3300006237 Bacteria 6450
307 Ga0097621_100151586 3300006237 Unclassified 1988
308 Ga0097621_100363159 3300006237 Bacteria 1290
309 Ga0075370_10248827 3300006353 Bacteria 1053
310 Ga0068871_100000750 3300006358 Bacteria 21894
311 Ga0068871_100664700 3300006358 Bacteria 952
312 Ga0068871_100740487 3300006358 Bacteria 903
313 Ga0075428_100020790 3300006844 Bacteria 7267
314 Ga0075428_100036510 3300006844 Bacteria 5412
315 Ga0075428_100047292 3300006844 Bacteria 4726
316 Ga0075428_100101750 3300006844 Bacteria 3132
317 Ga0075430_100026803 3300006846 Bacteria 4902
318 Ga0075431_100045756 3300006847 Bacteria 4512
319 Ga0075434_100094466 3300006871 Bacteria 2995
320 Ga0075429_100267396 3300006880 Bacteria 1497
321 Ga0068865_100010351 3300006881 Bacteria 5803
322 Ga0068865_100113476 3300006881 Bacteria 2003
323 Ga0068865_100433675 3300006881 Bacteria 1083
324 Ga0068865_100446834 3300006881 Bacteria 1068
325 Ga0097620_100000064 3300006931 Bacteria 104971
326 Ga0097620_100003888 3300006931 Bacteria 15253
327 Ga0097620_100143359 3300006931 Unclassified 2462
328 Ga0097620_100152316 3300006931 Bacteria 2388
329 Ga0097620_100157752 3300006931 Bacteria 2347
330 Ga0097620_100203891 3300006931 Bacteria 2063
331 Ga0097620_100270064 3300006931 Bacteria 1793
332 Ga0097620_100548740 3300006931 Bacteria 1250
333 Ga0097620_100551401 3300006931 Bacteria 1247
334 Ga0097620_100560178 3300006931 Bacteria 1237
335 Ga0097620_100749484 3300006931 Unclassified 1065
336 Ga0097620_100752417 3300006931 Unclassified 1063
337 Ga0097620_101538898 3300006931 Unclassified 734
338 Ga0105240_10000074 3300009093 Bacteria 199611
339 Ga0105240_10000598 3300009093 Bacteria 67006
340 Ga0105240_10000626 3300009093 Bacteria 65179
341 Ga0105240_10002254 3300009093 Bacteria 31303
342 Ga0105240_10004476 3300009093 Bacteria 21284
343 Ga0105240_10007364 3300009093 Bacteria 16008
344 Ga0105240_10045005 3300009093 Bacteria 5602
345 Ga0105240_10065482 3300009093 Unclassified 4511
346 Ga0105240_10087664 3300009093 Bacteria 3811
347 Ga0105240_10122025 3300009093 Bacteria 3137
348 Ga0105240_10136812 3300009093 Bacteria 2933
349 Ga0111539_10016692 3300009094 Bacteria 9100
350 Ga0111539_10425294 3300009094 Bacteria 1547
351 Ga0111539_10615859 3300009094 Bacteria 1264
352 Ga0105245_10280169 3300009098 Bacteria 1629
353 Ga0105245_10314070 3300009098 Bacteria 1542
354 Ga0105245_11307523 3300009098 Unclassified 774
355 Ga0105247_10004356 3300009101 Bacteria 9051
356 Ga0105247_10005280 3300009101 Bacteria 8152
357 Ga0114129_10017850 3300009147 Bacteria 10104
358 Ga0114129_10053478 3300009147 Bacteria 5663
359 Ga0114129_10107363 3300009147 Bacteria 3856
360 Ga0105243_10089369 3300009148 Bacteria 2532
361 Ga0105241_10000659 3300009174 Bacteria 25872
362 Ga0105241_10002102 3300009174 Bacteria 15038
363 Ga0105241_10030423 3300009174 Bacteria 4035
364 Ga0105241_10058744 3300009174 Bacteria 2954
365 Ga0105241_10075050 3300009174 Bacteria 2634
366 Ga0105241_10136956 3300009174 Bacteria 1989
367 Ga0105241_10304898 3300009174 Bacteria 1368
368 Ga0105241_10377754 3300009174 Bacteria 1237
369 Ga0105241_10799234 3300009174 Bacteria 869
370 Ga0105242_10029709 3300009176 Bacteria 4359
371 Ga0105242_10090175 3300009176 Bacteria 2578
372 Ga0105242_10095223 3300009176 Bacteria 2513
373 Ga0105242_10158722 3300009176 Bacteria 1978
374 Ga0105242_10193030 3300009176 Bacteria 1804
375 Ga0105242_10262121 3300009176 Bacteria 1562
376 Ga0105242_10281903 3300009176 Bacteria 1510
377 Ga0105242_10668262 3300009176 Bacteria 1012
378 Ga0105242_10913286 3300009176 Bacteria 879
379 Ga0105248_10110498 3300009177 Bacteria 3099
380 Ga0105237_10000755 3300009545 Bacteria 44312
381 Ga0105237_10003416 3300009545 Bacteria 18881
382 Ga0105237_10003671 3300009545 Bacteria 18080
383 Ga0105237_10011051 3300009545 Bacteria 9573
384 Ga0105237_10015329 3300009545 Bacteria 7983
385 Ga0105237_10071377 3300009545 Bacteria 3467
386 Ga0105237_10102485 3300009545 Bacteria 2854
387 Ga0105237_10107568 3300009545 Bacteria 2781
388 Ga0105237_10115778 3300009545 Bacteria 2674
389 Ga0105237_10490826 3300009545 Bacteria 1234
390 Ga0105237_10769510 3300009545 Bacteria 970
391 Ga0105238_10001132 3300009551 Bacteria 26885
392 Ga0105238_10084549 3300009551 Bacteria 3162
393 Ga0105249_10001648 3300009553 Bacteria 19565
394 Ga0105249_10009236 3300009553 Bacteria 8625
395 Ga0105249_10019347 3300009553 Bacteria 6073
396 Ga0105249_10278051 3300009553 Bacteria 1671
397 Ga0105249_10394234 3300009553 Bacteria 1413
398 Ga0105249_10447783 3300009553 Bacteria 1329
399 Ga0105239_10000048 3300010375 Bacteria 177855
400 Ga0105239_10001136 3300010375 Bacteria 36704
401 Ga0105239_10002613 3300010375 Bacteria 22790
402 Ga0105239_10017403 3300010375 Bacteria 7949
403 Ga0105239_10027980 3300010375 Bacteria 6203
404 Ga0105239_10032560 3300010375 Bacteria 5728
405 Ga0105239_10497734 3300010375 Bacteria 1385
406 Ga0105239_10731675 3300010375 Bacteria 1132
407 Ga0105246_10099156 3300011119 Bacteria 2117
408 Ga0105246_10196436 3300011119 Bacteria 1565
409 Ga0105246_10237380 3300011119 Bacteria 1439
410 Ga0157373_10012918 3300013100 Bacteria 6130
411 Ga0157373_10018988 3300013100 Bacteria 5004
412 Ga0157373_10033618 3300013100 Bacteria 3687
413 Ga0157373_10172620 3300013100 Bacteria 1521
414 Ga0157371_10000830 3300013102 Bacteria 35437
415 Ga0157371_10004289 3300013102 Bacteria 12511
416 Ga0157371_10010326 3300013102 Bacteria 7286
417 Ga0157371_10191690 3300013102 Bacteria 1464
418 Ga0157371_10200867 3300013102 Bacteria 1429
419 Ga0157371_10240055 3300013102 Bacteria 1303
420 Ga0157371_10372543 3300013102 Bacteria 1042
421 Ga0157371_10497455 3300013102 Bacteria 900
422 Ga0157370_10000878 3300013104 Bacteria 38164
423 Ga0157370_10002365 3300013104 Bacteria 22738
424 Ga0157370_10007920 3300013104 Bacteria 11508
425 Ga0157370_10009537 3300013104 Bacteria 10354
426 Ga0157370_10041110 3300013104 Bacteria 4463
427 Ga0157370_10113719 3300013104 Bacteria 2529
428 Ga0157370_10152193 3300013104 Bacteria 2152
429 Ga0157369_10019583 3300013105 Bacteria 7572
430 Ga0157369_10049397 3300013105 Bacteria 4560
431 Ga0157369_10057809 3300013105 Bacteria 4183
432 Ga0157369_10424096 3300013105 Bacteria 1379
433 Ga0157374_10021570 3300013296 Bacteria 5734
434 Ga0157374_10047005 3300013296 Unclassified 3999
435 Ga0157374_10083014 3300013296 Bacteria 3043
436 Ga0157374_10089350 3300013296 Bacteria 2935
437 Ga0157374_10109364 3300013296 Bacteria 2657
438 Ga0157374_10129662 3300013296 Bacteria 2440
439 Ga0157374_10177420 3300013296 Bacteria 2080
440 Ga0157374_10261128 3300013296 Bacteria 1706
441 Ga0157374_10411681 3300013296 Unclassified 1350
442 Ga0157374_10574263 3300013296 Unclassified 1136
443 Ga0157378_10003501 3300013297 Bacteria 13935
444 Ga0157378_10017913 3300013297 Bacteria 6217
445 Ga0157378_10033917 3300013297 Bacteria 4515
446 Ga0157378_10044635 3300013297 Bacteria 3937
447 Ga0157378_10045171 3300013297 Bacteria 3914
448 Ga0157378_10063555 3300013297 Bacteria 3298
449 Ga0157378_10065579 3300013297 Bacteria 3250
450 Ga0157378_10239198 3300013297 Bacteria 1734
451 Ga0163162_10000331 3300013306 Bacteria 43319
452 Ga0163162_10000862 3300013306 Bacteria 28294
453 Ga0163162_10001657 3300013306 Bacteria 20874
454 Ga0163162_10003049 3300013306 Bacteria 16006
455 Ga0163162_10010782 3300013306 Bacteria 8891
456 Ga0163162_10021755 3300013306 Bacteria 6317
457 Ga0163162_10027024 3300013306 Bacteria 5675
458 Ga0163162_10079222 3300013306 Bacteria 3351
459 Ga0163162_10094439 3300013306 Unclassified 3077
460 Ga0163162_10138809 3300013306 Bacteria 2543
461 Ga0163162_10169930 3300013306 Bacteria 2305
462 Ga0163162_10174849 3300013306 Bacteria 2272
463 Ga0163162_10186483 3300013306 Bacteria 2201
464 Ga0163162_10188033 3300013306 Bacteria 2192
465 Ga0163162_10288614 3300013306 Bacteria 1773
466 Ga0163162_10296359 3300013306 Bacteria 1749
467 Ga0163162_10517025 3300013306 Bacteria 1323
468 Ga0163162_10519077 3300013306 Bacteria 1321
469 Ga0163162_10688415 3300013306 Bacteria 1144
470 Ga0163162_10730371 3300013306 Bacteria 1110
471 Ga0163162_11291938 3300013306 Bacteria 829
472 Ga0157372_10002207 3300013307 Bacteria 21135
473 Ga0157372_10003015 3300013307 Bacteria 18158
474 Ga0157372_10008452 3300013307 Bacteria 10927
475 Ga0157372_10016387 3300013307 Bacteria 7950
476 Ga0157372_10023020 3300013307 Bacteria 6751
477 Ga0157372_10063516 3300013307 Unclassified 4140
478 Ga0157372_10090954 3300013307 Unclassified 3470
479 Ga0157372_10155061 3300013307 Bacteria 2645
480 Ga0157372_10200417 3300013307 Bacteria 2312
481 Ga0157372_10214241 3300013307 Bacteria 2232
482 Ga0157372_10217126 3300013307 Bacteria 2216
483 Ga0157372_10226602 3300013307 Bacteria 2167
484 Ga0157372_10226782 3300013307 Bacteria 2166
485 Ga0157372_10250305 3300013307 Unclassified 2057
486 Ga0157372_10250805 3300013307 Bacteria 2054
487 Ga0157372_10267796 3300013307 Bacteria 1984
488 Ga0157372_10327005 3300013307 Bacteria 1785
489 Ga0157372_10472836 3300013307 Bacteria 1461
490 Ga0157372_10662367 3300013307 Bacteria 1215
491 Ga0157372_10993600 3300013307 Bacteria 972
492 Ga0157375_10000403 3300013308 Bacteria 39237
493 Ga0157375_10005688 3300013308 Bacteria 10848
494 Ga0157375_10053259 3300013308 Bacteria 3980
495 Ga0157375_10118034 3300013308 Bacteria 2759
496 Ga0157375_10139637 3300013308 Bacteria 2549
497 Ga0157375_10152036 3300013308 Bacteria 2451
498 Ga0157375_10184290 3300013308 Bacteria 2240
499 Ga0157375_10255619 3300013308 Bacteria 1913
500 Ga0157375_10272991 3300013308 Bacteria 1853
501 Ga0157375_10370360 3300013308 Bacteria 1599
502 Ga0157375_11194148 3300013308 Unclassified 892
503 Ga0163163_10000399 3300014325 Bacteria 41026
504 Ga0163163_10000653 3300014325 Bacteria 29691
505 Ga0163163_10050638 3300014325 Bacteria 4090
506 Ga0163163_10122936 3300014325 Unclassified 2630
507 Ga0163163_10548107 3300014325 Bacteria 1219
508 Ga0163163_10725400 3300014325 Bacteria 1057
509 Ga0157380_10005370 3300014326 Bacteria 8953
510 Ga0157380_10006261 3300014326 Bacteria 8358
511 Ga0157380_10067509 3300014326 Bacteria 2880
512 Ga0157380_10537331 3300014326 Bacteria 1144
513 Ga0157380_11187241 3300014326 Bacteria 806
514 Ga0157377_10012052 3300014745 Bacteria 4337
515 Ga0157377_10020354 3300014745 Bacteria 3475
516 Ga0157377_10057005 3300014745 Bacteria 2220
517 Ga0157377_10103353 3300014745 Bacteria 1702
518 Ga0157377_10138434 3300014745 Bacteria 1494
519 Ga0157377_10151268 3300014745 Bacteria 1435
520 Ga0157377_10158057 3300014745 Bacteria 1407
521 Ga0157377_10285922 3300014745 Bacteria 1083
522 Ga0157379_10007752 3300014968 Bacteria 9297
523 Ga0157379_10020556 3300014968 Bacteria 5840
524 Ga0157379_10038671 3300014968 Bacteria 4256
525 Ga0157379_10093054 3300014968 Bacteria 2704
526 Ga0157379_10151722 3300014968 Bacteria 2090
527 Ga0157379_10261991 3300014968 Bacteria 1571
528 Ga0157379_10823817 3300014968 Bacteria 877
529 Ga0157376_10014600 3300014969 Bacteria 5900
530 Ga0157376_10020948 3300014969 Bacteria 5069
531 Ga0157376_10050787 3300014969 Bacteria 3442
532 Ga0157376_10059697 3300014969 Unclassified 3198
533 Ga0157376_10071222 3300014969 Bacteria 2953
534 Ga0157376_10075952 3300014969 Bacteria 2869
535 Ga0157376_10221522 3300014969 Bacteria 1752
536 Ga0157376_10351249 3300014969 Bacteria 1411
537 Ga0157376_10356890 3300014969 Bacteria 1401
538 Ga0157376_10387147 3300014969 Bacteria 1348
539 Ga0157376_10444559 3300014969 Bacteria 1263
540 Ga0157376_10461803 3300014969 Bacteria 1241
541 Ga0157376_10535006 3300014969 Bacteria 1157
542 Ga0163161_10003834 3300017792 Bacteria 10540
543 Ga0163161_10031281 3300017792 Bacteria 3791
544 Ga0163161_10065804 3300017792 Bacteria 2645
545 Ga0163161_10072654 3300017792 Bacteria 2519
546 Ga0163161_10086657 3300017792 Bacteria 2312
547 Ga0163161_10184256 3300017792 Bacteria 1602
548 Ga0163161_10431853 3300017792 Bacteria 1062
549 Ga0163161_10500033 3300017792 Bacteria 990
550 Ga0163161_10568157 3300017792 Bacteria 931
551 Ga0213876_10005738 3300021384 Bacteria 6800
552 Ga0209436_102603 3300025208 Bacteria 5303
553 Ga0207666_1004620 3300025271 Bacteria 1732
554 Ga0209673_1000016 3300025273 Bacteria 506202
555 Ga0209130_1003624 3300025284 Bacteria 6405
556 Ga0209564_1006250 3300025295 Bacteria 6495
557 Ga0209564_1027158 3300025295 Bacteria 1867
558 Ga0209758_1005921 3300025297 Bacteria 9090
559 Ga0209758_1011914 3300025297 Bacteria 4951
560 Ga0209050_1000616 3300025298 Bacteria 55934
561 Ga0207426_1000139 3300025302 Bacteria 195835
562 Ga0207426_1031851 3300025302 Bacteria 1717
563 Ga0207426_1038833 3300025302 Bacteria 1496
564 Ga0209051_1014936 3300025303 Bacteria 3600
565 Ga0209257_1006990 3300025304 Bacteria 7020
566 Ga0207697_10000488 3300025315 Bacteria 22401
567 Ga0207697_10055345 3300025315 Bacteria 1645
568 Ga0207656_10003445 3300025321 Bacteria 5436
569 Ga0207656_10026721 3300025321 Bacteria 2356
570 Ga0207656_10198205 3300025321 Unclassified 969
571 Ga0207682_10007523 3300025893 Bacteria 4334
572 Ga0207682_10016325 3300025893 Bacteria 2896
573 Ga0207682_10274833 3300025893 Bacteria 787
574 Ga0207642_10397851 3300025899 Bacteria 824
575 Ga0207710_10006861 3300025900 Bacteria 4847
576 Ga0207688_10287719 3300025901 Bacteria 1003
577 Ga0207680_10000877 3300025903 Bacteria 14203
578 Ga0207680_10023815 3300025903 Bacteria 3350
579 Ga0207680_10168230 3300025903 Bacteria 1475
580 Ga0207680_10186892 3300025903 Bacteria 1404
581 Ga0207680_10230038 3300025903 Bacteria 1274
582 Ga0207647_10000530 3300025904 Bacteria 30443
583 Ga0207647_10055791 3300025904 Bacteria 2426
584 Ga0207647_10194583 3300025904 Bacteria 1174
585 Ga0207645_10007828 3300025907 Bacteria 7514
586 Ga0207645_10010367 3300025907 Bacteria 6398
587 Ga0207645_10065949 3300025907 Bacteria 2314
588 Ga0207643_10005004 3300025908 Bacteria 7097
589 Ga0207643_10008998 3300025908 Bacteria 5361
590 Ga0207643_10103057 3300025908 Bacteria 1675
591 Ga0207705_10071276 3300025909 Bacteria 2519
592 Ga0207705_10103349 3300025909 Unclassified 2099
593 Ga0207705_10145746 3300025909 Bacteria 1771
594 Ga0207705_10198948 3300025909 Bacteria 1518
595 Ga0207705_10322142 3300025909 Bacteria 1188
596 Ga0207654_10000483 3300025911 Bacteria 22768
597 Ga0207654_10008469 3300025911 Bacteria 5201
598 Ga0207654_10036518 3300025911 Bacteria 2746
599 Ga0207654_10094548 3300025911 Bacteria 1829
600 Ga0207707_10000051 3300025912 Bacteria 117204
601 Ga0207707_10000490 3300025912 Bacteria 40927
602 Ga0207707_10149703 3300025912 Bacteria 2041
603 Ga0207695_10000071 3300025913 Bacteria 315568
604 Ga0207695_10000084 3300025913 Bacteria 282392
605 Ga0207695_10000323 3300025913 Bacteria 114265
606 Ga0207695_10004025 3300025913 Bacteria 20234
607 Ga0207695_10007684 3300025913 Bacteria 13656
608 Ga0207695_10009590 3300025913 Bacteria 11959
609 Ga0207695_10020243 3300025913 Bacteria 7626
610 Ga0207695_10029916 3300025913 Bacteria 6007
611 Ga0207695_10044514 3300025913 Bacteria 4720
612 Ga0207695_10051643 3300025913 Bacteria 4314
613 Ga0207695_10075438 3300025913 Bacteria 3431
614 Ga0207695_11042968 3300025913 Bacteria 697
615 Ga0207671_10000036 3300025914 Bacteria 236133
616 Ga0207671_10001044 3300025914 Bacteria 33679
617 Ga0207671_10002316 3300025914 Bacteria 20539
618 Ga0207671_10004890 3300025914 Bacteria 12594
619 Ga0207671_10076294 3300025914 Bacteria 2508
620 Ga0207671_10095635 3300025914 Bacteria 2243
621 Ga0207671_10114913 3300025914 Bacteria 2052
622 Ga0207671_10416835 3300025914 Bacteria 1068
623 Ga0207660_10000371 3300025917 Bacteria 29362
624 Ga0207660_10386831 3300025917 Bacteria 1125
625 Ga0207662_10034747 3300025918 Bacteria 2942
626 Ga0207662_10047254 3300025918 Bacteria 2549
627 Ga0207657_10004060 3300025919 Bacteria 15540
628 Ga0207657_10013726 3300025919 Bacteria 7930
629 Ga0207649_10014996 3300025920 Bacteria 4351
630 Ga0207649_10165059 3300025920 Bacteria 1538
631 Ga0207652_10000045 3300025921 Bacteria 125343
632 Ga0207652_10001693 3300025921 Bacteria 19292
633 Ga0207652_10030239 3300025921 Bacteria 4534
634 Ga0207681_10063297 3300025923 Bacteria 2550
635 Ga0207681_10066545 3300025923 Bacteria 2495
636 Ga0207681_10206386 3300025923 Bacteria 1512
637 Ga0207681_10573228 3300025923 Bacteria 930
638 Ga0207694_10030500 3300025924 Bacteria 4119
639 Ga0207694_10055666 3300025924 Bacteria 3070
640 Ga0207650_10018352 3300025925 Bacteria 4909
641 Ga0207650_10040160 3300025925 Bacteria 3422
642 Ga0207650_10041209 3300025925 Unclassified 3382
643 Ga0207650_10107927 3300025925 Bacteria 2151
644 Ga0207650_10134118 3300025925 Bacteria 1940
645 Ga0207650_10269341 3300025925 Bacteria 1384
646 Ga0207650_10317384 3300025925 Bacteria 1275
647 Ga0207650_10339615 3300025925 Bacteria 1233
648 Ga0207650_10393722 3300025925 Unclassified 1146
649 Ga0207650_10480527 3300025925 Bacteria 1037
650 Ga0207650_10494828 3300025925 Bacteria 1021
651 Ga0207659_10048360 3300025926 Bacteria 3012
652 Ga0207644_10081611 3300025931 Bacteria 2390
653 Ga0207644_10113203 3300025931 Bacteria 2054
654 Ga0207644_10218698 3300025931 Bacteria 1509
655 Ga0207644_10788384 3300025931 Bacteria 795
656 Ga0207690_10103340 3300025932 Bacteria 2039
657 Ga0207690_10142865 3300025932 Bacteria 1766
658 Ga0207690_10145816 3300025932 Bacteria 1750
659 Ga0207690_10520402 3300025932 Bacteria 964
660 Ga0207690_10576843 3300025932 Bacteria 916
661 Ga0207706_10009485 3300025933 Bacteria 8938
662 Ga0207706_10023276 3300025933 Bacteria 5563
663 Ga0207706_10074803 3300025933 Bacteria 2978
664 Ga0207706_10109750 3300025933 Unclassified 2428
665 Ga0207706_10220171 3300025933 Bacteria 1662
666 Ga0207706_10318661 3300025933 Unclassified 1353
667 Ga0207706_10802784 3300025933 Bacteria 799
668 Ga0207686_10059242 3300025934 Unclassified 2418
669 Ga0207686_10217673 3300025934 Bacteria 1377
670 Ga0207670_10069648 3300025936 Bacteria 2427
671 Ga0207670_10081645 3300025936 Bacteria 2263
672 Ga0207670_10094353 3300025936 Bacteria 2123
673 Ga0207670_10134098 3300025936 Bacteria 1818
674 Ga0207669_10002940 3300025937 Bacteria 7318
675 Ga0207669_10214850 3300025937 Bacteria 1407
676 Ga0207704_10057241 3300025938 Unclassified 2394
677 Ga0207704_10347434 3300025938 Bacteria 1154
678 Ga0207704_10510989 3300025938 Bacteria 970
679 Ga0207691_10003785 3300025940 Bacteria 14692
680 Ga0207691_10006538 3300025940 Bacteria 11250
681 Ga0207691_10181605 3300025940 Bacteria 1838
682 Ga0207691_10185184 3300025940 Bacteria 1818
683 Ga0207691_10374224 3300025940 Bacteria 1216
684 Ga0207691_10470916 3300025940 Bacteria 1068
685 Ga0207691_10555539 3300025940 Bacteria 973
686 Ga0207689_10007246 3300025942 Bacteria 9741
687 Ga0207689_10012105 3300025942 Bacteria 7386
688 Ga0207689_10015970 3300025942 Bacteria 6354
689 Ga0207689_10025044 3300025942 Bacteria 5002
690 Ga0207689_10033718 3300025942 Bacteria 4253
691 Ga0207689_10042397 3300025942 Bacteria 3765
692 Ga0207689_10045723 3300025942 Bacteria 3619
693 Ga0207689_10830830 3300025942 Bacteria 780
694 Ga0207661_10017642 3300025944 Bacteria 5288
695 Ga0207661_10018282 3300025944 Bacteria 5206
696 Ga0207661_10046148 3300025944 Unclassified 3454
697 Ga0207661_10048995 3300025944 Bacteria 3361
698 Ga0207661_10279507 3300025944 Bacteria 1492
699 Ga0207679_10000660 3300025945 Bacteria 23125
700 Ga0207679_10031627 3300025945 Bacteria 3706
701 Ga0207679_10318293 3300025945 Bacteria 1346
702 Ga0207679_10533605 3300025945 Bacteria 1051
703 Ga0207679_10872712 3300025945 Bacteria 822
704 Ga0207667_10001672 3300025949 Bacteria 27944
705 Ga0207667_10002100 3300025949 Bacteria 24981
706 Ga0207667_10018760 3300025949 Bacteria 7747
707 Ga0207667_10021218 3300025949 Bacteria 7200
708 Ga0207667_10083528 3300025949 Unclassified 3307
709 Ga0207667_10186397 3300025949 Bacteria 2130
710 Ga0207667_10188239 3300025949 Bacteria 2118
711 Ga0207667_10324348 3300025949 Bacteria 1573
712 Ga0207667_10902934 3300025949 Bacteria 875
713 Ga0207651_10012113 3300025960 Bacteria 4862
714 Ga0207651_10024476 3300025960 Bacteria 3736
715 Ga0207651_10085369 3300025960 Bacteria 2290
716 Ga0207651_10197856 3300025960 Bacteria 1608
717 Ga0207651_10281110 3300025960 Bacteria 1375
718 Ga0207651_10421014 3300025960 Bacteria 1140
719 Ga0207712_10001659 3300025961 Bacteria 14937
720 Ga0207712_10013905 3300025961 Bacteria 5162
721 Ga0207712_10015160 3300025961 Bacteria 4967
722 Ga0207712_10020106 3300025961 Bacteria 4369
723 Ga0207712_10052105 3300025961 Bacteria 2865
724 Ga0207712_10052992 3300025961 Bacteria 2844
725 Ga0207712_10080594 3300025961 Bacteria 2368
726 Ga0207668_10000843 3300025972 Bacteria 18537
727 Ga0207668_10099307 3300025972 Bacteria 2159
728 Ga0207668_10106907 3300025972 Bacteria 2091
729 Ga0207668_10299748 3300025972 Bacteria 1326
730 Ga0207668_10748372 3300025972 Unclassified 862
731 Ga0207640_10032898 3300025981 Bacteria 3220
732 Ga0207640_10040439 3300025981 Bacteria 2958
733 Ga0207640_10171534 3300025981 Bacteria 1617
734 Ga0207640_10376852 3300025981 Bacteria 1148
735 Ga0207640_10567559 3300025981 Unclassified 956
736 Ga0207640_10902303 3300025981 Bacteria 772
737 Ga0207658_10028138 3300025986 Bacteria 3956
738 Ga0207658_10039424 3300025986 Bacteria 3408
739 Ga0207658_10063161 3300025986 Bacteria 2774
740 Ga0207658_10303416 3300025986 Bacteria 1376
741 Ga0207658_10339937 3300025986 Bacteria 1304
742 Ga0207658_10443123 3300025986 Bacteria 1148
743 Ga0207658_10622051 3300025986 Bacteria 971
744 Ga0207658_10743939 3300025986 Bacteria 888
745 Ga0207658_11031683 3300025986 Bacteria 751
746 Ga0207677_10010298 3300026023 Bacteria 5288
747 Ga0207677_10037285 3300026023 Bacteria 3176
748 Ga0207677_10049026 3300026023 Unclassified 2847
749 Ga0207677_10094706 3300026023 Unclassified 2180
750 Ga0207677_10118789 3300026023 Unclassified 1984
751 Ga0207677_10247587 3300026023 Bacteria 1446
752 Ga0207677_10321980 3300026023 Unclassified 1285
753 Ga0207677_10516772 3300026023 Bacteria 1035
754 Ga0207703_10034699 3300026035 Bacteria 4004
755 Ga0207703_10079799 3300026035 Bacteria 2724
756 Ga0207703_10126015 3300026035 Bacteria 2205
757 Ga0207703_10926991 3300026035 Bacteria 834
758 Ga0207639_10002030 3300026041 Bacteria 13645
759 Ga0207639_10027999 3300026041 Bacteria 4110
760 Ga0207639_10057303 3300026041 Bacteria 2991
761 Ga0207639_10083325 3300026041 Bacteria 2538
762 Ga0207639_10338162 3300026041 Bacteria 1341
763 Ga0207639_10491026 3300026041 Bacteria 1120
764 Ga0207639_10551997 3300026041 Unclassified 1058
765 Ga0207639_10645764 3300026041 Bacteria 979
766 Ga0207639_11065462 3300026041 Bacteria 758
767 Ga0207678_10094288 3300026067 Bacteria 2558
768 Ga0207678_10214913 3300026067 Bacteria 1645
769 Ga0207678_10416713 3300026067 Bacteria 1164
770 Ga0207678_10513936 3300026067 Bacteria 1045
771 Ga0207708_10175955 3300026075 Bacteria 1697
772 Ga0207708_10312799 3300026075 Bacteria 1280
773 Ga0207702_10078821 3300026078 Bacteria 2853
774 Ga0207702_10313212 3300026078 Bacteria 1493
775 Ga0207641_10000212 3300026088 Bacteria 75285
776 Ga0207641_10001311 3300026088 Bacteria 24595
777 Ga0207641_10061188 3300026088 Bacteria 3211
778 Ga0207641_10182128 3300026088 Bacteria 1925
779 Ga0207641_10201275 3300026088 Bacteria 1836
780 Ga0207641_10279064 3300026088 Bacteria 1571
781 Ga0207641_10602960 3300026088 Bacteria 1075
782 Ga0207648_10075008 3300026089 Bacteria 2949
783 Ga0207648_10075058 3300026089 Bacteria 2948
784 Ga0207648_10112020 3300026089 Bacteria 2396
785 Ga0207648_10113991 3300026089 Bacteria 2375
786 Ga0207648_10114302 3300026089 Bacteria 2371
787 Ga0207648_10114994 3300026089 Bacteria 2364
788 Ga0207648_10146780 3300026089 Bacteria 2081
789 Ga0207648_10536631 3300026089 Bacteria 1073
790 Ga0207648_11176366 3300026089 Bacteria 720
791 Ga0207676_10003111 3300026095 Bacteria 11837
792 Ga0207676_10003477 3300026095 Bacteria 11144
793 Ga0207676_10041742 3300026095 Bacteria 3524
794 Ga0207676_10060656 3300026095 Bacteria 2993
795 Ga0207676_10363014 3300026095 Bacteria 1343
796 Ga0207676_10471210 3300026095 Bacteria 1187
797 Ga0207674_10000672 3300026116 Bacteria 44419
798 Ga0207674_10002807 3300026116 Bacteria 21671
799 Ga0207674_10035026 3300026116 Bacteria 5241
800 Ga0207674_10042103 3300026116 Bacteria 4720
801 Ga0207674_10044802 3300026116 Unclassified 4556
802 Ga0207674_10054325 3300026116 Bacteria 4078
803 Ga0207674_10102557 3300026116 Bacteria 2841
804 Ga0207675_100000326 3300026118 Bacteria 45358
805 Ga0207675_100050510 3300026118 Bacteria 3880
806 Ga0207675_100060492 3300026118 Bacteria 3536
807 Ga0207675_100282870 3300026118 Bacteria 1612
808 Ga0207675_100914214 3300026118 Bacteria 894
809 Ga0207683_10012945 3300026121 Bacteria 7122
810 Ga0207683_10043838 3300026121 Bacteria 3910
811 Ga0207683_10077012 3300026121 Bacteria 2953
812 Ga0207683_10123695 3300026121 Bacteria 2323
813 Ga0207683_10142757 3300026121 Bacteria 2158
814 Ga0207683_10241993 3300026121 Unclassified 1646
815 Ga0207698_10014057 3300026142 Bacteria 5307
816 Ga0207698_10015761 3300026142 Bacteria 5075
817 Ga0207698_10124852 3300026142 Bacteria 2186
818 Ga0207698_10130934 3300026142 Bacteria 2143
819 Ga0207698_10167819 3300026142 Bacteria 1929
820 Ga0207698_10178818 3300026142 Bacteria 1877
821 Ga0207698_10236868 3300026142 Bacteria 1661
822 Ga0207698_10260335 3300026142 Bacteria 1593
823 Ga0207698_10430363 3300026142 Unclassified 1269
824 Ga0207698_10645732 3300026142 Bacteria 1048
825 Ga0207698_10892692 3300026142 Bacteria 896
826 Ga0207428_10037411 3300027907 Bacteria 3948
827 Ga0268266_10000049 3300028379 Bacteria 307763
828 Ga0268266_10548555 3300028379 Bacteria 1107
829 Ga0268265_10525583 3300028380 Bacteria 1119
830 Ga0268265_10632011 3300028380 Bacteria 1027
831 Ga0268265_10669463 3300028380 Unclassified 999
832 Ga0268264_10000041 3300028381 Bacteria 372501
833 Ga0268264_10002479 3300028381 Bacteria 16221
834 Ga0268264_10003505 3300028381 Bacteria 13525
835 Ga0268264_10003739 3300028381 Bacteria 13067
836 Ga0268264_10007266 3300028381 Bacteria 9270
837 Ga0268264_10007386 3300028381 Bacteria 9179
838 Ga0268264_10067063 3300028381 Bacteria 3028
839 Ga0268264_10210408 3300028381 Unclassified 1785
840 Ga0268264_10303271 3300028381 Unclassified 1504
841 Ga0268264_10351024 3300028381 Bacteria 1404
842 Ga0268264_10636434 3300028381 Bacteria 1054
843 Ga0307517_10232046 3300028786 Bacteria 1106
844 Ga0307515_10000002 3300028794 Bacteria 1231751
845 Ga0307511_10001228 3300030521 Bacteria 27171
846 Ga0307512_10116816 3300030522 Bacteria 1732
847 Ga0265327_10000316 3300031251 Bacteria 92271
848 Ga0307513_10077328 3300031456 Bacteria 3447
849 Ga0307513_10098306 3300031456 Bacteria 2959
850 Ga0307513_10517883 3300031456 Bacteria 908
851 Ga0307509_10087285 3300031507 Bacteria 3205
852 Ga0307509_10097840 3300031507 Bacteria 2982
853 Ga0307509_10104731 3300031507 Bacteria 2853
854 Ga0265313_10036075 3300031595 Bacteria 2484
855 Ga0307516_10001558 3300031730 Bacteria 31533
856 Ga0307516_10077058 3300031730 Bacteria 3184
857 Ga0307406_10167633 3300031901 Bacteria 1586
858 Ga0307411_10476522 3300032005 Bacteria 1050
859 Ga0307411_10868994 3300032005 Bacteria 799
860 Ga0307415_100021044 3300032126 Bacteria 3999
861 Ga0307510_10000217 3300033180 Bacteria 51069
862 Ga0373943_0061340 3300035170 Bacteria 1880
863 Ga0373943_0391542 3300035170 Bacteria 801
864 Ga0373924_0029480 3300035410 Bacteria 2194
865 Ga0373937_0455425 3300036401 Bacteria 1215
866 Ga0395900_0001468 3300037418 Bacteria 28127
867 Ga0395900_0041360 3300037418 Bacteria 4752
868 Ga0395898_0001670 3300037466 Bacteria 29744
869 Ga0395905_0177870 3300037471 Bacteria 1997
870 Ga0395901_0001174 3300038443 Bacteria 27840
871 Ga0395901_0425187 3300038443 Bacteria 1362
872 Ga0395901_0745858 3300038443 Bacteria 973
873 Ga0436365_0168773 3300039437 Bacteria 712
874 Ga0436365_0246639 3300039437 Bacteria 834
875 Ga0436365_0591026 3300039437 Bacteria 18814
876 Ga0436365_1248268 3300039437 Bacteria 25465
877 Ga0436365_1724629 3300039437 Unclassified 1468
878 Ga0439436_0019019 3300041404 Bacteria 2052
879 Ga0451789_0528288 3300041443 Bacteria 679
880 Ga0451833_1275392 3300041491 Bacteria 915
881 Ga0451837_0610310 3300041494 Bacteria 755
882 Ga0451849_0024587 3300041505 Bacteria 1338
883 Ga0451855_1789405 3300041511 Bacteria 3129
884 Ga0439441_007968 3300042001 Bacteria 1721
885 Ga0439449_0050281 3300042007 Bacteria 1542
886 Ga0439457_001674 3300042014 Bacteria 6577
887 Ga0439462_0028345 3300042015 Bacteria 1480
888 Ga0439462_0060813 3300042015 Bacteria 1022
889 Ga0439434_0102735 3300042435 Bacteria 922
890 Ga0451577_0008492 3300042876 Bacteria 9999
891 Ga0451577_0082716 3300042876 Bacteria 2864
892 Ga0451577_0089816 3300042876 Bacteria 2742
893 Ga0466972_0000207 3300044658 Bacteria 42277
894 Ga0466972_0000469 3300044658 Bacteria 20427
895 Ga0466972_0115966 3300044658 Bacteria 1264
896 Ga0466965_0070490 3300044683 Bacteria 1757
897 Ga0466966_0001667 3300044684 Bacteria 14318
898 Ga0466961_0160958 3300044693 Bacteria 1399
899 Ga0466961_0220450 3300044693 Bacteria 1169
900 Ga0466961_0330291 3300044693 Bacteria 929
901 Ga0466964_0319287 3300044706 Bacteria 789
902 Ga0453684_0012189 3300044712 Bacteria 14256
903 Ga0453684_0701361 3300044712 Bacteria 1100
904 Ga0466968_0028617 3300044735 Bacteria 2299
905 Ga0466960_0260317 3300044901 Bacteria 966
906 Ga0466959_0000002 3300045049 Bacteria 362671
907 Ga0466959_0194517 3300045049 Bacteria 1414
908 Ga0495603_0055250 3300046455 Bacteria 2353
909 Ga0495638_0113799 3300046460 Bacteria 1605
910 Ga0495638_0145809 3300046460 Bacteria 1377
911 Ga0495653_0211395 3300046463 Bacteria 1310
912 Ga0495580_0151990 3300046472 Bacteria 1604
913 Ga0495594_0100148 3300046499 Bacteria 1630
914 Ga0495606_0018941 3300046507 Bacteria 5143
915 Ga0495608_0067081 3300046511 Bacteria 2348
916 Ga0495628_0013274 3300046516 Bacteria 6929
917 Ga0495630_0054622 3300046517 Bacteria 2992
918 Ga0495648_0003830 3300046524 Bacteria 13054
919 Ga0495587_0171142 3300046536 Bacteria 1234
920 Ga0495621_0031193 3300046539 Bacteria 1827
921 Ga0495622_0069730 3300046557 Bacteria 1623
922 Ga0495668_0000459 3300046616 Bacteria 52226
923 Ga0495634_0031752 3300046642 Bacteria 3636
924 Ga0495611_0000090 3300046648 Bacteria 63531
925 Ga0495611_0023013 3300046648 Bacteria 2700
926 Ga0495625_0069055 3300046660 Bacteria 2483
927 Ga0495672_0009967 3300047320 Bacteria 6816
928 Ga0495672_0026413 3300047320 Bacteria 3705
929 Ga0495672_0063586 3300047320 Bacteria 2117
930 Ga0495672_0076601 3300047320 Bacteria 1878
931 Ga0495687_000001 3300047443 Bacteria 1215582
932 Ga0495686_0013476 3300047472 Bacteria 5669
933 Ga0495686_0239443 3300047472 Bacteria 1024
934 Ga0496101_0068362 3300048904 Bacteria 2597
935 Ga0496108_0417943 3300048911 Bacteria 1171
936 Ga0496109_0233204 3300048912 Unclassified 1732
937 Ga0501298_010178 3300049521 Bacteria 1613
938 Ga0501033_0044752 3300049570 Bacteria 3295
939 Ga0501033_0525137 3300049570 Bacteria 817
940 Ga0501034_0000002 3300049571 Bacteria 565510
941 Ga0501034_0036199 3300049571 Bacteria 5001
942 Ga0501034_0040916 3300049571 Bacteria 4689
943 Ga0501034_0067326 3300049571 Bacteria 3594
944 Ga0501034_0152616 3300049571 Bacteria 2285
945 Ga0501036_0002265 3300049572 Bacteria 15035
946 Ga0501037_0108656 3300049573 Bacteria 1998
947 Ga0501038_0029035 3300049574 Bacteria 4906
948 Ga0501043_0019215 3300049579 Bacteria 5364
949 Ga0501043_0224894 3300049579 Bacteria 1451
950 Ga0501046_0014249 3300049580 Bacteria 6715
951 Ga0501047_0049725 3300049581 Bacteria 4047
952 Ga0501047_0364165 3300049581 Bacteria 1281
953 Ga0501048_0005214 3300049582 Bacteria 9901
954 Ga0501048_0521956 3300049582 Bacteria 852
955 Ga0501067_0101704 3300049583 Unclassified 1597
956 Ga0501070_0004566 3300049586 Bacteria 11872
957 Ga0501070_0142025 3300049586 Bacteria 1982
958 Ga0501070_0845273 3300049586 Bacteria 716
959 Ga0501072_0042730 3300049588 Bacteria 3561
960 Ga0501073_0021169 3300049589 Bacteria 4689
961 Ga0501074_0008635 3300049590 Bacteria 7379
962 Ga0501074_0032245 3300049590 Bacteria 3796
963 Ga0501198_014611 3300049649 Bacteria 1198
964 Ga0501202_000088 3300049652 Bacteria 10001
965 Ga0501217_000307 3300049661 Bacteria 7778
966 Ga0501222_004413 3300049662 Bacteria 1910
967 Ga0501223_004563 3300049663 Bacteria 2951
968 Ga0501233_016917 3300049668 Bacteria 1517
969 Ga0501242_000045 3300049674 Bacteria 7825
970 Ga0501250_002675 3300049680 Bacteria 1636
971 Ga0501252_001448 3300049682 Bacteria 2190
972 Ga0501257_016256 3300049686 Bacteria 1725
973 Ga0501257_019994 3300049686 Bacteria 1569
974 Ga0501257_028791 3300049686 Bacteria 1333
975 Ga0501261_000243 3300049690 Bacteria 7492
976 Ga0501221_000246 3300049704 Bacteria 7890
977 Ga0501225_0045695 3300049705 Bacteria 1213
978 Ga0501234_001444 3300049707 Bacteria 3733
979 Ga0501079_0122554 3300049741 Bacteria 2022
980 Ga0501079_0178029 3300049741 Bacteria 1659
981 Ga0501080_0034986 3300049742 Bacteria 4689
982 Ga0501083_0028952 3300049744 Bacteria 3814
983 Ga0501083_0035414 3300049744 Bacteria 3410
984 Ga0501266_004571 3300049763 Bacteria 1717
985 Ga0501268_032506 3300049765 Bacteria 951
986 Ga0501279_009074 3300049775 Bacteria 1331
987 Ga0501035_0037902 3300049822 Bacteria 4364
988 Ga0501044_0012075 3300049823 Bacteria 9356
989 Ga0501044_0039771 3300049823 Unclassified 4904
990 Ga0501044_0094530 3300049823 Unclassified 3014
991 Ga0501044_0182740 3300049823 Bacteria 2063
992 Ga0501044_0266994 3300049823 Bacteria 1648
993 Ga0501044_0324204 3300049823 Bacteria 1464
994 Ga0501044_0355076 3300049823 Bacteria 1385
995 Ga0501044_0533723 3300049823 Bacteria 1072
996 Ga0501045_0085055 3300049824 Bacteria 2334
997 Ga0501284_00021 3300050005 Bacteria 89729
998 nmdc:mga0k408_110246_c1 3300050493 Bacteria 1627
999 nmdc:mga0k408_337123_c1 3300050493 Bacteria 899
1000 nmdc:mga0k408_384732_c1 3300050493 Unclassified 836
1001 nmdc:mga05p37_299061_c1 3300050507 Bacteria 1913
1002 nmdc:mga05p37_3833_c1 3300050507 Bacteria 17590
1003 nmdc:mga05p37_89890_c1 3300050507 Bacteria 3784
1004 nmdc:mga09592_118468_c1 3300050508 Bacteria 2273
1005 nmdc:mga0qj67_35464_c1 3300050509 Bacteria 3900
1006 nmdc:mga0qj67_385449_c1 3300050509 Bacteria 1132
1007 nmdc:mga06r32_69155_c1 3300050510 Bacteria 3412
1008 nmdc:mga08y16_40834_c1 3300050511 Unclassified 4861
1009 nmdc:mga08y16_759985_c1 3300050511 Bacteria 965
1010 nmdc:mga0n895_148980_c1 3300050512 Bacteria 2369
1011 Ga0495619_0016556 3300053085 Bacteria 4668
1012 Ga0500578_0000694 3300053086 Bacteria 40191
1013 Ga0500578_0097000 3300053086 Bacteria 1868
1014 Ga0500644_0141293 3300053088 Bacteria 957
1015 Ga0500646_0057636 3300053090 Bacteria 1135
1016 Ga0500583_0000059 3300053092 Bacteria 68222
1017 Ga0500583_0000379 3300053092 Bacteria 14546
1018 Ga0500583_0012380 3300053092 Bacteria 3253
1019 Ga0500651_0191202 3300053093 Bacteria 1212
1020 Ga0500650_0191595 3300053098 Bacteria 934
1021 Ga0500555_000038 3300053103 Bacteria 70808
1022 Ga0500555_033505 3300053103 Bacteria 1448
1023 Ga0500556_0036860 3300053104 Bacteria 1699
1024 Ga0500642_0004765 3300053130 Bacteria 4292
1025 Ga0500652_024201 3300053131 Bacteria 2316
1026 Ga0500568_0000236 3300053139 Bacteria 47278
1027 Ga0500573_0172627 3300053140 Bacteria 1168
1028 Ga0500588_0133963 3300053146 Unclassified 885
1029 Ga0500589_030930 3300053147 Bacteria 2494
1030 Ga0500616_0000248 3300053153 Bacteria 84268
1031 Ga0500616_0012902 3300053153 Bacteria 4870
1032 Ga0500616_0065196 3300053153 Bacteria 1874
1033 Ga0500622_0020646 3300053156 Bacteria 3498
1034 Ga0500622_0057217 3300053156 Bacteria 1995
1035 Ga0500636_0051649 3300053177 Bacteria 2417
1036 Ga0500636_0267366 3300053177 Bacteria 862
1037 Ga0500637_0120693 3300053178 Bacteria 1521
1038 Ga0500637_0377896 3300053178 Bacteria 744
1039 Ga0500611_000006 3300053727 Bacteria 226069
1040 Ga0500645_000416 3300053730 Bacteria 29452
1041 Ga0500599_003380 3300053736 Bacteria 1943
1042 Ga0501084_0236063 3300054114 Bacteria 1543
1043 Ga0501084_0499043 3300054114 Bacteria 1028
1044 Ga0501082_0862376 3300060353 Bacteria 792
1045 Ga0466962_0068404 3300061719 Bacteria 1696
1046 2819678960 2818991460 Bacteria 7595395
1047 2884792064 2884791551 Bacteria 8511252
1048 2896088559 2896085136 Bacteria 6129793
1049 Ga0163161_10116007
1050 ARCol0yngRDRAFT_1002900
1051 JGI24736J21556_1008050
1052 JGI24739J22299_10000682
1053 JGI24751J29686_10001386
1054 JGI25153J46596_10009265
1055 JGI25153J46596_10052922
1056 rootH1_10086091
1057 rootH2_10014568
1058 rootH2_10042606
1059 rootH2_10077502
1060 rootH2_10084580
1061 rootL2_10007556
1062 rootL2_10245585
1063 rootH1_10038857
1064 rootH1_10072926
1065 rootH1_10073999
1066 JGI25160J50197_1000883
1067 JGI25160J50197_1016652
1068 Ga0055526_1016976
1069 Ga0055528_1000481
1070 Ga0055530_10067843
1071 Ga0055543_1016228
1072 Ga0065165_1000228
1073 Ga0065714_10124544
1074 Ga0065704_10227980
1075 Ga0065712_10014868
1076 Ga0065712_10087928
1077 Ga0065712_10137176
1078 Ga0065712_10203207
1079 Ga0065707_10016744
1080 Ga0070658_10099229
1081 Ga0070658_10117693
1082 Ga0070658_10305196
1083 Ga0070658_10545980
1084 Ga0070658_10922590
1085 Ga0070676_10044940
1086 Ga0070676_10124222
1087 Ga0070676_10144146
1088 Ga0070676_10224076
1089 Ga0070683_100008791
1090 Ga0070683_100039507
1091 Ga0070683_100555264
1092 Ga0070690_100016704
1093 Ga0070670_100016861
1094 Ga0070670_100055775
1095 Ga0070670_100152746
1096 Ga0070670_100164272
1097 Ga0070670_100336416
1098 Ga0070670_100558697
1099 Ga0068869_100062872
1100 Ga0068869_100165888
1101 Ga0068869_100170468
1102 Ga0068869_100319674
1103 Ga0068869_100363721
1104 Ga0070666_10001517
1105 Ga0070666_10016406
1106 Ga0070666_10019018
1107 Ga0070666_10103090
1108 Ga0070666_10494461
1109 Ga0070680_100223008
1110 Ga0070680_100325911
1111 Ga0070682_100000525
1112 Ga0070682_100000549
1113 Ga0070682_100066184
1114 Ga0070682_100320427
1115 Ga0068868_100016594
1116 Ga0068868_100037301
1117 Ga0068868_100146050
1118 Ga0068868_100195259
1119 Ga0068868_100284043
1120 Ga0068868_100360829
1121 Ga0070660_100015710
1122 Ga0070660_100108535
1123 Ga0070660_100290700
1124 Ga0070660_100603244
1125 Ga0070689_100015893
1126 Ga0070689_100036250
1127 Ga0070689_100090910
1128 Ga0070689_100152260
1129 Ga0070691_10013755
1130 Ga0070691_10192165
1131 Ga0070687_100008860
1132 Ga0070687_100113402
1133 Ga0070661_100023553
1134 Ga0070661_100058810
1135 Ga0070668_100006539
1136 Ga0070668_100032657
1137 Ga0070668_100049425
1138 Ga0070668_100066202
1139 Ga0070668_100233594
1140 Ga0070668_100374000
1141 Ga0070668_100450350
1142 Ga0070668_100544919
1143 Ga0070669_100020363
1144 Ga0070669_100172850
1145 Ga0070669_100525274
1146 Ga0070675_100040664
1147 Ga0070675_100162645
1148 Ga0070675_100177324
1149 Ga0070671_100058796
1150 Ga0070671_100069049
1151 Ga0070674_100005888
1152 Ga0070674_100078074
1153 Ga0070674_100124296
1154 Ga0070674_100157342
1155 Ga0070674_100188537
1156 Ga0070674_100359509
1157 Ga0070673_100012518
1158 Ga0070673_100060556
1159 Ga0070673_100151338
1160 Ga0070673_100172631
1161 Ga0070673_100239328
1162 Ga0070673_100316430
1163 Ga0070688_100016934
1164 Ga0070688_100081906
1165 Ga0070659_100011635
1166 Ga0070659_100024976
1167 Ga0070659_100084683
1168 Ga0070667_100025205
1169 Ga0070667_100277325
1170 Ga0070667_100306751
1171 Ga0070667_100337049
1172 Ga0070713_100360684
1173 Ga0070701_10320473
1174 Ga0070705_100203581
1175 Ga0070700_100104436
1176 Ga0070700_100286381
1177 Ga0070663_100092978
1178 Ga0070663_100348021
1179 Ga0070663_100358522
1180 Ga0070678_100042123
1181 Ga0070678_100110704
1182 Ga0070678_100217699
1183 Ga0070678_100407376
1184 Ga0070662_100017167
1185 Ga0070662_100270784
1186 Ga0070662_100661235
1187 Ga0070662_101067575
1188 Ga0070681_10029846
1189 Ga0070681_10285741
1190 Ga0070681_10483815
1191 Ga0068867_100023813
1192 Ga0068867_100024822
1193 Ga0068867_100066329
1194 Ga0068867_100078570
1195 Ga0068867_100171923
1196 Ga0068867_100226514
1197 Ga0068867_100463992
1198 Ga0068867_100622036
1199 Ga0070685_10005545
1200 Ga0070685_10024336
1201 Ga0070685_10131001
1202 Ga0070698_100016231
1203 Ga0070698_100017582
1204 Ga0070698_100018248
1205 Ga0070699_100256212
1206 Ga0070679_100000367
1207 Ga0070679_100003068
1208 Ga0070679_100038459
1209 Ga0070679_100647243
1210 Ga0070684_100007425
1211 Ga0070684_100029638
1212 Ga0070684_100601592
1213 Ga0070684_100752307
1214 Ga0068853_100000221
1215 Ga0068853_100002087
1216 Ga0068853_100019176
1217 Ga0068853_100061272
1218 Ga0068853_100073002
1219 Ga0068853_100183339
1220 Ga0068853_100199808
1221 Ga0068853_100217559
1222 Ga0068853_100393664
1223 Ga0068853_100441005
1224 Ga0068853_100872992
1225 Ga0070672_100001464
1226 Ga0070672_100069744
1227 Ga0070672_100093336
1228 Ga0070672_100116709
1229 Ga0070672_100134167
1230 Ga0070672_100201353
1231 Ga0070672_100293358
1232 Ga0070672_100953589
1233 Ga0070686_100004288
1234 Ga0070686_100065269
1235 Ga0070686_100114670
1236 Ga0070686_100369592
1237 Ga0070686_100477613
1238 Ga0070686_100485530
1239 Ga0070686_100796273
1240 Ga0070696_100312735
1241 Ga0070693_100003508
1242 Ga0070665_100000001
1243 Ga0070665_100026357
1244 Ga0068855_100004630
1245 Ga0068855_100027234
1246 Ga0068855_100035742
1247 Ga0068855_100042983
1248 Ga0068855_100108675
1249 Ga0068855_100157104
1250 Ga0068855_100468964
1251 Ga0068855_100543839
1252 Ga0070664_100008111
1253 Ga0070664_100031077
1254 Ga0070664_100208558
1255 Ga0070664_100239557
1256 Ga0070664_100295104
1257 Ga0070664_100398592
1258 Ga0070664_100467246
1259 Ga0070664_100492630
1260 Ga0068857_100001119
1261 Ga0068857_100025593
1262 Ga0068857_100046345
1263 Ga0068857_100052392
1264 Ga0068857_100114779
1265 Ga0068857_100262825
1266 Ga0068857_100503385
1267 Ga0068854_100054032
1268 Ga0068854_100065233
1269 Ga0068854_100136104
1270 Ga0068854_100337340
1271 Ga0068856_100118539
1272 Ga0068856_100152151
1273 Ga0068856_100173437
1274 Ga0070702_100658983
1275 Ga0068852_100000926
1276 Ga0068852_100003421
1277 Ga0068852_100054329
1278 Ga0068852_100057379
1279 Ga0068852_100079852
1280 Ga0068852_100111034
1281 Ga0068852_100193789
1282 Ga0068852_100223230
1283 Ga0068852_100272534
1284 Ga0068852_100431225
1285 Ga0068852_100519996
1286 Ga0068852_100647203
1287 Ga0068852_100876143
1288 Ga0068859_100000064
1289 Ga0068859_100003888
1290 Ga0068859_100143359
1291 Ga0068859_100152314
1292 Ga0068859_100157751
1293 Ga0068859_100203886
1294 Ga0068859_100270064
1295 Ga0068859_100548803
1296 Ga0068859_100551478
1297 Ga0068859_100560121
1298 Ga0068859_100749494
1299 Ga0068859_100752512
1300 Ga0068864_100014171
1301 Ga0068864_100119793
1302 Ga0068864_100154832
1303 Ga0068864_100219107
1304 Ga0068864_100223912
1305 Ga0068864_100233513
1306 Ga0068866_10051778
1307 Ga0068866_10427075
1308 Ga0068866_10598124
1309 Ga0068861_100013578
1310 Ga0068861_100014654
1311 Ga0068861_100096436
1312 Ga0068861_100098648
1313 Ga0068861_100262160
1314 Ga0068861_100303993
1315 Ga0068861_100459601
1316 Ga0068851_10014911
1317 Ga0068851_10102731
1318 Ga0068851_10168778
1319 Ga0068851_10182705
1320 Ga0068870_10013252
1321 Ga0068870_10389570
1322 Ga0068863_100011703
1323 Ga0068863_100020291
1324 Ga0068863_100023194
1325 Ga0068863_100045799
1326 Ga0068863_100121175
1327 Ga0068863_100163098
1328 Ga0068863_100347479
1329 Ga0068858_100148339
1330 Ga0068858_100254842
1331 Ga0068858_100553017
1332 Ga0068858_101185375
1333 Ga0068860_100000046
1334 Ga0068860_100003652
1335 Ga0068860_100004779
1336 Ga0068860_100008360
1337 Ga0068860_100009074
1338 Ga0068860_100021218
1339 Ga0068860_100042273
1340 Ga0068860_100054406
1341 Ga0068860_100157678
1342 Ga0068860_100235472
1343 Ga0068862_100001846
1344 Ga0068862_100025134
1345 Ga0068862_100135139
1346 Ga0068862_100305329
1347 Ga0068862_100626314
1348 Ga0068862_100724042
1349 Ga0081540_1007674
1350 Ga0081539_10001598
1351 Ga0081539_10068454
1352 Ga0097621_100000974
1353 Ga0097621_100010940
1354 Ga0097621_100011820
1355 Ga0097621_100151586
1356 Ga0097621_100363159
1357 Ga0075370_10248827
1358 Ga0068871_100000750
1359 Ga0068871_100664700
1360 Ga0068871_100740487
1361 Ga0075428_100020790
1362 Ga0075428_100036510
1363 Ga0075428_100047292
1364 Ga0075428_100101750
1365 Ga0075430_100026803
1366 Ga0075431_100045756
1367 Ga0075434_100094466
1368 Ga0075429_100267396
1369 Ga0068865_100010351
1370 Ga0068865_100113476
1371 Ga0068865_100433675
1372 Ga0068865_100446834
1373 Ga0097620_100000064
1374 Ga0097620_100003888
1375 Ga0097620_100143359
1376 Ga0097620_100152316
1377 Ga0097620_100157752
1378 Ga0097620_100203891
1379 Ga0097620_100270064
1380 Ga0097620_100548740
1381 Ga0097620_100551401
1382 Ga0097620_100560178
1383 Ga0097620_100749484
1384 Ga0097620_100752417
1385 Ga0097620_101538898
1386 Ga0105240_10000074
1387 Ga0105240_10000598
1388 Ga0105240_10000626
1389 Ga0105240_10002254
1390 Ga0105240_10004476
1391 Ga0105240_10007364
1392 Ga0105240_10045005
1393 Ga0105240_10065482
1394 Ga0105240_10087664
1395 Ga0105240_10122025
1396 Ga0105240_10136812
1397 Ga0111539_10016692
1398 Ga0111539_10425294
1399 Ga0111539_10615859
1400 Ga0105245_10280169
1401 Ga0105245_10314070
1402 Ga0105245_11307523
1403 Ga0105247_10004356
1404 Ga0105247_10005280
1405 Ga0114129_10017850
1406 Ga0114129_10053478
1407 Ga0114129_10107363
1408 Ga0105243_10089369
1409 Ga0105241_10000659
1410 Ga0105241_10002102
1411 Ga0105241_10030423
1412 Ga0105241_10058744
1413 Ga0105241_10075050
1414 Ga0105241_10136956
1415 Ga0105241_10304898
1416 Ga0105241_10377754
1417 Ga0105241_10799234
1418 Ga0105242_10029709
1419 Ga0105242_10090175
1420 Ga0105242_10095223
1421 Ga0105242_10158722
1422 Ga0105242_10193030
1423 Ga0105242_10262121
1424 Ga0105242_10281903
1425 Ga0105242_10668262
1426 Ga0105242_10913286
1427 Ga0105248_10110498
1428 Ga0105237_10000755
1429 Ga0105237_10003416
1430 Ga0105237_10003671
1431 Ga0105237_10011051
1432 Ga0105237_10015329
1433 Ga0105237_10071377
1434 Ga0105237_10102485
1435 Ga0105237_10107568
1436 Ga0105237_10115778
1437 Ga0105237_10490826
1438 Ga0105237_10769510
1439 Ga0105238_10001132
1440 Ga0105238_10084549
1441 Ga0105249_10001648
1442 Ga0105249_10009236
1443 Ga0105249_10019347
1444 Ga0105249_10278051
1445 Ga0105249_10394234
1446 Ga0105249_10447783
1447 Ga0105239_10000048
1448 Ga0105239_10001136
1449 Ga0105239_10002613
1450 Ga0105239_10017403
1451 Ga0105239_10027980
1452 Ga0105239_10032560
1453 Ga0105239_10497734
1454 Ga0105239_10731675
1455 Ga0105246_10099156
1456 Ga0105246_10196436
1457 Ga0105246_10237380
1458 Ga0157373_10012918
1459 Ga0157373_10018988
1460 Ga0157373_10033618
1461 Ga0157373_10172620
1462 Ga0157371_10000830
1463 Ga0157371_10004289
1464 Ga0157371_10010326
1465 Ga0157371_10191690
1466 Ga0157371_10200867
1467 Ga0157371_10240055
1468 Ga0157371_10372543
1469 Ga0157371_10497455
1470 Ga0157370_10000878
1471 Ga0157370_10002365
1472 Ga0157370_10007920
1473 Ga0157370_10009537
1474 Ga0157370_10041110
1475 Ga0157370_10113719
1476 Ga0157370_10152193
1477 Ga0157369_10019583
1478 Ga0157369_10049397
1479 Ga0157369_10057809
1480 Ga0157369_10424096
1481 Ga0157374_10021570
1482 Ga0157374_10047005
1483 Ga0157374_10083014
1484 Ga0157374_10089350
1485 Ga0157374_10109364
1486 Ga0157374_10129662
1487 Ga0157374_10177420
1488 Ga0157374_10261128
1489 Ga0157374_10411681
1490 Ga0157374_10574263
1491 Ga0157378_10003501
1492 Ga0157378_10017913
1493 Ga0157378_10033917
1494 Ga0157378_10044635
1495 Ga0157378_10045171
1496 Ga0157378_10063555
1497 Ga0157378_10065579
1498 Ga0157378_10239198
1499 Ga0163162_10000331
1500 Ga0163162_10000862
1501 Ga0163162_10001657
1502 Ga0163162_10003049
1503 Ga0163162_10010782
1504 Ga0163162_10021755
1505 Ga0163162_10027024
1506 Ga0163162_10079222
1507 Ga0163162_10094439
1508 Ga0163162_10138809
1509 Ga0163162_10169930
1510 Ga0163162_10174849
1511 Ga0163162_10186483
1512 Ga0163162_10188033
1513 Ga0163162_10288614
1514 Ga0163162_10296359
1515 Ga0163162_10517025
1516 Ga0163162_10519077
1517 Ga0163162_10688415
1518 Ga0163162_10730371
1519 Ga0163162_11291938
1520 Ga0157372_10002207
1521 Ga0157372_10003015
1522 Ga0157372_10008452
1523 Ga0157372_10016387
1524 Ga0157372_10023020
1525 Ga0157372_10063516
1526 Ga0157372_10090954
1527 Ga0157372_10155061
1528 Ga0157372_10200417
1529 Ga0157372_10214241
1530 Ga0157372_10217126
1531 Ga0157372_10226602
1532 Ga0157372_10226782
1533 Ga0157372_10250305
1534 Ga0157372_10250805
1535 Ga0157372_10267796
1536 Ga0157372_10327005
1537 Ga0157372_10472836
1538 Ga0157372_10662367
1539 Ga0157372_10993600
1540 Ga0157375_10000403
1541 Ga0157375_10005688
1542 Ga0157375_10053259
1543 Ga0157375_10118034
1544 Ga0157375_10139637
1545 Ga0157375_10152036
1546 Ga0157375_10184290
1547 Ga0157375_10255619
1548 Ga0157375_10272991
1549 Ga0157375_10370360
1550 Ga0157375_11194148
1551 Ga0163163_10000399
1552 Ga0163163_10000653
1553 Ga0163163_10050638
1554 Ga0163163_10122936
1555 Ga0163163_10548107
1556 Ga0163163_10725400
1557 Ga0157380_10005370
1558 Ga0157380_10006261
1559 Ga0157380_10067509
1560 Ga0157380_10537331
1561 Ga0157380_11187241
1562 Ga0157377_10012052
1563 Ga0157377_10020354
1564 Ga0157377_10057005
1565 Ga0157377_10103353
1566 Ga0157377_10138434
1567 Ga0157377_10151268
1568 Ga0157377_10158057
1569 Ga0157377_10285922
1570 Ga0157379_10007752
1571 Ga0157379_10020556
1572 Ga0157379_10038671
1573 Ga0157379_10093054
1574 Ga0157379_10151722
1575 Ga0157379_10261991
1576 Ga0157379_10823817
1577 Ga0157376_10014600
1578 Ga0157376_10020948
1579 Ga0157376_10050787
1580 Ga0157376_10059697
1581 Ga0157376_10071222
1582 Ga0157376_10075952
1583 Ga0157376_10221522
1584 Ga0157376_10351249
1585 Ga0157376_10356890
1586 Ga0157376_10387147
1587 Ga0157376_10444559
1588 Ga0157376_10461803
1589 Ga0157376_10535006
1590 Ga0163161_10003834
1591 Ga0163161_10031281
1592 Ga0163161_10065804
1593 Ga0163161_10072654
1594 Ga0163161_10086657
1595 Ga0163161_10184256
1596 Ga0163161_10431853
1597 Ga0163161_10500033
1598 Ga0163161_10568157
1599 Ga0213876_10005738
1600 Ga0209436_102603
1601 Ga0207666_1004620
1602 Ga0209673_1000016
1603 Ga0209130_1003624
1604 Ga0209564_1006250
1605 Ga0209564_1027158
1606 Ga0209758_1005921
1607 Ga0209758_1011914
1608 Ga0209050_1000616
1609 Ga0207426_1000139
1610 Ga0207426_1031851
1611 Ga0207426_1038833
1612 Ga0209051_1014936
1613 Ga0209257_1006990
1614 Ga0207697_10000488
1615 Ga0207697_10055345
1616 Ga0207656_10003445
1617 Ga0207656_10026721
1618 Ga0207656_10198205
1619 Ga0207682_10007523
1620 Ga0207682_10016325
1621 Ga0207682_10274833
1622 Ga0207642_10397851
1623 Ga0207710_10006861
1624 Ga0207688_10287719
1625 Ga0207680_10000877
1626 Ga0207680_10023815
1627 Ga0207680_10168230
1628 Ga0207680_10186892
1629 Ga0207680_10230038
1630 Ga0207647_10000530
1631 Ga0207647_10055791
1632 Ga0207647_10194583
1633 Ga0207645_10007828
1634 Ga0207645_10010367
1635 Ga0207645_10065949
1636 Ga0207643_10005004
1637 Ga0207643_10008998
1638 Ga0207643_10103057
1639 Ga0207705_10071276
1640 Ga0207705_10103349
1641 Ga0207705_10145746
1642 Ga0207705_10198948
1643 Ga0207705_10322142
1644 Ga0207654_10000483
1645 Ga0207654_10008469
1646 Ga0207654_10036518
1647 Ga0207654_10094548
1648 Ga0207707_10000051
1649 Ga0207707_10000490
1650 Ga0207707_10149703
1651 Ga0207695_10000071
1652 Ga0207695_10000084
1653 Ga0207695_10000323
1654 Ga0207695_10004025
1655 Ga0207695_10007684
1656 Ga0207695_10009590
1657 Ga0207695_10020243
1658 Ga0207695_10029916
1659 Ga0207695_10044514
1660 Ga0207695_10051643
1661 Ga0207695_10075438
1662 Ga0207695_11042968
1663 Ga0207671_10000036
1664 Ga0207671_10001044
1665 Ga0207671_10002316
1666 Ga0207671_10004890
1667 Ga0207671_10076294
1668 Ga0207671_10095635
1669 Ga0207671_10114913
1670 Ga0207671_10416835
1671 Ga0207660_10000371
1672 Ga0207660_10386831
1673 Ga0207662_10034747
1674 Ga0207662_10047254
1675 Ga0207657_10004060
1676 Ga0207657_10013726
1677 Ga0207649_10014996
1678 Ga0207649_10165059
1679 Ga0207652_10000045
1680 Ga0207652_10001693
1681 Ga0207652_10030239
1682 Ga0207681_10063297
1683 Ga0207681_10066545
1684 Ga0207681_10206386
1685 Ga0207681_10573228
1686 Ga0207694_10030500
1687 Ga0207694_10055666
1688 Ga0207650_10018352
1689 Ga0207650_10040160
1690 Ga0207650_10041209
1691 Ga0207650_10107927
1692 Ga0207650_10134118
1693 Ga0207650_10269341
1694 Ga0207650_10317384
1695 Ga0207650_10339615
1696 Ga0207650_10393722
1697 Ga0207650_10480527
1698 Ga0207650_10494828
1699 Ga0207659_10048360
1700 Ga0207644_10081611
1701 Ga0207644_10113203
1702 Ga0207644_10218698
1703 Ga0207644_10788384
1704 Ga0207690_10103340
1705 Ga0207690_10142865
1706 Ga0207690_10145816
1707 Ga0207690_10520402
1708 Ga0207690_10576843
1709 Ga0207706_10009485
1710 Ga0207706_10023276
1711 Ga0207706_10074803
1712 Ga0207706_10109750
1713 Ga0207706_10220171
1714 Ga0207706_10318661
1715 Ga0207706_10802784
1716 Ga0207686_10059242
1717 Ga0207686_10217673
1718 Ga0207670_10069648
1719 Ga0207670_10081645
1720 Ga0207670_10094353
1721 Ga0207670_10134098
1722 Ga0207669_10002940
1723 Ga0207669_10214850
1724 Ga0207704_10057241
1725 Ga0207704_10347434
1726 Ga0207704_10510989
1727 Ga0207691_10003785
1728 Ga0207691_10006538
1729 Ga0207691_10181605
1730 Ga0207691_10185184
1731 Ga0207691_10374224
1732 Ga0207691_10470916
1733 Ga0207691_10555539
1734 Ga0207689_10007246
1735 Ga0207689_10012105
1736 Ga0207689_10015970
1737 Ga0207689_10025044
1738 Ga0207689_10033718
1739 Ga0207689_10042397
1740 Ga0207689_10045723
1741 Ga0207689_10830830
1742 Ga0207661_10017642
1743 Ga0207661_10018282
1744 Ga0207661_10046148
1745 Ga0207661_10048995
1746 Ga0207661_10279507
1747 Ga0207679_10000660
1748 Ga0207679_10031627
1749 Ga0207679_10318293
1750 Ga0207679_10533605
1751 Ga0207679_10872712
1752 Ga0207667_10001672
1753 Ga0207667_10002100
1754 Ga0207667_10018760
1755 Ga0207667_10021218
1756 Ga0207667_10083528
1757 Ga0207667_10186397
1758 Ga0207667_10188239
1759 Ga0207667_10324348
1760 Ga0207667_10902934
1761 Ga0207651_10012113
1762 Ga0207651_10024476
1763 Ga0207651_10085369
1764 Ga0207651_10197856
1765 Ga0207651_10281110
1766 Ga0207651_10421014
1767 Ga0207712_10001659
1768 Ga0207712_10013905
1769 Ga0207712_10015160
1770 Ga0207712_10020106
1771 Ga0207712_10052105
1772 Ga0207712_10052992
1773 Ga0207712_10080594
1774 Ga0207668_10000843
1775 Ga0207668_10099307
1776 Ga0207668_10106907
1777 Ga0207668_10299748
1778 Ga0207668_10748372
1779 Ga0207640_10032898
1780 Ga0207640_10040439
1781 Ga0207640_10171534
1782 Ga0207640_10376852
1783 Ga0207640_10567559
1784 Ga0207640_10902303
1785 Ga0207658_10028138
1786 Ga0207658_10039424
1787 Ga0207658_10063161
1788 Ga0207658_10303416
1789 Ga0207658_10339937
1790 Ga0207658_10443123
1791 Ga0207658_10622051
1792 Ga0207658_10743939
1793 Ga0207658_11031683
1794 Ga0207677_10010298
1795 Ga0207677_10037285
1796 Ga0207677_10049026
1797 Ga0207677_10094706
1798 Ga0207677_10118789
1799 Ga0207677_10247587
1800 Ga0207677_10321980
1801 Ga0207677_10516772
1802 Ga0207703_10034699
1803 Ga0207703_10079799
1804 Ga0207703_10126015
1805 Ga0207703_10926991
1806 Ga0207639_10002030
1807 Ga0207639_10027999
1808 Ga0207639_10057303
1809 Ga0207639_10083325
1810 Ga0207639_10338162
1811 Ga0207639_10491026
1812 Ga0207639_10551997
1813 Ga0207639_10645764
1814 Ga0207639_11065462
1815 Ga0207678_10094288
1816 Ga0207678_10214913
1817 Ga0207678_10416713
1818 Ga0207678_10513936
1819 Ga0207708_10175955
1820 Ga0207708_10312799
1821 Ga0207702_10078821
1822 Ga0207702_10313212
1823 Ga0207641_10000212
1824 Ga0207641_10001311
1825 Ga0207641_10061188
1826 Ga0207641_10182128
1827 Ga0207641_10201275
1828 Ga0207641_10279064
1829 Ga0207641_10602960
1830 Ga0207648_10075008
1831 Ga0207648_10075058
1832 Ga0207648_10112020
1833 Ga0207648_10113991
1834 Ga0207648_10114302
1835 Ga0207648_10114994
1836 Ga0207648_10146780
1837 Ga0207648_10536631
1838 Ga0207648_11176366
1839 Ga0207676_10003111
1840 Ga0207676_10003477
1841 Ga0207676_10041742
1842 Ga0207676_10060656
1843 Ga0207676_10363014
1844 Ga0207676_10471210
1845 Ga0207674_10000672
1846 Ga0207674_10002807
1847 Ga0207674_10035026
1848 Ga0207674_10042103
1849 Ga0207674_10044802
1850 Ga0207674_10054325
1851 Ga0207674_10102557
1852 Ga0207675_100000326
1853 Ga0207675_100050510
1854 Ga0207675_100060492
1855 Ga0207675_100282870
1856 Ga0207675_100914214
1857 Ga0207683_10012945
1858 Ga0207683_10043838
1859 Ga0207683_10077012
1860 Ga0207683_10123695
1861 Ga0207683_10142757
1862 Ga0207683_10241993
1863 Ga0207698_10014057
1864 Ga0207698_10015761
1865 Ga0207698_10124852
1866 Ga0207698_10130934
1867 Ga0207698_10167819
1868 Ga0207698_10178818
1869 Ga0207698_10236868
1870 Ga0207698_10260335
1871 Ga0207698_10430363
1872 Ga0207698_10645732
1873 Ga0207698_10892692
1874 Ga0207428_10037411
1875 Ga0268266_10000049
1876 Ga0268266_10548555
1877 Ga0268265_10525583
1878 Ga0268265_10632011
1879 Ga0268265_10669463
1880 Ga0268264_10000041
1881 Ga0268264_10002479
1882 Ga0268264_10003505
1883 Ga0268264_10003739
1884 Ga0268264_10007266
1885 Ga0268264_10007386
1886 Ga0268264_10067063
1887 Ga0268264_10210408
1888 Ga0268264_10303271
1889 Ga0268264_10351024
1890 Ga0268264_10636434
1891 Ga0307517_10232046
1892 Ga0307515_10000002
1893 Ga0307511_10001228
1894 Ga0307512_10116816
1895 Ga0265327_10000316
1896 Ga0307513_10077328
1897 Ga0307513_10098306
1898 Ga0307513_10517883
1899 Ga0307509_10087285
1900 Ga0307509_10097840
1901 Ga0307509_10104731
1902 Ga0265313_10036075
1903 Ga0307516_10001558
1904 Ga0307516_10077058
1905 Ga0307406_10167633
1906 Ga0307411_10476522
1907 Ga0307411_10868994
1908 Ga0307415_100021044
1909 Ga0307510_10000217
1910 Ga0373943_0061340
1911 Ga0373943_0391542
1912 Ga0373924_0029480
1913 Ga0373937_0455425
1914 Ga0395900_0001468
1915 Ga0395900_0041360
1916 Ga0395898_0001670
1917 Ga0395905_0177870
1918 Ga0395901_0001174
1919 Ga0395901_0425187
1920 Ga0395901_0745858
1921 Ga0436365_0168773
1922 Ga0436365_0246639
1923 Ga0436365_0591026
1924 Ga0436365_1248268
1925 Ga0436365_1724629
1926 Ga0439436_0019019
1927 Ga0451789_0528288
1928 Ga0451833_1275392
1929 Ga0451837_0610310
1930 Ga0451849_0024587
1931 Ga0451855_1789405
1932 Ga0439441_007968
1933 Ga0439449_0050281
1934 Ga0439457_001674
1935 Ga0439462_0028345
1936 Ga0439462_0060813
1937 Ga0439434_0102735
1938 Ga0451577_0008492
1939 Ga0451577_0082716
1940 Ga0451577_0089816
1941 Ga0466972_0000207
1942 Ga0466972_0000469
1943 Ga0466972_0115966
1944 Ga0466965_0070490
1945 Ga0466966_0001667
1946 Ga0466961_0160958
1947 Ga0466961_0220450
1948 Ga0466961_0330291
1949 Ga0466964_0319287
1950 Ga0453684_0012189
1951 Ga0453684_0701361
1952 Ga0466968_0028617
1953 Ga0466960_0260317
1954 Ga0466959_0000002
1955 Ga0466959_0194517
1956 Ga0495603_0055250
1957 Ga0495638_0113799
1958 Ga0495638_0145809
1959 Ga0495653_0211395
1960 Ga0495580_0151990
1961 Ga0495594_0100148
1962 Ga0495606_0018941
1963 Ga0495608_0067081
1964 Ga0495628_0013274
1965 Ga0495630_0054622
1966 Ga0495648_0003830
1967 Ga0495587_0171142
1968 Ga0495621_0031193
1969 Ga0495622_0069730
1970 Ga0495668_0000459
1971 Ga0495634_0031752
1972 Ga0495611_0000090
1973 Ga0495611_0023013
1974 Ga0495625_0069055
1975 Ga0495672_0009967
1976 Ga0495672_0026413
1977 Ga0495672_0063586
1978 Ga0495672_0076601
1979 Ga0495687_000001
1980 Ga0495686_0013476
1981 Ga0495686_0239443
1982 Ga0496101_0068362
1983 Ga0496108_0417943
1984 Ga0496109_0233204
1985 Ga0501298_010178
1986 Ga0501033_0044752
1987 Ga0501033_0525137
1988 Ga0501034_0000002
1989 Ga0501034_0036199
1990 Ga0501034_0040916
1991 Ga0501034_0067326
1992 Ga0501034_0152616
1993 Ga0501036_0002265
1994 Ga0501037_0108656
1995 Ga0501038_0029035
1996 Ga0501043_0019215
1997 Ga0501043_0224894
1998 Ga0501046_0014249
1999 Ga0501047_0049725
2000 Ga0501047_0364165
2001 Ga0501048_0005214
2002 Ga0501048_0521956
2003 Ga0501067_0101704
2004 Ga0501070_0004566
2005 Ga0501070_0142025
2006 Ga0501070_0845273
2007 Ga0501072_0042730
2008 Ga0501073_0021169
2009 Ga0501074_0008635
2010 Ga0501074_0032245
2011 Ga0501198_014611
2012 Ga0501202_000088
2013 Ga0501217_000307
2014 Ga0501222_004413
2015 Ga0501223_004563
2016 Ga0501233_016917
2017 Ga0501242_000045
2018 Ga0501250_002675
2019 Ga0501252_001448
2020 Ga0501257_016256
2021 Ga0501257_019994
2022 Ga0501257_028791
2023 Ga0501261_000243
2024 Ga0501221_000246
2025 Ga0501225_0045695
2026 Ga0501234_001444
2027 Ga0501079_0122554
2028 Ga0501079_0178029
2029 Ga0501080_0034986
2030 Ga0501083_0028952
2031 Ga0501083_0035414
2032 Ga0501266_004571
2033 Ga0501268_032506
2034 Ga0501279_009074
2035 Ga0501035_0037902
2036 Ga0501044_0012075
2037 Ga0501044_0039771
2038 Ga0501044_0094530
2039 Ga0501044_0182740
2040 Ga0501044_0266994
2041 Ga0501044_0324204
2042 Ga0501044_0355076
2043 Ga0501044_0533723
2044 Ga0501045_0085055
2045 Ga0501284_00021
2046 nmdc:mga0k408_110246_c1
2047 nmdc:mga0k408_337123_c1
2048 nmdc:mga0k408_384732_c1
2049 nmdc:mga05p37_299061_c1
2050 nmdc:mga05p37_3833_c1
2051 nmdc:mga05p37_89890_c1
2052 nmdc:mga09592_118468_c1
2053 nmdc:mga0qj67_35464_c1
2054 nmdc:mga0qj67_385449_c1
2055 nmdc:mga06r32_69155_c1
2056 nmdc:mga08y16_40834_c1
2057 nmdc:mga08y16_759985_c1
2058 nmdc:mga0n895_148980_c1
2059 Ga0495619_0016556
2060 Ga0500578_0000694
2061 Ga0500578_0097000
2062 Ga0500644_0141293
2063 Ga0500646_0057636
2064 Ga0500583_0000059
2065 Ga0500583_0000379
2066 Ga0500583_0012380
2067 Ga0500651_0191202
2068 Ga0500650_0191595
2069 Ga0500555_000038
2070 Ga0500555_033505
2071 Ga0500556_0036860
2072 Ga0500642_0004765
2073 Ga0500652_024201
2074 Ga0500568_0000236
2075 Ga0500573_0172627
2076 Ga0500588_0133963
2077 Ga0500589_030930
2078 Ga0500616_0000248
2079 Ga0500616_0012902
2080 Ga0500616_0065196
2081 Ga0500622_0020646
2082 Ga0500622_0057217
2083 Ga0500636_0051649
2084 Ga0500636_0267366
2085 Ga0500637_0120693
2086 Ga0500637_0377896
2087 Ga0500611_000006
2088 Ga0500645_000416
2089 Ga0500599_003380
2090 Ga0501084_0236063
2091 Ga0501084_0499043
2092 Ga0501082_0862376
2093 Ga0466962_0068404
2094 2819678960
2095 2884792064
2096 2896088559

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

25

208

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9802 1 215
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9794 3 215
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9779 1 216
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9771 2 216
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9758 2 216
ID Description Score Start End Superfamily
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9819 1 215 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9792 1 215 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9788 1 215 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9747 2 217 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9709 2 215 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A849UUQ6-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9976 3 214 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1M3GRW9-F1-model_v4 deleted 0.9973 1 214
AF-A0A3E1NIR6-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9963 1 215 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A2A5HI54-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9954 2 213 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A1F5VP74-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9949 31 215 GO:0004750
GO:0005975
GO:0006098
GO:0046872

Map