F488998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1048 | 329 | 2096 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10116007|Ga0163161_101160072 |
| Length | 223 |
| Sequence | MLEEKLKKIKYQLSFHKLSIIKMPIIAPSLLSANYLQLQQDCDMLNASQADWFHLDVMDGRFVPNISFGPMLIEFFKKATTKICDVHLMIEEPERYTMEACRHLHRNIQQIKGLGMQAGVALNPHTPVESLKDVLADIDMVLIMSVNPGFGGQSFIPHTLNKIKQLRAMIDEQSLKVKIEIDGGVTLDNAASILAAGADVLVAGNTVFKSVNPAETISKLKSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 213 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 215 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 216 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 217 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 218 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 273 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 274 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 275 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 279 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 281 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 283 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 289 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 290 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 306 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 315 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 316 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 319 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 321 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 322 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 327 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 328 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 329 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.34 |
| Nodule | 0 |
| Rhizoplane | 0.38 |
| Rhizosphere | 90.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163161_10116007 | 3300017792 | Bacteria | 2007 |
| 2 | ARCol0yngRDRAFT_1002900 | 3300000652 | Bacteria | 1270 |
| 3 | JGI24736J21556_1008050 | 3300001904 | Unclassified | 1757 |
| 4 | JGI24739J22299_10000682 | 3300001989 | Bacteria | 12266 |
| 5 | JGI24751J29686_10001386 | 3300002459 | Bacteria | 5090 |
| 6 | JGI25153J46596_10009265 | 3300003215 | Bacteria | 4602 |
| 7 | JGI25153J46596_10052922 | 3300003215 | Unclassified | 1152 |
| 8 | rootH1_10086091 | 3300003316 | Bacteria | 5693 |
| 9 | rootH2_10014568 | 3300003320 | Bacteria | 37185 |
| 10 | rootH2_10042606 | 3300003320 | Bacteria | 5685 |
| 11 | rootH2_10077502 | 3300003320 | Bacteria | 25078 |
| 12 | rootH2_10084580 | 3300003320 | Bacteria | 2163 |
| 13 | rootL2_10007556 | 3300003322 | Bacteria | 9857 |
| 14 | rootL2_10245585 | 3300003322 | Bacteria | 1104 |
| 15 | rootH1_10038857 | 3300003323 | Unclassified | 3923 |
| 16 | rootH1_10072926 | 3300003323 | Bacteria | 8901 |
| 17 | rootH1_10073999 | 3300003323 | Bacteria | 2457 |
| 18 | JGI25160J50197_1000883 | 3300003354 | Bacteria | 15785 |
| 19 | JGI25160J50197_1016652 | 3300003354 | Bacteria | 2360 |
| 20 | Ga0055526_1016976 | 3300003771 | Bacteria | 2810 |
| 21 | Ga0055528_1000481 | 3300003790 | Bacteria | 31687 |
| 22 | Ga0055530_10067843 | 3300003791 | Bacteria | 777 |
| 23 | Ga0055543_1016228 | 3300004625 | Bacteria | 1419 |
| 24 | Ga0065165_1000228 | 3300005262 | Bacteria | 98736 |
| 25 | Ga0065714_10124544 | 3300005288 | Bacteria | 1291 |
| 26 | Ga0065704_10227980 | 3300005289 | Bacteria | 1052 |
| 27 | Ga0065712_10014868 | 3300005290 | Bacteria | 2128 |
| 28 | Ga0065712_10087928 | 3300005290 | Bacteria | 2541 |
| 29 | Ga0065712_10137176 | 3300005290 | Bacteria | 1486 |
| 30 | Ga0065712_10203207 | 3300005290 | Bacteria | 1089 |
| 31 | Ga0065707_10016744 | 3300005295 | Bacteria | 1819 |
| 32 | Ga0070658_10099229 | 3300005327 | Bacteria | 2406 |
| 33 | Ga0070658_10117693 | 3300005327 | Bacteria | 2206 |
| 34 | Ga0070658_10305196 | 3300005327 | Bacteria | 1358 |
| 35 | Ga0070658_10545980 | 3300005327 | Unclassified | 1003 |
| 36 | Ga0070658_10922590 | 3300005327 | Bacteria | 759 |
| 37 | Ga0070676_10044940 | 3300005328 | Bacteria | 2572 |
| 38 | Ga0070676_10124222 | 3300005328 | Bacteria | 1624 |
| 39 | Ga0070676_10144146 | 3300005328 | Bacteria | 1519 |
| 40 | Ga0070676_10224076 | 3300005328 | Unclassified | 1243 |
| 41 | Ga0070683_100008791 | 3300005329 | Bacteria | 8588 |
| 42 | Ga0070683_100039507 | 3300005329 | Bacteria | 4332 |
| 43 | Ga0070683_100555264 | 3300005329 | Bacteria | 1098 |
| 44 | Ga0070690_100016704 | 3300005330 | Bacteria | 4403 |
| 45 | Ga0070670_100016861 | 3300005331 | Bacteria | 6269 |
| 46 | Ga0070670_100055775 | 3300005331 | Bacteria | 3391 |
| 47 | Ga0070670_100152746 | 3300005331 | Bacteria | 1998 |
| 48 | Ga0070670_100164272 | 3300005331 | Bacteria | 1925 |
| 49 | Ga0070670_100336416 | 3300005331 | Bacteria | 1325 |
| 50 | Ga0070670_100558697 | 3300005331 | Bacteria | 1021 |
| 51 | Ga0068869_100062872 | 3300005334 | Bacteria | 2725 |
| 52 | Ga0068869_100165888 | 3300005334 | Bacteria | 1722 |
| 53 | Ga0068869_100170468 | 3300005334 | Bacteria | 1700 |
| 54 | Ga0068869_100319674 | 3300005334 | Bacteria | 1258 |
| 55 | Ga0068869_100363721 | 3300005334 | Bacteria | 1182 |
| 56 | Ga0070666_10001517 | 3300005335 | Bacteria | 14090 |
| 57 | Ga0070666_10016406 | 3300005335 | Unclassified | 4739 |
| 58 | Ga0070666_10019018 | 3300005335 | Bacteria | 4428 |
| 59 | Ga0070666_10103090 | 3300005335 | Bacteria | 1968 |
| 60 | Ga0070666_10494461 | 3300005335 | Bacteria | 886 |
| 61 | Ga0070680_100223008 | 3300005336 | Bacteria | 1591 |
| 62 | Ga0070680_100325911 | 3300005336 | Bacteria | 1304 |
| 63 | Ga0070682_100000525 | 3300005337 | Bacteria | 23970 |
| 64 | Ga0070682_100000549 | 3300005337 | Bacteria | 23315 |
| 65 | Ga0070682_100066184 | 3300005337 | Bacteria | 2298 |
| 66 | Ga0070682_100320427 | 3300005337 | Bacteria | 1145 |
| 67 | Ga0068868_100016594 | 3300005338 | Bacteria | 5474 |
| 68 | Ga0068868_100037301 | 3300005338 | Bacteria | 3767 |
| 69 | Ga0068868_100146050 | 3300005338 | Bacteria | 1945 |
| 70 | Ga0068868_100195259 | 3300005338 | Unclassified | 1685 |
| 71 | Ga0068868_100284043 | 3300005338 | Bacteria | 1401 |
| 72 | Ga0068868_100360829 | 3300005338 | Bacteria | 1246 |
| 73 | Ga0070660_100015710 | 3300005339 | Bacteria | 5474 |
| 74 | Ga0070660_100108535 | 3300005339 | Bacteria | 2206 |
| 75 | Ga0070660_100290700 | 3300005339 | Bacteria | 1338 |
| 76 | Ga0070660_100603244 | 3300005339 | Bacteria | 918 |
| 77 | Ga0070689_100015893 | 3300005340 | Bacteria | 5499 |
| 78 | Ga0070689_100036250 | 3300005340 | Bacteria | 3772 |
| 79 | Ga0070689_100090910 | 3300005340 | Bacteria | 2406 |
| 80 | Ga0070689_100152260 | 3300005340 | Unclassified | 1866 |
| 81 | Ga0070691_10013755 | 3300005341 | Bacteria | 3712 |
| 82 | Ga0070691_10192165 | 3300005341 | Unclassified | 1068 |
| 83 | Ga0070687_100008860 | 3300005343 | Unclassified | 4279 |
| 84 | Ga0070687_100113402 | 3300005343 | Unclassified | 1538 |
| 85 | Ga0070661_100023553 | 3300005344 | Bacteria | 4414 |
| 86 | Ga0070661_100058810 | 3300005344 | Bacteria | 2817 |
| 87 | Ga0070668_100006539 | 3300005347 | Bacteria | 8638 |
| 88 | Ga0070668_100032657 | 3300005347 | Bacteria | 3961 |
| 89 | Ga0070668_100049425 | 3300005347 | Bacteria | 3236 |
| 90 | Ga0070668_100066202 | 3300005347 | Bacteria | 2803 |
| 91 | Ga0070668_100233594 | 3300005347 | Bacteria | 1521 |
| 92 | Ga0070668_100374000 | 3300005347 | Bacteria | 1211 |
| 93 | Ga0070668_100450350 | 3300005347 | Bacteria | 1106 |
| 94 | Ga0070668_100544919 | 3300005347 | Bacteria | 1009 |
| 95 | Ga0070669_100020363 | 3300005353 | Unclassified | 4738 |
| 96 | Ga0070669_100172850 | 3300005353 | Bacteria | 1686 |
| 97 | Ga0070669_100525274 | 3300005353 | Bacteria | 984 |
| 98 | Ga0070675_100040664 | 3300005354 | Bacteria | 3797 |
| 99 | Ga0070675_100162645 | 3300005354 | Bacteria | 1921 |
| 100 | Ga0070675_100177324 | 3300005354 | Bacteria | 1841 |
| 101 | Ga0070671_100058796 | 3300005355 | Bacteria | 3199 |
| 102 | Ga0070671_100069049 | 3300005355 | Bacteria | 2947 |
| 103 | Ga0070674_100005888 | 3300005356 | Bacteria | 7127 |
| 104 | Ga0070674_100078074 | 3300005356 | Bacteria | 2359 |
| 105 | Ga0070674_100124296 | 3300005356 | Bacteria | 1914 |
| 106 | Ga0070674_100157342 | 3300005356 | Bacteria | 1721 |
| 107 | Ga0070674_100188537 | 3300005356 | Bacteria | 1585 |
| 108 | Ga0070674_100359509 | 3300005356 | Bacteria | 1178 |
| 109 | Ga0070673_100012518 | 3300005364 | Bacteria | 5828 |
| 110 | Ga0070673_100060556 | 3300005364 | Bacteria | 3000 |
| 111 | Ga0070673_100151338 | 3300005364 | Bacteria | 1965 |
| 112 | Ga0070673_100172631 | 3300005364 | Bacteria | 1846 |
| 113 | Ga0070673_100239328 | 3300005364 | Bacteria | 1577 |
| 114 | Ga0070673_100316430 | 3300005364 | Bacteria | 1378 |
| 115 | Ga0070688_100016934 | 3300005365 | Bacteria | 4175 |
| 116 | Ga0070688_100081906 | 3300005365 | Bacteria | 2091 |
| 117 | Ga0070659_100011635 | 3300005366 | Bacteria | 6510 |
| 118 | Ga0070659_100024976 | 3300005366 | Bacteria | 4585 |
| 119 | Ga0070659_100084683 | 3300005366 | Bacteria | 2535 |
| 120 | Ga0070667_100025205 | 3300005367 | Bacteria | 4943 |
| 121 | Ga0070667_100277325 | 3300005367 | Bacteria | 1505 |
| 122 | Ga0070667_100306751 | 3300005367 | Bacteria | 1430 |
| 123 | Ga0070667_100337049 | 3300005367 | Bacteria | 1363 |
| 124 | Ga0070713_100360684 | 3300005436 | Bacteria | 1350 |
| 125 | Ga0070701_10320473 | 3300005438 | Bacteria | 959 |
| 126 | Ga0070705_100203581 | 3300005440 | Bacteria | 1359 |
| 127 | Ga0070700_100104436 | 3300005441 | Bacteria | 1872 |
| 128 | Ga0070700_100286381 | 3300005441 | Unclassified | 1197 |
| 129 | Ga0070663_100092978 | 3300005455 | Bacteria | 2237 |
| 130 | Ga0070663_100348021 | 3300005455 | Unclassified | 1199 |
| 131 | Ga0070663_100358522 | 3300005455 | Bacteria | 1182 |
| 132 | Ga0070678_100042123 | 3300005456 | Bacteria | 3243 |
| 133 | Ga0070678_100110704 | 3300005456 | Unclassified | 2148 |
| 134 | Ga0070678_100217699 | 3300005456 | Bacteria | 1586 |
| 135 | Ga0070678_100407376 | 3300005456 | Bacteria | 1183 |
| 136 | Ga0070662_100017167 | 3300005457 | Bacteria | 4873 |
| 137 | Ga0070662_100270784 | 3300005457 | Bacteria | 1371 |
| 138 | Ga0070662_100661235 | 3300005457 | Bacteria | 882 |
| 139 | Ga0070662_101067575 | 3300005457 | Bacteria | 692 |
| 140 | Ga0070681_10029846 | 3300005458 | Bacteria | 5473 |
| 141 | Ga0070681_10285741 | 3300005458 | Bacteria | 1560 |
| 142 | Ga0070681_10483815 | 3300005458 | Bacteria | 1151 |
| 143 | Ga0068867_100023813 | 3300005459 | Bacteria | 4386 |
| 144 | Ga0068867_100024822 | 3300005459 | Bacteria | 4298 |
| 145 | Ga0068867_100066329 | 3300005459 | Bacteria | 2688 |
| 146 | Ga0068867_100078570 | 3300005459 | Bacteria | 2482 |
| 147 | Ga0068867_100171923 | 3300005459 | Unclassified | 1717 |
| 148 | Ga0068867_100226514 | 3300005459 | Bacteria | 1509 |
| 149 | Ga0068867_100463992 | 3300005459 | Bacteria | 1082 |
| 150 | Ga0068867_100622036 | 3300005459 | Bacteria | 944 |
| 151 | Ga0070685_10005545 | 3300005466 | Bacteria | 6399 |
| 152 | Ga0070685_10024336 | 3300005466 | Bacteria | 3324 |
| 153 | Ga0070685_10131001 | 3300005466 | Bacteria | 1568 |
| 154 | Ga0070698_100016231 | 3300005471 | Bacteria | 7861 |
| 155 | Ga0070698_100017582 | 3300005471 | Bacteria | 7535 |
| 156 | Ga0070698_100018248 | 3300005471 | Bacteria | 7389 |
| 157 | Ga0070699_100256212 | 3300005518 | Bacteria | 1564 |
| 158 | Ga0070679_100000367 | 3300005530 | Bacteria | 38344 |
| 159 | Ga0070679_100003068 | 3300005530 | Bacteria | 15268 |
| 160 | Ga0070679_100038459 | 3300005530 | Bacteria | 4756 |
| 161 | Ga0070679_100647243 | 3300005530 | Bacteria | 1000 |
| 162 | Ga0070684_100007425 | 3300005535 | Bacteria | 8518 |
| 163 | Ga0070684_100029638 | 3300005535 | Bacteria | 4640 |
| 164 | Ga0070684_100601592 | 3300005535 | Bacteria | 1022 |
| 165 | Ga0070684_100752307 | 3300005535 | Bacteria | 910 |
| 166 | Ga0068853_100000221 | 3300005539 | Bacteria | 40294 |
| 167 | Ga0068853_100002087 | 3300005539 | Bacteria | 14818 |
| 168 | Ga0068853_100019176 | 3300005539 | Bacteria | 5669 |
| 169 | Ga0068853_100061272 | 3300005539 | Bacteria | 3254 |
| 170 | Ga0068853_100073002 | 3300005539 | Bacteria | 2991 |
| 171 | Ga0068853_100183339 | 3300005539 | Bacteria | 1899 |
| 172 | Ga0068853_100199808 | 3300005539 | Bacteria | 1819 |
| 173 | Ga0068853_100217559 | 3300005539 | Bacteria | 1743 |
| 174 | Ga0068853_100393664 | 3300005539 | Bacteria | 1296 |
| 175 | Ga0068853_100441005 | 3300005539 | Bacteria | 1224 |
| 176 | Ga0068853_100872992 | 3300005539 | Bacteria | 863 |
| 177 | Ga0070672_100001464 | 3300005543 | Bacteria | 14647 |
| 178 | Ga0070672_100069744 | 3300005543 | Bacteria | 2792 |
| 179 | Ga0070672_100093336 | 3300005543 | Bacteria | 2431 |
| 180 | Ga0070672_100116709 | 3300005543 | Bacteria | 2181 |
| 181 | Ga0070672_100134167 | 3300005543 | Bacteria | 2038 |
| 182 | Ga0070672_100201353 | 3300005543 | Bacteria | 1665 |
| 183 | Ga0070672_100293358 | 3300005543 | Bacteria | 1377 |
| 184 | Ga0070672_100953589 | 3300005543 | Bacteria | 759 |
| 185 | Ga0070686_100004288 | 3300005544 | Bacteria | 7859 |
| 186 | Ga0070686_100065269 | 3300005544 | Bacteria | 2364 |
| 187 | Ga0070686_100114670 | 3300005544 | Bacteria | 1841 |
| 188 | Ga0070686_100369592 | 3300005544 | Bacteria | 1082 |
| 189 | Ga0070686_100477613 | 3300005544 | Bacteria | 963 |
| 190 | Ga0070686_100485530 | 3300005544 | Unclassified | 956 |
| 191 | Ga0070686_100796273 | 3300005544 | Bacteria | 761 |
| 192 | Ga0070696_100312735 | 3300005546 | Bacteria | 1206 |
| 193 | Ga0070693_100003508 | 3300005547 | Bacteria | 7314 |
| 194 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 195 | Ga0070665_100026357 | 3300005548 | Bacteria | 5855 |
| 196 | Ga0068855_100004630 | 3300005563 | Bacteria | 16786 |
| 197 | Ga0068855_100027234 | 3300005563 | Bacteria | 6839 |
| 198 | Ga0068855_100035742 | 3300005563 | Bacteria | 5918 |
| 199 | Ga0068855_100042983 | 3300005563 | Bacteria | 5355 |
| 200 | Ga0068855_100108675 | 3300005563 | Unclassified | 3185 |
| 201 | Ga0068855_100157104 | 3300005563 | Bacteria | 2583 |
| 202 | Ga0068855_100468964 | 3300005563 | Bacteria | 1372 |
| 203 | Ga0068855_100543839 | 3300005563 | Bacteria | 1258 |
| 204 | Ga0070664_100008111 | 3300005564 | Bacteria | 8491 |
| 205 | Ga0070664_100031077 | 3300005564 | Bacteria | 4459 |
| 206 | Ga0070664_100208558 | 3300005564 | Bacteria | 1746 |
| 207 | Ga0070664_100239557 | 3300005564 | Bacteria | 1628 |
| 208 | Ga0070664_100295104 | 3300005564 | Bacteria | 1464 |
| 209 | Ga0070664_100398592 | 3300005564 | Bacteria | 1258 |
| 210 | Ga0070664_100467246 | 3300005564 | Bacteria | 1160 |
| 211 | Ga0070664_100492630 | 3300005564 | Unclassified | 1129 |
| 212 | Ga0068857_100001119 | 3300005577 | Bacteria | 20854 |
| 213 | Ga0068857_100025593 | 3300005577 | Bacteria | 5196 |
| 214 | Ga0068857_100046345 | 3300005577 | Bacteria | 3858 |
| 215 | Ga0068857_100052392 | 3300005577 | Bacteria | 3621 |
| 216 | Ga0068857_100114779 | 3300005577 | Unclassified | 2422 |
| 217 | Ga0068857_100262825 | 3300005577 | Bacteria | 1584 |
| 218 | Ga0068857_100503385 | 3300005577 | Bacteria | 1137 |
| 219 | Ga0068854_100054032 | 3300005578 | Bacteria | 2887 |
| 220 | Ga0068854_100065233 | 3300005578 | Bacteria | 2647 |
| 221 | Ga0068854_100136104 | 3300005578 | Bacteria | 1881 |
| 222 | Ga0068854_100337340 | 3300005578 | Bacteria | 1230 |
| 223 | Ga0068856_100118539 | 3300005614 | Bacteria | 2648 |
| 224 | Ga0068856_100152151 | 3300005614 | Bacteria | 2323 |
| 225 | Ga0068856_100173437 | 3300005614 | Bacteria | 2169 |
| 226 | Ga0070702_100658983 | 3300005615 | Bacteria | 793 |
| 227 | Ga0068852_100000926 | 3300005616 | Bacteria | 19410 |
| 228 | Ga0068852_100003421 | 3300005616 | Bacteria | 11085 |
| 229 | Ga0068852_100054329 | 3300005616 | Bacteria | 3452 |
| 230 | Ga0068852_100057379 | 3300005616 | Bacteria | 3369 |
| 231 | Ga0068852_100079852 | 3300005616 | Bacteria | 2899 |
| 232 | Ga0068852_100111034 | 3300005616 | Bacteria | 2492 |
| 233 | Ga0068852_100193789 | 3300005616 | Bacteria | 1919 |
| 234 | Ga0068852_100223230 | 3300005616 | Unclassified | 1793 |
| 235 | Ga0068852_100272534 | 3300005616 | Bacteria | 1629 |
| 236 | Ga0068852_100431225 | 3300005616 | Bacteria | 1302 |
| 237 | Ga0068852_100519996 | 3300005616 | Bacteria | 1187 |
| 238 | Ga0068852_100647203 | 3300005616 | Bacteria | 1064 |
| 239 | Ga0068852_100876143 | 3300005616 | Bacteria | 914 |
| 240 | Ga0068859_100000064 | 3300005617 | Bacteria | 104971 |
| 241 | Ga0068859_100003888 | 3300005617 | Bacteria | 15253 |
| 242 | Ga0068859_100143359 | 3300005617 | Unclassified | 2462 |
| 243 | Ga0068859_100152314 | 3300005617 | Bacteria | 2388 |
| 244 | Ga0068859_100157751 | 3300005617 | Bacteria | 2347 |
| 245 | Ga0068859_100203886 | 3300005617 | Bacteria | 2063 |
| 246 | Ga0068859_100270064 | 3300005617 | Bacteria | 1793 |
| 247 | Ga0068859_100548803 | 3300005617 | Bacteria | 1250 |
| 248 | Ga0068859_100551478 | 3300005617 | Bacteria | 1247 |
| 249 | Ga0068859_100560121 | 3300005617 | Bacteria | 1237 |
| 250 | Ga0068859_100749494 | 3300005617 | Unclassified | 1065 |
| 251 | Ga0068859_100752512 | 3300005617 | Unclassified | 1063 |
| 252 | Ga0068864_100014171 | 3300005618 | Bacteria | 6617 |
| 253 | Ga0068864_100119793 | 3300005618 | Bacteria | 2352 |
| 254 | Ga0068864_100154832 | 3300005618 | Bacteria | 2079 |
| 255 | Ga0068864_100219107 | 3300005618 | Bacteria | 1755 |
| 256 | Ga0068864_100223912 | 3300005618 | Bacteria | 1736 |
| 257 | Ga0068864_100233513 | 3300005618 | Bacteria | 1702 |
| 258 | Ga0068866_10051778 | 3300005718 | Bacteria | 2092 |
| 259 | Ga0068866_10427075 | 3300005718 | Bacteria | 861 |
| 260 | Ga0068866_10598124 | 3300005718 | Bacteria | 744 |
| 261 | Ga0068861_100013578 | 3300005719 | Bacteria | 5701 |
| 262 | Ga0068861_100014654 | 3300005719 | Bacteria | 5505 |
| 263 | Ga0068861_100096436 | 3300005719 | Bacteria | 2343 |
| 264 | Ga0068861_100098648 | 3300005719 | Unclassified | 2319 |
| 265 | Ga0068861_100262160 | 3300005719 | Bacteria | 1480 |
| 266 | Ga0068861_100303993 | 3300005719 | Bacteria | 1383 |
| 267 | Ga0068861_100459601 | 3300005719 | Bacteria | 1142 |
| 268 | Ga0068851_10014911 | 3300005834 | Bacteria | 3696 |
| 269 | Ga0068851_10102731 | 3300005834 | Bacteria | 1518 |
| 270 | Ga0068851_10168778 | 3300005834 | Bacteria | 1206 |
| 271 | Ga0068851_10182705 | 3300005834 | Bacteria | 1162 |
| 272 | Ga0068870_10013252 | 3300005840 | Bacteria | 3872 |
| 273 | Ga0068870_10389570 | 3300005840 | Bacteria | 904 |
| 274 | Ga0068863_100011703 | 3300005841 | Bacteria | 8484 |
| 275 | Ga0068863_100020291 | 3300005841 | Bacteria | 6357 |
| 276 | Ga0068863_100023194 | 3300005841 | Bacteria | 5931 |
| 277 | Ga0068863_100045799 | 3300005841 | Bacteria | 4152 |
| 278 | Ga0068863_100121175 | 3300005841 | Bacteria | 2494 |
| 279 | Ga0068863_100163098 | 3300005841 | Bacteria | 2136 |
| 280 | Ga0068863_100347479 | 3300005841 | Bacteria | 1444 |
| 281 | Ga0068858_100148339 | 3300005842 | Bacteria | 2204 |
| 282 | Ga0068858_100254842 | 3300005842 | Unclassified | 1667 |
| 283 | Ga0068858_100553017 | 3300005842 | Bacteria | 1114 |
| 284 | Ga0068858_101185375 | 3300005842 | Bacteria | 751 |
| 285 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 286 | Ga0068860_100003652 | 3300005843 | Bacteria | 15833 |
| 287 | Ga0068860_100004779 | 3300005843 | Bacteria | 13804 |
| 288 | Ga0068860_100008360 | 3300005843 | Bacteria | 10305 |
| 289 | Ga0068860_100009074 | 3300005843 | Bacteria | 9898 |
| 290 | Ga0068860_100021218 | 3300005843 | Bacteria | 6292 |
| 291 | Ga0068860_100042273 | 3300005843 | Bacteria | 4354 |
| 292 | Ga0068860_100054406 | 3300005843 | Bacteria | 3805 |
| 293 | Ga0068860_100157678 | 3300005843 | Bacteria | 2188 |
| 294 | Ga0068860_100235472 | 3300005843 | Unclassified | 1780 |
| 295 | Ga0068862_100001846 | 3300005844 | Bacteria | 19205 |
| 296 | Ga0068862_100025134 | 3300005844 | Bacteria | 5000 |
| 297 | Ga0068862_100135139 | 3300005844 | Bacteria | 2185 |
| 298 | Ga0068862_100305329 | 3300005844 | Bacteria | 1465 |
| 299 | Ga0068862_100626314 | 3300005844 | Bacteria | 1035 |
| 300 | Ga0068862_100724042 | 3300005844 | Unclassified | 966 |
| 301 | Ga0081540_1007674 | 3300005983 | Bacteria | 7649 |
| 302 | Ga0081539_10001598 | 3300005985 | Bacteria | 37363 |
| 303 | Ga0081539_10068454 | 3300005985 | Bacteria | 1915 |
| 304 | Ga0097621_100000974 | 3300006237 | Bacteria | 20059 |
| 305 | Ga0097621_100010940 | 3300006237 | Bacteria | 6662 |
| 306 | Ga0097621_100011820 | 3300006237 | Bacteria | 6450 |
| 307 | Ga0097621_100151586 | 3300006237 | Unclassified | 1988 |
| 308 | Ga0097621_100363159 | 3300006237 | Bacteria | 1290 |
| 309 | Ga0075370_10248827 | 3300006353 | Bacteria | 1053 |
| 310 | Ga0068871_100000750 | 3300006358 | Bacteria | 21894 |
| 311 | Ga0068871_100664700 | 3300006358 | Bacteria | 952 |
| 312 | Ga0068871_100740487 | 3300006358 | Bacteria | 903 |
| 313 | Ga0075428_100020790 | 3300006844 | Bacteria | 7267 |
| 314 | Ga0075428_100036510 | 3300006844 | Bacteria | 5412 |
| 315 | Ga0075428_100047292 | 3300006844 | Bacteria | 4726 |
| 316 | Ga0075428_100101750 | 3300006844 | Bacteria | 3132 |
| 317 | Ga0075430_100026803 | 3300006846 | Bacteria | 4902 |
| 318 | Ga0075431_100045756 | 3300006847 | Bacteria | 4512 |
| 319 | Ga0075434_100094466 | 3300006871 | Bacteria | 2995 |
| 320 | Ga0075429_100267396 | 3300006880 | Bacteria | 1497 |
| 321 | Ga0068865_100010351 | 3300006881 | Bacteria | 5803 |
| 322 | Ga0068865_100113476 | 3300006881 | Bacteria | 2003 |
| 323 | Ga0068865_100433675 | 3300006881 | Bacteria | 1083 |
| 324 | Ga0068865_100446834 | 3300006881 | Bacteria | 1068 |
| 325 | Ga0097620_100000064 | 3300006931 | Bacteria | 104971 |
| 326 | Ga0097620_100003888 | 3300006931 | Bacteria | 15253 |
| 327 | Ga0097620_100143359 | 3300006931 | Unclassified | 2462 |
| 328 | Ga0097620_100152316 | 3300006931 | Bacteria | 2388 |
| 329 | Ga0097620_100157752 | 3300006931 | Bacteria | 2347 |
| 330 | Ga0097620_100203891 | 3300006931 | Bacteria | 2063 |
| 331 | Ga0097620_100270064 | 3300006931 | Bacteria | 1793 |
| 332 | Ga0097620_100548740 | 3300006931 | Bacteria | 1250 |
| 333 | Ga0097620_100551401 | 3300006931 | Bacteria | 1247 |
| 334 | Ga0097620_100560178 | 3300006931 | Bacteria | 1237 |
| 335 | Ga0097620_100749484 | 3300006931 | Unclassified | 1065 |
| 336 | Ga0097620_100752417 | 3300006931 | Unclassified | 1063 |
| 337 | Ga0097620_101538898 | 3300006931 | Unclassified | 734 |
| 338 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 339 | Ga0105240_10000598 | 3300009093 | Bacteria | 67006 |
| 340 | Ga0105240_10000626 | 3300009093 | Bacteria | 65179 |
| 341 | Ga0105240_10002254 | 3300009093 | Bacteria | 31303 |
| 342 | Ga0105240_10004476 | 3300009093 | Bacteria | 21284 |
| 343 | Ga0105240_10007364 | 3300009093 | Bacteria | 16008 |
| 344 | Ga0105240_10045005 | 3300009093 | Bacteria | 5602 |
| 345 | Ga0105240_10065482 | 3300009093 | Unclassified | 4511 |
| 346 | Ga0105240_10087664 | 3300009093 | Bacteria | 3811 |
| 347 | Ga0105240_10122025 | 3300009093 | Bacteria | 3137 |
| 348 | Ga0105240_10136812 | 3300009093 | Bacteria | 2933 |
| 349 | Ga0111539_10016692 | 3300009094 | Bacteria | 9100 |
| 350 | Ga0111539_10425294 | 3300009094 | Bacteria | 1547 |
| 351 | Ga0111539_10615859 | 3300009094 | Bacteria | 1264 |
| 352 | Ga0105245_10280169 | 3300009098 | Bacteria | 1629 |
| 353 | Ga0105245_10314070 | 3300009098 | Bacteria | 1542 |
| 354 | Ga0105245_11307523 | 3300009098 | Unclassified | 774 |
| 355 | Ga0105247_10004356 | 3300009101 | Bacteria | 9051 |
| 356 | Ga0105247_10005280 | 3300009101 | Bacteria | 8152 |
| 357 | Ga0114129_10017850 | 3300009147 | Bacteria | 10104 |
| 358 | Ga0114129_10053478 | 3300009147 | Bacteria | 5663 |
| 359 | Ga0114129_10107363 | 3300009147 | Bacteria | 3856 |
| 360 | Ga0105243_10089369 | 3300009148 | Bacteria | 2532 |
| 361 | Ga0105241_10000659 | 3300009174 | Bacteria | 25872 |
| 362 | Ga0105241_10002102 | 3300009174 | Bacteria | 15038 |
| 363 | Ga0105241_10030423 | 3300009174 | Bacteria | 4035 |
| 364 | Ga0105241_10058744 | 3300009174 | Bacteria | 2954 |
| 365 | Ga0105241_10075050 | 3300009174 | Bacteria | 2634 |
| 366 | Ga0105241_10136956 | 3300009174 | Bacteria | 1989 |
| 367 | Ga0105241_10304898 | 3300009174 | Bacteria | 1368 |
| 368 | Ga0105241_10377754 | 3300009174 | Bacteria | 1237 |
| 369 | Ga0105241_10799234 | 3300009174 | Bacteria | 869 |
| 370 | Ga0105242_10029709 | 3300009176 | Bacteria | 4359 |
| 371 | Ga0105242_10090175 | 3300009176 | Bacteria | 2578 |
| 372 | Ga0105242_10095223 | 3300009176 | Bacteria | 2513 |
| 373 | Ga0105242_10158722 | 3300009176 | Bacteria | 1978 |
| 374 | Ga0105242_10193030 | 3300009176 | Bacteria | 1804 |
| 375 | Ga0105242_10262121 | 3300009176 | Bacteria | 1562 |
| 376 | Ga0105242_10281903 | 3300009176 | Bacteria | 1510 |
| 377 | Ga0105242_10668262 | 3300009176 | Bacteria | 1012 |
| 378 | Ga0105242_10913286 | 3300009176 | Bacteria | 879 |
| 379 | Ga0105248_10110498 | 3300009177 | Bacteria | 3099 |
| 380 | Ga0105237_10000755 | 3300009545 | Bacteria | 44312 |
| 381 | Ga0105237_10003416 | 3300009545 | Bacteria | 18881 |
| 382 | Ga0105237_10003671 | 3300009545 | Bacteria | 18080 |
| 383 | Ga0105237_10011051 | 3300009545 | Bacteria | 9573 |
| 384 | Ga0105237_10015329 | 3300009545 | Bacteria | 7983 |
| 385 | Ga0105237_10071377 | 3300009545 | Bacteria | 3467 |
| 386 | Ga0105237_10102485 | 3300009545 | Bacteria | 2854 |
| 387 | Ga0105237_10107568 | 3300009545 | Bacteria | 2781 |
| 388 | Ga0105237_10115778 | 3300009545 | Bacteria | 2674 |
| 389 | Ga0105237_10490826 | 3300009545 | Bacteria | 1234 |
| 390 | Ga0105237_10769510 | 3300009545 | Bacteria | 970 |
| 391 | Ga0105238_10001132 | 3300009551 | Bacteria | 26885 |
| 392 | Ga0105238_10084549 | 3300009551 | Bacteria | 3162 |
| 393 | Ga0105249_10001648 | 3300009553 | Bacteria | 19565 |
| 394 | Ga0105249_10009236 | 3300009553 | Bacteria | 8625 |
| 395 | Ga0105249_10019347 | 3300009553 | Bacteria | 6073 |
| 396 | Ga0105249_10278051 | 3300009553 | Bacteria | 1671 |
| 397 | Ga0105249_10394234 | 3300009553 | Bacteria | 1413 |
| 398 | Ga0105249_10447783 | 3300009553 | Bacteria | 1329 |
| 399 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 400 | Ga0105239_10001136 | 3300010375 | Bacteria | 36704 |
| 401 | Ga0105239_10002613 | 3300010375 | Bacteria | 22790 |
| 402 | Ga0105239_10017403 | 3300010375 | Bacteria | 7949 |
| 403 | Ga0105239_10027980 | 3300010375 | Bacteria | 6203 |
| 404 | Ga0105239_10032560 | 3300010375 | Bacteria | 5728 |
| 405 | Ga0105239_10497734 | 3300010375 | Bacteria | 1385 |
| 406 | Ga0105239_10731675 | 3300010375 | Bacteria | 1132 |
| 407 | Ga0105246_10099156 | 3300011119 | Bacteria | 2117 |
| 408 | Ga0105246_10196436 | 3300011119 | Bacteria | 1565 |
| 409 | Ga0105246_10237380 | 3300011119 | Bacteria | 1439 |
| 410 | Ga0157373_10012918 | 3300013100 | Bacteria | 6130 |
| 411 | Ga0157373_10018988 | 3300013100 | Bacteria | 5004 |
| 412 | Ga0157373_10033618 | 3300013100 | Bacteria | 3687 |
| 413 | Ga0157373_10172620 | 3300013100 | Bacteria | 1521 |
| 414 | Ga0157371_10000830 | 3300013102 | Bacteria | 35437 |
| 415 | Ga0157371_10004289 | 3300013102 | Bacteria | 12511 |
| 416 | Ga0157371_10010326 | 3300013102 | Bacteria | 7286 |
| 417 | Ga0157371_10191690 | 3300013102 | Bacteria | 1464 |
| 418 | Ga0157371_10200867 | 3300013102 | Bacteria | 1429 |
| 419 | Ga0157371_10240055 | 3300013102 | Bacteria | 1303 |
| 420 | Ga0157371_10372543 | 3300013102 | Bacteria | 1042 |
| 421 | Ga0157371_10497455 | 3300013102 | Bacteria | 900 |
| 422 | Ga0157370_10000878 | 3300013104 | Bacteria | 38164 |
| 423 | Ga0157370_10002365 | 3300013104 | Bacteria | 22738 |
| 424 | Ga0157370_10007920 | 3300013104 | Bacteria | 11508 |
| 425 | Ga0157370_10009537 | 3300013104 | Bacteria | 10354 |
| 426 | Ga0157370_10041110 | 3300013104 | Bacteria | 4463 |
| 427 | Ga0157370_10113719 | 3300013104 | Bacteria | 2529 |
| 428 | Ga0157370_10152193 | 3300013104 | Bacteria | 2152 |
| 429 | Ga0157369_10019583 | 3300013105 | Bacteria | 7572 |
| 430 | Ga0157369_10049397 | 3300013105 | Bacteria | 4560 |
| 431 | Ga0157369_10057809 | 3300013105 | Bacteria | 4183 |
| 432 | Ga0157369_10424096 | 3300013105 | Bacteria | 1379 |
| 433 | Ga0157374_10021570 | 3300013296 | Bacteria | 5734 |
| 434 | Ga0157374_10047005 | 3300013296 | Unclassified | 3999 |
| 435 | Ga0157374_10083014 | 3300013296 | Bacteria | 3043 |
| 436 | Ga0157374_10089350 | 3300013296 | Bacteria | 2935 |
| 437 | Ga0157374_10109364 | 3300013296 | Bacteria | 2657 |
| 438 | Ga0157374_10129662 | 3300013296 | Bacteria | 2440 |
| 439 | Ga0157374_10177420 | 3300013296 | Bacteria | 2080 |
| 440 | Ga0157374_10261128 | 3300013296 | Bacteria | 1706 |
| 441 | Ga0157374_10411681 | 3300013296 | Unclassified | 1350 |
| 442 | Ga0157374_10574263 | 3300013296 | Unclassified | 1136 |
| 443 | Ga0157378_10003501 | 3300013297 | Bacteria | 13935 |
| 444 | Ga0157378_10017913 | 3300013297 | Bacteria | 6217 |
| 445 | Ga0157378_10033917 | 3300013297 | Bacteria | 4515 |
| 446 | Ga0157378_10044635 | 3300013297 | Bacteria | 3937 |
| 447 | Ga0157378_10045171 | 3300013297 | Bacteria | 3914 |
| 448 | Ga0157378_10063555 | 3300013297 | Bacteria | 3298 |
| 449 | Ga0157378_10065579 | 3300013297 | Bacteria | 3250 |
| 450 | Ga0157378_10239198 | 3300013297 | Bacteria | 1734 |
| 451 | Ga0163162_10000331 | 3300013306 | Bacteria | 43319 |
| 452 | Ga0163162_10000862 | 3300013306 | Bacteria | 28294 |
| 453 | Ga0163162_10001657 | 3300013306 | Bacteria | 20874 |
| 454 | Ga0163162_10003049 | 3300013306 | Bacteria | 16006 |
| 455 | Ga0163162_10010782 | 3300013306 | Bacteria | 8891 |
| 456 | Ga0163162_10021755 | 3300013306 | Bacteria | 6317 |
| 457 | Ga0163162_10027024 | 3300013306 | Bacteria | 5675 |
| 458 | Ga0163162_10079222 | 3300013306 | Bacteria | 3351 |
| 459 | Ga0163162_10094439 | 3300013306 | Unclassified | 3077 |
| 460 | Ga0163162_10138809 | 3300013306 | Bacteria | 2543 |
| 461 | Ga0163162_10169930 | 3300013306 | Bacteria | 2305 |
| 462 | Ga0163162_10174849 | 3300013306 | Bacteria | 2272 |
| 463 | Ga0163162_10186483 | 3300013306 | Bacteria | 2201 |
| 464 | Ga0163162_10188033 | 3300013306 | Bacteria | 2192 |
| 465 | Ga0163162_10288614 | 3300013306 | Bacteria | 1773 |
| 466 | Ga0163162_10296359 | 3300013306 | Bacteria | 1749 |
| 467 | Ga0163162_10517025 | 3300013306 | Bacteria | 1323 |
| 468 | Ga0163162_10519077 | 3300013306 | Bacteria | 1321 |
| 469 | Ga0163162_10688415 | 3300013306 | Bacteria | 1144 |
| 470 | Ga0163162_10730371 | 3300013306 | Bacteria | 1110 |
| 471 | Ga0163162_11291938 | 3300013306 | Bacteria | 829 |
| 472 | Ga0157372_10002207 | 3300013307 | Bacteria | 21135 |
| 473 | Ga0157372_10003015 | 3300013307 | Bacteria | 18158 |
| 474 | Ga0157372_10008452 | 3300013307 | Bacteria | 10927 |
| 475 | Ga0157372_10016387 | 3300013307 | Bacteria | 7950 |
| 476 | Ga0157372_10023020 | 3300013307 | Bacteria | 6751 |
| 477 | Ga0157372_10063516 | 3300013307 | Unclassified | 4140 |
| 478 | Ga0157372_10090954 | 3300013307 | Unclassified | 3470 |
| 479 | Ga0157372_10155061 | 3300013307 | Bacteria | 2645 |
| 480 | Ga0157372_10200417 | 3300013307 | Bacteria | 2312 |
| 481 | Ga0157372_10214241 | 3300013307 | Bacteria | 2232 |
| 482 | Ga0157372_10217126 | 3300013307 | Bacteria | 2216 |
| 483 | Ga0157372_10226602 | 3300013307 | Bacteria | 2167 |
| 484 | Ga0157372_10226782 | 3300013307 | Bacteria | 2166 |
| 485 | Ga0157372_10250305 | 3300013307 | Unclassified | 2057 |
| 486 | Ga0157372_10250805 | 3300013307 | Bacteria | 2054 |
| 487 | Ga0157372_10267796 | 3300013307 | Bacteria | 1984 |
| 488 | Ga0157372_10327005 | 3300013307 | Bacteria | 1785 |
| 489 | Ga0157372_10472836 | 3300013307 | Bacteria | 1461 |
| 490 | Ga0157372_10662367 | 3300013307 | Bacteria | 1215 |
| 491 | Ga0157372_10993600 | 3300013307 | Bacteria | 972 |
| 492 | Ga0157375_10000403 | 3300013308 | Bacteria | 39237 |
| 493 | Ga0157375_10005688 | 3300013308 | Bacteria | 10848 |
| 494 | Ga0157375_10053259 | 3300013308 | Bacteria | 3980 |
| 495 | Ga0157375_10118034 | 3300013308 | Bacteria | 2759 |
| 496 | Ga0157375_10139637 | 3300013308 | Bacteria | 2549 |
| 497 | Ga0157375_10152036 | 3300013308 | Bacteria | 2451 |
| 498 | Ga0157375_10184290 | 3300013308 | Bacteria | 2240 |
| 499 | Ga0157375_10255619 | 3300013308 | Bacteria | 1913 |
| 500 | Ga0157375_10272991 | 3300013308 | Bacteria | 1853 |
| 501 | Ga0157375_10370360 | 3300013308 | Bacteria | 1599 |
| 502 | Ga0157375_11194148 | 3300013308 | Unclassified | 892 |
| 503 | Ga0163163_10000399 | 3300014325 | Bacteria | 41026 |
| 504 | Ga0163163_10000653 | 3300014325 | Bacteria | 29691 |
| 505 | Ga0163163_10050638 | 3300014325 | Bacteria | 4090 |
| 506 | Ga0163163_10122936 | 3300014325 | Unclassified | 2630 |
| 507 | Ga0163163_10548107 | 3300014325 | Bacteria | 1219 |
| 508 | Ga0163163_10725400 | 3300014325 | Bacteria | 1057 |
| 509 | Ga0157380_10005370 | 3300014326 | Bacteria | 8953 |
| 510 | Ga0157380_10006261 | 3300014326 | Bacteria | 8358 |
| 511 | Ga0157380_10067509 | 3300014326 | Bacteria | 2880 |
| 512 | Ga0157380_10537331 | 3300014326 | Bacteria | 1144 |
| 513 | Ga0157380_11187241 | 3300014326 | Bacteria | 806 |
| 514 | Ga0157377_10012052 | 3300014745 | Bacteria | 4337 |
| 515 | Ga0157377_10020354 | 3300014745 | Bacteria | 3475 |
| 516 | Ga0157377_10057005 | 3300014745 | Bacteria | 2220 |
| 517 | Ga0157377_10103353 | 3300014745 | Bacteria | 1702 |
| 518 | Ga0157377_10138434 | 3300014745 | Bacteria | 1494 |
| 519 | Ga0157377_10151268 | 3300014745 | Bacteria | 1435 |
| 520 | Ga0157377_10158057 | 3300014745 | Bacteria | 1407 |
| 521 | Ga0157377_10285922 | 3300014745 | Bacteria | 1083 |
| 522 | Ga0157379_10007752 | 3300014968 | Bacteria | 9297 |
| 523 | Ga0157379_10020556 | 3300014968 | Bacteria | 5840 |
| 524 | Ga0157379_10038671 | 3300014968 | Bacteria | 4256 |
| 525 | Ga0157379_10093054 | 3300014968 | Bacteria | 2704 |
| 526 | Ga0157379_10151722 | 3300014968 | Bacteria | 2090 |
| 527 | Ga0157379_10261991 | 3300014968 | Bacteria | 1571 |
| 528 | Ga0157379_10823817 | 3300014968 | Bacteria | 877 |
| 529 | Ga0157376_10014600 | 3300014969 | Bacteria | 5900 |
| 530 | Ga0157376_10020948 | 3300014969 | Bacteria | 5069 |
| 531 | Ga0157376_10050787 | 3300014969 | Bacteria | 3442 |
| 532 | Ga0157376_10059697 | 3300014969 | Unclassified | 3198 |
| 533 | Ga0157376_10071222 | 3300014969 | Bacteria | 2953 |
| 534 | Ga0157376_10075952 | 3300014969 | Bacteria | 2869 |
| 535 | Ga0157376_10221522 | 3300014969 | Bacteria | 1752 |
| 536 | Ga0157376_10351249 | 3300014969 | Bacteria | 1411 |
| 537 | Ga0157376_10356890 | 3300014969 | Bacteria | 1401 |
| 538 | Ga0157376_10387147 | 3300014969 | Bacteria | 1348 |
| 539 | Ga0157376_10444559 | 3300014969 | Bacteria | 1263 |
| 540 | Ga0157376_10461803 | 3300014969 | Bacteria | 1241 |
| 541 | Ga0157376_10535006 | 3300014969 | Bacteria | 1157 |
| 542 | Ga0163161_10003834 | 3300017792 | Bacteria | 10540 |
| 543 | Ga0163161_10031281 | 3300017792 | Bacteria | 3791 |
| 544 | Ga0163161_10065804 | 3300017792 | Bacteria | 2645 |
| 545 | Ga0163161_10072654 | 3300017792 | Bacteria | 2519 |
| 546 | Ga0163161_10086657 | 3300017792 | Bacteria | 2312 |
| 547 | Ga0163161_10184256 | 3300017792 | Bacteria | 1602 |
| 548 | Ga0163161_10431853 | 3300017792 | Bacteria | 1062 |
| 549 | Ga0163161_10500033 | 3300017792 | Bacteria | 990 |
| 550 | Ga0163161_10568157 | 3300017792 | Bacteria | 931 |
| 551 | Ga0213876_10005738 | 3300021384 | Bacteria | 6800 |
| 552 | Ga0209436_102603 | 3300025208 | Bacteria | 5303 |
| 553 | Ga0207666_1004620 | 3300025271 | Bacteria | 1732 |
| 554 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 555 | Ga0209130_1003624 | 3300025284 | Bacteria | 6405 |
| 556 | Ga0209564_1006250 | 3300025295 | Bacteria | 6495 |
| 557 | Ga0209564_1027158 | 3300025295 | Bacteria | 1867 |
| 558 | Ga0209758_1005921 | 3300025297 | Bacteria | 9090 |
| 559 | Ga0209758_1011914 | 3300025297 | Bacteria | 4951 |
| 560 | Ga0209050_1000616 | 3300025298 | Bacteria | 55934 |
| 561 | Ga0207426_1000139 | 3300025302 | Bacteria | 195835 |
| 562 | Ga0207426_1031851 | 3300025302 | Bacteria | 1717 |
| 563 | Ga0207426_1038833 | 3300025302 | Bacteria | 1496 |
| 564 | Ga0209051_1014936 | 3300025303 | Bacteria | 3600 |
| 565 | Ga0209257_1006990 | 3300025304 | Bacteria | 7020 |
| 566 | Ga0207697_10000488 | 3300025315 | Bacteria | 22401 |
| 567 | Ga0207697_10055345 | 3300025315 | Bacteria | 1645 |
| 568 | Ga0207656_10003445 | 3300025321 | Bacteria | 5436 |
| 569 | Ga0207656_10026721 | 3300025321 | Bacteria | 2356 |
| 570 | Ga0207656_10198205 | 3300025321 | Unclassified | 969 |
| 571 | Ga0207682_10007523 | 3300025893 | Bacteria | 4334 |
| 572 | Ga0207682_10016325 | 3300025893 | Bacteria | 2896 |
| 573 | Ga0207682_10274833 | 3300025893 | Bacteria | 787 |
| 574 | Ga0207642_10397851 | 3300025899 | Bacteria | 824 |
| 575 | Ga0207710_10006861 | 3300025900 | Bacteria | 4847 |
| 576 | Ga0207688_10287719 | 3300025901 | Bacteria | 1003 |
| 577 | Ga0207680_10000877 | 3300025903 | Bacteria | 14203 |
| 578 | Ga0207680_10023815 | 3300025903 | Bacteria | 3350 |
| 579 | Ga0207680_10168230 | 3300025903 | Bacteria | 1475 |
| 580 | Ga0207680_10186892 | 3300025903 | Bacteria | 1404 |
| 581 | Ga0207680_10230038 | 3300025903 | Bacteria | 1274 |
| 582 | Ga0207647_10000530 | 3300025904 | Bacteria | 30443 |
| 583 | Ga0207647_10055791 | 3300025904 | Bacteria | 2426 |
| 584 | Ga0207647_10194583 | 3300025904 | Bacteria | 1174 |
| 585 | Ga0207645_10007828 | 3300025907 | Bacteria | 7514 |
| 586 | Ga0207645_10010367 | 3300025907 | Bacteria | 6398 |
| 587 | Ga0207645_10065949 | 3300025907 | Bacteria | 2314 |
| 588 | Ga0207643_10005004 | 3300025908 | Bacteria | 7097 |
| 589 | Ga0207643_10008998 | 3300025908 | Bacteria | 5361 |
| 590 | Ga0207643_10103057 | 3300025908 | Bacteria | 1675 |
| 591 | Ga0207705_10071276 | 3300025909 | Bacteria | 2519 |
| 592 | Ga0207705_10103349 | 3300025909 | Unclassified | 2099 |
| 593 | Ga0207705_10145746 | 3300025909 | Bacteria | 1771 |
| 594 | Ga0207705_10198948 | 3300025909 | Bacteria | 1518 |
| 595 | Ga0207705_10322142 | 3300025909 | Bacteria | 1188 |
| 596 | Ga0207654_10000483 | 3300025911 | Bacteria | 22768 |
| 597 | Ga0207654_10008469 | 3300025911 | Bacteria | 5201 |
| 598 | Ga0207654_10036518 | 3300025911 | Bacteria | 2746 |
| 599 | Ga0207654_10094548 | 3300025911 | Bacteria | 1829 |
| 600 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 601 | Ga0207707_10000490 | 3300025912 | Bacteria | 40927 |
| 602 | Ga0207707_10149703 | 3300025912 | Bacteria | 2041 |
| 603 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 604 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 605 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 606 | Ga0207695_10004025 | 3300025913 | Bacteria | 20234 |
| 607 | Ga0207695_10007684 | 3300025913 | Bacteria | 13656 |
| 608 | Ga0207695_10009590 | 3300025913 | Bacteria | 11959 |
| 609 | Ga0207695_10020243 | 3300025913 | Bacteria | 7626 |
| 610 | Ga0207695_10029916 | 3300025913 | Bacteria | 6007 |
| 611 | Ga0207695_10044514 | 3300025913 | Bacteria | 4720 |
| 612 | Ga0207695_10051643 | 3300025913 | Bacteria | 4314 |
| 613 | Ga0207695_10075438 | 3300025913 | Bacteria | 3431 |
| 614 | Ga0207695_11042968 | 3300025913 | Bacteria | 697 |
| 615 | Ga0207671_10000036 | 3300025914 | Bacteria | 236133 |
| 616 | Ga0207671_10001044 | 3300025914 | Bacteria | 33679 |
| 617 | Ga0207671_10002316 | 3300025914 | Bacteria | 20539 |
| 618 | Ga0207671_10004890 | 3300025914 | Bacteria | 12594 |
| 619 | Ga0207671_10076294 | 3300025914 | Bacteria | 2508 |
| 620 | Ga0207671_10095635 | 3300025914 | Bacteria | 2243 |
| 621 | Ga0207671_10114913 | 3300025914 | Bacteria | 2052 |
| 622 | Ga0207671_10416835 | 3300025914 | Bacteria | 1068 |
| 623 | Ga0207660_10000371 | 3300025917 | Bacteria | 29362 |
| 624 | Ga0207660_10386831 | 3300025917 | Bacteria | 1125 |
| 625 | Ga0207662_10034747 | 3300025918 | Bacteria | 2942 |
| 626 | Ga0207662_10047254 | 3300025918 | Bacteria | 2549 |
| 627 | Ga0207657_10004060 | 3300025919 | Bacteria | 15540 |
| 628 | Ga0207657_10013726 | 3300025919 | Bacteria | 7930 |
| 629 | Ga0207649_10014996 | 3300025920 | Bacteria | 4351 |
| 630 | Ga0207649_10165059 | 3300025920 | Bacteria | 1538 |
| 631 | Ga0207652_10000045 | 3300025921 | Bacteria | 125343 |
| 632 | Ga0207652_10001693 | 3300025921 | Bacteria | 19292 |
| 633 | Ga0207652_10030239 | 3300025921 | Bacteria | 4534 |
| 634 | Ga0207681_10063297 | 3300025923 | Bacteria | 2550 |
| 635 | Ga0207681_10066545 | 3300025923 | Bacteria | 2495 |
| 636 | Ga0207681_10206386 | 3300025923 | Bacteria | 1512 |
| 637 | Ga0207681_10573228 | 3300025923 | Bacteria | 930 |
| 638 | Ga0207694_10030500 | 3300025924 | Bacteria | 4119 |
| 639 | Ga0207694_10055666 | 3300025924 | Bacteria | 3070 |
| 640 | Ga0207650_10018352 | 3300025925 | Bacteria | 4909 |
| 641 | Ga0207650_10040160 | 3300025925 | Bacteria | 3422 |
| 642 | Ga0207650_10041209 | 3300025925 | Unclassified | 3382 |
| 643 | Ga0207650_10107927 | 3300025925 | Bacteria | 2151 |
| 644 | Ga0207650_10134118 | 3300025925 | Bacteria | 1940 |
| 645 | Ga0207650_10269341 | 3300025925 | Bacteria | 1384 |
| 646 | Ga0207650_10317384 | 3300025925 | Bacteria | 1275 |
| 647 | Ga0207650_10339615 | 3300025925 | Bacteria | 1233 |
| 648 | Ga0207650_10393722 | 3300025925 | Unclassified | 1146 |
| 649 | Ga0207650_10480527 | 3300025925 | Bacteria | 1037 |
| 650 | Ga0207650_10494828 | 3300025925 | Bacteria | 1021 |
| 651 | Ga0207659_10048360 | 3300025926 | Bacteria | 3012 |
| 652 | Ga0207644_10081611 | 3300025931 | Bacteria | 2390 |
| 653 | Ga0207644_10113203 | 3300025931 | Bacteria | 2054 |
| 654 | Ga0207644_10218698 | 3300025931 | Bacteria | 1509 |
| 655 | Ga0207644_10788384 | 3300025931 | Bacteria | 795 |
| 656 | Ga0207690_10103340 | 3300025932 | Bacteria | 2039 |
| 657 | Ga0207690_10142865 | 3300025932 | Bacteria | 1766 |
| 658 | Ga0207690_10145816 | 3300025932 | Bacteria | 1750 |
| 659 | Ga0207690_10520402 | 3300025932 | Bacteria | 964 |
| 660 | Ga0207690_10576843 | 3300025932 | Bacteria | 916 |
| 661 | Ga0207706_10009485 | 3300025933 | Bacteria | 8938 |
| 662 | Ga0207706_10023276 | 3300025933 | Bacteria | 5563 |
| 663 | Ga0207706_10074803 | 3300025933 | Bacteria | 2978 |
| 664 | Ga0207706_10109750 | 3300025933 | Unclassified | 2428 |
| 665 | Ga0207706_10220171 | 3300025933 | Bacteria | 1662 |
| 666 | Ga0207706_10318661 | 3300025933 | Unclassified | 1353 |
| 667 | Ga0207706_10802784 | 3300025933 | Bacteria | 799 |
| 668 | Ga0207686_10059242 | 3300025934 | Unclassified | 2418 |
| 669 | Ga0207686_10217673 | 3300025934 | Bacteria | 1377 |
| 670 | Ga0207670_10069648 | 3300025936 | Bacteria | 2427 |
| 671 | Ga0207670_10081645 | 3300025936 | Bacteria | 2263 |
| 672 | Ga0207670_10094353 | 3300025936 | Bacteria | 2123 |
| 673 | Ga0207670_10134098 | 3300025936 | Bacteria | 1818 |
| 674 | Ga0207669_10002940 | 3300025937 | Bacteria | 7318 |
| 675 | Ga0207669_10214850 | 3300025937 | Bacteria | 1407 |
| 676 | Ga0207704_10057241 | 3300025938 | Unclassified | 2394 |
| 677 | Ga0207704_10347434 | 3300025938 | Bacteria | 1154 |
| 678 | Ga0207704_10510989 | 3300025938 | Bacteria | 970 |
| 679 | Ga0207691_10003785 | 3300025940 | Bacteria | 14692 |
| 680 | Ga0207691_10006538 | 3300025940 | Bacteria | 11250 |
| 681 | Ga0207691_10181605 | 3300025940 | Bacteria | 1838 |
| 682 | Ga0207691_10185184 | 3300025940 | Bacteria | 1818 |
| 683 | Ga0207691_10374224 | 3300025940 | Bacteria | 1216 |
| 684 | Ga0207691_10470916 | 3300025940 | Bacteria | 1068 |
| 685 | Ga0207691_10555539 | 3300025940 | Bacteria | 973 |
| 686 | Ga0207689_10007246 | 3300025942 | Bacteria | 9741 |
| 687 | Ga0207689_10012105 | 3300025942 | Bacteria | 7386 |
| 688 | Ga0207689_10015970 | 3300025942 | Bacteria | 6354 |
| 689 | Ga0207689_10025044 | 3300025942 | Bacteria | 5002 |
| 690 | Ga0207689_10033718 | 3300025942 | Bacteria | 4253 |
| 691 | Ga0207689_10042397 | 3300025942 | Bacteria | 3765 |
| 692 | Ga0207689_10045723 | 3300025942 | Bacteria | 3619 |
| 693 | Ga0207689_10830830 | 3300025942 | Bacteria | 780 |
| 694 | Ga0207661_10017642 | 3300025944 | Bacteria | 5288 |
| 695 | Ga0207661_10018282 | 3300025944 | Bacteria | 5206 |
| 696 | Ga0207661_10046148 | 3300025944 | Unclassified | 3454 |
| 697 | Ga0207661_10048995 | 3300025944 | Bacteria | 3361 |
| 698 | Ga0207661_10279507 | 3300025944 | Bacteria | 1492 |
| 699 | Ga0207679_10000660 | 3300025945 | Bacteria | 23125 |
| 700 | Ga0207679_10031627 | 3300025945 | Bacteria | 3706 |
| 701 | Ga0207679_10318293 | 3300025945 | Bacteria | 1346 |
| 702 | Ga0207679_10533605 | 3300025945 | Bacteria | 1051 |
| 703 | Ga0207679_10872712 | 3300025945 | Bacteria | 822 |
| 704 | Ga0207667_10001672 | 3300025949 | Bacteria | 27944 |
| 705 | Ga0207667_10002100 | 3300025949 | Bacteria | 24981 |
| 706 | Ga0207667_10018760 | 3300025949 | Bacteria | 7747 |
| 707 | Ga0207667_10021218 | 3300025949 | Bacteria | 7200 |
| 708 | Ga0207667_10083528 | 3300025949 | Unclassified | 3307 |
| 709 | Ga0207667_10186397 | 3300025949 | Bacteria | 2130 |
| 710 | Ga0207667_10188239 | 3300025949 | Bacteria | 2118 |
| 711 | Ga0207667_10324348 | 3300025949 | Bacteria | 1573 |
| 712 | Ga0207667_10902934 | 3300025949 | Bacteria | 875 |
| 713 | Ga0207651_10012113 | 3300025960 | Bacteria | 4862 |
| 714 | Ga0207651_10024476 | 3300025960 | Bacteria | 3736 |
| 715 | Ga0207651_10085369 | 3300025960 | Bacteria | 2290 |
| 716 | Ga0207651_10197856 | 3300025960 | Bacteria | 1608 |
| 717 | Ga0207651_10281110 | 3300025960 | Bacteria | 1375 |
| 718 | Ga0207651_10421014 | 3300025960 | Bacteria | 1140 |
| 719 | Ga0207712_10001659 | 3300025961 | Bacteria | 14937 |
| 720 | Ga0207712_10013905 | 3300025961 | Bacteria | 5162 |
| 721 | Ga0207712_10015160 | 3300025961 | Bacteria | 4967 |
| 722 | Ga0207712_10020106 | 3300025961 | Bacteria | 4369 |
| 723 | Ga0207712_10052105 | 3300025961 | Bacteria | 2865 |
| 724 | Ga0207712_10052992 | 3300025961 | Bacteria | 2844 |
| 725 | Ga0207712_10080594 | 3300025961 | Bacteria | 2368 |
| 726 | Ga0207668_10000843 | 3300025972 | Bacteria | 18537 |
| 727 | Ga0207668_10099307 | 3300025972 | Bacteria | 2159 |
| 728 | Ga0207668_10106907 | 3300025972 | Bacteria | 2091 |
| 729 | Ga0207668_10299748 | 3300025972 | Bacteria | 1326 |
| 730 | Ga0207668_10748372 | 3300025972 | Unclassified | 862 |
| 731 | Ga0207640_10032898 | 3300025981 | Bacteria | 3220 |
| 732 | Ga0207640_10040439 | 3300025981 | Bacteria | 2958 |
| 733 | Ga0207640_10171534 | 3300025981 | Bacteria | 1617 |
| 734 | Ga0207640_10376852 | 3300025981 | Bacteria | 1148 |
| 735 | Ga0207640_10567559 | 3300025981 | Unclassified | 956 |
| 736 | Ga0207640_10902303 | 3300025981 | Bacteria | 772 |
| 737 | Ga0207658_10028138 | 3300025986 | Bacteria | 3956 |
| 738 | Ga0207658_10039424 | 3300025986 | Bacteria | 3408 |
| 739 | Ga0207658_10063161 | 3300025986 | Bacteria | 2774 |
| 740 | Ga0207658_10303416 | 3300025986 | Bacteria | 1376 |
| 741 | Ga0207658_10339937 | 3300025986 | Bacteria | 1304 |
| 742 | Ga0207658_10443123 | 3300025986 | Bacteria | 1148 |
| 743 | Ga0207658_10622051 | 3300025986 | Bacteria | 971 |
| 744 | Ga0207658_10743939 | 3300025986 | Bacteria | 888 |
| 745 | Ga0207658_11031683 | 3300025986 | Bacteria | 751 |
| 746 | Ga0207677_10010298 | 3300026023 | Bacteria | 5288 |
| 747 | Ga0207677_10037285 | 3300026023 | Bacteria | 3176 |
| 748 | Ga0207677_10049026 | 3300026023 | Unclassified | 2847 |
| 749 | Ga0207677_10094706 | 3300026023 | Unclassified | 2180 |
| 750 | Ga0207677_10118789 | 3300026023 | Unclassified | 1984 |
| 751 | Ga0207677_10247587 | 3300026023 | Bacteria | 1446 |
| 752 | Ga0207677_10321980 | 3300026023 | Unclassified | 1285 |
| 753 | Ga0207677_10516772 | 3300026023 | Bacteria | 1035 |
| 754 | Ga0207703_10034699 | 3300026035 | Bacteria | 4004 |
| 755 | Ga0207703_10079799 | 3300026035 | Bacteria | 2724 |
| 756 | Ga0207703_10126015 | 3300026035 | Bacteria | 2205 |
| 757 | Ga0207703_10926991 | 3300026035 | Bacteria | 834 |
| 758 | Ga0207639_10002030 | 3300026041 | Bacteria | 13645 |
| 759 | Ga0207639_10027999 | 3300026041 | Bacteria | 4110 |
| 760 | Ga0207639_10057303 | 3300026041 | Bacteria | 2991 |
| 761 | Ga0207639_10083325 | 3300026041 | Bacteria | 2538 |
| 762 | Ga0207639_10338162 | 3300026041 | Bacteria | 1341 |
| 763 | Ga0207639_10491026 | 3300026041 | Bacteria | 1120 |
| 764 | Ga0207639_10551997 | 3300026041 | Unclassified | 1058 |
| 765 | Ga0207639_10645764 | 3300026041 | Bacteria | 979 |
| 766 | Ga0207639_11065462 | 3300026041 | Bacteria | 758 |
| 767 | Ga0207678_10094288 | 3300026067 | Bacteria | 2558 |
| 768 | Ga0207678_10214913 | 3300026067 | Bacteria | 1645 |
| 769 | Ga0207678_10416713 | 3300026067 | Bacteria | 1164 |
| 770 | Ga0207678_10513936 | 3300026067 | Bacteria | 1045 |
| 771 | Ga0207708_10175955 | 3300026075 | Bacteria | 1697 |
| 772 | Ga0207708_10312799 | 3300026075 | Bacteria | 1280 |
| 773 | Ga0207702_10078821 | 3300026078 | Bacteria | 2853 |
| 774 | Ga0207702_10313212 | 3300026078 | Bacteria | 1493 |
| 775 | Ga0207641_10000212 | 3300026088 | Bacteria | 75285 |
| 776 | Ga0207641_10001311 | 3300026088 | Bacteria | 24595 |
| 777 | Ga0207641_10061188 | 3300026088 | Bacteria | 3211 |
| 778 | Ga0207641_10182128 | 3300026088 | Bacteria | 1925 |
| 779 | Ga0207641_10201275 | 3300026088 | Bacteria | 1836 |
| 780 | Ga0207641_10279064 | 3300026088 | Bacteria | 1571 |
| 781 | Ga0207641_10602960 | 3300026088 | Bacteria | 1075 |
| 782 | Ga0207648_10075008 | 3300026089 | Bacteria | 2949 |
| 783 | Ga0207648_10075058 | 3300026089 | Bacteria | 2948 |
| 784 | Ga0207648_10112020 | 3300026089 | Bacteria | 2396 |
| 785 | Ga0207648_10113991 | 3300026089 | Bacteria | 2375 |
| 786 | Ga0207648_10114302 | 3300026089 | Bacteria | 2371 |
| 787 | Ga0207648_10114994 | 3300026089 | Bacteria | 2364 |
| 788 | Ga0207648_10146780 | 3300026089 | Bacteria | 2081 |
| 789 | Ga0207648_10536631 | 3300026089 | Bacteria | 1073 |
| 790 | Ga0207648_11176366 | 3300026089 | Bacteria | 720 |
| 791 | Ga0207676_10003111 | 3300026095 | Bacteria | 11837 |
| 792 | Ga0207676_10003477 | 3300026095 | Bacteria | 11144 |
| 793 | Ga0207676_10041742 | 3300026095 | Bacteria | 3524 |
| 794 | Ga0207676_10060656 | 3300026095 | Bacteria | 2993 |
| 795 | Ga0207676_10363014 | 3300026095 | Bacteria | 1343 |
| 796 | Ga0207676_10471210 | 3300026095 | Bacteria | 1187 |
| 797 | Ga0207674_10000672 | 3300026116 | Bacteria | 44419 |
| 798 | Ga0207674_10002807 | 3300026116 | Bacteria | 21671 |
| 799 | Ga0207674_10035026 | 3300026116 | Bacteria | 5241 |
| 800 | Ga0207674_10042103 | 3300026116 | Bacteria | 4720 |
| 801 | Ga0207674_10044802 | 3300026116 | Unclassified | 4556 |
| 802 | Ga0207674_10054325 | 3300026116 | Bacteria | 4078 |
| 803 | Ga0207674_10102557 | 3300026116 | Bacteria | 2841 |
| 804 | Ga0207675_100000326 | 3300026118 | Bacteria | 45358 |
| 805 | Ga0207675_100050510 | 3300026118 | Bacteria | 3880 |
| 806 | Ga0207675_100060492 | 3300026118 | Bacteria | 3536 |
| 807 | Ga0207675_100282870 | 3300026118 | Bacteria | 1612 |
| 808 | Ga0207675_100914214 | 3300026118 | Bacteria | 894 |
| 809 | Ga0207683_10012945 | 3300026121 | Bacteria | 7122 |
| 810 | Ga0207683_10043838 | 3300026121 | Bacteria | 3910 |
| 811 | Ga0207683_10077012 | 3300026121 | Bacteria | 2953 |
| 812 | Ga0207683_10123695 | 3300026121 | Bacteria | 2323 |
| 813 | Ga0207683_10142757 | 3300026121 | Bacteria | 2158 |
| 814 | Ga0207683_10241993 | 3300026121 | Unclassified | 1646 |
| 815 | Ga0207698_10014057 | 3300026142 | Bacteria | 5307 |
| 816 | Ga0207698_10015761 | 3300026142 | Bacteria | 5075 |
| 817 | Ga0207698_10124852 | 3300026142 | Bacteria | 2186 |
| 818 | Ga0207698_10130934 | 3300026142 | Bacteria | 2143 |
| 819 | Ga0207698_10167819 | 3300026142 | Bacteria | 1929 |
| 820 | Ga0207698_10178818 | 3300026142 | Bacteria | 1877 |
| 821 | Ga0207698_10236868 | 3300026142 | Bacteria | 1661 |
| 822 | Ga0207698_10260335 | 3300026142 | Bacteria | 1593 |
| 823 | Ga0207698_10430363 | 3300026142 | Unclassified | 1269 |
| 824 | Ga0207698_10645732 | 3300026142 | Bacteria | 1048 |
| 825 | Ga0207698_10892692 | 3300026142 | Bacteria | 896 |
| 826 | Ga0207428_10037411 | 3300027907 | Bacteria | 3948 |
| 827 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 828 | Ga0268266_10548555 | 3300028379 | Bacteria | 1107 |
| 829 | Ga0268265_10525583 | 3300028380 | Bacteria | 1119 |
| 830 | Ga0268265_10632011 | 3300028380 | Bacteria | 1027 |
| 831 | Ga0268265_10669463 | 3300028380 | Unclassified | 999 |
| 832 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 833 | Ga0268264_10002479 | 3300028381 | Bacteria | 16221 |
| 834 | Ga0268264_10003505 | 3300028381 | Bacteria | 13525 |
| 835 | Ga0268264_10003739 | 3300028381 | Bacteria | 13067 |
| 836 | Ga0268264_10007266 | 3300028381 | Bacteria | 9270 |
| 837 | Ga0268264_10007386 | 3300028381 | Bacteria | 9179 |
| 838 | Ga0268264_10067063 | 3300028381 | Bacteria | 3028 |
| 839 | Ga0268264_10210408 | 3300028381 | Unclassified | 1785 |
| 840 | Ga0268264_10303271 | 3300028381 | Unclassified | 1504 |
| 841 | Ga0268264_10351024 | 3300028381 | Bacteria | 1404 |
| 842 | Ga0268264_10636434 | 3300028381 | Bacteria | 1054 |
| 843 | Ga0307517_10232046 | 3300028786 | Bacteria | 1106 |
| 844 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 845 | Ga0307511_10001228 | 3300030521 | Bacteria | 27171 |
| 846 | Ga0307512_10116816 | 3300030522 | Bacteria | 1732 |
| 847 | Ga0265327_10000316 | 3300031251 | Bacteria | 92271 |
| 848 | Ga0307513_10077328 | 3300031456 | Bacteria | 3447 |
| 849 | Ga0307513_10098306 | 3300031456 | Bacteria | 2959 |
| 850 | Ga0307513_10517883 | 3300031456 | Bacteria | 908 |
| 851 | Ga0307509_10087285 | 3300031507 | Bacteria | 3205 |
| 852 | Ga0307509_10097840 | 3300031507 | Bacteria | 2982 |
| 853 | Ga0307509_10104731 | 3300031507 | Bacteria | 2853 |
| 854 | Ga0265313_10036075 | 3300031595 | Bacteria | 2484 |
| 855 | Ga0307516_10001558 | 3300031730 | Bacteria | 31533 |
| 856 | Ga0307516_10077058 | 3300031730 | Bacteria | 3184 |
| 857 | Ga0307406_10167633 | 3300031901 | Bacteria | 1586 |
| 858 | Ga0307411_10476522 | 3300032005 | Bacteria | 1050 |
| 859 | Ga0307411_10868994 | 3300032005 | Bacteria | 799 |
| 860 | Ga0307415_100021044 | 3300032126 | Bacteria | 3999 |
| 861 | Ga0307510_10000217 | 3300033180 | Bacteria | 51069 |
| 862 | Ga0373943_0061340 | 3300035170 | Bacteria | 1880 |
| 863 | Ga0373943_0391542 | 3300035170 | Bacteria | 801 |
| 864 | Ga0373924_0029480 | 3300035410 | Bacteria | 2194 |
| 865 | Ga0373937_0455425 | 3300036401 | Bacteria | 1215 |
| 866 | Ga0395900_0001468 | 3300037418 | Bacteria | 28127 |
| 867 | Ga0395900_0041360 | 3300037418 | Bacteria | 4752 |
| 868 | Ga0395898_0001670 | 3300037466 | Bacteria | 29744 |
| 869 | Ga0395905_0177870 | 3300037471 | Bacteria | 1997 |
| 870 | Ga0395901_0001174 | 3300038443 | Bacteria | 27840 |
| 871 | Ga0395901_0425187 | 3300038443 | Bacteria | 1362 |
| 872 | Ga0395901_0745858 | 3300038443 | Bacteria | 973 |
| 873 | Ga0436365_0168773 | 3300039437 | Bacteria | 712 |
| 874 | Ga0436365_0246639 | 3300039437 | Bacteria | 834 |
| 875 | Ga0436365_0591026 | 3300039437 | Bacteria | 18814 |
| 876 | Ga0436365_1248268 | 3300039437 | Bacteria | 25465 |
| 877 | Ga0436365_1724629 | 3300039437 | Unclassified | 1468 |
| 878 | Ga0439436_0019019 | 3300041404 | Bacteria | 2052 |
| 879 | Ga0451789_0528288 | 3300041443 | Bacteria | 679 |
| 880 | Ga0451833_1275392 | 3300041491 | Bacteria | 915 |
| 881 | Ga0451837_0610310 | 3300041494 | Bacteria | 755 |
| 882 | Ga0451849_0024587 | 3300041505 | Bacteria | 1338 |
| 883 | Ga0451855_1789405 | 3300041511 | Bacteria | 3129 |
| 884 | Ga0439441_007968 | 3300042001 | Bacteria | 1721 |
| 885 | Ga0439449_0050281 | 3300042007 | Bacteria | 1542 |
| 886 | Ga0439457_001674 | 3300042014 | Bacteria | 6577 |
| 887 | Ga0439462_0028345 | 3300042015 | Bacteria | 1480 |
| 888 | Ga0439462_0060813 | 3300042015 | Bacteria | 1022 |
| 889 | Ga0439434_0102735 | 3300042435 | Bacteria | 922 |
| 890 | Ga0451577_0008492 | 3300042876 | Bacteria | 9999 |
| 891 | Ga0451577_0082716 | 3300042876 | Bacteria | 2864 |
| 892 | Ga0451577_0089816 | 3300042876 | Bacteria | 2742 |
| 893 | Ga0466972_0000207 | 3300044658 | Bacteria | 42277 |
| 894 | Ga0466972_0000469 | 3300044658 | Bacteria | 20427 |
| 895 | Ga0466972_0115966 | 3300044658 | Bacteria | 1264 |
| 896 | Ga0466965_0070490 | 3300044683 | Bacteria | 1757 |
| 897 | Ga0466966_0001667 | 3300044684 | Bacteria | 14318 |
| 898 | Ga0466961_0160958 | 3300044693 | Bacteria | 1399 |
| 899 | Ga0466961_0220450 | 3300044693 | Bacteria | 1169 |
| 900 | Ga0466961_0330291 | 3300044693 | Bacteria | 929 |
| 901 | Ga0466964_0319287 | 3300044706 | Bacteria | 789 |
| 902 | Ga0453684_0012189 | 3300044712 | Bacteria | 14256 |
| 903 | Ga0453684_0701361 | 3300044712 | Bacteria | 1100 |
| 904 | Ga0466968_0028617 | 3300044735 | Bacteria | 2299 |
| 905 | Ga0466960_0260317 | 3300044901 | Bacteria | 966 |
| 906 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 907 | Ga0466959_0194517 | 3300045049 | Bacteria | 1414 |
| 908 | Ga0495603_0055250 | 3300046455 | Bacteria | 2353 |
| 909 | Ga0495638_0113799 | 3300046460 | Bacteria | 1605 |
| 910 | Ga0495638_0145809 | 3300046460 | Bacteria | 1377 |
| 911 | Ga0495653_0211395 | 3300046463 | Bacteria | 1310 |
| 912 | Ga0495580_0151990 | 3300046472 | Bacteria | 1604 |
| 913 | Ga0495594_0100148 | 3300046499 | Bacteria | 1630 |
| 914 | Ga0495606_0018941 | 3300046507 | Bacteria | 5143 |
| 915 | Ga0495608_0067081 | 3300046511 | Bacteria | 2348 |
| 916 | Ga0495628_0013274 | 3300046516 | Bacteria | 6929 |
| 917 | Ga0495630_0054622 | 3300046517 | Bacteria | 2992 |
| 918 | Ga0495648_0003830 | 3300046524 | Bacteria | 13054 |
| 919 | Ga0495587_0171142 | 3300046536 | Bacteria | 1234 |
| 920 | Ga0495621_0031193 | 3300046539 | Bacteria | 1827 |
| 921 | Ga0495622_0069730 | 3300046557 | Bacteria | 1623 |
| 922 | Ga0495668_0000459 | 3300046616 | Bacteria | 52226 |
| 923 | Ga0495634_0031752 | 3300046642 | Bacteria | 3636 |
| 924 | Ga0495611_0000090 | 3300046648 | Bacteria | 63531 |
| 925 | Ga0495611_0023013 | 3300046648 | Bacteria | 2700 |
| 926 | Ga0495625_0069055 | 3300046660 | Bacteria | 2483 |
| 927 | Ga0495672_0009967 | 3300047320 | Bacteria | 6816 |
| 928 | Ga0495672_0026413 | 3300047320 | Bacteria | 3705 |
| 929 | Ga0495672_0063586 | 3300047320 | Bacteria | 2117 |
| 930 | Ga0495672_0076601 | 3300047320 | Bacteria | 1878 |
| 931 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 932 | Ga0495686_0013476 | 3300047472 | Bacteria | 5669 |
| 933 | Ga0495686_0239443 | 3300047472 | Bacteria | 1024 |
| 934 | Ga0496101_0068362 | 3300048904 | Bacteria | 2597 |
| 935 | Ga0496108_0417943 | 3300048911 | Bacteria | 1171 |
| 936 | Ga0496109_0233204 | 3300048912 | Unclassified | 1732 |
| 937 | Ga0501298_010178 | 3300049521 | Bacteria | 1613 |
| 938 | Ga0501033_0044752 | 3300049570 | Bacteria | 3295 |
| 939 | Ga0501033_0525137 | 3300049570 | Bacteria | 817 |
| 940 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 941 | Ga0501034_0036199 | 3300049571 | Bacteria | 5001 |
| 942 | Ga0501034_0040916 | 3300049571 | Bacteria | 4689 |
| 943 | Ga0501034_0067326 | 3300049571 | Bacteria | 3594 |
| 944 | Ga0501034_0152616 | 3300049571 | Bacteria | 2285 |
| 945 | Ga0501036_0002265 | 3300049572 | Bacteria | 15035 |
| 946 | Ga0501037_0108656 | 3300049573 | Bacteria | 1998 |
| 947 | Ga0501038_0029035 | 3300049574 | Bacteria | 4906 |
| 948 | Ga0501043_0019215 | 3300049579 | Bacteria | 5364 |
| 949 | Ga0501043_0224894 | 3300049579 | Bacteria | 1451 |
| 950 | Ga0501046_0014249 | 3300049580 | Bacteria | 6715 |
| 951 | Ga0501047_0049725 | 3300049581 | Bacteria | 4047 |
| 952 | Ga0501047_0364165 | 3300049581 | Bacteria | 1281 |
| 953 | Ga0501048_0005214 | 3300049582 | Bacteria | 9901 |
| 954 | Ga0501048_0521956 | 3300049582 | Bacteria | 852 |
| 955 | Ga0501067_0101704 | 3300049583 | Unclassified | 1597 |
| 956 | Ga0501070_0004566 | 3300049586 | Bacteria | 11872 |
| 957 | Ga0501070_0142025 | 3300049586 | Bacteria | 1982 |
| 958 | Ga0501070_0845273 | 3300049586 | Bacteria | 716 |
| 959 | Ga0501072_0042730 | 3300049588 | Bacteria | 3561 |
| 960 | Ga0501073_0021169 | 3300049589 | Bacteria | 4689 |
| 961 | Ga0501074_0008635 | 3300049590 | Bacteria | 7379 |
| 962 | Ga0501074_0032245 | 3300049590 | Bacteria | 3796 |
| 963 | Ga0501198_014611 | 3300049649 | Bacteria | 1198 |
| 964 | Ga0501202_000088 | 3300049652 | Bacteria | 10001 |
| 965 | Ga0501217_000307 | 3300049661 | Bacteria | 7778 |
| 966 | Ga0501222_004413 | 3300049662 | Bacteria | 1910 |
| 967 | Ga0501223_004563 | 3300049663 | Bacteria | 2951 |
| 968 | Ga0501233_016917 | 3300049668 | Bacteria | 1517 |
| 969 | Ga0501242_000045 | 3300049674 | Bacteria | 7825 |
| 970 | Ga0501250_002675 | 3300049680 | Bacteria | 1636 |
| 971 | Ga0501252_001448 | 3300049682 | Bacteria | 2190 |
| 972 | Ga0501257_016256 | 3300049686 | Bacteria | 1725 |
| 973 | Ga0501257_019994 | 3300049686 | Bacteria | 1569 |
| 974 | Ga0501257_028791 | 3300049686 | Bacteria | 1333 |
| 975 | Ga0501261_000243 | 3300049690 | Bacteria | 7492 |
| 976 | Ga0501221_000246 | 3300049704 | Bacteria | 7890 |
| 977 | Ga0501225_0045695 | 3300049705 | Bacteria | 1213 |
| 978 | Ga0501234_001444 | 3300049707 | Bacteria | 3733 |
| 979 | Ga0501079_0122554 | 3300049741 | Bacteria | 2022 |
| 980 | Ga0501079_0178029 | 3300049741 | Bacteria | 1659 |
| 981 | Ga0501080_0034986 | 3300049742 | Bacteria | 4689 |
| 982 | Ga0501083_0028952 | 3300049744 | Bacteria | 3814 |
| 983 | Ga0501083_0035414 | 3300049744 | Bacteria | 3410 |
| 984 | Ga0501266_004571 | 3300049763 | Bacteria | 1717 |
| 985 | Ga0501268_032506 | 3300049765 | Bacteria | 951 |
| 986 | Ga0501279_009074 | 3300049775 | Bacteria | 1331 |
| 987 | Ga0501035_0037902 | 3300049822 | Bacteria | 4364 |
| 988 | Ga0501044_0012075 | 3300049823 | Bacteria | 9356 |
| 989 | Ga0501044_0039771 | 3300049823 | Unclassified | 4904 |
| 990 | Ga0501044_0094530 | 3300049823 | Unclassified | 3014 |
| 991 | Ga0501044_0182740 | 3300049823 | Bacteria | 2063 |
| 992 | Ga0501044_0266994 | 3300049823 | Bacteria | 1648 |
| 993 | Ga0501044_0324204 | 3300049823 | Bacteria | 1464 |
| 994 | Ga0501044_0355076 | 3300049823 | Bacteria | 1385 |
| 995 | Ga0501044_0533723 | 3300049823 | Bacteria | 1072 |
| 996 | Ga0501045_0085055 | 3300049824 | Bacteria | 2334 |
| 997 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 998 | nmdc:mga0k408_110246_c1 | 3300050493 | Bacteria | 1627 |
| 999 | nmdc:mga0k408_337123_c1 | 3300050493 | Bacteria | 899 |
| 1000 | nmdc:mga0k408_384732_c1 | 3300050493 | Unclassified | 836 |
| 1001 | nmdc:mga05p37_299061_c1 | 3300050507 | Bacteria | 1913 |
| 1002 | nmdc:mga05p37_3833_c1 | 3300050507 | Bacteria | 17590 |
| 1003 | nmdc:mga05p37_89890_c1 | 3300050507 | Bacteria | 3784 |
| 1004 | nmdc:mga09592_118468_c1 | 3300050508 | Bacteria | 2273 |
| 1005 | nmdc:mga0qj67_35464_c1 | 3300050509 | Bacteria | 3900 |
| 1006 | nmdc:mga0qj67_385449_c1 | 3300050509 | Bacteria | 1132 |
| 1007 | nmdc:mga06r32_69155_c1 | 3300050510 | Bacteria | 3412 |
| 1008 | nmdc:mga08y16_40834_c1 | 3300050511 | Unclassified | 4861 |
| 1009 | nmdc:mga08y16_759985_c1 | 3300050511 | Bacteria | 965 |
| 1010 | nmdc:mga0n895_148980_c1 | 3300050512 | Bacteria | 2369 |
| 1011 | Ga0495619_0016556 | 3300053085 | Bacteria | 4668 |
| 1012 | Ga0500578_0000694 | 3300053086 | Bacteria | 40191 |
| 1013 | Ga0500578_0097000 | 3300053086 | Bacteria | 1868 |
| 1014 | Ga0500644_0141293 | 3300053088 | Bacteria | 957 |
| 1015 | Ga0500646_0057636 | 3300053090 | Bacteria | 1135 |
| 1016 | Ga0500583_0000059 | 3300053092 | Bacteria | 68222 |
| 1017 | Ga0500583_0000379 | 3300053092 | Bacteria | 14546 |
| 1018 | Ga0500583_0012380 | 3300053092 | Bacteria | 3253 |
| 1019 | Ga0500651_0191202 | 3300053093 | Bacteria | 1212 |
| 1020 | Ga0500650_0191595 | 3300053098 | Bacteria | 934 |
| 1021 | Ga0500555_000038 | 3300053103 | Bacteria | 70808 |
| 1022 | Ga0500555_033505 | 3300053103 | Bacteria | 1448 |
| 1023 | Ga0500556_0036860 | 3300053104 | Bacteria | 1699 |
| 1024 | Ga0500642_0004765 | 3300053130 | Bacteria | 4292 |
| 1025 | Ga0500652_024201 | 3300053131 | Bacteria | 2316 |
| 1026 | Ga0500568_0000236 | 3300053139 | Bacteria | 47278 |
| 1027 | Ga0500573_0172627 | 3300053140 | Bacteria | 1168 |
| 1028 | Ga0500588_0133963 | 3300053146 | Unclassified | 885 |
| 1029 | Ga0500589_030930 | 3300053147 | Bacteria | 2494 |
| 1030 | Ga0500616_0000248 | 3300053153 | Bacteria | 84268 |
| 1031 | Ga0500616_0012902 | 3300053153 | Bacteria | 4870 |
| 1032 | Ga0500616_0065196 | 3300053153 | Bacteria | 1874 |
| 1033 | Ga0500622_0020646 | 3300053156 | Bacteria | 3498 |
| 1034 | Ga0500622_0057217 | 3300053156 | Bacteria | 1995 |
| 1035 | Ga0500636_0051649 | 3300053177 | Bacteria | 2417 |
| 1036 | Ga0500636_0267366 | 3300053177 | Bacteria | 862 |
| 1037 | Ga0500637_0120693 | 3300053178 | Bacteria | 1521 |
| 1038 | Ga0500637_0377896 | 3300053178 | Bacteria | 744 |
| 1039 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 1040 | Ga0500645_000416 | 3300053730 | Bacteria | 29452 |
| 1041 | Ga0500599_003380 | 3300053736 | Bacteria | 1943 |
| 1042 | Ga0501084_0236063 | 3300054114 | Bacteria | 1543 |
| 1043 | Ga0501084_0499043 | 3300054114 | Bacteria | 1028 |
| 1044 | Ga0501082_0862376 | 3300060353 | Bacteria | 792 |
| 1045 | Ga0466962_0068404 | 3300061719 | Bacteria | 1696 |
| 1046 | 2819678960 | 2818991460 | Bacteria | 7595395 |
| 1047 | 2884792064 | 2884791551 | Bacteria | 8511252 |
| 1048 | 2896088559 | 2896085136 | Bacteria | 6129793 |
| 1049 | Ga0163161_10116007 | |||
| 1050 | ARCol0yngRDRAFT_1002900 | |||
| 1051 | JGI24736J21556_1008050 | |||
| 1052 | JGI24739J22299_10000682 | |||
| 1053 | JGI24751J29686_10001386 | |||
| 1054 | JGI25153J46596_10009265 | |||
| 1055 | JGI25153J46596_10052922 | |||
| 1056 | rootH1_10086091 | |||
| 1057 | rootH2_10014568 | |||
| 1058 | rootH2_10042606 | |||
| 1059 | rootH2_10077502 | |||
| 1060 | rootH2_10084580 | |||
| 1061 | rootL2_10007556 | |||
| 1062 | rootL2_10245585 | |||
| 1063 | rootH1_10038857 | |||
| 1064 | rootH1_10072926 | |||
| 1065 | rootH1_10073999 | |||
| 1066 | JGI25160J50197_1000883 | |||
| 1067 | JGI25160J50197_1016652 | |||
| 1068 | Ga0055526_1016976 | |||
| 1069 | Ga0055528_1000481 | |||
| 1070 | Ga0055530_10067843 | |||
| 1071 | Ga0055543_1016228 | |||
| 1072 | Ga0065165_1000228 | |||
| 1073 | Ga0065714_10124544 | |||
| 1074 | Ga0065704_10227980 | |||
| 1075 | Ga0065712_10014868 | |||
| 1076 | Ga0065712_10087928 | |||
| 1077 | Ga0065712_10137176 | |||
| 1078 | Ga0065712_10203207 | |||
| 1079 | Ga0065707_10016744 | |||
| 1080 | Ga0070658_10099229 | |||
| 1081 | Ga0070658_10117693 | |||
| 1082 | Ga0070658_10305196 | |||
| 1083 | Ga0070658_10545980 | |||
| 1084 | Ga0070658_10922590 | |||
| 1085 | Ga0070676_10044940 | |||
| 1086 | Ga0070676_10124222 | |||
| 1087 | Ga0070676_10144146 | |||
| 1088 | Ga0070676_10224076 | |||
| 1089 | Ga0070683_100008791 | |||
| 1090 | Ga0070683_100039507 | |||
| 1091 | Ga0070683_100555264 | |||
| 1092 | Ga0070690_100016704 | |||
| 1093 | Ga0070670_100016861 | |||
| 1094 | Ga0070670_100055775 | |||
| 1095 | Ga0070670_100152746 | |||
| 1096 | Ga0070670_100164272 | |||
| 1097 | Ga0070670_100336416 | |||
| 1098 | Ga0070670_100558697 | |||
| 1099 | Ga0068869_100062872 | |||
| 1100 | Ga0068869_100165888 | |||
| 1101 | Ga0068869_100170468 | |||
| 1102 | Ga0068869_100319674 | |||
| 1103 | Ga0068869_100363721 | |||
| 1104 | Ga0070666_10001517 | |||
| 1105 | Ga0070666_10016406 | |||
| 1106 | Ga0070666_10019018 | |||
| 1107 | Ga0070666_10103090 | |||
| 1108 | Ga0070666_10494461 | |||
| 1109 | Ga0070680_100223008 | |||
| 1110 | Ga0070680_100325911 | |||
| 1111 | Ga0070682_100000525 | |||
| 1112 | Ga0070682_100000549 | |||
| 1113 | Ga0070682_100066184 | |||
| 1114 | Ga0070682_100320427 | |||
| 1115 | Ga0068868_100016594 | |||
| 1116 | Ga0068868_100037301 | |||
| 1117 | Ga0068868_100146050 | |||
| 1118 | Ga0068868_100195259 | |||
| 1119 | Ga0068868_100284043 | |||
| 1120 | Ga0068868_100360829 | |||
| 1121 | Ga0070660_100015710 | |||
| 1122 | Ga0070660_100108535 | |||
| 1123 | Ga0070660_100290700 | |||
| 1124 | Ga0070660_100603244 | |||
| 1125 | Ga0070689_100015893 | |||
| 1126 | Ga0070689_100036250 | |||
| 1127 | Ga0070689_100090910 | |||
| 1128 | Ga0070689_100152260 | |||
| 1129 | Ga0070691_10013755 | |||
| 1130 | Ga0070691_10192165 | |||
| 1131 | Ga0070687_100008860 | |||
| 1132 | Ga0070687_100113402 | |||
| 1133 | Ga0070661_100023553 | |||
| 1134 | Ga0070661_100058810 | |||
| 1135 | Ga0070668_100006539 | |||
| 1136 | Ga0070668_100032657 | |||
| 1137 | Ga0070668_100049425 | |||
| 1138 | Ga0070668_100066202 | |||
| 1139 | Ga0070668_100233594 | |||
| 1140 | Ga0070668_100374000 | |||
| 1141 | Ga0070668_100450350 | |||
| 1142 | Ga0070668_100544919 | |||
| 1143 | Ga0070669_100020363 | |||
| 1144 | Ga0070669_100172850 | |||
| 1145 | Ga0070669_100525274 | |||
| 1146 | Ga0070675_100040664 | |||
| 1147 | Ga0070675_100162645 | |||
| 1148 | Ga0070675_100177324 | |||
| 1149 | Ga0070671_100058796 | |||
| 1150 | Ga0070671_100069049 | |||
| 1151 | Ga0070674_100005888 | |||
| 1152 | Ga0070674_100078074 | |||
| 1153 | Ga0070674_100124296 | |||
| 1154 | Ga0070674_100157342 | |||
| 1155 | Ga0070674_100188537 | |||
| 1156 | Ga0070674_100359509 | |||
| 1157 | Ga0070673_100012518 | |||
| 1158 | Ga0070673_100060556 | |||
| 1159 | Ga0070673_100151338 | |||
| 1160 | Ga0070673_100172631 | |||
| 1161 | Ga0070673_100239328 | |||
| 1162 | Ga0070673_100316430 | |||
| 1163 | Ga0070688_100016934 | |||
| 1164 | Ga0070688_100081906 | |||
| 1165 | Ga0070659_100011635 | |||
| 1166 | Ga0070659_100024976 | |||
| 1167 | Ga0070659_100084683 | |||
| 1168 | Ga0070667_100025205 | |||
| 1169 | Ga0070667_100277325 | |||
| 1170 | Ga0070667_100306751 | |||
| 1171 | Ga0070667_100337049 | |||
| 1172 | Ga0070713_100360684 | |||
| 1173 | Ga0070701_10320473 | |||
| 1174 | Ga0070705_100203581 | |||
| 1175 | Ga0070700_100104436 | |||
| 1176 | Ga0070700_100286381 | |||
| 1177 | Ga0070663_100092978 | |||
| 1178 | Ga0070663_100348021 | |||
| 1179 | Ga0070663_100358522 | |||
| 1180 | Ga0070678_100042123 | |||
| 1181 | Ga0070678_100110704 | |||
| 1182 | Ga0070678_100217699 | |||
| 1183 | Ga0070678_100407376 | |||
| 1184 | Ga0070662_100017167 | |||
| 1185 | Ga0070662_100270784 | |||
| 1186 | Ga0070662_100661235 | |||
| 1187 | Ga0070662_101067575 | |||
| 1188 | Ga0070681_10029846 | |||
| 1189 | Ga0070681_10285741 | |||
| 1190 | Ga0070681_10483815 | |||
| 1191 | Ga0068867_100023813 | |||
| 1192 | Ga0068867_100024822 | |||
| 1193 | Ga0068867_100066329 | |||
| 1194 | Ga0068867_100078570 | |||
| 1195 | Ga0068867_100171923 | |||
| 1196 | Ga0068867_100226514 | |||
| 1197 | Ga0068867_100463992 | |||
| 1198 | Ga0068867_100622036 | |||
| 1199 | Ga0070685_10005545 | |||
| 1200 | Ga0070685_10024336 | |||
| 1201 | Ga0070685_10131001 | |||
| 1202 | Ga0070698_100016231 | |||
| 1203 | Ga0070698_100017582 | |||
| 1204 | Ga0070698_100018248 | |||
| 1205 | Ga0070699_100256212 | |||
| 1206 | Ga0070679_100000367 | |||
| 1207 | Ga0070679_100003068 | |||
| 1208 | Ga0070679_100038459 | |||
| 1209 | Ga0070679_100647243 | |||
| 1210 | Ga0070684_100007425 | |||
| 1211 | Ga0070684_100029638 | |||
| 1212 | Ga0070684_100601592 | |||
| 1213 | Ga0070684_100752307 | |||
| 1214 | Ga0068853_100000221 | |||
| 1215 | Ga0068853_100002087 | |||
| 1216 | Ga0068853_100019176 | |||
| 1217 | Ga0068853_100061272 | |||
| 1218 | Ga0068853_100073002 | |||
| 1219 | Ga0068853_100183339 | |||
| 1220 | Ga0068853_100199808 | |||
| 1221 | Ga0068853_100217559 | |||
| 1222 | Ga0068853_100393664 | |||
| 1223 | Ga0068853_100441005 | |||
| 1224 | Ga0068853_100872992 | |||
| 1225 | Ga0070672_100001464 | |||
| 1226 | Ga0070672_100069744 | |||
| 1227 | Ga0070672_100093336 | |||
| 1228 | Ga0070672_100116709 | |||
| 1229 | Ga0070672_100134167 | |||
| 1230 | Ga0070672_100201353 | |||
| 1231 | Ga0070672_100293358 | |||
| 1232 | Ga0070672_100953589 | |||
| 1233 | Ga0070686_100004288 | |||
| 1234 | Ga0070686_100065269 | |||
| 1235 | Ga0070686_100114670 | |||
| 1236 | Ga0070686_100369592 | |||
| 1237 | Ga0070686_100477613 | |||
| 1238 | Ga0070686_100485530 | |||
| 1239 | Ga0070686_100796273 | |||
| 1240 | Ga0070696_100312735 | |||
| 1241 | Ga0070693_100003508 | |||
| 1242 | Ga0070665_100000001 | |||
| 1243 | Ga0070665_100026357 | |||
| 1244 | Ga0068855_100004630 | |||
| 1245 | Ga0068855_100027234 | |||
| 1246 | Ga0068855_100035742 | |||
| 1247 | Ga0068855_100042983 | |||
| 1248 | Ga0068855_100108675 | |||
| 1249 | Ga0068855_100157104 | |||
| 1250 | Ga0068855_100468964 | |||
| 1251 | Ga0068855_100543839 | |||
| 1252 | Ga0070664_100008111 | |||
| 1253 | Ga0070664_100031077 | |||
| 1254 | Ga0070664_100208558 | |||
| 1255 | Ga0070664_100239557 | |||
| 1256 | Ga0070664_100295104 | |||
| 1257 | Ga0070664_100398592 | |||
| 1258 | Ga0070664_100467246 | |||
| 1259 | Ga0070664_100492630 | |||
| 1260 | Ga0068857_100001119 | |||
| 1261 | Ga0068857_100025593 | |||
| 1262 | Ga0068857_100046345 | |||
| 1263 | Ga0068857_100052392 | |||
| 1264 | Ga0068857_100114779 | |||
| 1265 | Ga0068857_100262825 | |||
| 1266 | Ga0068857_100503385 | |||
| 1267 | Ga0068854_100054032 | |||
| 1268 | Ga0068854_100065233 | |||
| 1269 | Ga0068854_100136104 | |||
| 1270 | Ga0068854_100337340 | |||
| 1271 | Ga0068856_100118539 | |||
| 1272 | Ga0068856_100152151 | |||
| 1273 | Ga0068856_100173437 | |||
| 1274 | Ga0070702_100658983 | |||
| 1275 | Ga0068852_100000926 | |||
| 1276 | Ga0068852_100003421 | |||
| 1277 | Ga0068852_100054329 | |||
| 1278 | Ga0068852_100057379 | |||
| 1279 | Ga0068852_100079852 | |||
| 1280 | Ga0068852_100111034 | |||
| 1281 | Ga0068852_100193789 | |||
| 1282 | Ga0068852_100223230 | |||
| 1283 | Ga0068852_100272534 | |||
| 1284 | Ga0068852_100431225 | |||
| 1285 | Ga0068852_100519996 | |||
| 1286 | Ga0068852_100647203 | |||
| 1287 | Ga0068852_100876143 | |||
| 1288 | Ga0068859_100000064 | |||
| 1289 | Ga0068859_100003888 | |||
| 1290 | Ga0068859_100143359 | |||
| 1291 | Ga0068859_100152314 | |||
| 1292 | Ga0068859_100157751 | |||
| 1293 | Ga0068859_100203886 | |||
| 1294 | Ga0068859_100270064 | |||
| 1295 | Ga0068859_100548803 | |||
| 1296 | Ga0068859_100551478 | |||
| 1297 | Ga0068859_100560121 | |||
| 1298 | Ga0068859_100749494 | |||
| 1299 | Ga0068859_100752512 | |||
| 1300 | Ga0068864_100014171 | |||
| 1301 | Ga0068864_100119793 | |||
| 1302 | Ga0068864_100154832 | |||
| 1303 | Ga0068864_100219107 | |||
| 1304 | Ga0068864_100223912 | |||
| 1305 | Ga0068864_100233513 | |||
| 1306 | Ga0068866_10051778 | |||
| 1307 | Ga0068866_10427075 | |||
| 1308 | Ga0068866_10598124 | |||
| 1309 | Ga0068861_100013578 | |||
| 1310 | Ga0068861_100014654 | |||
| 1311 | Ga0068861_100096436 | |||
| 1312 | Ga0068861_100098648 | |||
| 1313 | Ga0068861_100262160 | |||
| 1314 | Ga0068861_100303993 | |||
| 1315 | Ga0068861_100459601 | |||
| 1316 | Ga0068851_10014911 | |||
| 1317 | Ga0068851_10102731 | |||
| 1318 | Ga0068851_10168778 | |||
| 1319 | Ga0068851_10182705 | |||
| 1320 | Ga0068870_10013252 | |||
| 1321 | Ga0068870_10389570 | |||
| 1322 | Ga0068863_100011703 | |||
| 1323 | Ga0068863_100020291 | |||
| 1324 | Ga0068863_100023194 | |||
| 1325 | Ga0068863_100045799 | |||
| 1326 | Ga0068863_100121175 | |||
| 1327 | Ga0068863_100163098 | |||
| 1328 | Ga0068863_100347479 | |||
| 1329 | Ga0068858_100148339 | |||
| 1330 | Ga0068858_100254842 | |||
| 1331 | Ga0068858_100553017 | |||
| 1332 | Ga0068858_101185375 | |||
| 1333 | Ga0068860_100000046 | |||
| 1334 | Ga0068860_100003652 | |||
| 1335 | Ga0068860_100004779 | |||
| 1336 | Ga0068860_100008360 | |||
| 1337 | Ga0068860_100009074 | |||
| 1338 | Ga0068860_100021218 | |||
| 1339 | Ga0068860_100042273 | |||
| 1340 | Ga0068860_100054406 | |||
| 1341 | Ga0068860_100157678 | |||
| 1342 | Ga0068860_100235472 | |||
| 1343 | Ga0068862_100001846 | |||
| 1344 | Ga0068862_100025134 | |||
| 1345 | Ga0068862_100135139 | |||
| 1346 | Ga0068862_100305329 | |||
| 1347 | Ga0068862_100626314 | |||
| 1348 | Ga0068862_100724042 | |||
| 1349 | Ga0081540_1007674 | |||
| 1350 | Ga0081539_10001598 | |||
| 1351 | Ga0081539_10068454 | |||
| 1352 | Ga0097621_100000974 | |||
| 1353 | Ga0097621_100010940 | |||
| 1354 | Ga0097621_100011820 | |||
| 1355 | Ga0097621_100151586 | |||
| 1356 | Ga0097621_100363159 | |||
| 1357 | Ga0075370_10248827 | |||
| 1358 | Ga0068871_100000750 | |||
| 1359 | Ga0068871_100664700 | |||
| 1360 | Ga0068871_100740487 | |||
| 1361 | Ga0075428_100020790 | |||
| 1362 | Ga0075428_100036510 | |||
| 1363 | Ga0075428_100047292 | |||
| 1364 | Ga0075428_100101750 | |||
| 1365 | Ga0075430_100026803 | |||
| 1366 | Ga0075431_100045756 | |||
| 1367 | Ga0075434_100094466 | |||
| 1368 | Ga0075429_100267396 | |||
| 1369 | Ga0068865_100010351 | |||
| 1370 | Ga0068865_100113476 | |||
| 1371 | Ga0068865_100433675 | |||
| 1372 | Ga0068865_100446834 | |||
| 1373 | Ga0097620_100000064 | |||
| 1374 | Ga0097620_100003888 | |||
| 1375 | Ga0097620_100143359 | |||
| 1376 | Ga0097620_100152316 | |||
| 1377 | Ga0097620_100157752 | |||
| 1378 | Ga0097620_100203891 | |||
| 1379 | Ga0097620_100270064 | |||
| 1380 | Ga0097620_100548740 | |||
| 1381 | Ga0097620_100551401 | |||
| 1382 | Ga0097620_100560178 | |||
| 1383 | Ga0097620_100749484 | |||
| 1384 | Ga0097620_100752417 | |||
| 1385 | Ga0097620_101538898 | |||
| 1386 | Ga0105240_10000074 | |||
| 1387 | Ga0105240_10000598 | |||
| 1388 | Ga0105240_10000626 | |||
| 1389 | Ga0105240_10002254 | |||
| 1390 | Ga0105240_10004476 | |||
| 1391 | Ga0105240_10007364 | |||
| 1392 | Ga0105240_10045005 | |||
| 1393 | Ga0105240_10065482 | |||
| 1394 | Ga0105240_10087664 | |||
| 1395 | Ga0105240_10122025 | |||
| 1396 | Ga0105240_10136812 | |||
| 1397 | Ga0111539_10016692 | |||
| 1398 | Ga0111539_10425294 | |||
| 1399 | Ga0111539_10615859 | |||
| 1400 | Ga0105245_10280169 | |||
| 1401 | Ga0105245_10314070 | |||
| 1402 | Ga0105245_11307523 | |||
| 1403 | Ga0105247_10004356 | |||
| 1404 | Ga0105247_10005280 | |||
| 1405 | Ga0114129_10017850 | |||
| 1406 | Ga0114129_10053478 | |||
| 1407 | Ga0114129_10107363 | |||
| 1408 | Ga0105243_10089369 | |||
| 1409 | Ga0105241_10000659 | |||
| 1410 | Ga0105241_10002102 | |||
| 1411 | Ga0105241_10030423 | |||
| 1412 | Ga0105241_10058744 | |||
| 1413 | Ga0105241_10075050 | |||
| 1414 | Ga0105241_10136956 | |||
| 1415 | Ga0105241_10304898 | |||
| 1416 | Ga0105241_10377754 | |||
| 1417 | Ga0105241_10799234 | |||
| 1418 | Ga0105242_10029709 | |||
| 1419 | Ga0105242_10090175 | |||
| 1420 | Ga0105242_10095223 | |||
| 1421 | Ga0105242_10158722 | |||
| 1422 | Ga0105242_10193030 | |||
| 1423 | Ga0105242_10262121 | |||
| 1424 | Ga0105242_10281903 | |||
| 1425 | Ga0105242_10668262 | |||
| 1426 | Ga0105242_10913286 | |||
| 1427 | Ga0105248_10110498 | |||
| 1428 | Ga0105237_10000755 | |||
| 1429 | Ga0105237_10003416 | |||
| 1430 | Ga0105237_10003671 | |||
| 1431 | Ga0105237_10011051 | |||
| 1432 | Ga0105237_10015329 | |||
| 1433 | Ga0105237_10071377 | |||
| 1434 | Ga0105237_10102485 | |||
| 1435 | Ga0105237_10107568 | |||
| 1436 | Ga0105237_10115778 | |||
| 1437 | Ga0105237_10490826 | |||
| 1438 | Ga0105237_10769510 | |||
| 1439 | Ga0105238_10001132 | |||
| 1440 | Ga0105238_10084549 | |||
| 1441 | Ga0105249_10001648 | |||
| 1442 | Ga0105249_10009236 | |||
| 1443 | Ga0105249_10019347 | |||
| 1444 | Ga0105249_10278051 | |||
| 1445 | Ga0105249_10394234 | |||
| 1446 | Ga0105249_10447783 | |||
| 1447 | Ga0105239_10000048 | |||
| 1448 | Ga0105239_10001136 | |||
| 1449 | Ga0105239_10002613 | |||
| 1450 | Ga0105239_10017403 | |||
| 1451 | Ga0105239_10027980 | |||
| 1452 | Ga0105239_10032560 | |||
| 1453 | Ga0105239_10497734 | |||
| 1454 | Ga0105239_10731675 | |||
| 1455 | Ga0105246_10099156 | |||
| 1456 | Ga0105246_10196436 | |||
| 1457 | Ga0105246_10237380 | |||
| 1458 | Ga0157373_10012918 | |||
| 1459 | Ga0157373_10018988 | |||
| 1460 | Ga0157373_10033618 | |||
| 1461 | Ga0157373_10172620 | |||
| 1462 | Ga0157371_10000830 | |||
| 1463 | Ga0157371_10004289 | |||
| 1464 | Ga0157371_10010326 | |||
| 1465 | Ga0157371_10191690 | |||
| 1466 | Ga0157371_10200867 | |||
| 1467 | Ga0157371_10240055 | |||
| 1468 | Ga0157371_10372543 | |||
| 1469 | Ga0157371_10497455 | |||
| 1470 | Ga0157370_10000878 | |||
| 1471 | Ga0157370_10002365 | |||
| 1472 | Ga0157370_10007920 | |||
| 1473 | Ga0157370_10009537 | |||
| 1474 | Ga0157370_10041110 | |||
| 1475 | Ga0157370_10113719 | |||
| 1476 | Ga0157370_10152193 | |||
| 1477 | Ga0157369_10019583 | |||
| 1478 | Ga0157369_10049397 | |||
| 1479 | Ga0157369_10057809 | |||
| 1480 | Ga0157369_10424096 | |||
| 1481 | Ga0157374_10021570 | |||
| 1482 | Ga0157374_10047005 | |||
| 1483 | Ga0157374_10083014 | |||
| 1484 | Ga0157374_10089350 | |||
| 1485 | Ga0157374_10109364 | |||
| 1486 | Ga0157374_10129662 | |||
| 1487 | Ga0157374_10177420 | |||
| 1488 | Ga0157374_10261128 | |||
| 1489 | Ga0157374_10411681 | |||
| 1490 | Ga0157374_10574263 | |||
| 1491 | Ga0157378_10003501 | |||
| 1492 | Ga0157378_10017913 | |||
| 1493 | Ga0157378_10033917 | |||
| 1494 | Ga0157378_10044635 | |||
| 1495 | Ga0157378_10045171 | |||
| 1496 | Ga0157378_10063555 | |||
| 1497 | Ga0157378_10065579 | |||
| 1498 | Ga0157378_10239198 | |||
| 1499 | Ga0163162_10000331 | |||
| 1500 | Ga0163162_10000862 | |||
| 1501 | Ga0163162_10001657 | |||
| 1502 | Ga0163162_10003049 | |||
| 1503 | Ga0163162_10010782 | |||
| 1504 | Ga0163162_10021755 | |||
| 1505 | Ga0163162_10027024 | |||
| 1506 | Ga0163162_10079222 | |||
| 1507 | Ga0163162_10094439 | |||
| 1508 | Ga0163162_10138809 | |||
| 1509 | Ga0163162_10169930 | |||
| 1510 | Ga0163162_10174849 | |||
| 1511 | Ga0163162_10186483 | |||
| 1512 | Ga0163162_10188033 | |||
| 1513 | Ga0163162_10288614 | |||
| 1514 | Ga0163162_10296359 | |||
| 1515 | Ga0163162_10517025 | |||
| 1516 | Ga0163162_10519077 | |||
| 1517 | Ga0163162_10688415 | |||
| 1518 | Ga0163162_10730371 | |||
| 1519 | Ga0163162_11291938 | |||
| 1520 | Ga0157372_10002207 | |||
| 1521 | Ga0157372_10003015 | |||
| 1522 | Ga0157372_10008452 | |||
| 1523 | Ga0157372_10016387 | |||
| 1524 | Ga0157372_10023020 | |||
| 1525 | Ga0157372_10063516 | |||
| 1526 | Ga0157372_10090954 | |||
| 1527 | Ga0157372_10155061 | |||
| 1528 | Ga0157372_10200417 | |||
| 1529 | Ga0157372_10214241 | |||
| 1530 | Ga0157372_10217126 | |||
| 1531 | Ga0157372_10226602 | |||
| 1532 | Ga0157372_10226782 | |||
| 1533 | Ga0157372_10250305 | |||
| 1534 | Ga0157372_10250805 | |||
| 1535 | Ga0157372_10267796 | |||
| 1536 | Ga0157372_10327005 | |||
| 1537 | Ga0157372_10472836 | |||
| 1538 | Ga0157372_10662367 | |||
| 1539 | Ga0157372_10993600 | |||
| 1540 | Ga0157375_10000403 | |||
| 1541 | Ga0157375_10005688 | |||
| 1542 | Ga0157375_10053259 | |||
| 1543 | Ga0157375_10118034 | |||
| 1544 | Ga0157375_10139637 | |||
| 1545 | Ga0157375_10152036 | |||
| 1546 | Ga0157375_10184290 | |||
| 1547 | Ga0157375_10255619 | |||
| 1548 | Ga0157375_10272991 | |||
| 1549 | Ga0157375_10370360 | |||
| 1550 | Ga0157375_11194148 | |||
| 1551 | Ga0163163_10000399 | |||
| 1552 | Ga0163163_10000653 | |||
| 1553 | Ga0163163_10050638 | |||
| 1554 | Ga0163163_10122936 | |||
| 1555 | Ga0163163_10548107 | |||
| 1556 | Ga0163163_10725400 | |||
| 1557 | Ga0157380_10005370 | |||
| 1558 | Ga0157380_10006261 | |||
| 1559 | Ga0157380_10067509 | |||
| 1560 | Ga0157380_10537331 | |||
| 1561 | Ga0157380_11187241 | |||
| 1562 | Ga0157377_10012052 | |||
| 1563 | Ga0157377_10020354 | |||
| 1564 | Ga0157377_10057005 | |||
| 1565 | Ga0157377_10103353 | |||
| 1566 | Ga0157377_10138434 | |||
| 1567 | Ga0157377_10151268 | |||
| 1568 | Ga0157377_10158057 | |||
| 1569 | Ga0157377_10285922 | |||
| 1570 | Ga0157379_10007752 | |||
| 1571 | Ga0157379_10020556 | |||
| 1572 | Ga0157379_10038671 | |||
| 1573 | Ga0157379_10093054 | |||
| 1574 | Ga0157379_10151722 | |||
| 1575 | Ga0157379_10261991 | |||
| 1576 | Ga0157379_10823817 | |||
| 1577 | Ga0157376_10014600 | |||
| 1578 | Ga0157376_10020948 | |||
| 1579 | Ga0157376_10050787 | |||
| 1580 | Ga0157376_10059697 | |||
| 1581 | Ga0157376_10071222 | |||
| 1582 | Ga0157376_10075952 | |||
| 1583 | Ga0157376_10221522 | |||
| 1584 | Ga0157376_10351249 | |||
| 1585 | Ga0157376_10356890 | |||
| 1586 | Ga0157376_10387147 | |||
| 1587 | Ga0157376_10444559 | |||
| 1588 | Ga0157376_10461803 | |||
| 1589 | Ga0157376_10535006 | |||
| 1590 | Ga0163161_10003834 | |||
| 1591 | Ga0163161_10031281 | |||
| 1592 | Ga0163161_10065804 | |||
| 1593 | Ga0163161_10072654 | |||
| 1594 | Ga0163161_10086657 | |||
| 1595 | Ga0163161_10184256 | |||
| 1596 | Ga0163161_10431853 | |||
| 1597 | Ga0163161_10500033 | |||
| 1598 | Ga0163161_10568157 | |||
| 1599 | Ga0213876_10005738 | |||
| 1600 | Ga0209436_102603 | |||
| 1601 | Ga0207666_1004620 | |||
| 1602 | Ga0209673_1000016 | |||
| 1603 | Ga0209130_1003624 | |||
| 1604 | Ga0209564_1006250 | |||
| 1605 | Ga0209564_1027158 | |||
| 1606 | Ga0209758_1005921 | |||
| 1607 | Ga0209758_1011914 | |||
| 1608 | Ga0209050_1000616 | |||
| 1609 | Ga0207426_1000139 | |||
| 1610 | Ga0207426_1031851 | |||
| 1611 | Ga0207426_1038833 | |||
| 1612 | Ga0209051_1014936 | |||
| 1613 | Ga0209257_1006990 | |||
| 1614 | Ga0207697_10000488 | |||
| 1615 | Ga0207697_10055345 | |||
| 1616 | Ga0207656_10003445 | |||
| 1617 | Ga0207656_10026721 | |||
| 1618 | Ga0207656_10198205 | |||
| 1619 | Ga0207682_10007523 | |||
| 1620 | Ga0207682_10016325 | |||
| 1621 | Ga0207682_10274833 | |||
| 1622 | Ga0207642_10397851 | |||
| 1623 | Ga0207710_10006861 | |||
| 1624 | Ga0207688_10287719 | |||
| 1625 | Ga0207680_10000877 | |||
| 1626 | Ga0207680_10023815 | |||
| 1627 | Ga0207680_10168230 | |||
| 1628 | Ga0207680_10186892 | |||
| 1629 | Ga0207680_10230038 | |||
| 1630 | Ga0207647_10000530 | |||
| 1631 | Ga0207647_10055791 | |||
| 1632 | Ga0207647_10194583 | |||
| 1633 | Ga0207645_10007828 | |||
| 1634 | Ga0207645_10010367 | |||
| 1635 | Ga0207645_10065949 | |||
| 1636 | Ga0207643_10005004 | |||
| 1637 | Ga0207643_10008998 | |||
| 1638 | Ga0207643_10103057 | |||
| 1639 | Ga0207705_10071276 | |||
| 1640 | Ga0207705_10103349 | |||
| 1641 | Ga0207705_10145746 | |||
| 1642 | Ga0207705_10198948 | |||
| 1643 | Ga0207705_10322142 | |||
| 1644 | Ga0207654_10000483 | |||
| 1645 | Ga0207654_10008469 | |||
| 1646 | Ga0207654_10036518 | |||
| 1647 | Ga0207654_10094548 | |||
| 1648 | Ga0207707_10000051 | |||
| 1649 | Ga0207707_10000490 | |||
| 1650 | Ga0207707_10149703 | |||
| 1651 | Ga0207695_10000071 | |||
| 1652 | Ga0207695_10000084 | |||
| 1653 | Ga0207695_10000323 | |||
| 1654 | Ga0207695_10004025 | |||
| 1655 | Ga0207695_10007684 | |||
| 1656 | Ga0207695_10009590 | |||
| 1657 | Ga0207695_10020243 | |||
| 1658 | Ga0207695_10029916 | |||
| 1659 | Ga0207695_10044514 | |||
| 1660 | Ga0207695_10051643 | |||
| 1661 | Ga0207695_10075438 | |||
| 1662 | Ga0207695_11042968 | |||
| 1663 | Ga0207671_10000036 | |||
| 1664 | Ga0207671_10001044 | |||
| 1665 | Ga0207671_10002316 | |||
| 1666 | Ga0207671_10004890 | |||
| 1667 | Ga0207671_10076294 | |||
| 1668 | Ga0207671_10095635 | |||
| 1669 | Ga0207671_10114913 | |||
| 1670 | Ga0207671_10416835 | |||
| 1671 | Ga0207660_10000371 | |||
| 1672 | Ga0207660_10386831 | |||
| 1673 | Ga0207662_10034747 | |||
| 1674 | Ga0207662_10047254 | |||
| 1675 | Ga0207657_10004060 | |||
| 1676 | Ga0207657_10013726 | |||
| 1677 | Ga0207649_10014996 | |||
| 1678 | Ga0207649_10165059 | |||
| 1679 | Ga0207652_10000045 | |||
| 1680 | Ga0207652_10001693 | |||
| 1681 | Ga0207652_10030239 | |||
| 1682 | Ga0207681_10063297 | |||
| 1683 | Ga0207681_10066545 | |||
| 1684 | Ga0207681_10206386 | |||
| 1685 | Ga0207681_10573228 | |||
| 1686 | Ga0207694_10030500 | |||
| 1687 | Ga0207694_10055666 | |||
| 1688 | Ga0207650_10018352 | |||
| 1689 | Ga0207650_10040160 | |||
| 1690 | Ga0207650_10041209 | |||
| 1691 | Ga0207650_10107927 | |||
| 1692 | Ga0207650_10134118 | |||
| 1693 | Ga0207650_10269341 | |||
| 1694 | Ga0207650_10317384 | |||
| 1695 | Ga0207650_10339615 | |||
| 1696 | Ga0207650_10393722 | |||
| 1697 | Ga0207650_10480527 | |||
| 1698 | Ga0207650_10494828 | |||
| 1699 | Ga0207659_10048360 | |||
| 1700 | Ga0207644_10081611 | |||
| 1701 | Ga0207644_10113203 | |||
| 1702 | Ga0207644_10218698 | |||
| 1703 | Ga0207644_10788384 | |||
| 1704 | Ga0207690_10103340 | |||
| 1705 | Ga0207690_10142865 | |||
| 1706 | Ga0207690_10145816 | |||
| 1707 | Ga0207690_10520402 | |||
| 1708 | Ga0207690_10576843 | |||
| 1709 | Ga0207706_10009485 | |||
| 1710 | Ga0207706_10023276 | |||
| 1711 | Ga0207706_10074803 | |||
| 1712 | Ga0207706_10109750 | |||
| 1713 | Ga0207706_10220171 | |||
| 1714 | Ga0207706_10318661 | |||
| 1715 | Ga0207706_10802784 | |||
| 1716 | Ga0207686_10059242 | |||
| 1717 | Ga0207686_10217673 | |||
| 1718 | Ga0207670_10069648 | |||
| 1719 | Ga0207670_10081645 | |||
| 1720 | Ga0207670_10094353 | |||
| 1721 | Ga0207670_10134098 | |||
| 1722 | Ga0207669_10002940 | |||
| 1723 | Ga0207669_10214850 | |||
| 1724 | Ga0207704_10057241 | |||
| 1725 | Ga0207704_10347434 | |||
| 1726 | Ga0207704_10510989 | |||
| 1727 | Ga0207691_10003785 | |||
| 1728 | Ga0207691_10006538 | |||
| 1729 | Ga0207691_10181605 | |||
| 1730 | Ga0207691_10185184 | |||
| 1731 | Ga0207691_10374224 | |||
| 1732 | Ga0207691_10470916 | |||
| 1733 | Ga0207691_10555539 | |||
| 1734 | Ga0207689_10007246 | |||
| 1735 | Ga0207689_10012105 | |||
| 1736 | Ga0207689_10015970 | |||
| 1737 | Ga0207689_10025044 | |||
| 1738 | Ga0207689_10033718 | |||
| 1739 | Ga0207689_10042397 | |||
| 1740 | Ga0207689_10045723 | |||
| 1741 | Ga0207689_10830830 | |||
| 1742 | Ga0207661_10017642 | |||
| 1743 | Ga0207661_10018282 | |||
| 1744 | Ga0207661_10046148 | |||
| 1745 | Ga0207661_10048995 | |||
| 1746 | Ga0207661_10279507 | |||
| 1747 | Ga0207679_10000660 | |||
| 1748 | Ga0207679_10031627 | |||
| 1749 | Ga0207679_10318293 | |||
| 1750 | Ga0207679_10533605 | |||
| 1751 | Ga0207679_10872712 | |||
| 1752 | Ga0207667_10001672 | |||
| 1753 | Ga0207667_10002100 | |||
| 1754 | Ga0207667_10018760 | |||
| 1755 | Ga0207667_10021218 | |||
| 1756 | Ga0207667_10083528 | |||
| 1757 | Ga0207667_10186397 | |||
| 1758 | Ga0207667_10188239 | |||
| 1759 | Ga0207667_10324348 | |||
| 1760 | Ga0207667_10902934 | |||
| 1761 | Ga0207651_10012113 | |||
| 1762 | Ga0207651_10024476 | |||
| 1763 | Ga0207651_10085369 | |||
| 1764 | Ga0207651_10197856 | |||
| 1765 | Ga0207651_10281110 | |||
| 1766 | Ga0207651_10421014 | |||
| 1767 | Ga0207712_10001659 | |||
| 1768 | Ga0207712_10013905 | |||
| 1769 | Ga0207712_10015160 | |||
| 1770 | Ga0207712_10020106 | |||
| 1771 | Ga0207712_10052105 | |||
| 1772 | Ga0207712_10052992 | |||
| 1773 | Ga0207712_10080594 | |||
| 1774 | Ga0207668_10000843 | |||
| 1775 | Ga0207668_10099307 | |||
| 1776 | Ga0207668_10106907 | |||
| 1777 | Ga0207668_10299748 | |||
| 1778 | Ga0207668_10748372 | |||
| 1779 | Ga0207640_10032898 | |||
| 1780 | Ga0207640_10040439 | |||
| 1781 | Ga0207640_10171534 | |||
| 1782 | Ga0207640_10376852 | |||
| 1783 | Ga0207640_10567559 | |||
| 1784 | Ga0207640_10902303 | |||
| 1785 | Ga0207658_10028138 | |||
| 1786 | Ga0207658_10039424 | |||
| 1787 | Ga0207658_10063161 | |||
| 1788 | Ga0207658_10303416 | |||
| 1789 | Ga0207658_10339937 | |||
| 1790 | Ga0207658_10443123 | |||
| 1791 | Ga0207658_10622051 | |||
| 1792 | Ga0207658_10743939 | |||
| 1793 | Ga0207658_11031683 | |||
| 1794 | Ga0207677_10010298 | |||
| 1795 | Ga0207677_10037285 | |||
| 1796 | Ga0207677_10049026 | |||
| 1797 | Ga0207677_10094706 | |||
| 1798 | Ga0207677_10118789 | |||
| 1799 | Ga0207677_10247587 | |||
| 1800 | Ga0207677_10321980 | |||
| 1801 | Ga0207677_10516772 | |||
| 1802 | Ga0207703_10034699 | |||
| 1803 | Ga0207703_10079799 | |||
| 1804 | Ga0207703_10126015 | |||
| 1805 | Ga0207703_10926991 | |||
| 1806 | Ga0207639_10002030 | |||
| 1807 | Ga0207639_10027999 | |||
| 1808 | Ga0207639_10057303 | |||
| 1809 | Ga0207639_10083325 | |||
| 1810 | Ga0207639_10338162 | |||
| 1811 | Ga0207639_10491026 | |||
| 1812 | Ga0207639_10551997 | |||
| 1813 | Ga0207639_10645764 | |||
| 1814 | Ga0207639_11065462 | |||
| 1815 | Ga0207678_10094288 | |||
| 1816 | Ga0207678_10214913 | |||
| 1817 | Ga0207678_10416713 | |||
| 1818 | Ga0207678_10513936 | |||
| 1819 | Ga0207708_10175955 | |||
| 1820 | Ga0207708_10312799 | |||
| 1821 | Ga0207702_10078821 | |||
| 1822 | Ga0207702_10313212 | |||
| 1823 | Ga0207641_10000212 | |||
| 1824 | Ga0207641_10001311 | |||
| 1825 | Ga0207641_10061188 | |||
| 1826 | Ga0207641_10182128 | |||
| 1827 | Ga0207641_10201275 | |||
| 1828 | Ga0207641_10279064 | |||
| 1829 | Ga0207641_10602960 | |||
| 1830 | Ga0207648_10075008 | |||
| 1831 | Ga0207648_10075058 | |||
| 1832 | Ga0207648_10112020 | |||
| 1833 | Ga0207648_10113991 | |||
| 1834 | Ga0207648_10114302 | |||
| 1835 | Ga0207648_10114994 | |||
| 1836 | Ga0207648_10146780 | |||
| 1837 | Ga0207648_10536631 | |||
| 1838 | Ga0207648_11176366 | |||
| 1839 | Ga0207676_10003111 | |||
| 1840 | Ga0207676_10003477 | |||
| 1841 | Ga0207676_10041742 | |||
| 1842 | Ga0207676_10060656 | |||
| 1843 | Ga0207676_10363014 | |||
| 1844 | Ga0207676_10471210 | |||
| 1845 | Ga0207674_10000672 | |||
| 1846 | Ga0207674_10002807 | |||
| 1847 | Ga0207674_10035026 | |||
| 1848 | Ga0207674_10042103 | |||
| 1849 | Ga0207674_10044802 | |||
| 1850 | Ga0207674_10054325 | |||
| 1851 | Ga0207674_10102557 | |||
| 1852 | Ga0207675_100000326 | |||
| 1853 | Ga0207675_100050510 | |||
| 1854 | Ga0207675_100060492 | |||
| 1855 | Ga0207675_100282870 | |||
| 1856 | Ga0207675_100914214 | |||
| 1857 | Ga0207683_10012945 | |||
| 1858 | Ga0207683_10043838 | |||
| 1859 | Ga0207683_10077012 | |||
| 1860 | Ga0207683_10123695 | |||
| 1861 | Ga0207683_10142757 | |||
| 1862 | Ga0207683_10241993 | |||
| 1863 | Ga0207698_10014057 | |||
| 1864 | Ga0207698_10015761 | |||
| 1865 | Ga0207698_10124852 | |||
| 1866 | Ga0207698_10130934 | |||
| 1867 | Ga0207698_10167819 | |||
| 1868 | Ga0207698_10178818 | |||
| 1869 | Ga0207698_10236868 | |||
| 1870 | Ga0207698_10260335 | |||
| 1871 | Ga0207698_10430363 | |||
| 1872 | Ga0207698_10645732 | |||
| 1873 | Ga0207698_10892692 | |||
| 1874 | Ga0207428_10037411 | |||
| 1875 | Ga0268266_10000049 | |||
| 1876 | Ga0268266_10548555 | |||
| 1877 | Ga0268265_10525583 | |||
| 1878 | Ga0268265_10632011 | |||
| 1879 | Ga0268265_10669463 | |||
| 1880 | Ga0268264_10000041 | |||
| 1881 | Ga0268264_10002479 | |||
| 1882 | Ga0268264_10003505 | |||
| 1883 | Ga0268264_10003739 | |||
| 1884 | Ga0268264_10007266 | |||
| 1885 | Ga0268264_10007386 | |||
| 1886 | Ga0268264_10067063 | |||
| 1887 | Ga0268264_10210408 | |||
| 1888 | Ga0268264_10303271 | |||
| 1889 | Ga0268264_10351024 | |||
| 1890 | Ga0268264_10636434 | |||
| 1891 | Ga0307517_10232046 | |||
| 1892 | Ga0307515_10000002 | |||
| 1893 | Ga0307511_10001228 | |||
| 1894 | Ga0307512_10116816 | |||
| 1895 | Ga0265327_10000316 | |||
| 1896 | Ga0307513_10077328 | |||
| 1897 | Ga0307513_10098306 | |||
| 1898 | Ga0307513_10517883 | |||
| 1899 | Ga0307509_10087285 | |||
| 1900 | Ga0307509_10097840 | |||
| 1901 | Ga0307509_10104731 | |||
| 1902 | Ga0265313_10036075 | |||
| 1903 | Ga0307516_10001558 | |||
| 1904 | Ga0307516_10077058 | |||
| 1905 | Ga0307406_10167633 | |||
| 1906 | Ga0307411_10476522 | |||
| 1907 | Ga0307411_10868994 | |||
| 1908 | Ga0307415_100021044 | |||
| 1909 | Ga0307510_10000217 | |||
| 1910 | Ga0373943_0061340 | |||
| 1911 | Ga0373943_0391542 | |||
| 1912 | Ga0373924_0029480 | |||
| 1913 | Ga0373937_0455425 | |||
| 1914 | Ga0395900_0001468 | |||
| 1915 | Ga0395900_0041360 | |||
| 1916 | Ga0395898_0001670 | |||
| 1917 | Ga0395905_0177870 | |||
| 1918 | Ga0395901_0001174 | |||
| 1919 | Ga0395901_0425187 | |||
| 1920 | Ga0395901_0745858 | |||
| 1921 | Ga0436365_0168773 | |||
| 1922 | Ga0436365_0246639 | |||
| 1923 | Ga0436365_0591026 | |||
| 1924 | Ga0436365_1248268 | |||
| 1925 | Ga0436365_1724629 | |||
| 1926 | Ga0439436_0019019 | |||
| 1927 | Ga0451789_0528288 | |||
| 1928 | Ga0451833_1275392 | |||
| 1929 | Ga0451837_0610310 | |||
| 1930 | Ga0451849_0024587 | |||
| 1931 | Ga0451855_1789405 | |||
| 1932 | Ga0439441_007968 | |||
| 1933 | Ga0439449_0050281 | |||
| 1934 | Ga0439457_001674 | |||
| 1935 | Ga0439462_0028345 | |||
| 1936 | Ga0439462_0060813 | |||
| 1937 | Ga0439434_0102735 | |||
| 1938 | Ga0451577_0008492 | |||
| 1939 | Ga0451577_0082716 | |||
| 1940 | Ga0451577_0089816 | |||
| 1941 | Ga0466972_0000207 | |||
| 1942 | Ga0466972_0000469 | |||
| 1943 | Ga0466972_0115966 | |||
| 1944 | Ga0466965_0070490 | |||
| 1945 | Ga0466966_0001667 | |||
| 1946 | Ga0466961_0160958 | |||
| 1947 | Ga0466961_0220450 | |||
| 1948 | Ga0466961_0330291 | |||
| 1949 | Ga0466964_0319287 | |||
| 1950 | Ga0453684_0012189 | |||
| 1951 | Ga0453684_0701361 | |||
| 1952 | Ga0466968_0028617 | |||
| 1953 | Ga0466960_0260317 | |||
| 1954 | Ga0466959_0000002 | |||
| 1955 | Ga0466959_0194517 | |||
| 1956 | Ga0495603_0055250 | |||
| 1957 | Ga0495638_0113799 | |||
| 1958 | Ga0495638_0145809 | |||
| 1959 | Ga0495653_0211395 | |||
| 1960 | Ga0495580_0151990 | |||
| 1961 | Ga0495594_0100148 | |||
| 1962 | Ga0495606_0018941 | |||
| 1963 | Ga0495608_0067081 | |||
| 1964 | Ga0495628_0013274 | |||
| 1965 | Ga0495630_0054622 | |||
| 1966 | Ga0495648_0003830 | |||
| 1967 | Ga0495587_0171142 | |||
| 1968 | Ga0495621_0031193 | |||
| 1969 | Ga0495622_0069730 | |||
| 1970 | Ga0495668_0000459 | |||
| 1971 | Ga0495634_0031752 | |||
| 1972 | Ga0495611_0000090 | |||
| 1973 | Ga0495611_0023013 | |||
| 1974 | Ga0495625_0069055 | |||
| 1975 | Ga0495672_0009967 | |||
| 1976 | Ga0495672_0026413 | |||
| 1977 | Ga0495672_0063586 | |||
| 1978 | Ga0495672_0076601 | |||
| 1979 | Ga0495687_000001 | |||
| 1980 | Ga0495686_0013476 | |||
| 1981 | Ga0495686_0239443 | |||
| 1982 | Ga0496101_0068362 | |||
| 1983 | Ga0496108_0417943 | |||
| 1984 | Ga0496109_0233204 | |||
| 1985 | Ga0501298_010178 | |||
| 1986 | Ga0501033_0044752 | |||
| 1987 | Ga0501033_0525137 | |||
| 1988 | Ga0501034_0000002 | |||
| 1989 | Ga0501034_0036199 | |||
| 1990 | Ga0501034_0040916 | |||
| 1991 | Ga0501034_0067326 | |||
| 1992 | Ga0501034_0152616 | |||
| 1993 | Ga0501036_0002265 | |||
| 1994 | Ga0501037_0108656 | |||
| 1995 | Ga0501038_0029035 | |||
| 1996 | Ga0501043_0019215 | |||
| 1997 | Ga0501043_0224894 | |||
| 1998 | Ga0501046_0014249 | |||
| 1999 | Ga0501047_0049725 | |||
| 2000 | Ga0501047_0364165 | |||
| 2001 | Ga0501048_0005214 | |||
| 2002 | Ga0501048_0521956 | |||
| 2003 | Ga0501067_0101704 | |||
| 2004 | Ga0501070_0004566 | |||
| 2005 | Ga0501070_0142025 | |||
| 2006 | Ga0501070_0845273 | |||
| 2007 | Ga0501072_0042730 | |||
| 2008 | Ga0501073_0021169 | |||
| 2009 | Ga0501074_0008635 | |||
| 2010 | Ga0501074_0032245 | |||
| 2011 | Ga0501198_014611 | |||
| 2012 | Ga0501202_000088 | |||
| 2013 | Ga0501217_000307 | |||
| 2014 | Ga0501222_004413 | |||
| 2015 | Ga0501223_004563 | |||
| 2016 | Ga0501233_016917 | |||
| 2017 | Ga0501242_000045 | |||
| 2018 | Ga0501250_002675 | |||
| 2019 | Ga0501252_001448 | |||
| 2020 | Ga0501257_016256 | |||
| 2021 | Ga0501257_019994 | |||
| 2022 | Ga0501257_028791 | |||
| 2023 | Ga0501261_000243 | |||
| 2024 | Ga0501221_000246 | |||
| 2025 | Ga0501225_0045695 | |||
| 2026 | Ga0501234_001444 | |||
| 2027 | Ga0501079_0122554 | |||
| 2028 | Ga0501079_0178029 | |||
| 2029 | Ga0501080_0034986 | |||
| 2030 | Ga0501083_0028952 | |||
| 2031 | Ga0501083_0035414 | |||
| 2032 | Ga0501266_004571 | |||
| 2033 | Ga0501268_032506 | |||
| 2034 | Ga0501279_009074 | |||
| 2035 | Ga0501035_0037902 | |||
| 2036 | Ga0501044_0012075 | |||
| 2037 | Ga0501044_0039771 | |||
| 2038 | Ga0501044_0094530 | |||
| 2039 | Ga0501044_0182740 | |||
| 2040 | Ga0501044_0266994 | |||
| 2041 | Ga0501044_0324204 | |||
| 2042 | Ga0501044_0355076 | |||
| 2043 | Ga0501044_0533723 | |||
| 2044 | Ga0501045_0085055 | |||
| 2045 | Ga0501284_00021 | |||
| 2046 | nmdc:mga0k408_110246_c1 | |||
| 2047 | nmdc:mga0k408_337123_c1 | |||
| 2048 | nmdc:mga0k408_384732_c1 | |||
| 2049 | nmdc:mga05p37_299061_c1 | |||
| 2050 | nmdc:mga05p37_3833_c1 | |||
| 2051 | nmdc:mga05p37_89890_c1 | |||
| 2052 | nmdc:mga09592_118468_c1 | |||
| 2053 | nmdc:mga0qj67_35464_c1 | |||
| 2054 | nmdc:mga0qj67_385449_c1 | |||
| 2055 | nmdc:mga06r32_69155_c1 | |||
| 2056 | nmdc:mga08y16_40834_c1 | |||
| 2057 | nmdc:mga08y16_759985_c1 | |||
| 2058 | nmdc:mga0n895_148980_c1 | |||
| 2059 | Ga0495619_0016556 | |||
| 2060 | Ga0500578_0000694 | |||
| 2061 | Ga0500578_0097000 | |||
| 2062 | Ga0500644_0141293 | |||
| 2063 | Ga0500646_0057636 | |||
| 2064 | Ga0500583_0000059 | |||
| 2065 | Ga0500583_0000379 | |||
| 2066 | Ga0500583_0012380 | |||
| 2067 | Ga0500651_0191202 | |||
| 2068 | Ga0500650_0191595 | |||
| 2069 | Ga0500555_000038 | |||
| 2070 | Ga0500555_033505 | |||
| 2071 | Ga0500556_0036860 | |||
| 2072 | Ga0500642_0004765 | |||
| 2073 | Ga0500652_024201 | |||
| 2074 | Ga0500568_0000236 | |||
| 2075 | Ga0500573_0172627 | |||
| 2076 | Ga0500588_0133963 | |||
| 2077 | Ga0500589_030930 | |||
| 2078 | Ga0500616_0000248 | |||
| 2079 | Ga0500616_0012902 | |||
| 2080 | Ga0500616_0065196 | |||
| 2081 | Ga0500622_0020646 | |||
| 2082 | Ga0500622_0057217 | |||
| 2083 | Ga0500636_0051649 | |||
| 2084 | Ga0500636_0267366 | |||
| 2085 | Ga0500637_0120693 | |||
| 2086 | Ga0500637_0377896 | |||
| 2087 | Ga0500611_000006 | |||
| 2088 | Ga0500645_000416 | |||
| 2089 | Ga0500599_003380 | |||
| 2090 | Ga0501084_0236063 | |||
| 2091 | Ga0501084_0499043 | |||
| 2092 | Ga0501082_0862376 | |||
| 2093 | Ga0466962_0068404 | |||
| 2094 | 2819678960 | |||
| 2095 | 2884792064 | |||
| 2096 | 2896088559 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9802 | 1 | 215 |
| 7sbj-assembly1.cif.gz_C | crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a | 0.9794 | 3 | 215 |
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9779 | 1 | 216 |
| 1tqj-assembly1.cif.gz_E | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9771 | 2 | 216 |
| 1rpx-assembly1.cif.gz_A | d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts | 0.9758 | 2 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9819 | 1 | 215 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9792 | 1 | 215 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9788 | 1 | 215 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9747 | 2 | 217 | 3.20.20.70 |
| af_P9WI51_4_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9709 | 2 | 215 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849UUQ6-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9976 | 3 | 214 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1M3GRW9-F1-model_v4 | deleted | 0.9973 | 1 | 214 |
|
| AF-A0A3E1NIR6-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9963 | 1 | 215 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A2A5HI54-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9954 | 2 | 213 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A1F5VP74-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9949 | 31 | 215 |
GO:0004750
GO:0005975 GO:0006098 GO:0046872 |