F488703

General Info

Members Datasets Scaffolds Average Seq Length
1035 808 460 428

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000055|Ga0500618_000055_52136_53644
Length 502
Sequence MPRPEQGLPFEPNTKGRRKAPLLHLRAAAPCLPLSPVASGALSKNAGGGYAPFHARHFPGLNEFLQTTRSTAMARALGLDFGTTNTVLALADGGNTTHSMRFSSSAGETDSMRTALSFMKDAQLGAQALKVEAGQAAIRQFIDNPGDARFLQSIKTFAASAVFQGTLVFARRHTFEDLMEIFLKRLKVYADGHWPSDVSRLVAGRPVHFAGASPDEKLATDRYNEALTRLGFPEIHYVYEPVAAAYYFAQTLKSDANVLVADFGGGTTDYSLIRFERVAGKLTAKPIGHSGVGIAGDHFDARMIERLVAPEIGKGTFFKSFDKLLEVPSSYYANFSRWNQLSIFKTTREFNDLKSLVRSAVDPDKLELFIDLVEHDEGYPLYQAISATKMALSAAEEAEFNFSPLGKAGRKVVKRADFETWIADDLARIEGALDDVLTKTNTAPADVDKVFLTGGTSFVPAVRRIFTERFDASKIESGGELLSIAHGLALIGESDNAGEWAA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
55 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
56 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
57 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
58 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
61 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
70 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
71 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
72 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
73 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
74 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
75 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
76 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
77 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
78 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
79 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
80 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
81 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
82 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
83 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
84 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
85 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
86 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
87 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
88 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
89 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
90 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
91 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
92 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
93 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
94 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
95 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
96 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
97 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
98 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
99 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
100 2643221557 Ensifer sp. Root558 Isolate Unclassified
101 2643221558 Rhizobium sp. Root149 Isolate Unclassified
102 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
103 2643221568 Rhizobium sp. Root564 Isolate Unclassified
104 2643221582 Rhizobium sp. Root651 Isolate Unclassified
105 2643221599 Rhizobium sp. Root708 Isolate Unclassified
106 2643221607 Rhizobium sp. Root73 Isolate Unclassified
107 2643221610 Ensifer sp. Root74 Isolate Unclassified
108 2643221618 Ensifer sp. Root231 Isolate Unclassified
109 2643221626 Ensifer sp. Root31 Isolate Unclassified
110 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
111 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
112 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
113 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
114 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
115 2643221655 Ensifer sp. Root1252 Isolate Unclassified
116 2643221659 Ensifer sp. Root127 Isolate Unclassified
117 2643221668 Ensifer sp. Root423 Isolate Unclassified
118 2643221675 Ensifer sp. Root1298 Isolate Unclassified
119 2643221680 Ensifer sp. Root1312 Isolate Unclassified
120 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
121 2643221688 Rhizobium sp. Root482 Isolate Unclassified
122 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
123 2643221693 Rhizobium sp. Root491 Isolate Unclassified
124 2643221698 Ensifer sp. Root142 Isolate Unclassified
125 2643221712 Ensifer sp. Root258 Isolate Unclassified
126 2643221718 Rhizobium sp. Root268 Isolate Unclassified
127 2643221719 Rhizobium sp. Root274 Isolate Unclassified
128 2643221723 Ensifer sp. Root278 Isolate Unclassified
129 2643221726 Ensifer sp. Root954 Isolate Unclassified
130 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
131 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
132 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
133 2718217927 Rhizobium sp. N324 Isolate Nodule
134 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
135 2718218009 Rhizobium sp. N561 Isolate Nodule
136 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
137 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
138 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
139 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
140 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
141 2718218363 Rhizobium sp. N113 Isolate Nodule
142 2718218365 Rhizobium sp. N731 Isolate Nodule
143 2718218366 Rhizobium sp. N621 Isolate Nodule
144 2718218423 Rhizobium sp. N941 Isolate Nodule
145 2721755514 Rhizobium sp. N6212 Isolate Nodule
146 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
147 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
148 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
149 2721755809 Rhizobium sp. N541 Isolate Nodule
150 2721755810 Rhizobium sp. N871 Isolate Nodule
151 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
152 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
153 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
154 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
155 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
156 2728369365 Rhizobium sp. N1341 Isolate Nodule
157 2728369397 Rhizobium sp. N1314 Isolate Nodule
158 2738541293 Rhizobium sp. GV031 Isolate Unclassified
159 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
160 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
161 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
162 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
163 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
164 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
165 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
166 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
167 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
168 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
169 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
170 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
171 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
172 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
173 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
174 2791355256 Rhizobium sp. M10 Isolate Nodule
175 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
176 2791355261 Rhizobium sp. J15 Isolate Nodule
177 2791355262 Rhizobium sp. M1 Isolate Nodule
178 2791355263 Rhizobium chutanense C5 Isolate Nodule
179 2791355264 Rhizobium sp. S9 Isolate Nodule
180 2791355265 Rhizobium sp. H4 Isolate Nodule
181 2791355266 Rhizobium sp. L43 Isolate Nodule
182 2791355267 Rhizobium sp. L18 Isolate Nodule
183 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
184 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
185 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
186 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
187 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
188 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
189 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
190 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
191 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
192 2802429633 Rhizobium anhuiense J3 Isolate Nodule
193 2802429634 Rhizobium anhuiense S10 Isolate Nodule
194 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
195 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
196 2802429637 Rhizobium anhuiense C15 Isolate Nodule
197 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
198 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
199 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
200 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
201 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
202 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
203 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
204 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
205 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
206 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
207 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
208 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
209 2838048938 Rhizobium pisi 27/80 Isolate Nodule
210 2838061910 Rhizobium phaseoli L15 Isolate Nodule
211 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
212 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
213 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
214 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
215 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
216 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
217 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
218 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
219 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
220 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
221 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
222 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
223 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
224 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
225 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
226 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
227 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
228 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
229 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
230 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
231 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
232 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
233 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
234 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
235 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
236 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
237 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
238 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
239 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
240 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
241 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
242 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
243 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
244 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
245 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
246 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
247 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
248 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
249 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
250 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
251 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
252 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
253 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
254 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
255 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
256 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
257 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
258 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
259 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
260 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
261 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
262 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
263 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
264 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
265 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
266 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
267 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
268 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
269 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
270 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
271 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
272 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
273 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
274 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
275 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
276 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
277 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
278 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
279 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
280 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
281 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
282 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
283 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
284 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
285 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
286 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
287 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
288 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
289 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
290 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
291 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
292 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
293 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
294 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
295 2844163670 Ensifer sp. 1H6 Isolate Unclassified
296 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
297 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
298 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
299 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
300 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
301 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
302 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
303 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
304 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
305 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
306 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
307 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
308 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
309 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
310 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
311 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
312 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
313 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
314 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
315 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
316 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
317 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
318 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
319 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
320 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
321 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
322 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
323 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
324 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
325 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
326 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
327 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
328 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
329 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
330 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
331 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
332 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
333 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
334 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
335 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
336 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
337 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
338 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
339 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
340 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
341 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
342 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
343 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
344 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
345 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
346 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
347 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
348 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
349 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
350 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
351 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
352 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
353 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
354 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
355 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
356 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
357 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
358 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
359 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
360 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
361 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
362 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
363 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
364 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
365 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
366 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
367 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
368 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
369 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
370 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
371 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
372 2933599457 Rhizobium phaseoli M3 Isolate Nodule
373 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
374 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
375 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
376 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
377 2936381700 Rhizobium chutanense C16 Isolate Unclassified
378 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
379 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
380 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
381 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
382 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
383 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
384 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
385 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
386 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
387 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
388 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
389 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
390 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
391 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
392 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
393 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
394 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
395 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
396 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
397 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
398 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
399 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
400 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
401 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
402 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
403 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
404 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
405 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
406 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
407 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
408 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
409 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
410 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
411 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
412 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
413 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
414 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
415 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
416 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
417 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
418 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
419 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
420 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
421 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
422 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
423 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
424 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
425 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
426 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
427 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
428 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
429 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
430 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
431 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
432 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
433 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
434 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
435 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
436 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
437 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
438 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
439 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
440 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
441 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
442 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
443 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
444 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
445 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
446 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
447 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
448 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
449 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
450 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
451 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
452 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
453 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
454 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
455 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
456 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
457 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
458 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
459 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
460 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
461 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
462 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
463 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
464 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
465 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
466 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
467 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
468 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
469 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
470 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
471 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
472 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
473 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
474 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
475 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
476 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
477 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
478 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
479 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
480 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
481 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
482 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
483 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
484 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
485 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
486 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
487 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
488 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
489 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
490 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
491 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
492 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
493 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
494 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
495 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
496 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
497 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
498 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
499 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
500 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
501 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
502 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
503 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
504 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
505 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
506 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
507 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
508 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
509 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
510 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
511 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
512 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
513 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
514 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
515 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
516 2996887358 Rhizobium sp. R711 Isolate Nodule
517 2996893221 Rhizobium sp. R635 Isolate Nodule
518 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
519 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
520 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
521 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
522 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
523 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
524 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
525 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
526 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
527 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
528 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
529 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
530 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
531 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
532 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
533 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
534 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
535 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
536 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
537 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
538 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
539 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
540 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
541 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
542 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
543 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
544 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
545 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
546 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
547 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
548 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
549 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
550 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
551 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
552 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
553 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
554 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
555 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
556 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
557 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
558 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
559 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
560 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
561 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
562 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
563 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
564 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
565 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
566 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
567 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
568 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
569 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
570 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
571 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
572 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
573 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
574 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
575 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
576 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
577 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
578 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
579 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
580 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
581 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
582 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
583 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
584 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
585 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
586 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
587 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
588 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
589 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
590 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
591 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
592 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
593 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
594 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
595 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
596 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
597 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
598 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
599 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
600 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
601 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
602 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
603 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
604 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
605 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
606 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
607 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
608 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
609 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
610 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
611 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
612 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
613 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
614 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
615 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
616 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
617 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
618 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
619 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
620 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
621 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
622 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
624 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
642 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
643 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
644 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
646 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
647 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
648 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
649 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
650 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
651 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
652 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
653 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
654 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
655 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
656 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
657 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
658 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
659 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
660 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
661 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
662 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
663 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
664 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
665 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
666 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
667 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
668 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
669 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
670 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
671 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
672 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
673 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
674 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
675 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
676 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
677 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
678 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
679 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
680 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
681 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
682 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
683 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
684 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
685 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
686 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
687 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
688 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
689 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
690 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
691 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
692 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
693 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
694 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
695 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
696 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
697 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
698 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
699 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
700 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
701 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
702 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
703 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
704 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
705 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
706 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
707 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
708 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
709 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
710 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
711 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
712 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
713 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
714 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
715 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
716 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
717 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
718 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
719 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
720 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
721 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
722 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
723 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
724 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
727 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
728 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
729 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
730 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
731 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
732 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
733 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
734 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
735 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
736 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
737 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
738 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
739 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
740 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
741 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
742 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
743 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
744 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
745 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
746 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
747 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
748 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
749 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
750 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
751 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
752 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
753 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
754 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
755 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
756 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
757 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
758 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
759 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
760 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
761 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
762 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
763 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
764 8005258706 Rhizobium sp. R693 Isolate Nodule
765 8005275841 Rhizobium sp. N4311 Isolate Nodule
766 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
767 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
768 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
769 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
770 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
771 8005321885 Rhizobium sp. R72 Isolate Nodule
772 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
773 8005382845 Rhizobium sp. R634 Isolate Nodule
774 8005395548 Rhizobium sp. R339 Isolate Nodule
775 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
776 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
777 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
778 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
779 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
780 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
781 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
782 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
783 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
784 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
785 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
786 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
787 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
788 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
789 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
790 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
791 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
792 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
793 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
794 8018176218 Rhizobium sp. N122 Isolate Nodule
795 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
796 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
797 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
798 8024501048 Rhizobium sp. H4 Isolate Nodule
799 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
800 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
801 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
802 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
803 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
804 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
805 8056382006 Rhizobium croatiense 13T Isolate Nodule
806 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
807 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
808 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.44
Metatranscriptomes 0
Isolates 55.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 16.23
Nodule 41.35
Rhizoplane 1.74
Rhizosphere 22.13
Stem 0
Stem Tuber 0
Unclassified 18.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000602 3300001979 Bacteria 15553
2 JGI25155J39150_1000072 3300002704 Bacteria 64012
3 JGI25156J39149_1000086 3300002705 Bacteria 69106
4 JGI25162J39368_1000956 3300002737 Bacteria 18449
5 JGI25162J39368_1001709 3300002737 Bacteria 10670
6 JGI25154J39366_1000205 3300002738 Bacteria 42445
7 JGI25157J39369_1000113 3300002741 Bacteria 69106
8 JGI25152J39213_1000959 3300002773 Bacteria 14079
9 JGI25150J39212_1000031 3300002774 Bacteria 100456
10 JGI25159J45721_1000001 3300002987 Bacteria 303489
11 JGI25159J45721_1000064 3300002987 Bacteria 51766
12 JGI25159J45721_1001419 3300002987 Bacteria 9950
13 JGI25151J46595_10000062 3300003187 Bacteria 146687
14 JGI25151J46595_10007169 3300003187 Bacteria 5495
15 JGI25151J46595_10018956 3300003187 Bacteria 2937
16 JGI25165J46597_1001014 3300003214 Bacteria 18522
17 JGI25165J46597_1001037 3300003214 Bacteria 18135
18 JGI25153J46596_10000312 3300003215 Bacteria 35785
19 JGI25153J46596_10005340 3300003215 Bacteria 6750
20 rootL2_10113901 3300003322 Bacteria 5126
21 rootH1_10015315 3300003323 Bacteria 2160
22 JGI25160J50197_1000002 3300003354 Bacteria 561707
23 JGI25160J50197_1000052 3300003354 Bacteria 127795
24 JGI25160J50197_1024650 3300003354 Bacteria 1701
25 JGI25161J50226_1000073 3300003374 Bacteria 86555
26 JGI25161J50226_1000153 3300003374 Bacteria 47896
27 JGI25161J50226_1003967 3300003374 Bacteria 3215
28 Ga0055526_1002168 3300003771 Bacteria 13463
29 Ga0055526_1003266 3300003771 Bacteria 10411
30 Ga0055526_1003657 3300003771 Bacteria 9623
31 Ga0055526_1005117 3300003771 Bacteria 7648
32 Ga0055526_1014304 3300003771 Bacteria 3275
33 Ga0055526_1015152 3300003771 Bacteria 3111
34 Ga0055526_1020618 3300003771 Bacteria 2334
35 Ga0055524_1003026 3300003775 Bacteria 8324
36 Ga0055524_1005073 3300003775 Bacteria 5956
37 Ga0055524_1006865 3300003775 Bacteria 4908
38 Ga0055524_1017546 3300003775 Bacteria 2522
39 Ga0055536_1000427 3300003781 Bacteria 30054
40 Ga0055536_1003558 3300003781 Bacteria 8331
41 Ga0055536_1005875 3300003781 Bacteria 5885
42 Ga0055536_1008275 3300003781 Bacteria 4498
43 Ga0055528_1000097 3300003790 Bacteria 70021
44 Ga0055528_1000413 3300003790 Bacteria 34511
45 Ga0055528_1007933 3300003790 Bacteria 4628
46 Ga0055540_1000234 3300003792 Bacteria 50741
47 Ga0055540_1003105 3300003792 Bacteria 8243
48 Ga0055531_10024536 3300003794 Bacteria 2221
49 Ga0055543_1000035 3300004625 Bacteria 127833
50 Ga0055543_1001724 3300004625 Bacteria 8207
51 Ga0065165_1000004 3300005262 Bacteria 377081
52 Ga0065165_1001373 3300005262 Bacteria 26778
53 Ga0065165_1001548 3300005262 Bacteria 23977
54 Ga0065165_1001869 3300005262 Bacteria 20423
55 Ga0065165_1006808 3300005262 Bacteria 5836
56 Ga0065165_1010060 3300005262 Bacteria 4151
57 Ga0065165_1010294 3300005262 Bacteria 4063
58 Ga0070658_10015409 3300005327 Bacteria 6117
59 Ga0070658_10016053 3300005327 Bacteria 5990
60 Ga0070658_10165504 3300005327 Bacteria 1856
61 Ga0070670_100000347 3300005331 Bacteria 38928
62 Ga0070671_100025768 3300005355 Bacteria 4828
63 Ga0070674_100040340 3300005356 Bacteria 3158
64 Ga0070659_100028862 3300005366 Bacteria 4286
65 Ga0070681_10111950 3300005458 Bacteria 2669
66 Ga0070679_100012408 3300005530 Bacteria 8143
67 Ga0070684_100036084 3300005535 Bacteria 4236
68 Ga0070665_100002410 3300005548 Bacteria 20612
69 Ga0070665_100192518 3300005548 Bacteria 2040
70 Ga0070665_100196685 3300005548 Bacteria 2017
71 Ga0068855_100010038 3300005563 Bacteria 11413
72 Ga0068855_100010543 3300005563 Bacteria 11146
73 Ga0068857_100178708 3300005577 Bacteria 1931
74 Ga0068856_100018126 3300005614 Bacteria 6826
75 Ga0068856_100046094 3300005614 Bacteria 4294
76 Ga0068856_100199246 3300005614 Bacteria 2017
77 Ga0068852_100024682 3300005616 Bacteria 4862
78 Ga0068852_100038488 3300005616 Bacteria 4020
79 Ga0068851_10005049 3300005834 Bacteria 5986
80 Ga0075365_10012052 3300006038 Bacteria 5115
81 Ga0075368_10015374 3300006042 Bacteria 2839
82 Ga0075363_100008956 3300006048 Bacteria 4687
83 Ga0075364_10000177 3300006051 Bacteria 28741
84 Ga0070712_100064141 3300006175 Bacteria 2604
85 Ga0075367_10006431 3300006178 Bacteria 5934
86 Ga0075367_10007923 3300006178 Bacteria 5474
87 Ga0075367_10021879 3300006178 Bacteria 3580
88 Ga0075369_10023091 3300006186 Bacteria 2569
89 Ga0075369_10041985 3300006186 Bacteria 1959
90 Ga0075366_10004489 3300006195 Bacteria 7486
91 Ga0097621_100010551 3300006237 Bacteria 6767
92 Ga0075370_10092350 3300006353 Bacteria 1747
93 Ga0068871_100052091 3300006358 Bacteria 3314
94 Ga0079104_1000010 3300006946 Bacteria 366021
95 Ga0079104_1002175 3300006946 Bacteria 11070
96 Ga0079104_1010103 3300006946 Bacteria 3136
97 Ga0099826_10000838 3300006948 Bacteria 16616
98 Ga0099826_10085596 3300006948 Bacteria 1946
99 Ga0099795_10000284 3300007788 Bacteria 9080
100 Ga0105251_10010972 3300009011 Bacteria 5209
101 Ga0105240_10000027 3300009093 Bacteria 348486
102 Ga0105240_10011173 3300009093 Bacteria 12533
103 Ga0105240_10049005 3300009093 Bacteria 5335
104 Ga0105245_10122532 3300009098 Bacteria 2430
105 Ga0105243_10013570 3300009148 Bacteria 6163
106 Ga0105241_10007637 3300009174 Bacteria 7947
107 Ga0105242_10085818 3300009176 Bacteria 2641
108 Ga0105248_10004763 3300009177 Bacteria 15015
109 Ga0105248_10280267 3300009177 Bacteria 1877
110 Ga0105237_10004420 3300009545 Bacteria 16294
111 Ga0105238_10019957 3300009551 Bacteria 6823
112 Ga0123341_1000006 3300009765 Bacteria 149197
113 Ga0123342_1009880 3300009766 Bacteria 11179
114 Ga0099796_10004798 3300010159 Bacteria 3309
115 Ga0105239_10010623 3300010375 Bacteria 10298
116 Ga0157373_10005723 3300013100 Bacteria 9314
117 Ga0157371_10000307 3300013102 Bacteria 63760
118 Ga0157370_10000223 3300013104 Bacteria 72025
119 Ga0157370_10000577 3300013104 Bacteria 45697
120 Ga0157370_10018273 3300013104 Bacteria 7052
121 Ga0157369_10000908 3300013105 Bacteria 37806
122 Ga0157369_10068607 3300013105 Bacteria 3810
123 Ga0157369_10109759 3300013105 Bacteria 2933
124 Ga0157369_10199134 3300013105 Bacteria 2103
125 Ga0157372_10001580 3300013307 Bacteria 24846
126 Ga0163163_10087840 3300014325 Bacteria 3120
127 Ga0182007_10009549 3300015262 Bacteria 3906
128 Ga0182005_1001113 3300015265 Bacteria 11231
129 Ga0183363_1089 3300015690 Bacteria 27581
130 Ga0214544_1000008 3300021320 Bacteria 326027
131 Ga0214542_1008369 3300021321 Bacteria 17166
132 Ga0214542_1010138 3300021321 Bacteria 13991
133 Ga0214543_1000003 3300021327 Bacteria 692327
134 Ga0214543_1000004 3300021327 Bacteria 527190
135 Ga0228711_1000001 3300022739 Bacteria 357377
136 Ga0228710_1000001 3300022740 Bacteria 314328
137 Ga0209435_100036 3300025206 Bacteria 126970
138 Ga0209436_100047 3300025208 Bacteria 68393
139 Ga0209436_102304 3300025208 Bacteria 5851
140 Ga0209672_103187 3300025228 Bacteria 3505
141 Ga0209437_100033 3300025233 Bacteria 512520
142 Ga0209437_100036 3300025233 Bacteria 469153
143 Ga0207425_1000031 3300025245 Bacteria 261181
144 Ga0207425_1001110 3300025245 Bacteria 12159
145 Ga0207425_1010137 3300025245 Bacteria 2307
146 Ga0209646_1000132 3300025246 Bacteria 126859
147 Ga0209026_1000236 3300025250 Bacteria 73740
148 Ga0209759_1000269 3300025256 Bacteria 73740
149 Ga0209129_1000053 3300025258 Bacteria 262823
150 Ga0209129_1000125 3300025258 Bacteria 133506
151 Ga0209129_1000611 3300025258 Bacteria 24129
152 Ga0209129_1001053 3300025258 Bacteria 16286
153 Ga0209129_1001178 3300025258 Bacteria 15052
154 Ga0209129_1001568 3300025258 Bacteria 12550
155 Ga0209129_1003548 3300025258 Bacteria 6714
156 Ga0209233_1000056 3300025261 Bacteria 438104
157 Ga0209233_1000064 3300025261 Bacteria 392156
158 Ga0209233_1000152 3300025261 Bacteria 175910
159 Ga0209455_1008421 3300025272 Bacteria 2805
160 Ga0209673_1000122 3300025273 Bacteria 170443
161 Ga0209673_1000409 3300025273 Bacteria 75876
162 Ga0209673_1001508 3300025273 Bacteria 21458
163 Ga0209673_1001874 3300025273 Bacteria 16993
164 Ga0209673_1001941 3300025273 Bacteria 16313
165 Ga0209673_1002296 3300025273 Bacteria 13630
166 Ga0209673_1006574 3300025273 Bacteria 5570
167 Ga0209130_1000006 3300025284 Bacteria 596528
168 Ga0209130_1000008 3300025284 Bacteria 581232
169 Ga0209130_1015165 3300025284 Bacteria 1908
170 Ga0209676_1001841 3300025292 Bacteria 17525
171 Ga0209676_1002222 3300025292 Bacteria 14418
172 Ga0209676_1012750 3300025292 Bacteria 3273
173 Ga0209025_1000074 3300025294 Bacteria 277445
174 Ga0209025_1000080 3300025294 Bacteria 267244
175 Ga0209025_1000087 3300025294 Bacteria 261181
176 Ga0209025_1000100 3300025294 Bacteria 229182
177 Ga0209025_1000165 3300025294 Bacteria 164692
178 Ga0209025_1000900 3300025294 Bacteria 46091
179 Ga0209025_1001226 3300025294 Bacteria 35815
180 Ga0209025_1001688 3300025294 Bacteria 26980
181 Ga0209025_1007426 3300025294 Bacteria 8179
182 Ga0209025_1012756 3300025294 Bacteria 5353
183 Ga0209025_1033604 3300025294 Bacteria 2366
184 Ga0209564_1000104 3300025295 Bacteria 219017
185 Ga0209564_1000853 3300025295 Bacteria 40719
186 Ga0209564_1001099 3300025295 Bacteria 32101
187 Ga0209564_1001645 3300025295 Bacteria 21556
188 Ga0209564_1005387 3300025295 Bacteria 7331
189 Ga0209758_1000081 3300025297 Bacteria 261181
190 Ga0209758_1000121 3300025297 Bacteria 192028
191 Ga0209758_1000313 3300025297 Bacteria 93883
192 Ga0209758_1000624 3300025297 Bacteria 54349
193 Ga0209758_1003467 3300025297 Bacteria 14302
194 Ga0209758_1008055 3300025297 Bacteria 6955
195 Ga0209758_1014909 3300025297 Bacteria 4079
196 Ga0209050_1001263 3300025298 Bacteria 29191
197 Ga0209050_1012778 3300025298 Bacteria 3810
198 Ga0209256_1000351 3300025299 Bacteria 74921
199 Ga0209256_1001199 3300025299 Bacteria 29031
200 Ga0209256_1001393 3300025299 Bacteria 25215
201 Ga0209256_1001494 3300025299 Bacteria 23770
202 Ga0209256_1002645 3300025299 Bacteria 14095
203 Ga0209256_1003108 3300025299 Bacteria 12147
204 Ga0209256_1003692 3300025299 Bacteria 10407
205 Ga0209256_1008356 3300025299 Bacteria 4822
206 Ga0207426_1000016 3300025302 Bacteria 581232
207 Ga0207426_1000044 3300025302 Bacteria 428043
208 Ga0207426_1000106 3300025302 Bacteria 244368
209 Ga0207426_1000743 3300025302 Bacteria 36635
210 Ga0207426_1001023 3300025302 Bacteria 26852
211 Ga0209051_1000339 3300025303 Bacteria 70136
212 Ga0209051_1000918 3300025303 Bacteria 29277
213 Ga0209051_1001825 3300025303 Bacteria 16844
214 Ga0209051_1014302 3300025303 Bacteria 3712
215 Ga0209257_1001790 3300025304 Bacteria 23629
216 Ga0209257_1002795 3300025304 Bacteria 16446
217 Ga0209257_1002847 3300025304 Bacteria 16197
218 Ga0209257_1003481 3300025304 Bacteria 13438
219 Ga0207705_10029588 3300025909 Bacteria 3904
220 Ga0207707_10111347 3300025912 Bacteria 2393
221 Ga0207695_10000024 3300025913 Bacteria 632311
222 Ga0207695_10018654 3300025913 Bacteria 8014
223 Ga0207695_10025079 3300025913 Bacteria 6688
224 Ga0207671_10000986 3300025914 Bacteria 35178
225 Ga0207660_10193806 3300025917 Bacteria 1584
226 Ga0207652_10044177 3300025921 Bacteria 3795
227 Ga0207681_10113687 3300025923 Bacteria 1974
228 Ga0207650_10000567 3300025925 Bacteria 30017
229 Ga0207664_10172947 3300025929 Bacteria 1850
230 Ga0207644_10079078 3300025931 Bacteria 2425
231 Ga0207711_10036636 3300025941 Bacteria 4163
232 Ga0207667_10031906 3300025949 Bacteria 5681
233 Ga0207677_10006032 3300026023 Bacteria 6607
234 Ga0207708_10117069 3300026075 Bacteria 2073
235 Ga0207702_10164056 3300026078 Bacteria 2031
236 Ga0207683_10137732 3300026121 Bacteria 2198
237 Ga0207698_10005638 3300026142 Bacteria 7750
238 Ga0207698_10028833 3300026142 Bacteria 3965
239 Ga0209281_1000053 3300027111 Bacteria 309587
240 Ga0209281_1000164 3300027111 Bacteria 157372
241 Ga0209281_1000377 3300027111 Bacteria 71243
242 Ga0209371_1000009 3300027312 Bacteria 963030
243 Ga0209371_1001175 3300027312 Bacteria 19137
244 Ga0209371_1005859 3300027312 Bacteria 4732
245 Ga0209282_1000007 3300027666 Bacteria 254917
246 Ga0209282_1000715 3300027666 Bacteria 16612
247 Ga0209282_1071011 3300027666 Bacteria 1896
248 Ga0268266_10032452 3300028379 Bacteria 4436
249 Ga0268266_10110435 3300028379 Bacteria 2436
250 Ga0307515_10000115 3300028794 Bacteria 193697
251 Ga0307515_10001359 3300028794 Bacteria 55373
252 Ga0307515_10002710 3300028794 Bacteria 37898
253 Ga0268256_1000010 3300030500 Bacteria 963034
254 Ga0268256_1005834 3300030500 Bacteria 4732
255 Ga0316181_1002016 3300030744 Bacteria 2554
256 Ga0265327_10000778 3300031251 Bacteria 49242
257 Ga0265327_10001708 3300031251 Bacteria 26225
258 Ga0265327_10024281 3300031251 Bacteria 3567
259 Ga0265316_10006286 3300031344 Bacteria 11374
260 Ga0307513_10008680 3300031456 Bacteria 12948
261 Ga0307513_10014591 3300031456 Bacteria 9566
262 Ga0307410_10095821 3300031852 Bacteria 2117
263 Ga0307412_10001806 3300031911 Bacteria 11834
264 Ga0307412_10079261 3300031911 Bacteria 2265
265 Ga0315914_1000006 3300031967 Bacteria 239817
266 Ga0307416_100153035 3300032002 Bacteria 2119
267 Ga0307414_10002909 3300032004 Bacteria 9058
268 Ga0315913_1000002 3300033430 Bacteria 241452
269 Ga0315915_1000001 3300033464 Bacteria 481518
270 Ga0373927_0000780 3300035695 Bacteria 24278
271 Ga0395905_0007143 3300037471 Bacteria 11167
272 Ga0395905_0008439 3300037471 Bacteria 10157
273 Ga0395905_0127507 3300037471 Bacteria 2393
274 Ga0237819_00516 3300038705 Bacteria 12975
275 Ga0237816_01893 3300039145 Bacteria 1661
276 Ga0439436_0025113 3300041404 Bacteria 1753
277 Ga0439439_0021887 3300041406 Bacteria 1595
278 Ga0439465_0004088 3300041413 Bacteria 4744
279 Ga0439465_0017163 3300041413 Bacteria 2259
280 Ga0439465_0020090 3300041413 Bacteria 2090
281 Ga0451837_1135412 3300041494 Bacteria 2422
282 Ga0451839_0324124 3300041496 Bacteria 2537
283 Ga0439431_0013507 3300041997 Bacteria 1885
284 Ga0439432_033106 3300042006 Bacteria 1664
285 Ga0439449_0006077 3300042007 Bacteria 4617
286 Ga0451576_0025375 3300045051 Bacteria 6384
287 Ga0451576_0244129 3300045051 Bacteria 1876
288 Ga0466958_0014567 3300045836 Bacteria 4489
289 Ga0495592_0074268 3300046454 Bacteria 2470
290 Ga0495629_0014314 3300046459 Bacteria 5708
291 Ga0495638_0000854 3300046460 Bacteria 31738
292 Ga0495638_0043878 3300046460 Bacteria 2819
293 Ga0495650_0000461 3300046471 Bacteria 63382
294 Ga0495650_0053217 3300046471 Bacteria 1659
295 Ga0495605_0000331 3300046474 Bacteria 47522
296 Ga0495662_0049991 3300046476 Bacteria 2018
297 Ga0495585_0062382 3300046492 Bacteria 2047
298 Ga0495607_0026847 3300046501 Bacteria 3569
299 Ga0495583_0008582 3300046506 Bacteria 6225
300 Ga0495583_0008848 3300046506 Bacteria 6091
301 Ga0495606_0003594 3300046507 Bacteria 16331
302 Ga0495606_0029980 3300046507 Bacteria 3809
303 Ga0495610_0012464 3300046512 Bacteria 5116
304 Ga0495616_0021617 3300046513 Bacteria 3480
305 Ga0495620_0010432 3300046515 Bacteria 4903
306 Ga0495620_0047972 3300046515 Bacteria 1835
307 Ga0495631_0003782 3300046518 Bacteria 8235
308 Ga0495631_0027381 3300046518 Bacteria 2609
309 Ga0495632_0002635 3300046519 Bacteria 13509
310 Ga0495632_0006079 3300046519 Bacteria 7832
311 Ga0495643_0019999 3300046522 Bacteria 3867
312 Ga0495643_0035161 3300046522 Bacteria 2760
313 Ga0495643_0106004 3300046522 Bacteria 1435
314 Ga0495648_0051940 3300046524 Bacteria 2494
315 Ga0495652_0040107 3300046529 Bacteria 4047
316 Ga0495654_0000130 3300046530 Bacteria 81643
317 Ga0495587_0017692 3300046536 Bacteria 4426
318 Ga0495609_0031792 3300046538 Bacteria 2398
319 Ga0495622_0012970 3300046557 Bacteria 3867
320 Ga0495633_0008112 3300046558 Bacteria 5956
321 Ga0495668_0007613 3300046616 Bacteria 6901
322 Ga0495668_0023282 3300046616 Bacteria 3535
323 Ga0495625_0000726 3300046660 Bacteria 46277
324 Ga0495625_0001965 3300046660 Bacteria 23208
325 Ga0495625_0077921 3300046660 Bacteria 2314
326 Ga0495661_0106826 3300046665 Bacteria 1566
327 Ga0495657_0033534 3300046675 Bacteria 3574
328 Ga0495600_0024098 3300046809 Bacteria 3916
329 Ga0495660_0007221 3300046810 Bacteria 6539
330 Ga0495673_0050131 3300047469 Bacteria 1834
331 Ga0495681_0004767 3300047470 Bacteria 9187
332 Ga0495681_0058420 3300047470 Bacteria 1787
333 Ga0495686_0000238 3300047472 Bacteria 99919
334 Ga0495686_0000613 3300047472 Bacteria 49253
335 Ga0495686_0012665 3300047472 Bacteria 5894
336 Ga0495686_0128339 3300047472 Bacteria 1506
337 Ga0496100_0187288 3300048903 Bacteria 1500
338 Ga0496102_0023580 3300048905 Bacteria 5467
339 Ga0496104_0238028 3300048907 Bacteria 1732
340 Ga0496106_0001004 3300048909 Bacteria 20640
341 Ga0496110_0106678 3300048913 Bacteria 2514
342 Ga0496113_0035330 3300048916 Bacteria 3654
343 Ga0496114_0120299 3300048917 Bacteria 2258
344 Ga0496116_0000036 3300048919 Bacteria 388508
345 Ga0496116_0001619 3300048919 Bacteria 24766
346 Ga0496116_0002976 3300048919 Bacteria 17219
347 Ga0496116_0010396 3300048919 Bacteria 7802
348 Ga0496116_0017233 3300048919 Bacteria 5617
349 Ga0496116_0100819 3300048919 Bacteria 1725
350 Ga0496117_0000002 3300048920 Bacteria 2483758
351 Ga0496117_0006548 3300048920 Bacteria 11726
352 Ga0496117_0007855 3300048920 Bacteria 10264
353 Ga0496117_0036258 3300048920 Bacteria 3693
354 Ga0496117_0046076 3300048920 Bacteria 3141
355 Ga0496117_0051153 3300048920 Bacteria 2923
356 Ga0496117_0071672 3300048920 Bacteria 2320
357 Ga0496118_0000084 3300048921 Bacteria 181733
358 Ga0496118_0000396 3300048921 Bacteria 73830
359 Ga0496118_0002631 3300048921 Bacteria 23807
360 Ga0496118_0006506 3300048921 Bacteria 12806
361 Ga0496118_0092593 3300048921 Bacteria 2074
362 Ga0496119_0010878 3300048922 Bacteria 7604
363 Ga0496119_0019985 3300048922 Bacteria 4904
364 Ga0496119_0029046 3300048922 Bacteria 3760
365 Ga0496119_0032929 3300048922 Bacteria 3447
366 Ga0496119_0051426 3300048922 Bacteria 2532
367 Ga0496120_0000087 3300048923 Bacteria 152857
368 Ga0496120_0004845 3300048923 Bacteria 11003
369 Ga0496120_0028306 3300048923 Bacteria 3435
370 Ga0496121_0000001 3300048924 Bacteria 1830318
371 Ga0496121_0001141 3300048924 Bacteria 46594
372 Ga0496121_0005778 3300048924 Bacteria 15693
373 Ga0496121_0009367 3300048924 Bacteria 11279
374 Ga0496121_0010484 3300048924 Bacteria 10447
375 Ga0496121_0015300 3300048924 Bacteria 8055
376 Ga0496121_0020840 3300048924 Bacteria 6459
377 Ga0496121_0046720 3300048924 Bacteria 3702
378 Ga0496121_0050304 3300048924 Bacteria 3522
379 Ga0496121_0109694 3300048924 Bacteria 2108
380 Ga0496121_0125056 3300048924 Bacteria 1935
381 Ga0496122_0000001 3300048925 Bacteria 1827766
382 Ga0496122_0000009 3300048925 Bacteria 584024
383 Ga0496122_0000205 3300048925 Bacteria 131755
384 Ga0496122_0014055 3300048925 Bacteria 7771
385 Ga0496122_0017027 3300048925 Bacteria 6824
386 Ga0496122_0018436 3300048925 Bacteria 6448
387 Ga0496122_0086661 3300048925 Bacteria 2154
388 Ga0496123_0000001 3300048926 Bacteria 1831497
389 Ga0496123_0000034 3300048926 Bacteria 274836
390 Ga0496123_0000103 3300048926 Bacteria 168232
391 Ga0496123_0007399 3300048926 Bacteria 10363
392 Ga0496123_0008628 3300048926 Bacteria 9322
393 Ga0496123_0009779 3300048926 Bacteria 8571
394 Ga0496123_0010695 3300048926 Bacteria 8067
395 Ga0496124_0000133 3300048927 Bacteria 154328
396 Ga0496124_0000854 3300048927 Bacteria 49730
397 Ga0496124_0001267 3300048927 Bacteria 38458
398 Ga0496124_0009898 3300048927 Bacteria 9746
399 Ga0496124_0013954 3300048927 Bacteria 7804
400 Ga0496124_0025344 3300048927 Bacteria 5373
401 Ga0496124_0035983 3300048927 Bacteria 4325
402 Ga0496124_0100955 3300048927 Bacteria 2338
403 Ga0496124_0109217 3300048927 Bacteria 2230
404 Ga0496125_0000001 3300048928 Bacteria 1766138
405 Ga0496125_0000385 3300048928 Bacteria 82113
406 Ga0496125_0013299 3300048928 Bacteria 8097
407 Ga0496125_0018668 3300048928 Bacteria 6578
408 Ga0496126_0000597 3300048929 Bacteria 68119
409 Ga0496126_0001488 3300048929 Bacteria 36340
410 Ga0496126_0018669 3300048929 Bacteria 6863
411 Ga0496126_0122689 3300048929 Bacteria 2251
412 Ga0501033_0000038 3300049570 Bacteria 144438
413 Ga0501033_0021895 3300049570 Bacteria 4823
414 Ga0501034_0003022 3300049571 Bacteria 19460
415 Ga0501034_0312590 3300049571 Bacteria 1505
416 Ga0501037_0057845 3300049573 Bacteria 2830
417 Ga0501038_0167137 3300049574 Bacteria 1784
418 Ga0501043_0058918 3300049579 Bacteria 3013
419 Ga0501047_0001955 3300049581 Bacteria 19810
420 Ga0501047_0178982 3300049581 Bacteria 1987
421 Ga0501068_0098395 3300049584 Bacteria 1811
422 Ga0501069_0004546 3300049585 Bacteria 7171
423 Ga0501070_0001389 3300049586 Bacteria 21681
424 Ga0501072_0204362 3300049588 Bacteria 1575
425 Ga0501073_0000206 3300049589 Bacteria 38869
426 Ga0501074_0000330 3300049590 Bacteria 27501
427 Ga0501083_0000293 3300049744 Bacteria 31385
428 Ga0501083_0064521 3300049744 Bacteria 2440
429 Ga0501035_0000326 3300049822 Bacteria 55174
430 Ga0501035_0170579 3300049822 Bacteria 1880
431 Ga0501044_0034308 3300049823 Bacteria 5322
432 nmdc:mga03683_51004_c1 3300050489 Bacteria 1726
433 nmdc:mga00v17_13054_c1 3300050491 Bacteria 4603
434 nmdc:mga00v17_201_c1 3300050491 Bacteria 36027
435 nmdc:mga00v17_52_c1 3300050491 Bacteria 72738
436 nmdc:mga0yw44_4284_c1 3300050492 Bacteria 6510
437 nmdc:mga07m45_84678_c1 3300050496 Bacteria 1812
438 Ga0500643_032572 3300053087 Bacteria 1582
439 Ga0500566_0002633 3300053094 Bacteria 10687
440 Ga0500560_000407 3300053107 Bacteria 5854
441 Ga0500595_004324 3300053119 Bacteria 6398
442 Ga0500618_000055 3300053125 Bacteria 99876
443 Ga0500618_000616 3300053125 Bacteria 21736
444 Ga0500618_002635 3300053125 Bacteria 6609
445 Ga0500618_004048 3300053125 Bacteria 4813
446 Ga0500618_014196 3300053125 Bacteria 2040
447 Ga0500658_0001240 3300053134 Bacteria 10358
448 Ga0500561_0000114 3300053137 Bacteria 15576
449 Ga0500568_0001799 3300053139 Bacteria 13200
450 Ga0500573_0048611 3300053140 Bacteria 2441
451 Ga0500616_0000224 3300053153 Bacteria 88293
452 Ga0500616_0000328 3300053153 Bacteria 68215
453 Ga0500616_0062932 3300053153 Bacteria 1915
454 Ga0500622_0000919 3300053156 Bacteria 25030
455 Ga0500622_0001161 3300053156 Bacteria 21882
456 Ga0500624_000161 3300053157 Bacteria 27520
457 Ga0500633_0000113 3300053160 Bacteria 10869
458 Ga0500634_0014495 3300053161 Bacteria 4160
459 Ga0500636_0000004 3300053177 Bacteria 202392
460 Ga0500636_0045907 3300053177 Bacteria 2576

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003790 Ga0055528_1007933 Ga0055528_10079332 372
2 3300048924 Ga0496121_0125056 Ga0496121_0125056_14_1171 384
3 3300046616 Ga0495668_0023282 Ga0495668_0023282_11_1189 391
4 3300053177 Ga0500636_0045907 Ga0500636_0045907_1101_2507 396
5 3300014325 Ga0163163_10087840 Ga0163163_100878404 403
6 3300046476 Ga0495662_0049991 Ga0495662_0049991_780_1991 403
7 3300046522 Ga0495643_0106004 Ga0495643_0106004_182_1393 403
8 3300053125 Ga0500618_014196 Ga0500618_014196_16_1227 403
9 3300048929 Ga0496126_0018669 Ga0496126_0018669_1544_2818 404
10 3300025245 Ga0207425_1010137 Ga0207425_10101371 406
11 3300005262 Ga0065165_1010294 Ga0065165_10102944 407
12 3300048922 Ga0496119_0029046 Ga0496119_0029046_458_1732 407
13 3300048924 Ga0496121_0001141 Ga0496121_0001141_24752_26044 407
14 3300048924 Ga0496121_0010484 Ga0496121_0010484_4708_5982 407
15 3300013105 Ga0157369_10068607 Ga0157369_100686072 408
16 3300013105 Ga0157369_10199134 Ga0157369_101991342 408
17 3300027312 Ga0209371_1001175 Ga0209371_100117513 408
18 3300048927 Ga0496124_0000133 Ga0496124_0000133_67662_68954 408
19 3300048927 Ga0496124_0109217 Ga0496124_0109217_22_1314 408
20 3300005548 Ga0070665_100192518 Ga0070665_1001925182 410
21 3300006946 Ga0079104_1000010 Ga0079104_100001059 410
22 3300027111 Ga0209281_1000053 Ga0209281_100005358 410
23 3300046460 Ga0495638_0000854 Ga0495638_0000854_6035_7327 410
24 3300048924 Ga0496121_0050304 Ga0496121_0050304_1338_2630 410
25 3300048927 Ga0496124_0025344 Ga0496124_0025344_3447_4739 410
26 3300053139 Ga0500568_0001799 Ga0500568_0001799_6001_7293 410
27 3300053153 Ga0500616_0000328 Ga0500616_0000328_59608_60900 410
28 3300027312 Ga0209371_1000009 Ga0209371_100000934 411
29 3300030500 Ga0268256_1000010 Ga0268256_100001034 411
30 3300041413 Ga0439465_0004088 Ga0439465_0004088_2747_4039 411
31 3300042006 Ga0439432_033106 Ga0439432_033106_126_1418 411
32 3300046474 Ga0495605_0000331 Ga0495605_0000331_19851_21143 411
33 3300046501 Ga0495607_0026847 Ga0495607_0026847_1503_2795 411
34 3300046513 Ga0495616_0021617 Ga0495616_0021617_473_1765 411
35 3300046515 Ga0495620_0010432 Ga0495620_0010432_1676_2968 411
36 3300046518 Ga0495631_0003782 Ga0495631_0003782_6613_7905 411
37 3300046519 Ga0495632_0006079 Ga0495632_0006079_5997_7289 411
38 3300046538 Ga0495609_0031792 Ga0495609_0031792_321_1613 411
39 3300046616 Ga0495668_0007613 Ga0495668_0007613_4666_5958 411
40 3300046660 Ga0495625_0001965 Ga0495625_0001965_14687_15979 411
41 3300046810 Ga0495660_0007221 Ga0495660_0007221_5152_6444 411
42 3300048925 Ga0496122_0086661 Ga0496122_0086661_233_1525 412
43 3300005262 Ga0065165_1001869 Ga0065165_10018698 414
44 3300049581 Ga0501047_0001955 Ga0501047_0001955_4128_5450 414
45 3300049584 Ga0501068_0098395 Ga0501068_0098395_183_1505 414
46 3300049585 Ga0501069_0004546 Ga0501069_0004546_149_1471 414
47 3300049586 Ga0501070_0001389 Ga0501070_0001389_449_1771 414
48 3300049588 Ga0501072_0204362 Ga0501072_0204362_71_1393 414
49 3300049589 Ga0501073_0000206 Ga0501073_0000206_28867_30189 414
50 3300049590 Ga0501074_0000330 Ga0501074_0000330_18704_20026 414
51 3300049744 Ga0501083_0000293 Ga0501083_0000293_14378_15700 414
52 3300049822 Ga0501035_0170579 Ga0501035_0170579_476_1798 414
53 3300049823 Ga0501044_0034308 Ga0501044_0034308_2344_3666 414
54 3300025294 Ga0209025_1000074 Ga0209025_1000074150 415
55 3300025294 Ga0209025_1000080 Ga0209025_1000080143 415
56 3300025929 Ga0207664_10172947 Ga0207664_101729472 415
57 3300025912 Ga0207707_10111347 Ga0207707_101113472 417
58 3300025917 Ga0207660_10193806 Ga0207660_101938061 417
59 3300005563 Ga0068855_100010038 Ga0068855_1000100385 419
60 3300009093 Ga0105240_10049005 Ga0105240_100490052 419
61 3300013104 Ga0157370_10018273 Ga0157370_100182735 419
62 3300025949 Ga0207667_10031906 Ga0207667_100319065 419
63 3300005356 Ga0070674_100040340 Ga0070674_1000403402 420
64 3300009098 Ga0105245_10122532 Ga0105245_101225322 420
65 3300009176 Ga0105242_10085818 Ga0105242_100858182 420
66 3300026075 Ga0207708_10117069 Ga0207708_101170692 420
67 3300026121 Ga0207683_10137732 Ga0207683_101377322 420
68 3300053094 Ga0500566_0002633 Ga0500566_0002633_6839_8116 420
69 3300032002 Ga0307416_100153035 Ga0307416_1001530352 421
70 3300048919 Ga0496116_0001619 Ga0496116_0001619_3761_5029 421
71 iso_pu_bacteria 2791355094 2792638428 421
72 3300003781 Ga0055536_1003558 Ga0055536_10035582 422
73 3300003781 Ga0055536_1008275 Ga0055536_10082754 422
74 3300003794 Ga0055531_10024536 Ga0055531_100245362 422
75 3300025292 Ga0209676_1002222 Ga0209676_10022224 422
76 3300046660 Ga0495625_0000726 Ga0495625_0000726_41120_42412 422
77 iso_pu_bacteria 2643221560 2643820667 422
78 iso_pu_bacteria 2791355091 2792622122 422
79 iso_pu_bacteria 2791355092 2792628313 422
80 iso_pu_bacteria 2937084907 2937091578 422
81 3300007788 Ga0099795_10000284 Ga0099795_100002845 423
82 3300010159 Ga0099796_10004798 Ga0099796_100047982 423
83 3300031251 Ga0265327_10001708 Ga0265327_1000170811 423
84 iso_pu_bacteria 2508501122 2509107461 423
85 iso_pu_bacteria 2509276019 2509374547 423
86 iso_pu_bacteria 2510065057 2510304464 423
87 iso_pu_bacteria 2511231052 2511500918 423
88 iso_pu_bacteria 2512047086 2512532340 423
89 iso_pu_bacteria 2512875026 2512972331 423
90 iso_pu_bacteria 2513237086 2513583544 423
91 iso_pu_bacteria 2513237089 2513603410 423
92 iso_pu_bacteria 2513237091 2513617529 423
93 iso_pu_bacteria 2513237140 2513882757 423
94 iso_pu_bacteria 2513237143 2513905302 423
95 iso_pu_bacteria 2513237160 2514004865 423
96 iso_pu_bacteria 2515154107 2515608043 423
97 iso_pu_bacteria 2516143018 2516208796 423
98 iso_pu_bacteria 2516653046 2516892195 423
99 iso_pu_bacteria 2517487022 2517569004 423
100 iso_pu_bacteria 2524023207 2524450241 423
101 iso_pu_bacteria 2551306084 2551676378 423
102 iso_pu_bacteria 2551306085 2551687485 423
103 iso_pu_bacteria 2551306087 2551699171 423
104 iso_pu_bacteria 2551306090 2551719052 423
105 iso_pu_bacteria 2551306091 2551730330 423
106 iso_pu_bacteria 2551306092 2551738827 423
107 iso_pu_bacteria 2551306093 2551745388 423
108 iso_pu_bacteria 2558860100 2558863575 423
109 iso_pu_bacteria 2657244999 2657682229 423
110 iso_pu_bacteria 2690316117 2692316909 423
111 iso_pu_bacteria 2751185821 2753458885 423
112 iso_pu_bacteria 2791355082 2792584077 423
113 iso_pu_bacteria 2802428858 2802717647 423
114 iso_pu_bacteria 2802428859 2802723426 423
115 iso_pu_bacteria 2802428860 2802731124 423
116 iso_pu_bacteria 2802428861 2802736130 423
117 iso_pu_bacteria 2802428862 2802743659 423
118 iso_pu_bacteria 2802428863 2802750629 423
119 iso_pu_bacteria 2802429268 2804751248 423
120 iso_pu_bacteria 2838074704 2838076354 423
121 iso_pu_bacteria 2847417321 2847418023 423
122 iso_pu_bacteria 2848992105 2848992999 423
123 iso_pu_bacteria 2850079185 2850080385 423
124 iso_pu_bacteria 2855825444 2855831269 423
125 iso_pu_bacteria 2855839649 2855840394 423
126 iso_pu_bacteria 2855872281 2855879061 423
127 iso_pu_bacteria 2858800743 2858800923 423
128 iso_pu_bacteria 2896384573 2896386556 423
129 iso_pu_bacteria 2915980308 2915986126 423
130 iso_pu_bacteria 2915986958 2915989992 423
131 iso_pu_bacteria 2915993759 2915996547 423
132 iso_pu_bacteria 2916000859 2916005850 423
133 iso_pu_bacteria 2916007675 2916010873 423
134 iso_pu_bacteria 2916014648 2916020946 423
135 iso_pu_bacteria 2916021584 2916027500 423
136 iso_pu_bacteria 2916028427 2916028866 423
137 iso_pu_bacteria 2916035215 2916035365 423
138 iso_pu_bacteria 2916041962 2916043067 423
139 iso_pu_bacteria 2916048683 2916054708 423
140 iso_pu_bacteria 2916055098 2916061407 423
141 iso_pu_bacteria 2916061851 2916068026 423
142 iso_pu_bacteria 2916068649 2916072047 423
143 iso_pu_bacteria 2920760137 2920762959 423
144 iso_pu_bacteria 2921201388 2921204299 423
145 iso_pu_bacteria 2921208531 2921215162 423
146 iso_pu_bacteria 2921237296 2921243942 423
147 iso_pu_bacteria 2921244191 2921245979 423
148 iso_pu_bacteria 2921250672 2921250910 423
149 iso_pu_bacteria 2921257292 2921261556 423
150 iso_pu_bacteria 2921263974 2921269368 423
151 iso_pu_bacteria 2921282425 2921288024 423
152 iso_pu_bacteria 2921289301 2921290184 423
153 iso_pu_bacteria 2921296804 2921303564 423
154 iso_pu_bacteria 2924144063 2924146909 423
155 iso_pu_bacteria 2924150972 2924153302 423
156 iso_pu_bacteria 2924158325 2924160519 423
157 iso_pu_bacteria 2924165586 2924166833 423
158 iso_pu_bacteria 2924172951 2924178536 423
159 iso_pu_bacteria 2924179722 2924181479 423
160 iso_pu_bacteria 2924186466 2924190303 423
161 iso_pu_bacteria 2924200457 2924204376 423
162 iso_pu_bacteria 2924207177 2924209856 423
163 iso_pu_bacteria 2924214083 2924216446 423
164 iso_pu_bacteria 2924221636 2924224422 423
165 iso_pu_bacteria 2924228884 2924234882 423
166 iso_pu_bacteria 2936996657 2937000473 423
167 iso_pu_bacteria 2937002841 2937009569 423
168 iso_pu_bacteria 2937009748 2937010833 423
169 iso_pu_bacteria 2937016420 2937022045 423
170 iso_pu_bacteria 2937023124 2937027978 423
171 iso_pu_bacteria 2937029754 2937029912 423
172 iso_pu_bacteria 2937036028 2937041575 423
173 iso_pu_bacteria 2937042894 2937046006 423
174 iso_pu_bacteria 2937049772 2937050292 423
175 iso_pu_bacteria 2937056579 2937061587 423
176 iso_pu_bacteria 2937063883 2937066466 423
177 iso_pu_bacteria 2937071275 2937073826 423
178 iso_pu_bacteria 2937078374 2937083019 423
179 iso_pu_bacteria 2937091812 2937098938 423
180 iso_pu_bacteria 2937098957 2937103689 423
181 iso_pu_bacteria 2937106411 2937113008 423
182 iso_pu_bacteria 2937113482 2937118227 423
183 iso_pu_bacteria 2937119839 2937121132 423
184 iso_pu_bacteria 2937126314 2937130139 423
185 iso_pu_bacteria 2957375807 2957380071 423
186 iso_pu_bacteria 2957382221 2957385122 423
187 iso_pu_bacteria 2957388812 2957389185 423
188 iso_pu_bacteria 2957395598 2957398651 423
189 iso_pu_bacteria 2957402308 2957405501 423
190 iso_pu_bacteria 2957408893 2957415226 423
191 iso_pu_bacteria 2957415311 2957418033 423
192 iso_pu_bacteria 2957422303 2957426802 423
193 iso_pu_bacteria 2957430029 2957433128 423
194 iso_pu_bacteria 2957437181 2957438952 423
195 iso_pu_bacteria 2957443900 2957446705 423
196 iso_pu_bacteria 2957450854 2957453493 423
197 iso_pu_bacteria 2957457609 2957457813 423
198 iso_pu_bacteria 2957464669 2957466461 423
199 iso_pu_bacteria 2957471148 2957473967 423
200 iso_pu_bacteria 2957478035 2957483716 423
201 iso_pu_bacteria 2957484790 2957485843 423
202 iso_pu_bacteria 2957491536 2957495942 423
203 iso_pu_bacteria 2957505466 2957511488 423
204 iso_pu_bacteria 2960584000 2960590036 423
205 iso_pu_bacteria 2960591022 2960595526 423
206 iso_pu_bacteria 2960597568 2960600628 423
207 iso_pu_bacteria 2960603979 2960609405 423
208 iso_pu_bacteria 2960610863 2960617075 423
209 iso_pu_bacteria 2960617483 2960617652 423
210 iso_pu_bacteria 2960624210 2960626110 423
211 iso_pu_bacteria 2960631154 2960633273 423
212 iso_pu_bacteria 2960637947 2960645336 423
213 iso_pu_bacteria 2960645483 2960648781 423
214 iso_pu_bacteria 2960652885 2960653739 423
215 iso_pu_bacteria 2960660292 2960662329 423
216 iso_pu_bacteria 2960667422 2960673872 423
217 iso_pu_bacteria 2960674078 2960676842 423
218 iso_pu_bacteria 2960680706 2960684116 423
219 iso_pu_bacteria 2960687367 2960688890 423
220 iso_pu_bacteria 2960693952 2960696327 423
221 iso_pu_bacteria 2964607997 2964613001 423
222 iso_pu_bacteria 2964615318 2964617629 423
223 iso_pu_bacteria 2964621998 2964627894 423
224 iso_pu_bacteria 2964628898 2964633170 423
225 iso_pu_bacteria 2964636051 2964642208 423
226 iso_pu_bacteria 2964643177 2964648757 423
227 iso_pu_bacteria 2964649959 2964653049 423
228 iso_pu_bacteria 2964656573 2964661081 423
229 iso_pu_bacteria 2964663802 2964666026 423
230 iso_pu_bacteria 2964670856 2964671786 423
231 iso_pu_bacteria 2964678106 2964684475 423
232 iso_pu_bacteria 2964685014 2964685409 423
233 iso_pu_bacteria 2964691889 2964695788 423
234 iso_pu_bacteria 2964698721 2964699552 423
235 iso_pu_bacteria 2964705432 2964712375 423
236 iso_pu_bacteria 2964712639 2964718482 423
237 iso_pu_bacteria 2964719344 2964725776 423
238 iso_pu_bacteria 2967664464 2967667317 423
239 iso_pu_bacteria 2967671571 2967672197 423
240 iso_pu_bacteria 2967678726 2967678871 423
241 iso_pu_bacteria 2967686174 2967686369 423
242 iso_pu_bacteria 2967693043 2967693192 423
243 iso_pu_bacteria 2967699805 2967701767 423
244 iso_pu_bacteria 2967706974 2967709220 423
245 iso_pu_bacteria 2967714385 2967716583 423
246 iso_pu_bacteria 2967721400 2967724805 423
247 iso_pu_bacteria 2967728569 2967734781 423
248 iso_pu_bacteria 2967735183 2967740951 423
249 iso_pu_bacteria 2967742019 2967742320 423
250 iso_pu_bacteria 2967748971 2967752158 423
251 iso_pu_bacteria 2967755722 2967757681 423
252 iso_pu_bacteria 2967762386 2967763766 423
253 iso_pu_bacteria 2967769361 2967774413 423
254 iso_pu_bacteria 2967775926 2967777179 423
255 iso_pu_bacteria 2970019648 2970026017 423
256 iso_pu_bacteria 2970026789 2970032864 423
257 iso_pu_bacteria 2970033650 2970037182 423
258 iso_pu_bacteria 2970040964 2970043338 423
259 iso_pu_bacteria 2970047711 2970049972 423
260 iso_pu_bacteria 2970054988 2970059661 423
261 iso_pu_bacteria 2970061556 2970065348 423
262 iso_pu_bacteria 2970068827 2970074028 423
263 iso_pu_bacteria 2970076120 2970077021 423
264 iso_pu_bacteria 2970082768 2970085700 423
265 iso_pu_bacteria 2970088815 2970093255 423
266 iso_pu_bacteria 2970095765 2970101657 423
267 iso_pu_bacteria 2970102677 2970108511 423
268 iso_pu_bacteria 2970109326 2970109872 423
269 iso_pu_bacteria 2970116247 2970118021 423
270 iso_pu_bacteria 2970122695 2970128225 423
271 iso_pu_bacteria 2970129317 2970129465 423
272 iso_pu_bacteria 2970136068 2970136974 423
273 iso_pu_bacteria 2970143518 2970149097 423
274 iso_pu_bacteria 2970149975 2970153867 423
275 iso_pu_bacteria 2970156795 2970162397 423
276 iso_pu_bacteria 2970164137 2970167451 423
277 iso_pu_bacteria 2970170962 2970171740 423
278 iso_pu_bacteria 2970177841 2970179222 423
279 iso_pu_bacteria 2970184632 2970189409 423
280 iso_pu_bacteria 2970191845 2970198377 423
281 iso_pu_bacteria 2977516862 2977520904 423
282 iso_pu_bacteria 2977523885 2977527222 423
283 iso_pu_bacteria 2977537788 2977537936 423
284 iso_pu_bacteria 2977544691 2977544885 423
285 iso_pu_bacteria 2977551784 2977551933 423
286 iso_pu_bacteria 2977558990 2977563145 423
287 iso_pu_bacteria 2977565890 2977568896 423
288 iso_pu_bacteria 2977572785 2977579014 423
289 iso_pu_bacteria 2977579622 2977581547 423
290 iso_pu_bacteria 643692032 643825000 423
291 iso_pu_bacteria 648276728 648740550 423
292 iso_pu_bacteria 8003992118 8003992810 423
293 iso_pu_bacteria 8003999396 8004000136 423
294 iso_pu_bacteria 8049293176 8049293830 423
295 3300005262 Ga0065165_1001548 Ga0065165_100154810 424
296 3300005548 Ga0070665_100002410 Ga0070665_10000241016 424
297 3300025304 Ga0209257_1001790 Ga0209257_100179025 424
298 3300031456 Ga0307513_10014591 Ga0307513_100145911 424
299 3300032004 Ga0307414_10002909 Ga0307414_100029098 424
300 3300038705 Ga0237819_00516 Ga0237819_00516_9934_11235 424
301 3300039145 Ga0237816_01893 Ga0237816_01893_280_1581 424
302 3300046471 Ga0495650_0000461 Ga0495650_0000461_17983_19284 424
303 3300046506 Ga0495583_0008848 Ga0495583_0008848_2132_3433 424
304 3300046558 Ga0495633_0008112 Ga0495633_0008112_1841_3142 424
305 3300047472 Ga0495686_0000238 Ga0495686_0000238_53390_54712 424
306 3300053119 Ga0500595_004324 Ga0500595_004324_4575_5879 424
307 3300053157 Ga0500624_000161 Ga0500624_000161_19426_20745 424
308 3300041404 Ga0439436_0025113 Ga0439436_0025113_404_1687 425
309 3300045051 Ga0451576_0025375 Ga0451576_0025375_4099_5457 425
310 3300053156 Ga0500622_0001161 Ga0500622_0001161_15977_17344 425
311 iso_pu_bacteria 2509276021 2509387828 425
312 iso_pu_bacteria 2509276033 2509443446 425
313 iso_pu_bacteria 2510065019 2510132192 425
314 iso_pu_bacteria 2510461069 2510840978 425
315 iso_pu_bacteria 2510461076 2510898526 425
316 iso_pu_bacteria 2510917022 2511133601 425
317 iso_pu_bacteria 2510917026 2511171853 425
318 iso_pu_bacteria 2510917028 2511182129 425
319 iso_pu_bacteria 2510917030 2511199581 425
320 iso_pu_bacteria 2511231027 2511390381 425
321 iso_pu_bacteria 2513237084 2513569026 425
322 iso_pu_bacteria 2513237085 2513580053 425
323 iso_pu_bacteria 2513237088 2513596142 425
324 iso_pu_bacteria 2513237093 2513635680 425
325 iso_pu_bacteria 2513237103 2513709315 425
326 iso_pu_bacteria 2513237138 2513865732 425
327 iso_pu_bacteria 2513237144 2513907633 425
328 iso_pu_bacteria 2513237146 2513925603 425
329 iso_pu_bacteria 2513237159 2513999462 425
330 iso_pu_bacteria 2513237162 2514023108 425
331 iso_pu_bacteria 2515075009 2515111172 425
332 iso_pu_bacteria 2515154113 2515636040 425
333 iso_pu_bacteria 2515154114 2515642692 425
334 iso_pu_bacteria 2515154116 2515658791 425
335 iso_pu_bacteria 2515154134 2515743897 425
336 iso_pu_bacteria 2516653077 2517039817 425
337 iso_pu_bacteria 2516653085 2517075339 425
338 iso_pu_bacteria 2517093000 2517093943 425
339 iso_pu_bacteria 2517287029 2517405758 425
340 iso_pu_bacteria 2524023209 2524457913 425
341 iso_pu_bacteria 2529292951 2530644003 425
342 iso_pu_bacteria 2534681796 2535515611 425
343 iso_pu_bacteria 2558860983 2561465974 425
344 iso_pu_bacteria 2582581283 2585165457 425
345 iso_pu_bacteria 2582581294 2585202976 425
346 iso_pu_bacteria 2582581298 2585220876 425
347 iso_pu_bacteria 2582581299 2585230517 425
348 iso_pu_bacteria 2582581304 2585256710 425
349 iso_pu_bacteria 2582581306 2585266281 425
350 iso_pu_bacteria 2582581307 2585275752 425
351 iso_pu_bacteria 2582581308 2585278801 425
352 iso_pu_bacteria 2582581315 2585325585 425
353 iso_pu_bacteria 2582581316 2585329740 425
354 iso_pu_bacteria 2582581865 2585387282 425
355 iso_pu_bacteria 2582581866 2585397785 425
356 iso_pu_bacteria 2582581867 2585400253 425
357 iso_pu_bacteria 2585427526 2585525530 425
358 iso_pu_bacteria 2585427527 2585535911 425
359 iso_pu_bacteria 2585427528 2585543823 425
360 iso_pu_bacteria 2585427529 2585550025 425
361 iso_pu_bacteria 2585427530 2585554006 425
362 iso_pu_bacteria 2585427531 2585559329 425
363 iso_pu_bacteria 2585427590 2585822977 425
364 iso_pu_bacteria 2585427593 2585839310 425
365 iso_pu_bacteria 2585427594 2585847313 425
366 iso_pu_bacteria 2585427608 2585901204 425
367 iso_pu_bacteria 2585427609 2585905294 425
368 iso_pu_bacteria 2585427633 2585994989 425
369 iso_pu_bacteria 2585427634 2585999531 425
370 iso_pu_bacteria 2585428125 2587979591 425
371 iso_pu_bacteria 2599185156 2599333883 425
372 iso_pu_bacteria 2599185170 2599418698 425
373 iso_pu_bacteria 2599185236 2599724217 425
374 iso_pu_bacteria 2599185352 2600191843 425
375 iso_pu_bacteria 2600254933 2600375171 425
376 iso_pu_bacteria 2615840626 2616305925 425
377 iso_pu_bacteria 2615840698 2616553830 425
378 iso_pu_bacteria 2617270742 2617381924 425
379 iso_pu_bacteria 2643221557 2643807295 425
380 iso_pu_bacteria 2643221558 2643810092 425
381 iso_pu_bacteria 2643221568 2643855990 425
382 iso_pu_bacteria 2643221599 2644007818 425
383 iso_pu_bacteria 2643221607 2644046676 425
384 iso_pu_bacteria 2643221610 2644069707 425
385 iso_pu_bacteria 2643221618 2644109086 425
386 iso_pu_bacteria 2643221626 2644151606 425
387 iso_pu_bacteria 2643221634 2644191079 425
388 iso_pu_bacteria 2643221636 2644202383 425
389 iso_pu_bacteria 2643221637 2644206299 425
390 iso_pu_bacteria 2643221643 2644242786 425
391 iso_pu_bacteria 2643221653 2644296947 425
392 iso_pu_bacteria 2643221655 2644311742 425
393 iso_pu_bacteria 2643221659 2644330013 425
394 iso_pu_bacteria 2643221668 2644380678 425
395 iso_pu_bacteria 2643221675 2644414583 425
396 iso_pu_bacteria 2643221680 2644448240 425
397 iso_pu_bacteria 2643221686 2644479465 425
398 iso_pu_bacteria 2643221688 2644493487 425
399 iso_pu_bacteria 2643221689 2644500906 425
400 iso_pu_bacteria 2643221698 2644543233 425
401 iso_pu_bacteria 2643221712 2644617540 425
402 iso_pu_bacteria 2643221718 2644649947 425
403 iso_pu_bacteria 2643221719 2644655201 425
404 iso_pu_bacteria 2643221723 2644673640 425
405 iso_pu_bacteria 2643221726 2644689453 425
406 iso_pu_bacteria 2667528174 2671112757 425
407 iso_pu_bacteria 2718217927 2719384745 425
408 iso_pu_bacteria 2718217997 2719664505 425
409 iso_pu_bacteria 2718218009 2719730897 425
410 iso_pu_bacteria 2718218199 2720490925 425
411 iso_pu_bacteria 2718218232 2720612289 425
412 iso_pu_bacteria 2718218233 2720619127 425
413 iso_pu_bacteria 2718218235 2720630529 425
414 iso_pu_bacteria 2718218269 2720774222 425
415 iso_pu_bacteria 2718218363 2721146241 425
416 iso_pu_bacteria 2718218365 2721157762 425
417 iso_pu_bacteria 2718218366 2721163121 425
418 iso_pu_bacteria 2718218423 2721398456 425
419 iso_pu_bacteria 2721755514 2722839291 425
420 iso_pu_bacteria 2721755556 2723025947 425
421 iso_pu_bacteria 2721755684 2723559493 425
422 iso_pu_bacteria 2721755685 2723566110 425
423 iso_pu_bacteria 2721755809 2724037269 425
424 iso_pu_bacteria 2721755810 2724043653 425
425 iso_pu_bacteria 2721755819 2724088829 425
426 iso_pu_bacteria 2721755822 2724103375 425
427 iso_pu_bacteria 2721755823 2724109213 425
428 iso_pu_bacteria 2724679232 2725951080 425
429 iso_pu_bacteria 2728369352 2730106883 425
430 iso_pu_bacteria 2728369365 2730163385 425
431 iso_pu_bacteria 2728369397 2730297394 425
432 iso_pu_bacteria 2738541293 2738803638 425
433 iso_pu_bacteria 2738541317 2738948795 425
434 iso_pu_bacteria 2738541333 2739039068 425
435 iso_pu_bacteria 2765235802 2765466322 425
436 iso_pu_bacteria 2765235942 2766067714 425
437 iso_pu_bacteria 2767802442 2770198957 425
438 iso_pu_bacteria 2775506902 2776270217 425
439 iso_pu_bacteria 2775506904 2776285056 425
440 iso_pu_bacteria 2775507049 2776912651 425
441 iso_pu_bacteria 2775507266 2778177360 425
442 iso_pu_bacteria 2791355253 2793282834 425
443 iso_pu_bacteria 2791355256 2793299746 425
444 iso_pu_bacteria 2791355259 2793316917 425
445 iso_pu_bacteria 2791355261 2793329346 425
446 iso_pu_bacteria 2791355262 2793336149 425
447 iso_pu_bacteria 2791355263 2793339909 425
448 iso_pu_bacteria 2791355264 2793350081 425
449 iso_pu_bacteria 2791355265 2793353463 425
450 iso_pu_bacteria 2791355266 2793358785 425
451 iso_pu_bacteria 2791355267 2793370495 425
452 iso_pu_bacteria 2802429605 2805930413 425
453 iso_pu_bacteria 2802429606 2805936163 425
454 iso_pu_bacteria 2802429633 2806049487 425
455 iso_pu_bacteria 2802429634 2806056582 425
456 iso_pu_bacteria 2802429635 2806063640 425
457 iso_pu_bacteria 2802429636 2806067637 425
458 iso_pu_bacteria 2802429637 2806077977 425
459 iso_pu_bacteria 2818991272 2819242662 425
460 iso_pu_bacteria 2818991448 2819613643 425
461 iso_pu_bacteria 2818991453 2819639354 425
462 iso_pu_bacteria 2818991461 2819684267 425
463 iso_pu_bacteria 2821123053 2821124144 425
464 iso_pu_bacteria 2838016132 2838017174 425
465 iso_pu_bacteria 2838022645 2838026922 425
466 iso_pu_bacteria 2838029111 2838031309 425
467 iso_pu_bacteria 2838035591 2838037611 425
468 iso_pu_bacteria 2838042994 2838047043 425
469 iso_pu_bacteria 2838048938 2838049342 425
470 iso_pu_bacteria 2838061910 2838067231 425
471 iso_pu_bacteria 2838068647 2838073221 425
472 iso_pu_bacteria 2838661181 2838662619 425
473 iso_pu_bacteria 2838668709 2838670742 425
474 iso_pu_bacteria 2838680041 2838681210 425
475 iso_pu_bacteria 2838686498 2838688744 425
476 iso_pu_bacteria 2838694306 2838694756 425
477 iso_pu_bacteria 2838701080 2838703113 425
478 iso_pu_bacteria 2838707686 2838708133 425
479 iso_pu_bacteria 2838729681 2838731039 425
480 iso_pu_bacteria 2838736955 2838738832 425
481 iso_pu_bacteria 2838742623 2838744067 425
482 iso_pu_bacteria 2839993093 2839998337 425
483 iso_pu_bacteria 2840764183 2840765930 425
484 iso_pu_bacteria 2841840854 2841842731 425
485 iso_pu_bacteria 2841851746 2841856967 425
486 iso_pu_bacteria 2841864319 2841870404 425
487 iso_pu_bacteria 2842077413 2842080635 425
488 iso_pu_bacteria 2842110456 2842116004 425
489 iso_pu_bacteria 2842118031 2842121254 425
490 iso_pu_bacteria 2842140634 2842142511 425
491 iso_pu_bacteria 2842146304 2842147663 425
492 iso_pu_bacteria 2842156927 2842159918 425
493 iso_pu_bacteria 2842163707 2842168161 425
494 iso_pu_bacteria 2842180545 2842183465 425
495 iso_pu_bacteria 2842192696 2842193547 425
496 iso_pu_bacteria 2842198810 2842202526 425
497 iso_pu_bacteria 2842205361 2842207804 425
498 iso_pu_bacteria 2842217011 2842220694 425
499 iso_pu_bacteria 2842229732 2842234055 425
500 iso_pu_bacteria 2842237096 2842237545 425
501 iso_pu_bacteria 2842243621 2842245531 425
502 iso_pu_bacteria 2842250916 2842252729 425
503 iso_pu_bacteria 2842257432 2842259819 425
504 iso_pu_bacteria 2842264693 2842269228 425
505 iso_pu_bacteria 2842271015 2842274658 425
506 iso_pu_bacteria 2842278818 2842281401 425
507 iso_pu_bacteria 2842285085 2842287227 425
508 iso_pu_bacteria 2842291075 2842294292 425
509 iso_pu_bacteria 2842298080 2842300469 425
510 iso_pu_bacteria 2842304105 2842306903 425
511 iso_pu_bacteria 2842311132 2842314565 425
512 iso_pu_bacteria 2842317721 2842318757 425
513 iso_pu_bacteria 2842341865 2842343712 425
514 iso_pu_bacteria 2842357229 2842358413 425
515 iso_pu_bacteria 2842363717 2842365060 425
516 iso_pu_bacteria 2842370503 2842371673 425
517 iso_pu_bacteria 2842377471 2842380689 425
518 iso_pu_bacteria 2842384541 2842387760 425
519 iso_pu_bacteria 2842395702 2842400845 425
520 iso_pu_bacteria 2842402390 2842404495 425
521 iso_pu_bacteria 2842409023 2842410820 425
522 iso_pu_bacteria 2842415677 2842417724 425
523 iso_pu_bacteria 2842422224 2842426606 425
524 iso_pu_bacteria 2842428310 2842433289 425
525 iso_pu_bacteria 2842434925 2842439714 425
526 iso_pu_bacteria 2842441272 2842446343 425
527 iso_pu_bacteria 2842447887 2842453481 425
528 iso_pu_bacteria 2842462802 2842467611 425
529 iso_pu_bacteria 2842469257 2842474226 425
530 iso_pu_bacteria 2842475841 2842478096 425
531 iso_pu_bacteria 2842482326 2842482748 425
532 iso_pu_bacteria 2842489311 2842494870 425
533 iso_pu_bacteria 2842495871 2842497392 425
534 iso_pu_bacteria 2842502639 2842504905 425
535 iso_pu_bacteria 2842509118 2842509620 425
536 iso_pu_bacteria 2842521101 2842525255 425
537 iso_pu_bacteria 2842871566 2842872350 425
538 iso_pu_bacteria 2842922631 2842923718 425
539 iso_pu_bacteria 2844163670 2844163909 425
540 iso_pu_bacteria 2844454524 2844455269 425
541 iso_pu_bacteria 2852387548 2852388960 425
542 iso_pu_bacteria 2854896431 2854898772 425
543 iso_pu_bacteria 2854916844 2854921644 425
544 iso_pu_bacteria 2857516855 2857520403 425
545 iso_pu_bacteria 2857531043 2857531725 425
546 iso_pu_bacteria 2891373044 2891376580 425
547 iso_pu_bacteria 2894652903 2894654985 425
548 iso_pu_bacteria 2899803654 2899806098 425
549 iso_pu_bacteria 2904578770 2904582312 425
550 iso_pu_bacteria 2913308742 2913311065 425
551 iso_pu_bacteria 2919100787 2919103714 425
552 iso_pu_bacteria 2919119836 2919122898 425
553 iso_pu_bacteria 2919166419 2919167244 425
554 iso_pu_bacteria 2919171160 2919171554 425
555 iso_pu_bacteria 2919408235 2919409196 425
556 iso_pu_bacteria 2920822456 2920823761 425
557 iso_pu_bacteria 2923556063 2923557682 425
558 iso_pu_bacteria 2928521798 2928524249 425
559 iso_pu_bacteria 2929138655 2929139332 425
560 iso_pu_bacteria 2933016740 2933018763 425
561 iso_pu_bacteria 2933570622 2933572982 425
562 iso_pu_bacteria 2933586486 2933592037 425
563 iso_pu_bacteria 2933599457 2933603414 425
564 iso_pu_bacteria 2935894831 2935895279 425
565 iso_pu_bacteria 2935901341 2935904266 425
566 iso_pu_bacteria 2936367885 2936368236 425
567 iso_pu_bacteria 2936375103 2936378891 425
568 iso_pu_bacteria 2936381700 2936386823 425
569 iso_pu_bacteria 2941499720 2941500307 425
570 iso_pu_bacteria 2954011201 2954013199 425
571 iso_pu_bacteria 2978969890 2978973677 425
572 iso_pu_bacteria 2984587000 2984591951 425
573 iso_pu_bacteria 2989349275 2989354283 425
574 iso_pu_bacteria 2989776772 2989778071 425
575 iso_pu_bacteria 2996887358 2996890861 425
576 iso_pu_bacteria 2996893221 2996895402 425
577 iso_pu_bacteria 3002141150 3002146180 425
578 iso_pu_bacteria 3005409236 3005412287 425
579 iso_pu_bacteria 3005416602 3005417036 425
580 iso_pu_bacteria 3005445848 3005446652 425
581 iso_pu_bacteria 3005452660 3005453336 425
582 iso_pu_bacteria 639633055 639647328 425
583 iso_pu_bacteria 8005246636 8005246685 425
584 iso_pu_bacteria 8005258706 8005262115 425
585 iso_pu_bacteria 8005275841 8005279463 425
586 iso_pu_bacteria 8005282627 8005287104 425
587 iso_pu_bacteria 8005289223 8005292687 425
588 iso_pu_bacteria 8005301065 8005304457 425
589 iso_pu_bacteria 8005307578 8005309038 425
590 iso_pu_bacteria 8005314921 8005315097 425
591 iso_pu_bacteria 8005321885 8005325388 425
592 iso_pu_bacteria 8005376324 8005376725 425
593 iso_pu_bacteria 8005382845 8005386108 425
594 iso_pu_bacteria 8005395548 8005397494 425
595 iso_pu_bacteria 8005430974 8005435410 425
596 iso_pu_bacteria 8005460587 8005461813 425
597 iso_pu_bacteria 8005484373 8005485732 425
598 iso_pu_bacteria 8005497431 8005499220 425
599 iso_pu_bacteria 8005542996 8005544241 425
600 iso_pu_bacteria 8005556819 8005563028 425
601 iso_pu_bacteria 8005563573 8005570325 425
602 iso_pu_bacteria 8005570704 8005574054 425
603 iso_pu_bacteria 8005619151 8005620413 425
604 iso_pu_bacteria 8005626139 8005629036 425
605 iso_pu_bacteria 8005645114 8005648124 425
606 iso_pu_bacteria 8005658619 8005660070 425
607 iso_pu_bacteria 8005668836 8005670636 425
608 iso_pu_bacteria 8005682033 8005684706 425
609 iso_pu_bacteria 8005688590 8005690878 425
610 iso_pu_bacteria 8005695170 8005698904 425
611 iso_pu_bacteria 8018127388 8018131184 425
612 iso_pu_bacteria 8018150411 8018153760 425
613 iso_pu_bacteria 8018163183 8018168287 425
614 iso_pu_bacteria 8018176218 8018177364 425
615 iso_pu_bacteria 8023680758 8023687110 425
616 iso_pu_bacteria 8024479707 8024480992 425
617 iso_pu_bacteria 8024486573 8024489853 425
618 iso_pu_bacteria 8024501048 8024503369 425
619 iso_pu_bacteria 8046767195 8046767562 425
620 iso_pu_bacteria 8054460903 8054461784 425
621 iso_pu_bacteria 8054558443 8054558764 425
622 iso_pu_bacteria 8055431914 8055434070 425
623 iso_pu_bacteria 8056375014 8056379456 425
624 iso_pu_bacteria 8056382006 8056384864 425
625 iso_pu_bacteria 8056875544 8056880026 425
626 iso_pu_bacteria 8057575449 8057579091 425
627 iso_pu_bacteria 8057874678 8057879632 425
628 3300006946 Ga0079104_1002175 Ga0079104_10021756 427
629 3300006946 Ga0079104_1010103 Ga0079104_10101032 427
630 3300021320 Ga0214544_1000008 Ga0214544_100000839 427
631 3300021321 Ga0214542_1008369 Ga0214542_10083696 427
632 3300021321 Ga0214542_1010138 Ga0214542_10101388 427
633 3300021327 Ga0214543_1000003 Ga0214543_1000003386 427
634 3300021327 Ga0214543_1000004 Ga0214543_100000417 427
635 3300022739 Ga0228711_1000001 Ga0228711_1000001160 427
636 3300022740 Ga0228710_1000001 Ga0228710_1000001164 427
637 3300027111 Ga0209281_1000164 Ga0209281_100016465 427
638 3300027111 Ga0209281_1000377 Ga0209281_100037718 427
639 3300027666 Ga0209282_1000007 Ga0209282_100000791 427
640 3300031251 Ga0265327_10000778 Ga0265327_1000077851 427
641 3300031251 Ga0265327_10024281 Ga0265327_100242812 427
642 3300031344 Ga0265316_10006286 Ga0265316_1000628612 427
643 3300031852 Ga0307410_10095821 Ga0307410_100958211 427
644 3300031967 Ga0315914_1000006 Ga0315914_1000006151 427
645 3300033430 Ga0315913_1000002 Ga0315913_100000291 427
646 3300033464 Ga0315915_1000001 Ga0315915_1000001395 427
647 3300042007 Ga0439449_0006077 Ga0439449_0006077_1833_3179 427
648 3300048919 Ga0496116_0000036 Ga0496116_0000036_153760_155052 427
649 3300048929 Ga0496126_0000597 Ga0496126_0000597_62037_63329 427
650 3300049571 Ga0501034_0003022 Ga0501034_0003022_5166_6461 427
651 iso_pu_bacteria 2537561587 2537877064 427
652 iso_pu_bacteria 2554235003 2554247015 427
653 iso_pu_bacteria 2558860242 2559294240 427
654 iso_pu_bacteria 2599185210 2599603425 427
655 iso_pu_bacteria 2600255279 2601608776 427
656 iso_pu_bacteria 2600255308 2601745550 427
657 iso_pu_bacteria 2643221582 2643918611 427
658 iso_pu_bacteria 2643221693 2644518844 427
659 iso_pu_bacteria 2808606387 2808985984 427
660 iso_pu_bacteria 2818991439 2819556106 427
661 iso_pu_bacteria 2838675328 2838676832 427
662 iso_pu_bacteria 2838714209 2838715716 427
663 iso_pu_bacteria 2838719591 2838720483 427
664 iso_pu_bacteria 2838724970 2838726472 427
665 iso_pu_bacteria 2841846520 2841847413 427
666 iso_pu_bacteria 2841859092 2841860048 427
667 iso_pu_bacteria 2842124991 2842126557 427
668 iso_pu_bacteria 2842130223 2842131725 427
669 iso_pu_bacteria 2842152218 2842153106 427
670 iso_pu_bacteria 2842170452 2842171960 427
671 iso_pu_bacteria 2842175837 2842176725 427
672 iso_pu_bacteria 2842187318 2842188825 427
673 iso_pu_bacteria 2842211629 2842213136 427
674 iso_pu_bacteria 2842224351 2842225245 427
675 iso_pu_bacteria 2842515876 2842516833 427
676 iso_pu_bacteria 2899792073 2899792116 427
677 iso_pu_bacteria 2899845264 2899846306 427
678 iso_pu_bacteria 2919114240 2919115919 427
679 iso_pu_bacteria 2926754445 2926756873 427
680 iso_pu_bacteria 2926760298 2926761098 427
681 iso_pu_bacteria 2933006813 2933007749 427
682 iso_pu_bacteria 2933011516 2933012525 427
683 iso_pu_bacteria 2933594066 2933594964 427
684 iso_pu_bacteria 2979089926 2979093619 427
685 iso_pu_bacteria 2979095461 2979098994 427
686 iso_pu_bacteria 2979100975 2979105598 427
687 iso_pu_bacteria 2984509177 2984512555 427
688 iso_pu_bacteria 2984518228 2984521084 427
689 iso_pu_bacteria 2984537506 2984540378 427
690 iso_pu_bacteria 2984601300 2984602575 427
691 iso_pu_bacteria 650716007 650739431 427
692 iso_pu_bacteria 8003570095 8003570473 427
693 3300005458 Ga0070681_10111950 Ga0070681_101119502 428
694 3300009174 Ga0105241_10007637 Ga0105241_100076378 428
695 3300009551 Ga0105238_10019957 Ga0105238_100199573 428
696 3300049570 Ga0501033_0000038 Ga0501033_0000038_29165_30451 428
697 3300049822 Ga0501035_0000326 Ga0501035_0000326_31474_32760 428
698 3300001979 JGI24740J21852_10000602 JGI24740J21852_100006027 429
699 3300002704 JGI25155J39150_1000072 JGI25155J39150_100007244 429
700 3300002705 JGI25156J39149_1000086 JGI25156J39149_100008648 429
701 3300002737 JGI25162J39368_1000956 JGI25162J39368_10009569 429
702 3300002737 JGI25162J39368_1001709 JGI25162J39368_10017096 429
703 3300002738 JGI25154J39366_1000205 JGI25154J39366_100020513 429
704 3300002741 JGI25157J39369_1000113 JGI25157J39369_100011348 429
705 3300002773 JGI25152J39213_1000959 JGI25152J39213_10009594 429
706 3300002774 JGI25150J39212_1000031 JGI25150J39212_100003122 429
707 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001312 429
708 3300002987 JGI25159J45721_1000064 JGI25159J45721_100006449 429
709 3300002987 JGI25159J45721_1001419 JGI25159J45721_10014194 429
710 3300003187 JGI25151J46595_10000062 JGI25151J46595_10000062102 429
711 3300003187 JGI25151J46595_10007169 JGI25151J46595_100071695 429
712 3300003187 JGI25151J46595_10018956 JGI25151J46595_100189562 429
713 3300003214 JGI25165J46597_1001014 JGI25165J46597_10010149 429
714 3300003214 JGI25165J46597_1001037 JGI25165J46597_10010378 429
715 3300003215 JGI25153J46596_10000312 JGI25153J46596_1000031216 429
716 3300003215 JGI25153J46596_10005340 JGI25153J46596_100053405 429
717 3300003322 rootL2_10113901 rootL2_101139012 429
718 3300003323 rootH1_10015315 rootH1_100153152 429
719 3300003354 JGI25160J50197_1000002 JGI25160J50197_10000022 429
720 3300003354 JGI25160J50197_1000052 JGI25160J50197_100005214 429
721 3300003354 JGI25160J50197_1024650 JGI25160J50197_10246501 429
722 3300003374 JGI25161J50226_1000073 JGI25161J50226_100007366 429
723 3300003374 JGI25161J50226_1000153 JGI25161J50226_100015348 429
724 3300003374 JGI25161J50226_1003967 JGI25161J50226_10039671 429
725 3300003771 Ga0055526_1002168 Ga0055526_10021689 429
726 3300003771 Ga0055526_1003266 Ga0055526_10032662 429
727 3300003771 Ga0055526_1003657 Ga0055526_10036572 429
728 3300003771 Ga0055526_1005117 Ga0055526_10051177 429
729 3300003771 Ga0055526_1014304 Ga0055526_10143043 429
730 3300003771 Ga0055526_1015152 Ga0055526_10151522 429
731 3300003771 Ga0055526_1020618 Ga0055526_10206182 429
732 3300003775 Ga0055524_1003026 Ga0055524_10030262 429
733 3300003775 Ga0055524_1005073 Ga0055524_10050732 429
734 3300003775 Ga0055524_1006865 Ga0055524_10068651 429
735 3300003775 Ga0055524_1017546 Ga0055524_10175461 429
736 3300003781 Ga0055536_1000427 Ga0055536_100042724 429
737 3300003781 Ga0055536_1005875 Ga0055536_10058754 429
738 3300003790 Ga0055528_1000097 Ga0055528_100009755 429
739 3300003790 Ga0055528_1000413 Ga0055528_100041317 429
740 3300003792 Ga0055540_1000234 Ga0055540_100023429 429
741 3300003792 Ga0055540_1003105 Ga0055540_10031059 429
742 3300004625 Ga0055543_1000035 Ga0055543_1000035108 429
743 3300004625 Ga0055543_1001724 Ga0055543_10017247 429
744 3300005262 Ga0065165_1000004 Ga0065165_1000004380 429
745 3300005262 Ga0065165_1001373 Ga0065165_100137314 429
746 3300005262 Ga0065165_1006808 Ga0065165_10068081 429
747 3300005262 Ga0065165_1010060 Ga0065165_10100602 429
748 3300005327 Ga0070658_10015409 Ga0070658_100154093 429
749 3300005327 Ga0070658_10016053 Ga0070658_100160534 429
750 3300005327 Ga0070658_10165504 Ga0070658_101655042 429
751 3300005331 Ga0070670_100000347 Ga0070670_10000034734 429
752 3300005355 Ga0070671_100025768 Ga0070671_1000257682 429
753 3300005366 Ga0070659_100028862 Ga0070659_1000288622 429
754 3300005530 Ga0070679_100012408 Ga0070679_1000124084 429
755 3300005535 Ga0070684_100036084 Ga0070684_1000360844 429
756 3300005548 Ga0070665_100196685 Ga0070665_1001966852 429
757 3300005563 Ga0068855_100010543 Ga0068855_1000105433 429
758 3300005577 Ga0068857_100178708 Ga0068857_1001787081 429
759 3300005614 Ga0068856_100018126 Ga0068856_1000181266 429
760 3300005614 Ga0068856_100046094 Ga0068856_1000460943 429
761 3300005614 Ga0068856_100199246 Ga0068856_1001992462 429
762 3300005616 Ga0068852_100024682 Ga0068852_1000246822 429
763 3300005616 Ga0068852_100038488 Ga0068852_1000384883 429
764 3300005834 Ga0068851_10005049 Ga0068851_100050495 429
765 3300006038 Ga0075365_10012052 Ga0075365_100120525 429
766 3300006042 Ga0075368_10015374 Ga0075368_100153742 429
767 3300006048 Ga0075363_100008956 Ga0075363_1000089562 429
768 3300006051 Ga0075364_10000177 Ga0075364_1000017715 429
769 3300006175 Ga0070712_100064141 Ga0070712_1000641412 429
770 3300006178 Ga0075367_10006431 Ga0075367_100064315 429
771 3300006178 Ga0075367_10007923 Ga0075367_100079232 429
772 3300006178 Ga0075367_10021879 Ga0075367_100218792 429
773 3300006186 Ga0075369_10023091 Ga0075369_100230912 429
774 3300006186 Ga0075369_10041985 Ga0075369_100419851 429
775 3300006195 Ga0075366_10004489 Ga0075366_100044896 429
776 3300006237 Ga0097621_100010551 Ga0097621_1000105517 429
777 3300006353 Ga0075370_10092350 Ga0075370_100923501 429
778 3300006358 Ga0068871_100052091 Ga0068871_1000520913 429
779 3300006948 Ga0099826_10000838 Ga0099826_1000083813 429
780 3300006948 Ga0099826_10085596 Ga0099826_100855962 429
781 3300009011 Ga0105251_10010972 Ga0105251_100109722 429
782 3300009093 Ga0105240_10000027 Ga0105240_10000027307 429
783 3300009093 Ga0105240_10011173 Ga0105240_100111736 429
784 3300009148 Ga0105243_10013570 Ga0105243_100135706 429
785 3300009177 Ga0105248_10004763 Ga0105248_100047633 429
786 3300009177 Ga0105248_10280267 Ga0105248_102802672 429
787 3300009545 Ga0105237_10004420 Ga0105237_100044208 429
788 3300009765 Ga0123341_1000006 Ga0123341_1000006123 429
789 3300009766 Ga0123342_1009880 Ga0123342_10098803 429
790 3300010375 Ga0105239_10010623 Ga0105239_100106235 429
791 3300013100 Ga0157373_10005723 Ga0157373_100057232 429
792 3300013102 Ga0157371_10000307 Ga0157371_1000030760 429
793 3300013104 Ga0157370_10000223 Ga0157370_100002234 429
794 3300013104 Ga0157370_10000577 Ga0157370_100005778 429
795 3300013105 Ga0157369_10000908 Ga0157369_1000090816 429
796 3300013105 Ga0157369_10109759 Ga0157369_101097592 429
797 3300013307 Ga0157372_10001580 Ga0157372_1000158016 429
798 3300015262 Ga0182007_10009549 Ga0182007_100095492 429
799 3300015265 Ga0182005_1001113 Ga0182005_10011135 429
800 3300015690 Ga0183363_1089 Ga0183363_108911 429
801 3300025206 Ga0209435_100036 Ga0209435_10003676 429
802 3300025208 Ga0209436_100047 Ga0209436_10004749 429
803 3300025208 Ga0209436_102304 Ga0209436_1023042 429
804 3300025228 Ga0209672_103187 Ga0209672_1031872 429
805 3300025233 Ga0209437_100033 Ga0209437_100033171 429
806 3300025233 Ga0209437_100036 Ga0209437_100036423 429
807 3300025245 Ga0207425_1000031 Ga0207425_1000031218 429
808 3300025245 Ga0207425_1001110 Ga0207425_10011102 429
809 3300025246 Ga0209646_1000132 Ga0209646_100013276 429
810 3300025250 Ga0209026_1000236 Ga0209026_100023613 429
811 3300025256 Ga0209759_1000269 Ga0209759_100026913 429
812 3300025258 Ga0209129_1000053 Ga0209129_1000053219 429
813 3300025258 Ga0209129_1000125 Ga0209129_100012597 429
814 3300025258 Ga0209129_1000611 Ga0209129_100061113 429
815 3300025258 Ga0209129_1001053 Ga0209129_10010538 429
816 3300025258 Ga0209129_1001178 Ga0209129_10011785 429
817 3300025258 Ga0209129_1001568 Ga0209129_10015682 429
818 3300025258 Ga0209129_1003548 Ga0209129_10035482 429
819 3300025261 Ga0209233_1000056 Ga0209233_1000056167 429
820 3300025261 Ga0209233_1000064 Ga0209233_1000064253 429
821 3300025261 Ga0209233_1000152 Ga0209233_10001529 429
822 3300025272 Ga0209455_1008421 Ga0209455_10084212 429
823 3300025273 Ga0209673_1000122 Ga0209673_1000122142 429
824 3300025273 Ga0209673_1000409 Ga0209673_100040919 429
825 3300025273 Ga0209673_1001508 Ga0209673_100150814 429
826 3300025273 Ga0209673_1001874 Ga0209673_10018746 429
827 3300025273 Ga0209673_1001941 Ga0209673_10019418 429
828 3300025273 Ga0209673_1002296 Ga0209673_10022964 429
829 3300025273 Ga0209673_1006574 Ga0209673_10065743 429
830 3300025284 Ga0209130_1000006 Ga0209130_1000006650 429
831 3300025284 Ga0209130_1000008 Ga0209130_1000008538 429
832 3300025284 Ga0209130_1015165 Ga0209130_10151652 429
833 3300025292 Ga0209676_1001841 Ga0209676_100184111 429
834 3300025292 Ga0209676_1012750 Ga0209676_10127503 429
835 3300025294 Ga0209025_1000087 Ga0209025_1000087218 429
836 3300025294 Ga0209025_1000100 Ga0209025_1000100124 429
837 3300025294 Ga0209025_1000165 Ga0209025_100016543 429
838 3300025294 Ga0209025_1000900 Ga0209025_100090046 429
839 3300025294 Ga0209025_1001226 Ga0209025_100122616 429
840 3300025294 Ga0209025_1001688 Ga0209025_10016886 429
841 3300025294 Ga0209025_1007426 Ga0209025_10074263 429
842 3300025294 Ga0209025_1012756 Ga0209025_10127562 429
843 3300025294 Ga0209025_1033604 Ga0209025_10336042 429
844 3300025295 Ga0209564_1000104 Ga0209564_1000104220 429
845 3300025295 Ga0209564_1000853 Ga0209564_100085323 429
846 3300025295 Ga0209564_1001099 Ga0209564_10010998 429
847 3300025295 Ga0209564_1001645 Ga0209564_100164515 429
848 3300025295 Ga0209564_1005387 Ga0209564_10053876 429
849 3300025297 Ga0209758_1000081 Ga0209758_1000081218 429
850 3300025297 Ga0209758_1000121 Ga0209758_1000121146 429
851 3300025297 Ga0209758_1000313 Ga0209758_100031348 429
852 3300025297 Ga0209758_1000624 Ga0209758_100062418 429
853 3300025297 Ga0209758_1003467 Ga0209758_10034676 429
854 3300025297 Ga0209758_1008055 Ga0209758_10080556 429
855 3300025297 Ga0209758_1014909 Ga0209758_10149092 429
856 3300025298 Ga0209050_1001263 Ga0209050_100126324 429
857 3300025298 Ga0209050_1012778 Ga0209050_10127782 429
858 3300025299 Ga0209256_1000351 Ga0209256_100035176 429
859 3300025299 Ga0209256_1001199 Ga0209256_100119913 429
860 3300025299 Ga0209256_1001393 Ga0209256_100139316 429
861 3300025299 Ga0209256_1001494 Ga0209256_100149416 429
862 3300025299 Ga0209256_1002645 Ga0209256_10026459 429
863 3300025299 Ga0209256_1003108 Ga0209256_10031089 429
864 3300025299 Ga0209256_1003692 Ga0209256_10036923 429
865 3300025299 Ga0209256_1008356 Ga0209256_10083562 429
866 3300025302 Ga0207426_1000016 Ga0207426_100001624 429
867 3300025302 Ga0207426_1000044 Ga0207426_100004413 429
868 3300025302 Ga0207426_1000106 Ga0207426_1000106227 429
869 3300025302 Ga0207426_1000743 Ga0207426_100074314 429
870 3300025302 Ga0207426_1001023 Ga0207426_100102315 429
871 3300025303 Ga0209051_1000339 Ga0209051_100033952 429
872 3300025303 Ga0209051_1000918 Ga0209051_10009182 429
873 3300025303 Ga0209051_1001825 Ga0209051_100182510 429
874 3300025303 Ga0209051_1014302 Ga0209051_10143023 429
875 3300025304 Ga0209257_1002795 Ga0209257_10027959 429
876 3300025304 Ga0209257_1002847 Ga0209257_10028472 429
877 3300025304 Ga0209257_1003481 Ga0209257_10034818 429
878 3300025909 Ga0207705_10029588 Ga0207705_100295883 429
879 3300025913 Ga0207695_10000024 Ga0207695_10000024322 429
880 3300025913 Ga0207695_10018654 Ga0207695_100186544 429
881 3300025913 Ga0207695_10025079 Ga0207695_100250794 429
882 3300025914 Ga0207671_10000986 Ga0207671_1000098625 429
883 3300025921 Ga0207652_10044177 Ga0207652_100441772 429
884 3300025923 Ga0207681_10113687 Ga0207681_101136872 429
885 3300025925 Ga0207650_10000567 Ga0207650_1000056721 429
886 3300025931 Ga0207644_10079078 Ga0207644_100790782 429
887 3300025941 Ga0207711_10036636 Ga0207711_100366362 429
888 3300026023 Ga0207677_10006032 Ga0207677_100060326 429
889 3300026078 Ga0207702_10164056 Ga0207702_101640561 429
890 3300026142 Ga0207698_10005638 Ga0207698_100056384 429
891 3300026142 Ga0207698_10028833 Ga0207698_100288332 429
892 3300027312 Ga0209371_1005859 Ga0209371_10058592 429
893 3300027666 Ga0209282_1000715 Ga0209282_10007156 429
894 3300027666 Ga0209282_1071011 Ga0209282_10710111 429
895 3300028379 Ga0268266_10032452 Ga0268266_100324524 429
896 3300028379 Ga0268266_10110435 Ga0268266_101104352 429
897 3300028794 Ga0307515_10000115 Ga0307515_10000115126 429
898 3300028794 Ga0307515_10001359 Ga0307515_1000135950 429
899 3300028794 Ga0307515_10002710 Ga0307515_1000271011 429
900 3300030500 Ga0268256_1005834 Ga0268256_10058342 429
901 3300030744 Ga0316181_1002016 Ga0316181_10020162 429
902 3300031456 Ga0307513_10008680 Ga0307513_100086805 429
903 3300031911 Ga0307412_10001806 Ga0307412_100018062 429
904 3300031911 Ga0307412_10079261 Ga0307412_100792612 429
905 3300035695 Ga0373927_0000780 Ga0373927_0000780_5984_7276 429
906 3300037471 Ga0395905_0007143 Ga0395905_0007143_9664_10956 429
907 3300037471 Ga0395905_0008439 Ga0395905_0008439_4691_6082 429
908 3300037471 Ga0395905_0127507 Ga0395905_0127507_867_2201 429
909 3300041406 Ga0439439_0021887 Ga0439439_0021887_269_1564 429
910 3300041413 Ga0439465_0017163 Ga0439465_0017163_222_1517 429
911 3300041413 Ga0439465_0020090 Ga0439465_0020090_11_1303 429
912 3300041494 Ga0451837_1135412 Ga0451837_1135412_155_1447 429
913 3300041496 Ga0451839_0324124 Ga0451839_0324124_438_1730 429
914 3300041997 Ga0439431_0013507 Ga0439431_0013507_313_1611 429
915 3300045051 Ga0451576_0244129 Ga0451576_0244129_370_1677 429
916 3300045836 Ga0466958_0014567 Ga0466958_0014567_2649_3983 429
917 3300046454 Ga0495592_0074268 Ga0495592_0074268_167_1456 429
918 3300046459 Ga0495629_0014314 Ga0495629_0014314_747_2036 429
919 3300046460 Ga0495638_0043878 Ga0495638_0043878_677_1969 429
920 3300046471 Ga0495650_0053217 Ga0495650_0053217_295_1587 429
921 3300046492 Ga0495585_0062382 Ga0495585_0062382_236_1528 429
922 3300046506 Ga0495583_0008582 Ga0495583_0008582_335_1627 429
923 3300046507 Ga0495606_0003594 Ga0495606_0003594_8707_9996 429
924 3300046507 Ga0495606_0029980 Ga0495606_0029980_1223_2512 429
925 3300046512 Ga0495610_0012464 Ga0495610_0012464_2305_3597 429
926 3300046515 Ga0495620_0047972 Ga0495620_0047972_325_1617 429
927 3300046518 Ga0495631_0027381 Ga0495631_0027381_586_1878 429
928 3300046519 Ga0495632_0002635 Ga0495632_0002635_10117_11409 429
929 3300046522 Ga0495643_0019999 Ga0495643_0019999_839_2131 429
930 3300046522 Ga0495643_0035161 Ga0495643_0035161_176_1471 429
931 3300046524 Ga0495648_0051940 Ga0495648_0051940_879_2171 429
932 3300046529 Ga0495652_0040107 Ga0495652_0040107_2011_3300 429
933 3300046530 Ga0495654_0000130 Ga0495654_0000130_54625_55917 429
934 3300046536 Ga0495587_0017692 Ga0495587_0017692_421_1710 429
935 3300046557 Ga0495622_0012970 Ga0495622_0012970_1950_3239 429
936 3300046660 Ga0495625_0077921 Ga0495625_0077921_940_2232 429
937 3300046665 Ga0495661_0106826 Ga0495661_0106826_234_1526 429
938 3300046675 Ga0495657_0033534 Ga0495657_0033534_1490_2779 429
939 3300046809 Ga0495600_0024098 Ga0495600_0024098_616_1905 429
940 3300047469 Ga0495673_0050131 Ga0495673_0050131_224_1516 429
941 3300047470 Ga0495681_0004767 Ga0495681_0004767_3008_4312 429
942 3300047470 Ga0495681_0058420 Ga0495681_0058420_432_1724 429
943 3300047472 Ga0495686_0000613 Ga0495686_0000613_511_1800 429
944 3300047472 Ga0495686_0012665 Ga0495686_0012665_545_1837 429
945 3300047472 Ga0495686_0128339 Ga0495686_0128339_31_1431 429
946 3300048903 Ga0496100_0187288 Ga0496100_0187288_188_1477 429
947 3300048905 Ga0496102_0023580 Ga0496102_0023580_638_1927 429
948 3300048907 Ga0496104_0238028 Ga0496104_0238028_28_1320 429
949 3300048909 Ga0496106_0001004 Ga0496106_0001004_9626_10921 429
950 3300048913 Ga0496110_0106678 Ga0496110_0106678_826_2127 429
951 3300048916 Ga0496113_0035330 Ga0496113_0035330_157_1497 429
952 3300048917 Ga0496114_0120299 Ga0496114_0120299_760_2052 429
953 3300048919 Ga0496116_0002976 Ga0496116_0002976_81_1373 429
954 3300048919 Ga0496116_0010396 Ga0496116_0010396_5585_6877 429
955 3300048919 Ga0496116_0017233 Ga0496116_0017233_728_2017 429
956 3300048919 Ga0496116_0100819 Ga0496116_0100819_81_1373 429
957 3300048920 Ga0496117_0000002 Ga0496117_0000002_1586783_1588123 429
958 3300048920 Ga0496117_0006548 Ga0496117_0006548_5363_6655 429
959 3300048920 Ga0496117_0007855 Ga0496117_0007855_6461_7750 429
960 3300048920 Ga0496117_0036258 Ga0496117_0036258_44_1348 429
961 3300048920 Ga0496117_0046076 Ga0496117_0046076_1470_2762 429
962 3300048920 Ga0496117_0051153 Ga0496117_0051153_1122_2414 429
963 3300048920 Ga0496117_0071672 Ga0496117_0071672_135_1427 429
964 3300048921 Ga0496118_0000084 Ga0496118_0000084_26544_27884 429
965 3300048921 Ga0496118_0000396 Ga0496118_0000396_28876_30165 429
966 3300048921 Ga0496118_0002631 Ga0496118_0002631_4517_5809 429
967 3300048921 Ga0496118_0006506 Ga0496118_0006506_11121_12413 429
968 3300048921 Ga0496118_0092593 Ga0496118_0092593_249_1541 429
969 3300048922 Ga0496119_0010878 Ga0496119_0010878_4449_5738 429
970 3300048922 Ga0496119_0019985 Ga0496119_0019985_3597_4889 429
971 3300048922 Ga0496119_0032929 Ga0496119_0032929_1378_2718 429
972 3300048922 Ga0496119_0051426 Ga0496119_0051426_494_1786 429
973 3300048923 Ga0496120_0000087 Ga0496120_0000087_146483_147823 429
974 3300048923 Ga0496120_0004845 Ga0496120_0004845_2846_4135 429
975 3300048923 Ga0496120_0028306 Ga0496120_0028306_1594_2886 429
976 3300048924 Ga0496121_0000001 Ga0496121_0000001_794779_796071 429
977 3300048924 Ga0496121_0005778 Ga0496121_0005778_5964_7253 429
978 3300048924 Ga0496121_0009367 Ga0496121_0009367_3360_4652 429
979 3300048924 Ga0496121_0015300 Ga0496121_0015300_3772_5064 429
980 3300048924 Ga0496121_0020840 Ga0496121_0020840_165_1460 429
981 3300048924 Ga0496121_0046720 Ga0496121_0046720_1475_2770 429
982 3300048924 Ga0496121_0109694 Ga0496121_0109694_469_1773 429
983 3300048925 Ga0496122_0000001 Ga0496122_0000001_957572_958912 429
984 3300048925 Ga0496122_0000009 Ga0496122_0000009_67607_68899 429
985 3300048925 Ga0496122_0000205 Ga0496122_0000205_40002_41294 429
986 3300048925 Ga0496122_0014055 Ga0496122_0014055_610_1899 429
987 3300048925 Ga0496122_0017027 Ga0496122_0017027_375_1667 429
988 3300048925 Ga0496122_0018436 Ga0496122_0018436_768_2060 429
989 3300048926 Ga0496123_0000001 Ga0496123_0000001_961303_962643 429
990 3300048926 Ga0496123_0000034 Ga0496123_0000034_256492_257784 429
991 3300048926 Ga0496123_0000103 Ga0496123_0000103_40002_41294 429
992 3300048926 Ga0496123_0007399 Ga0496123_0007399_650_1939 429
993 3300048926 Ga0496123_0008628 Ga0496123_0008628_2084_3376 429
994 3300048926 Ga0496123_0009779 Ga0496123_0009779_2210_3502 429
995 3300048926 Ga0496123_0010695 Ga0496123_0010695_3772_5064 429
996 3300048927 Ga0496124_0000854 Ga0496124_0000854_24139_25431 429
997 3300048927 Ga0496124_0001267 Ga0496124_0001267_32653_33945 429
998 3300048927 Ga0496124_0009898 Ga0496124_0009898_3360_4652 429
999 3300048927 Ga0496124_0013954 Ga0496124_0013954_341_1633 429
1000 3300048927 Ga0496124_0035983 Ga0496124_0035983_2680_3972 429
1001 3300048927 Ga0496124_0100955 Ga0496124_0100955_29_1324 429
1002 3300048928 Ga0496125_0000001 Ga0496125_0000001_908746_910038 429
1003 3300048928 Ga0496125_0000385 Ga0496125_0000385_35650_36942 429
1004 3300048928 Ga0496125_0013299 Ga0496125_0013299_6180_7472 429
1005 3300048928 Ga0496125_0018668 Ga0496125_0018668_2213_3517 429
1006 3300048929 Ga0496126_0001488 Ga0496126_0001488_11021_12313 429
1007 3300048929 Ga0496126_0122689 Ga0496126_0122689_361_1650 429
1008 3300049570 Ga0501033_0021895 Ga0501033_0021895_3057_4349 429
1009 3300049571 Ga0501034_0312590 Ga0501034_0312590_68_1360 429
1010 3300049573 Ga0501037_0057845 Ga0501037_0057845_1207_2499 429
1011 3300049574 Ga0501038_0167137 Ga0501038_0167137_261_1553 429
1012 3300049579 Ga0501043_0058918 Ga0501043_0058918_678_1973 429
1013 3300049581 Ga0501047_0178982 Ga0501047_0178982_449_1768 429
1014 3300049744 Ga0501083_0064521 Ga0501083_0064521_846_2141 429
1015 3300050489 nmdc:mga03683_51004_c1 nmdc:mga03683_51004_c1_338_1678 429
1016 3300050491 nmdc:mga00v17_13054_c1 nmdc:mga00v17_13054_c1_320_1612 429
1017 3300050491 nmdc:mga00v17_201_c1 nmdc:mga00v17_201_c1_20146_21438 429
1018 3300050491 nmdc:mga00v17_52_c1 nmdc:mga00v17_52_c1_11271_12611 429
1019 3300050492 nmdc:mga0yw44_4284_c1 nmdc:mga0yw44_4284_c1_4949_6241 429
1020 3300050496 nmdc:mga07m45_84678_c1 nmdc:mga07m45_84678_c1_278_1573 429
1021 3300053087 Ga0500643_032572 Ga0500643_032572_233_1546 429
1022 3300053107 Ga0500560_000407 Ga0500560_000407_189_1493 429
1023 3300053125 Ga0500618_000055 Ga0500618_000055_52136_53644 429
1024 3300053125 Ga0500618_000616 Ga0500618_000616_17321_18625 429
1025 3300053125 Ga0500618_002635 Ga0500618_002635_599_1891 429
1026 3300053125 Ga0500618_004048 Ga0500618_004048_2111_3403 429
1027 3300053134 Ga0500658_0001240 Ga0500658_0001240_8438_9730 429
1028 3300053137 Ga0500561_0000114 Ga0500561_0000114_4996_6336 429
1029 3300053140 Ga0500573_0048611 Ga0500573_0048611_732_2030 429
1030 3300053153 Ga0500616_0000224 Ga0500616_0000224_72184_73497 429
1031 3300053153 Ga0500616_0062932 Ga0500616_0062932_56_1363 429
1032 3300053156 Ga0500622_0000919 Ga0500622_0000919_9574_10869 429
1033 3300053160 Ga0500633_0000113 Ga0500633_0000113_5779_7074 429
1034 3300053161 Ga0500634_0014495 Ga0500634_0014495_1686_2978 429
1035 3300053177 Ga0500636_0000004 Ga0500636_0000004_98109_99527 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00012

HSP70

Hsp70 protein

355

493

0.86

PF00012

HSP70

Hsp70 protein

76

316

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rtf-assembly1.cif.gz_D crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv 0.8184 3 417
4rtf-assembly1.cif.gz_D crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv 0.8033 3 417
5oby-assembly1.cif.gz_A mycoplasma genitalium dnak-nbd in complex with amp-pnp 0.7925 3 419
6w6e-assembly1.cif.gz_I the mycobacterium tuberculosis clpb disaggregase hexamer structure with a locally refined clpb middle domain and a dnak nucleotide binding domain 0.7907 1 415
5obv-assembly1.cif.gz_A mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with adp and pi. 0.7894 1 426
ID Description Score Start End Superfamily
af_P36928_307_378_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8703 280 347 3.30.420.40
4rtfD03 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8598 305 354 3.90.640.10
af_O07239_201_278_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8417 303 349 3.90.640.10
4rtfD01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8366 3 175 3.30.420.40
af_P36928_307_378_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8173 280 347 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A520JBI4-F1-model_v4 Hsp70 family protein 0.9624 191 429 GO:0005524
GO:0140662
AF-A0A520JBI4-F1-model_v4 Hsp70 family protein 0.9546 191 429 GO:0005524
GO:0140662
AF-A0A839EQ70-F1-model_v4 Putative chaperone protein 0.9541 1 429 GO:0005524
GO:0140662
AF-A0A2A2M2Q2-F1-model_v4 Uncharacterized protein 0.9527 237 429 GO:0005524
GO:0005634
GO:0005829
GO:0140662
AF-A0A259I9A7-F1-model_v4 deleted 0.9498 281 429

Feature Viewer

pLDDT pTM Quality
89.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map