F488703
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1035 | 808 | 460 | 428 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_000055|Ga0500618_000055_52136_53644 |
| Length | 502 |
| Sequence | MPRPEQGLPFEPNTKGRRKAPLLHLRAAAPCLPLSPVASGALSKNAGGGYAPFHARHFPGLNEFLQTTRSTAMARALGLDFGTTNTVLALADGGNTTHSMRFSSSAGETDSMRTALSFMKDAQLGAQALKVEAGQAAIRQFIDNPGDARFLQSIKTFAASAVFQGTLVFARRHTFEDLMEIFLKRLKVYADGHWPSDVSRLVAGRPVHFAGASPDEKLATDRYNEALTRLGFPEIHYVYEPVAAAYYFAQTLKSDANVLVADFGGGTTDYSLIRFERVAGKLTAKPIGHSGVGIAGDHFDARMIERLVAPEIGKGTFFKSFDKLLEVPSSYYANFSRWNQLSIFKTTREFNDLKSLVRSAVDPDKLELFIDLVEHDEGYPLYQAISATKMALSAAEEAEFNFSPLGKAGRKVVKRADFETWIADDLARIEGALDDVLTKTNTAPADVDKVFLTGGTSFVPAVRRIFTERFDASKIESGGELLSIAHGLALIGESDNAGEWAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 14 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 15 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 16 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 17 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 18 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 19 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 20 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 21 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 22 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 23 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 24 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 25 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 26 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 27 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 28 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 29 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 30 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 31 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 32 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 35 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 36 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 37 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 38 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 39 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 40 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 41 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 42 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 43 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 44 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 45 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 46 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 47 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 48 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 49 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 50 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 51 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 52 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 53 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 54 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 55 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 56 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 57 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 58 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 59 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 60 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 61 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 62 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 63 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 64 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 65 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 66 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 67 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 68 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 69 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 70 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 71 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 72 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 73 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 74 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 75 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 76 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 77 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 78 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 79 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 80 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 81 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 82 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 83 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 84 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 85 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 86 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 87 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 88 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 89 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 90 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 91 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 92 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 93 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 94 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 95 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 96 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 97 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 98 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 99 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 100 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 101 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 102 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 103 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 104 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 105 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 106 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 107 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 108 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 109 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 110 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 111 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 112 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 113 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 114 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 115 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 116 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 117 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 118 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 119 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 120 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 121 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 122 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 123 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 124 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 125 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 126 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 127 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 128 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 129 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 130 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 131 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 132 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 133 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 134 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 135 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 136 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 137 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 138 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 139 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 140 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 141 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 142 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 143 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 144 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 145 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 146 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 147 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 148 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 149 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 150 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 151 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 152 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 153 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 154 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 155 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 156 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 157 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 158 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 159 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 160 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 161 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 162 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 163 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 164 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 165 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 166 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 167 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 168 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 169 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 170 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 171 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 172 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 173 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 174 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 175 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 176 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 177 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 178 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 179 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 180 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 181 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 182 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 183 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 184 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 185 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 186 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 187 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 188 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 189 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 190 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 191 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 192 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 193 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 194 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 195 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 196 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 197 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 198 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 199 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 200 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 201 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 202 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 203 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 204 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 205 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 206 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 207 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 208 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 209 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 210 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 211 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 212 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 213 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 214 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 215 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 216 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 217 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 218 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 219 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 220 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 221 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 222 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 223 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 224 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 225 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 226 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 227 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 228 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 229 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 230 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 231 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 232 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 233 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 234 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 235 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 236 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 237 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 238 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 239 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 240 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 241 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 242 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 243 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 244 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 245 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 246 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 247 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 248 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 249 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 250 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 251 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 252 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 253 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 254 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 255 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 256 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 257 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 258 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 259 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 260 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 261 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 262 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 263 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 264 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 265 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 266 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 267 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 268 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 269 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 270 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 271 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 272 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 273 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 274 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 275 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 276 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 277 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 278 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 279 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 280 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 281 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 282 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 283 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 284 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 285 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 286 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 287 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 288 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 289 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 290 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 291 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 292 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 293 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 294 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 295 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 296 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 297 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 298 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 299 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 300 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 301 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 302 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 303 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 304 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 305 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 306 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 307 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 308 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 309 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 310 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 311 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 312 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 313 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 314 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 315 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 316 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 317 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 318 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 319 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 320 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 321 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 322 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 323 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 324 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 325 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 326 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 327 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 328 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 329 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 330 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 331 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 332 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 333 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 334 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 335 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 336 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 337 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 338 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 339 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 340 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 341 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 342 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 343 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 344 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 345 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 346 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 347 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 348 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 349 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 350 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 351 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 352 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 353 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 354 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 355 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 356 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 357 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 358 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 359 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 360 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 361 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 362 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 363 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 364 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 365 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 366 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 367 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 368 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 369 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 370 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 371 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 372 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 373 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 374 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 375 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 376 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 377 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 378 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 379 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 380 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 381 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 382 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 383 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 384 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 385 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 386 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 387 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 388 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 389 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 390 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 391 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 392 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 393 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 394 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 395 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 396 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 397 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 398 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 399 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 400 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 401 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 402 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 403 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 404 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 405 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 406 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 407 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 408 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 409 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 410 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 411 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 412 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 413 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 414 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 415 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 416 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 417 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 418 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 419 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 420 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 421 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 422 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 423 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 424 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 425 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 426 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 427 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 428 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 429 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 430 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 431 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 432 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 433 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 434 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 435 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 436 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 437 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 438 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 439 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 440 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 441 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 442 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 443 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 444 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 445 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 446 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 447 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 448 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 449 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 450 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 451 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 452 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 453 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 454 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 455 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 456 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 457 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 458 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 459 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 460 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 461 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 462 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 463 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 464 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 465 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 466 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 467 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 468 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 469 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 470 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 471 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 472 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 473 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 474 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 475 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 476 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 477 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 478 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 479 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 480 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 481 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 482 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 483 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 484 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 485 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 486 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 487 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 488 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 489 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 490 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 491 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 492 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 493 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 494 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 495 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 496 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 497 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 498 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 499 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 500 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 501 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 502 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 503 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 504 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 505 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 506 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 507 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 508 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 509 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 510 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 511 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 512 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 513 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 514 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 515 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 516 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 517 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 518 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 519 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 520 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 521 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 522 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 523 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 524 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 525 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 526 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 527 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 528 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 529 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 530 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 531 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 532 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 533 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 534 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 535 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 536 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 537 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 538 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 539 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 540 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 541 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 542 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 543 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 544 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 545 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 546 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 547 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 548 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 549 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 550 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 551 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 552 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 553 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 554 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 555 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 556 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 557 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 558 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 559 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 560 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 561 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 562 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 563 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 564 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 565 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 566 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 567 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 568 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 569 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 571 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 572 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 573 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 574 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 575 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 576 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 577 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 578 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 579 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 580 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 581 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 582 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 583 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 584 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 585 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 586 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 587 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 588 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 589 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 590 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 591 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 592 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 593 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 594 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 595 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 596 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 597 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 598 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 599 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 600 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 601 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 602 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 603 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 604 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 605 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 606 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 607 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 608 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 609 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 610 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 611 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 612 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 613 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 614 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 615 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 616 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 617 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 618 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 619 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 620 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 621 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 622 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 623 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 624 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 642 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 644 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 646 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 647 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 648 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 649 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 650 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 651 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 652 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 653 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 654 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 655 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 656 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 657 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 658 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 659 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 660 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 661 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 662 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 663 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 664 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 665 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 666 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 667 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 668 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 669 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 670 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 671 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 672 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 705 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 706 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 707 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 708 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 709 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 710 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 711 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 712 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 713 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 714 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 715 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 716 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 717 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 718 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 719 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 720 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 721 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 722 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 723 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 724 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 725 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 726 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 727 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 728 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 729 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 730 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 731 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 732 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 733 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 734 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 735 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 736 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 737 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 738 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 739 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 740 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 741 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 742 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 743 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 744 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 745 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 746 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 747 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 748 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 749 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 750 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 751 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 752 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 753 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 754 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 755 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 756 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 757 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 758 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 759 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 760 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 761 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 762 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 763 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 764 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 765 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 766 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 767 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 768 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 769 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 770 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 771 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 772 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 773 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 774 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 775 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 776 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 777 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 778 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 779 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 780 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 781 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 782 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 783 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 784 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 785 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 786 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 787 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 788 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 789 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 790 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 791 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 792 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 793 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 794 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 795 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 796 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 797 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 798 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 799 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 800 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 801 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 802 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 803 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 804 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 805 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 806 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 807 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 808 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 44.44 |
| Metatranscriptomes | 0 |
| Isolates | 55.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.48 |
| Bulb | 0 |
| Endosphere | 16.23 |
| Nodule | 41.35 |
| Rhizoplane | 1.74 |
| Rhizosphere | 22.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000602 | 3300001979 | Bacteria | 15553 |
| 2 | JGI25155J39150_1000072 | 3300002704 | Bacteria | 64012 |
| 3 | JGI25156J39149_1000086 | 3300002705 | Bacteria | 69106 |
| 4 | JGI25162J39368_1000956 | 3300002737 | Bacteria | 18449 |
| 5 | JGI25162J39368_1001709 | 3300002737 | Bacteria | 10670 |
| 6 | JGI25154J39366_1000205 | 3300002738 | Bacteria | 42445 |
| 7 | JGI25157J39369_1000113 | 3300002741 | Bacteria | 69106 |
| 8 | JGI25152J39213_1000959 | 3300002773 | Bacteria | 14079 |
| 9 | JGI25150J39212_1000031 | 3300002774 | Bacteria | 100456 |
| 10 | JGI25159J45721_1000001 | 3300002987 | Bacteria | 303489 |
| 11 | JGI25159J45721_1000064 | 3300002987 | Bacteria | 51766 |
| 12 | JGI25159J45721_1001419 | 3300002987 | Bacteria | 9950 |
| 13 | JGI25151J46595_10000062 | 3300003187 | Bacteria | 146687 |
| 14 | JGI25151J46595_10007169 | 3300003187 | Bacteria | 5495 |
| 15 | JGI25151J46595_10018956 | 3300003187 | Bacteria | 2937 |
| 16 | JGI25165J46597_1001014 | 3300003214 | Bacteria | 18522 |
| 17 | JGI25165J46597_1001037 | 3300003214 | Bacteria | 18135 |
| 18 | JGI25153J46596_10000312 | 3300003215 | Bacteria | 35785 |
| 19 | JGI25153J46596_10005340 | 3300003215 | Bacteria | 6750 |
| 20 | rootL2_10113901 | 3300003322 | Bacteria | 5126 |
| 21 | rootH1_10015315 | 3300003323 | Bacteria | 2160 |
| 22 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 23 | JGI25160J50197_1000052 | 3300003354 | Bacteria | 127795 |
| 24 | JGI25160J50197_1024650 | 3300003354 | Bacteria | 1701 |
| 25 | JGI25161J50226_1000073 | 3300003374 | Bacteria | 86555 |
| 26 | JGI25161J50226_1000153 | 3300003374 | Bacteria | 47896 |
| 27 | JGI25161J50226_1003967 | 3300003374 | Bacteria | 3215 |
| 28 | Ga0055526_1002168 | 3300003771 | Bacteria | 13463 |
| 29 | Ga0055526_1003266 | 3300003771 | Bacteria | 10411 |
| 30 | Ga0055526_1003657 | 3300003771 | Bacteria | 9623 |
| 31 | Ga0055526_1005117 | 3300003771 | Bacteria | 7648 |
| 32 | Ga0055526_1014304 | 3300003771 | Bacteria | 3275 |
| 33 | Ga0055526_1015152 | 3300003771 | Bacteria | 3111 |
| 34 | Ga0055526_1020618 | 3300003771 | Bacteria | 2334 |
| 35 | Ga0055524_1003026 | 3300003775 | Bacteria | 8324 |
| 36 | Ga0055524_1005073 | 3300003775 | Bacteria | 5956 |
| 37 | Ga0055524_1006865 | 3300003775 | Bacteria | 4908 |
| 38 | Ga0055524_1017546 | 3300003775 | Bacteria | 2522 |
| 39 | Ga0055536_1000427 | 3300003781 | Bacteria | 30054 |
| 40 | Ga0055536_1003558 | 3300003781 | Bacteria | 8331 |
| 41 | Ga0055536_1005875 | 3300003781 | Bacteria | 5885 |
| 42 | Ga0055536_1008275 | 3300003781 | Bacteria | 4498 |
| 43 | Ga0055528_1000097 | 3300003790 | Bacteria | 70021 |
| 44 | Ga0055528_1000413 | 3300003790 | Bacteria | 34511 |
| 45 | Ga0055528_1007933 | 3300003790 | Bacteria | 4628 |
| 46 | Ga0055540_1000234 | 3300003792 | Bacteria | 50741 |
| 47 | Ga0055540_1003105 | 3300003792 | Bacteria | 8243 |
| 48 | Ga0055531_10024536 | 3300003794 | Bacteria | 2221 |
| 49 | Ga0055543_1000035 | 3300004625 | Bacteria | 127833 |
| 50 | Ga0055543_1001724 | 3300004625 | Bacteria | 8207 |
| 51 | Ga0065165_1000004 | 3300005262 | Bacteria | 377081 |
| 52 | Ga0065165_1001373 | 3300005262 | Bacteria | 26778 |
| 53 | Ga0065165_1001548 | 3300005262 | Bacteria | 23977 |
| 54 | Ga0065165_1001869 | 3300005262 | Bacteria | 20423 |
| 55 | Ga0065165_1006808 | 3300005262 | Bacteria | 5836 |
| 56 | Ga0065165_1010060 | 3300005262 | Bacteria | 4151 |
| 57 | Ga0065165_1010294 | 3300005262 | Bacteria | 4063 |
| 58 | Ga0070658_10015409 | 3300005327 | Bacteria | 6117 |
| 59 | Ga0070658_10016053 | 3300005327 | Bacteria | 5990 |
| 60 | Ga0070658_10165504 | 3300005327 | Bacteria | 1856 |
| 61 | Ga0070670_100000347 | 3300005331 | Bacteria | 38928 |
| 62 | Ga0070671_100025768 | 3300005355 | Bacteria | 4828 |
| 63 | Ga0070674_100040340 | 3300005356 | Bacteria | 3158 |
| 64 | Ga0070659_100028862 | 3300005366 | Bacteria | 4286 |
| 65 | Ga0070681_10111950 | 3300005458 | Bacteria | 2669 |
| 66 | Ga0070679_100012408 | 3300005530 | Bacteria | 8143 |
| 67 | Ga0070684_100036084 | 3300005535 | Bacteria | 4236 |
| 68 | Ga0070665_100002410 | 3300005548 | Bacteria | 20612 |
| 69 | Ga0070665_100192518 | 3300005548 | Bacteria | 2040 |
| 70 | Ga0070665_100196685 | 3300005548 | Bacteria | 2017 |
| 71 | Ga0068855_100010038 | 3300005563 | Bacteria | 11413 |
| 72 | Ga0068855_100010543 | 3300005563 | Bacteria | 11146 |
| 73 | Ga0068857_100178708 | 3300005577 | Bacteria | 1931 |
| 74 | Ga0068856_100018126 | 3300005614 | Bacteria | 6826 |
| 75 | Ga0068856_100046094 | 3300005614 | Bacteria | 4294 |
| 76 | Ga0068856_100199246 | 3300005614 | Bacteria | 2017 |
| 77 | Ga0068852_100024682 | 3300005616 | Bacteria | 4862 |
| 78 | Ga0068852_100038488 | 3300005616 | Bacteria | 4020 |
| 79 | Ga0068851_10005049 | 3300005834 | Bacteria | 5986 |
| 80 | Ga0075365_10012052 | 3300006038 | Bacteria | 5115 |
| 81 | Ga0075368_10015374 | 3300006042 | Bacteria | 2839 |
| 82 | Ga0075363_100008956 | 3300006048 | Bacteria | 4687 |
| 83 | Ga0075364_10000177 | 3300006051 | Bacteria | 28741 |
| 84 | Ga0070712_100064141 | 3300006175 | Bacteria | 2604 |
| 85 | Ga0075367_10006431 | 3300006178 | Bacteria | 5934 |
| 86 | Ga0075367_10007923 | 3300006178 | Bacteria | 5474 |
| 87 | Ga0075367_10021879 | 3300006178 | Bacteria | 3580 |
| 88 | Ga0075369_10023091 | 3300006186 | Bacteria | 2569 |
| 89 | Ga0075369_10041985 | 3300006186 | Bacteria | 1959 |
| 90 | Ga0075366_10004489 | 3300006195 | Bacteria | 7486 |
| 91 | Ga0097621_100010551 | 3300006237 | Bacteria | 6767 |
| 92 | Ga0075370_10092350 | 3300006353 | Bacteria | 1747 |
| 93 | Ga0068871_100052091 | 3300006358 | Bacteria | 3314 |
| 94 | Ga0079104_1000010 | 3300006946 | Bacteria | 366021 |
| 95 | Ga0079104_1002175 | 3300006946 | Bacteria | 11070 |
| 96 | Ga0079104_1010103 | 3300006946 | Bacteria | 3136 |
| 97 | Ga0099826_10000838 | 3300006948 | Bacteria | 16616 |
| 98 | Ga0099826_10085596 | 3300006948 | Bacteria | 1946 |
| 99 | Ga0099795_10000284 | 3300007788 | Bacteria | 9080 |
| 100 | Ga0105251_10010972 | 3300009011 | Bacteria | 5209 |
| 101 | Ga0105240_10000027 | 3300009093 | Bacteria | 348486 |
| 102 | Ga0105240_10011173 | 3300009093 | Bacteria | 12533 |
| 103 | Ga0105240_10049005 | 3300009093 | Bacteria | 5335 |
| 104 | Ga0105245_10122532 | 3300009098 | Bacteria | 2430 |
| 105 | Ga0105243_10013570 | 3300009148 | Bacteria | 6163 |
| 106 | Ga0105241_10007637 | 3300009174 | Bacteria | 7947 |
| 107 | Ga0105242_10085818 | 3300009176 | Bacteria | 2641 |
| 108 | Ga0105248_10004763 | 3300009177 | Bacteria | 15015 |
| 109 | Ga0105248_10280267 | 3300009177 | Bacteria | 1877 |
| 110 | Ga0105237_10004420 | 3300009545 | Bacteria | 16294 |
| 111 | Ga0105238_10019957 | 3300009551 | Bacteria | 6823 |
| 112 | Ga0123341_1000006 | 3300009765 | Bacteria | 149197 |
| 113 | Ga0123342_1009880 | 3300009766 | Bacteria | 11179 |
| 114 | Ga0099796_10004798 | 3300010159 | Bacteria | 3309 |
| 115 | Ga0105239_10010623 | 3300010375 | Bacteria | 10298 |
| 116 | Ga0157373_10005723 | 3300013100 | Bacteria | 9314 |
| 117 | Ga0157371_10000307 | 3300013102 | Bacteria | 63760 |
| 118 | Ga0157370_10000223 | 3300013104 | Bacteria | 72025 |
| 119 | Ga0157370_10000577 | 3300013104 | Bacteria | 45697 |
| 120 | Ga0157370_10018273 | 3300013104 | Bacteria | 7052 |
| 121 | Ga0157369_10000908 | 3300013105 | Bacteria | 37806 |
| 122 | Ga0157369_10068607 | 3300013105 | Bacteria | 3810 |
| 123 | Ga0157369_10109759 | 3300013105 | Bacteria | 2933 |
| 124 | Ga0157369_10199134 | 3300013105 | Bacteria | 2103 |
| 125 | Ga0157372_10001580 | 3300013307 | Bacteria | 24846 |
| 126 | Ga0163163_10087840 | 3300014325 | Bacteria | 3120 |
| 127 | Ga0182007_10009549 | 3300015262 | Bacteria | 3906 |
| 128 | Ga0182005_1001113 | 3300015265 | Bacteria | 11231 |
| 129 | Ga0183363_1089 | 3300015690 | Bacteria | 27581 |
| 130 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 131 | Ga0214542_1008369 | 3300021321 | Bacteria | 17166 |
| 132 | Ga0214542_1010138 | 3300021321 | Bacteria | 13991 |
| 133 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 134 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 135 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 136 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 137 | Ga0209435_100036 | 3300025206 | Bacteria | 126970 |
| 138 | Ga0209436_100047 | 3300025208 | Bacteria | 68393 |
| 139 | Ga0209436_102304 | 3300025208 | Bacteria | 5851 |
| 140 | Ga0209672_103187 | 3300025228 | Bacteria | 3505 |
| 141 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 142 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 143 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 144 | Ga0207425_1001110 | 3300025245 | Bacteria | 12159 |
| 145 | Ga0207425_1010137 | 3300025245 | Bacteria | 2307 |
| 146 | Ga0209646_1000132 | 3300025246 | Bacteria | 126859 |
| 147 | Ga0209026_1000236 | 3300025250 | Bacteria | 73740 |
| 148 | Ga0209759_1000269 | 3300025256 | Bacteria | 73740 |
| 149 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 150 | Ga0209129_1000125 | 3300025258 | Bacteria | 133506 |
| 151 | Ga0209129_1000611 | 3300025258 | Bacteria | 24129 |
| 152 | Ga0209129_1001053 | 3300025258 | Bacteria | 16286 |
| 153 | Ga0209129_1001178 | 3300025258 | Bacteria | 15052 |
| 154 | Ga0209129_1001568 | 3300025258 | Bacteria | 12550 |
| 155 | Ga0209129_1003548 | 3300025258 | Bacteria | 6714 |
| 156 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 157 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 158 | Ga0209233_1000152 | 3300025261 | Bacteria | 175910 |
| 159 | Ga0209455_1008421 | 3300025272 | Bacteria | 2805 |
| 160 | Ga0209673_1000122 | 3300025273 | Bacteria | 170443 |
| 161 | Ga0209673_1000409 | 3300025273 | Bacteria | 75876 |
| 162 | Ga0209673_1001508 | 3300025273 | Bacteria | 21458 |
| 163 | Ga0209673_1001874 | 3300025273 | Bacteria | 16993 |
| 164 | Ga0209673_1001941 | 3300025273 | Bacteria | 16313 |
| 165 | Ga0209673_1002296 | 3300025273 | Bacteria | 13630 |
| 166 | Ga0209673_1006574 | 3300025273 | Bacteria | 5570 |
| 167 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 168 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 169 | Ga0209130_1015165 | 3300025284 | Bacteria | 1908 |
| 170 | Ga0209676_1001841 | 3300025292 | Bacteria | 17525 |
| 171 | Ga0209676_1002222 | 3300025292 | Bacteria | 14418 |
| 172 | Ga0209676_1012750 | 3300025292 | Bacteria | 3273 |
| 173 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 174 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 175 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 176 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 177 | Ga0209025_1000165 | 3300025294 | Bacteria | 164692 |
| 178 | Ga0209025_1000900 | 3300025294 | Bacteria | 46091 |
| 179 | Ga0209025_1001226 | 3300025294 | Bacteria | 35815 |
| 180 | Ga0209025_1001688 | 3300025294 | Bacteria | 26980 |
| 181 | Ga0209025_1007426 | 3300025294 | Bacteria | 8179 |
| 182 | Ga0209025_1012756 | 3300025294 | Bacteria | 5353 |
| 183 | Ga0209025_1033604 | 3300025294 | Bacteria | 2366 |
| 184 | Ga0209564_1000104 | 3300025295 | Bacteria | 219017 |
| 185 | Ga0209564_1000853 | 3300025295 | Bacteria | 40719 |
| 186 | Ga0209564_1001099 | 3300025295 | Bacteria | 32101 |
| 187 | Ga0209564_1001645 | 3300025295 | Bacteria | 21556 |
| 188 | Ga0209564_1005387 | 3300025295 | Bacteria | 7331 |
| 189 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 190 | Ga0209758_1000121 | 3300025297 | Bacteria | 192028 |
| 191 | Ga0209758_1000313 | 3300025297 | Bacteria | 93883 |
| 192 | Ga0209758_1000624 | 3300025297 | Bacteria | 54349 |
| 193 | Ga0209758_1003467 | 3300025297 | Bacteria | 14302 |
| 194 | Ga0209758_1008055 | 3300025297 | Bacteria | 6955 |
| 195 | Ga0209758_1014909 | 3300025297 | Bacteria | 4079 |
| 196 | Ga0209050_1001263 | 3300025298 | Bacteria | 29191 |
| 197 | Ga0209050_1012778 | 3300025298 | Bacteria | 3810 |
| 198 | Ga0209256_1000351 | 3300025299 | Bacteria | 74921 |
| 199 | Ga0209256_1001199 | 3300025299 | Bacteria | 29031 |
| 200 | Ga0209256_1001393 | 3300025299 | Bacteria | 25215 |
| 201 | Ga0209256_1001494 | 3300025299 | Bacteria | 23770 |
| 202 | Ga0209256_1002645 | 3300025299 | Bacteria | 14095 |
| 203 | Ga0209256_1003108 | 3300025299 | Bacteria | 12147 |
| 204 | Ga0209256_1003692 | 3300025299 | Bacteria | 10407 |
| 205 | Ga0209256_1008356 | 3300025299 | Bacteria | 4822 |
| 206 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 207 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 208 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 209 | Ga0207426_1000743 | 3300025302 | Bacteria | 36635 |
| 210 | Ga0207426_1001023 | 3300025302 | Bacteria | 26852 |
| 211 | Ga0209051_1000339 | 3300025303 | Bacteria | 70136 |
| 212 | Ga0209051_1000918 | 3300025303 | Bacteria | 29277 |
| 213 | Ga0209051_1001825 | 3300025303 | Bacteria | 16844 |
| 214 | Ga0209051_1014302 | 3300025303 | Bacteria | 3712 |
| 215 | Ga0209257_1001790 | 3300025304 | Bacteria | 23629 |
| 216 | Ga0209257_1002795 | 3300025304 | Bacteria | 16446 |
| 217 | Ga0209257_1002847 | 3300025304 | Bacteria | 16197 |
| 218 | Ga0209257_1003481 | 3300025304 | Bacteria | 13438 |
| 219 | Ga0207705_10029588 | 3300025909 | Bacteria | 3904 |
| 220 | Ga0207707_10111347 | 3300025912 | Bacteria | 2393 |
| 221 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 222 | Ga0207695_10018654 | 3300025913 | Bacteria | 8014 |
| 223 | Ga0207695_10025079 | 3300025913 | Bacteria | 6688 |
| 224 | Ga0207671_10000986 | 3300025914 | Bacteria | 35178 |
| 225 | Ga0207660_10193806 | 3300025917 | Bacteria | 1584 |
| 226 | Ga0207652_10044177 | 3300025921 | Bacteria | 3795 |
| 227 | Ga0207681_10113687 | 3300025923 | Bacteria | 1974 |
| 228 | Ga0207650_10000567 | 3300025925 | Bacteria | 30017 |
| 229 | Ga0207664_10172947 | 3300025929 | Bacteria | 1850 |
| 230 | Ga0207644_10079078 | 3300025931 | Bacteria | 2425 |
| 231 | Ga0207711_10036636 | 3300025941 | Bacteria | 4163 |
| 232 | Ga0207667_10031906 | 3300025949 | Bacteria | 5681 |
| 233 | Ga0207677_10006032 | 3300026023 | Bacteria | 6607 |
| 234 | Ga0207708_10117069 | 3300026075 | Bacteria | 2073 |
| 235 | Ga0207702_10164056 | 3300026078 | Bacteria | 2031 |
| 236 | Ga0207683_10137732 | 3300026121 | Bacteria | 2198 |
| 237 | Ga0207698_10005638 | 3300026142 | Bacteria | 7750 |
| 238 | Ga0207698_10028833 | 3300026142 | Bacteria | 3965 |
| 239 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 240 | Ga0209281_1000164 | 3300027111 | Bacteria | 157372 |
| 241 | Ga0209281_1000377 | 3300027111 | Bacteria | 71243 |
| 242 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 243 | Ga0209371_1001175 | 3300027312 | Bacteria | 19137 |
| 244 | Ga0209371_1005859 | 3300027312 | Bacteria | 4732 |
| 245 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 246 | Ga0209282_1000715 | 3300027666 | Bacteria | 16612 |
| 247 | Ga0209282_1071011 | 3300027666 | Bacteria | 1896 |
| 248 | Ga0268266_10032452 | 3300028379 | Bacteria | 4436 |
| 249 | Ga0268266_10110435 | 3300028379 | Bacteria | 2436 |
| 250 | Ga0307515_10000115 | 3300028794 | Bacteria | 193697 |
| 251 | Ga0307515_10001359 | 3300028794 | Bacteria | 55373 |
| 252 | Ga0307515_10002710 | 3300028794 | Bacteria | 37898 |
| 253 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 254 | Ga0268256_1005834 | 3300030500 | Bacteria | 4732 |
| 255 | Ga0316181_1002016 | 3300030744 | Bacteria | 2554 |
| 256 | Ga0265327_10000778 | 3300031251 | Bacteria | 49242 |
| 257 | Ga0265327_10001708 | 3300031251 | Bacteria | 26225 |
| 258 | Ga0265327_10024281 | 3300031251 | Bacteria | 3567 |
| 259 | Ga0265316_10006286 | 3300031344 | Bacteria | 11374 |
| 260 | Ga0307513_10008680 | 3300031456 | Bacteria | 12948 |
| 261 | Ga0307513_10014591 | 3300031456 | Bacteria | 9566 |
| 262 | Ga0307410_10095821 | 3300031852 | Bacteria | 2117 |
| 263 | Ga0307412_10001806 | 3300031911 | Bacteria | 11834 |
| 264 | Ga0307412_10079261 | 3300031911 | Bacteria | 2265 |
| 265 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 266 | Ga0307416_100153035 | 3300032002 | Bacteria | 2119 |
| 267 | Ga0307414_10002909 | 3300032004 | Bacteria | 9058 |
| 268 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 269 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 270 | Ga0373927_0000780 | 3300035695 | Bacteria | 24278 |
| 271 | Ga0395905_0007143 | 3300037471 | Bacteria | 11167 |
| 272 | Ga0395905_0008439 | 3300037471 | Bacteria | 10157 |
| 273 | Ga0395905_0127507 | 3300037471 | Bacteria | 2393 |
| 274 | Ga0237819_00516 | 3300038705 | Bacteria | 12975 |
| 275 | Ga0237816_01893 | 3300039145 | Bacteria | 1661 |
| 276 | Ga0439436_0025113 | 3300041404 | Bacteria | 1753 |
| 277 | Ga0439439_0021887 | 3300041406 | Bacteria | 1595 |
| 278 | Ga0439465_0004088 | 3300041413 | Bacteria | 4744 |
| 279 | Ga0439465_0017163 | 3300041413 | Bacteria | 2259 |
| 280 | Ga0439465_0020090 | 3300041413 | Bacteria | 2090 |
| 281 | Ga0451837_1135412 | 3300041494 | Bacteria | 2422 |
| 282 | Ga0451839_0324124 | 3300041496 | Bacteria | 2537 |
| 283 | Ga0439431_0013507 | 3300041997 | Bacteria | 1885 |
| 284 | Ga0439432_033106 | 3300042006 | Bacteria | 1664 |
| 285 | Ga0439449_0006077 | 3300042007 | Bacteria | 4617 |
| 286 | Ga0451576_0025375 | 3300045051 | Bacteria | 6384 |
| 287 | Ga0451576_0244129 | 3300045051 | Bacteria | 1876 |
| 288 | Ga0466958_0014567 | 3300045836 | Bacteria | 4489 |
| 289 | Ga0495592_0074268 | 3300046454 | Bacteria | 2470 |
| 290 | Ga0495629_0014314 | 3300046459 | Bacteria | 5708 |
| 291 | Ga0495638_0000854 | 3300046460 | Bacteria | 31738 |
| 292 | Ga0495638_0043878 | 3300046460 | Bacteria | 2819 |
| 293 | Ga0495650_0000461 | 3300046471 | Bacteria | 63382 |
| 294 | Ga0495650_0053217 | 3300046471 | Bacteria | 1659 |
| 295 | Ga0495605_0000331 | 3300046474 | Bacteria | 47522 |
| 296 | Ga0495662_0049991 | 3300046476 | Bacteria | 2018 |
| 297 | Ga0495585_0062382 | 3300046492 | Bacteria | 2047 |
| 298 | Ga0495607_0026847 | 3300046501 | Bacteria | 3569 |
| 299 | Ga0495583_0008582 | 3300046506 | Bacteria | 6225 |
| 300 | Ga0495583_0008848 | 3300046506 | Bacteria | 6091 |
| 301 | Ga0495606_0003594 | 3300046507 | Bacteria | 16331 |
| 302 | Ga0495606_0029980 | 3300046507 | Bacteria | 3809 |
| 303 | Ga0495610_0012464 | 3300046512 | Bacteria | 5116 |
| 304 | Ga0495616_0021617 | 3300046513 | Bacteria | 3480 |
| 305 | Ga0495620_0010432 | 3300046515 | Bacteria | 4903 |
| 306 | Ga0495620_0047972 | 3300046515 | Bacteria | 1835 |
| 307 | Ga0495631_0003782 | 3300046518 | Bacteria | 8235 |
| 308 | Ga0495631_0027381 | 3300046518 | Bacteria | 2609 |
| 309 | Ga0495632_0002635 | 3300046519 | Bacteria | 13509 |
| 310 | Ga0495632_0006079 | 3300046519 | Bacteria | 7832 |
| 311 | Ga0495643_0019999 | 3300046522 | Bacteria | 3867 |
| 312 | Ga0495643_0035161 | 3300046522 | Bacteria | 2760 |
| 313 | Ga0495643_0106004 | 3300046522 | Bacteria | 1435 |
| 314 | Ga0495648_0051940 | 3300046524 | Bacteria | 2494 |
| 315 | Ga0495652_0040107 | 3300046529 | Bacteria | 4047 |
| 316 | Ga0495654_0000130 | 3300046530 | Bacteria | 81643 |
| 317 | Ga0495587_0017692 | 3300046536 | Bacteria | 4426 |
| 318 | Ga0495609_0031792 | 3300046538 | Bacteria | 2398 |
| 319 | Ga0495622_0012970 | 3300046557 | Bacteria | 3867 |
| 320 | Ga0495633_0008112 | 3300046558 | Bacteria | 5956 |
| 321 | Ga0495668_0007613 | 3300046616 | Bacteria | 6901 |
| 322 | Ga0495668_0023282 | 3300046616 | Bacteria | 3535 |
| 323 | Ga0495625_0000726 | 3300046660 | Bacteria | 46277 |
| 324 | Ga0495625_0001965 | 3300046660 | Bacteria | 23208 |
| 325 | Ga0495625_0077921 | 3300046660 | Bacteria | 2314 |
| 326 | Ga0495661_0106826 | 3300046665 | Bacteria | 1566 |
| 327 | Ga0495657_0033534 | 3300046675 | Bacteria | 3574 |
| 328 | Ga0495600_0024098 | 3300046809 | Bacteria | 3916 |
| 329 | Ga0495660_0007221 | 3300046810 | Bacteria | 6539 |
| 330 | Ga0495673_0050131 | 3300047469 | Bacteria | 1834 |
| 331 | Ga0495681_0004767 | 3300047470 | Bacteria | 9187 |
| 332 | Ga0495681_0058420 | 3300047470 | Bacteria | 1787 |
| 333 | Ga0495686_0000238 | 3300047472 | Bacteria | 99919 |
| 334 | Ga0495686_0000613 | 3300047472 | Bacteria | 49253 |
| 335 | Ga0495686_0012665 | 3300047472 | Bacteria | 5894 |
| 336 | Ga0495686_0128339 | 3300047472 | Bacteria | 1506 |
| 337 | Ga0496100_0187288 | 3300048903 | Bacteria | 1500 |
| 338 | Ga0496102_0023580 | 3300048905 | Bacteria | 5467 |
| 339 | Ga0496104_0238028 | 3300048907 | Bacteria | 1732 |
| 340 | Ga0496106_0001004 | 3300048909 | Bacteria | 20640 |
| 341 | Ga0496110_0106678 | 3300048913 | Bacteria | 2514 |
| 342 | Ga0496113_0035330 | 3300048916 | Bacteria | 3654 |
| 343 | Ga0496114_0120299 | 3300048917 | Bacteria | 2258 |
| 344 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 345 | Ga0496116_0001619 | 3300048919 | Bacteria | 24766 |
| 346 | Ga0496116_0002976 | 3300048919 | Bacteria | 17219 |
| 347 | Ga0496116_0010396 | 3300048919 | Bacteria | 7802 |
| 348 | Ga0496116_0017233 | 3300048919 | Bacteria | 5617 |
| 349 | Ga0496116_0100819 | 3300048919 | Bacteria | 1725 |
| 350 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 351 | Ga0496117_0006548 | 3300048920 | Bacteria | 11726 |
| 352 | Ga0496117_0007855 | 3300048920 | Bacteria | 10264 |
| 353 | Ga0496117_0036258 | 3300048920 | Bacteria | 3693 |
| 354 | Ga0496117_0046076 | 3300048920 | Bacteria | 3141 |
| 355 | Ga0496117_0051153 | 3300048920 | Bacteria | 2923 |
| 356 | Ga0496117_0071672 | 3300048920 | Bacteria | 2320 |
| 357 | Ga0496118_0000084 | 3300048921 | Bacteria | 181733 |
| 358 | Ga0496118_0000396 | 3300048921 | Bacteria | 73830 |
| 359 | Ga0496118_0002631 | 3300048921 | Bacteria | 23807 |
| 360 | Ga0496118_0006506 | 3300048921 | Bacteria | 12806 |
| 361 | Ga0496118_0092593 | 3300048921 | Bacteria | 2074 |
| 362 | Ga0496119_0010878 | 3300048922 | Bacteria | 7604 |
| 363 | Ga0496119_0019985 | 3300048922 | Bacteria | 4904 |
| 364 | Ga0496119_0029046 | 3300048922 | Bacteria | 3760 |
| 365 | Ga0496119_0032929 | 3300048922 | Bacteria | 3447 |
| 366 | Ga0496119_0051426 | 3300048922 | Bacteria | 2532 |
| 367 | Ga0496120_0000087 | 3300048923 | Bacteria | 152857 |
| 368 | Ga0496120_0004845 | 3300048923 | Bacteria | 11003 |
| 369 | Ga0496120_0028306 | 3300048923 | Bacteria | 3435 |
| 370 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 371 | Ga0496121_0001141 | 3300048924 | Bacteria | 46594 |
| 372 | Ga0496121_0005778 | 3300048924 | Bacteria | 15693 |
| 373 | Ga0496121_0009367 | 3300048924 | Bacteria | 11279 |
| 374 | Ga0496121_0010484 | 3300048924 | Bacteria | 10447 |
| 375 | Ga0496121_0015300 | 3300048924 | Bacteria | 8055 |
| 376 | Ga0496121_0020840 | 3300048924 | Bacteria | 6459 |
| 377 | Ga0496121_0046720 | 3300048924 | Bacteria | 3702 |
| 378 | Ga0496121_0050304 | 3300048924 | Bacteria | 3522 |
| 379 | Ga0496121_0109694 | 3300048924 | Bacteria | 2108 |
| 380 | Ga0496121_0125056 | 3300048924 | Bacteria | 1935 |
| 381 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 382 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 383 | Ga0496122_0000205 | 3300048925 | Bacteria | 131755 |
| 384 | Ga0496122_0014055 | 3300048925 | Bacteria | 7771 |
| 385 | Ga0496122_0017027 | 3300048925 | Bacteria | 6824 |
| 386 | Ga0496122_0018436 | 3300048925 | Bacteria | 6448 |
| 387 | Ga0496122_0086661 | 3300048925 | Bacteria | 2154 |
| 388 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 389 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 390 | Ga0496123_0000103 | 3300048926 | Bacteria | 168232 |
| 391 | Ga0496123_0007399 | 3300048926 | Bacteria | 10363 |
| 392 | Ga0496123_0008628 | 3300048926 | Bacteria | 9322 |
| 393 | Ga0496123_0009779 | 3300048926 | Bacteria | 8571 |
| 394 | Ga0496123_0010695 | 3300048926 | Bacteria | 8067 |
| 395 | Ga0496124_0000133 | 3300048927 | Bacteria | 154328 |
| 396 | Ga0496124_0000854 | 3300048927 | Bacteria | 49730 |
| 397 | Ga0496124_0001267 | 3300048927 | Bacteria | 38458 |
| 398 | Ga0496124_0009898 | 3300048927 | Bacteria | 9746 |
| 399 | Ga0496124_0013954 | 3300048927 | Bacteria | 7804 |
| 400 | Ga0496124_0025344 | 3300048927 | Bacteria | 5373 |
| 401 | Ga0496124_0035983 | 3300048927 | Bacteria | 4325 |
| 402 | Ga0496124_0100955 | 3300048927 | Bacteria | 2338 |
| 403 | Ga0496124_0109217 | 3300048927 | Bacteria | 2230 |
| 404 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 405 | Ga0496125_0000385 | 3300048928 | Bacteria | 82113 |
| 406 | Ga0496125_0013299 | 3300048928 | Bacteria | 8097 |
| 407 | Ga0496125_0018668 | 3300048928 | Bacteria | 6578 |
| 408 | Ga0496126_0000597 | 3300048929 | Bacteria | 68119 |
| 409 | Ga0496126_0001488 | 3300048929 | Bacteria | 36340 |
| 410 | Ga0496126_0018669 | 3300048929 | Bacteria | 6863 |
| 411 | Ga0496126_0122689 | 3300048929 | Bacteria | 2251 |
| 412 | Ga0501033_0000038 | 3300049570 | Bacteria | 144438 |
| 413 | Ga0501033_0021895 | 3300049570 | Bacteria | 4823 |
| 414 | Ga0501034_0003022 | 3300049571 | Bacteria | 19460 |
| 415 | Ga0501034_0312590 | 3300049571 | Bacteria | 1505 |
| 416 | Ga0501037_0057845 | 3300049573 | Bacteria | 2830 |
| 417 | Ga0501038_0167137 | 3300049574 | Bacteria | 1784 |
| 418 | Ga0501043_0058918 | 3300049579 | Bacteria | 3013 |
| 419 | Ga0501047_0001955 | 3300049581 | Bacteria | 19810 |
| 420 | Ga0501047_0178982 | 3300049581 | Bacteria | 1987 |
| 421 | Ga0501068_0098395 | 3300049584 | Bacteria | 1811 |
| 422 | Ga0501069_0004546 | 3300049585 | Bacteria | 7171 |
| 423 | Ga0501070_0001389 | 3300049586 | Bacteria | 21681 |
| 424 | Ga0501072_0204362 | 3300049588 | Bacteria | 1575 |
| 425 | Ga0501073_0000206 | 3300049589 | Bacteria | 38869 |
| 426 | Ga0501074_0000330 | 3300049590 | Bacteria | 27501 |
| 427 | Ga0501083_0000293 | 3300049744 | Bacteria | 31385 |
| 428 | Ga0501083_0064521 | 3300049744 | Bacteria | 2440 |
| 429 | Ga0501035_0000326 | 3300049822 | Bacteria | 55174 |
| 430 | Ga0501035_0170579 | 3300049822 | Bacteria | 1880 |
| 431 | Ga0501044_0034308 | 3300049823 | Bacteria | 5322 |
| 432 | nmdc:mga03683_51004_c1 | 3300050489 | Bacteria | 1726 |
| 433 | nmdc:mga00v17_13054_c1 | 3300050491 | Bacteria | 4603 |
| 434 | nmdc:mga00v17_201_c1 | 3300050491 | Bacteria | 36027 |
| 435 | nmdc:mga00v17_52_c1 | 3300050491 | Bacteria | 72738 |
| 436 | nmdc:mga0yw44_4284_c1 | 3300050492 | Bacteria | 6510 |
| 437 | nmdc:mga07m45_84678_c1 | 3300050496 | Bacteria | 1812 |
| 438 | Ga0500643_032572 | 3300053087 | Bacteria | 1582 |
| 439 | Ga0500566_0002633 | 3300053094 | Bacteria | 10687 |
| 440 | Ga0500560_000407 | 3300053107 | Bacteria | 5854 |
| 441 | Ga0500595_004324 | 3300053119 | Bacteria | 6398 |
| 442 | Ga0500618_000055 | 3300053125 | Bacteria | 99876 |
| 443 | Ga0500618_000616 | 3300053125 | Bacteria | 21736 |
| 444 | Ga0500618_002635 | 3300053125 | Bacteria | 6609 |
| 445 | Ga0500618_004048 | 3300053125 | Bacteria | 4813 |
| 446 | Ga0500618_014196 | 3300053125 | Bacteria | 2040 |
| 447 | Ga0500658_0001240 | 3300053134 | Bacteria | 10358 |
| 448 | Ga0500561_0000114 | 3300053137 | Bacteria | 15576 |
| 449 | Ga0500568_0001799 | 3300053139 | Bacteria | 13200 |
| 450 | Ga0500573_0048611 | 3300053140 | Bacteria | 2441 |
| 451 | Ga0500616_0000224 | 3300053153 | Bacteria | 88293 |
| 452 | Ga0500616_0000328 | 3300053153 | Bacteria | 68215 |
| 453 | Ga0500616_0062932 | 3300053153 | Bacteria | 1915 |
| 454 | Ga0500622_0000919 | 3300053156 | Bacteria | 25030 |
| 455 | Ga0500622_0001161 | 3300053156 | Bacteria | 21882 |
| 456 | Ga0500624_000161 | 3300053157 | Bacteria | 27520 |
| 457 | Ga0500633_0000113 | 3300053160 | Bacteria | 10869 |
| 458 | Ga0500634_0014495 | 3300053161 | Bacteria | 4160 |
| 459 | Ga0500636_0000004 | 3300053177 | Bacteria | 202392 |
| 460 | Ga0500636_0045907 | 3300053177 | Bacteria | 2576 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003790 | Ga0055528_1007933 | Ga0055528_10079332 | 372 |
| 2 | 3300048924 | Ga0496121_0125056 | Ga0496121_0125056_14_1171 | 384 |
| 3 | 3300046616 | Ga0495668_0023282 | Ga0495668_0023282_11_1189 | 391 |
| 4 | 3300053177 | Ga0500636_0045907 | Ga0500636_0045907_1101_2507 | 396 |
| 5 | 3300014325 | Ga0163163_10087840 | Ga0163163_100878404 | 403 |
| 6 | 3300046476 | Ga0495662_0049991 | Ga0495662_0049991_780_1991 | 403 |
| 7 | 3300046522 | Ga0495643_0106004 | Ga0495643_0106004_182_1393 | 403 |
| 8 | 3300053125 | Ga0500618_014196 | Ga0500618_014196_16_1227 | 403 |
| 9 | 3300048929 | Ga0496126_0018669 | Ga0496126_0018669_1544_2818 | 404 |
| 10 | 3300025245 | Ga0207425_1010137 | Ga0207425_10101371 | 406 |
| 11 | 3300005262 | Ga0065165_1010294 | Ga0065165_10102944 | 407 |
| 12 | 3300048922 | Ga0496119_0029046 | Ga0496119_0029046_458_1732 | 407 |
| 13 | 3300048924 | Ga0496121_0001141 | Ga0496121_0001141_24752_26044 | 407 |
| 14 | 3300048924 | Ga0496121_0010484 | Ga0496121_0010484_4708_5982 | 407 |
| 15 | 3300013105 | Ga0157369_10068607 | Ga0157369_100686072 | 408 |
| 16 | 3300013105 | Ga0157369_10199134 | Ga0157369_101991342 | 408 |
| 17 | 3300027312 | Ga0209371_1001175 | Ga0209371_100117513 | 408 |
| 18 | 3300048927 | Ga0496124_0000133 | Ga0496124_0000133_67662_68954 | 408 |
| 19 | 3300048927 | Ga0496124_0109217 | Ga0496124_0109217_22_1314 | 408 |
| 20 | 3300005548 | Ga0070665_100192518 | Ga0070665_1001925182 | 410 |
| 21 | 3300006946 | Ga0079104_1000010 | Ga0079104_100001059 | 410 |
| 22 | 3300027111 | Ga0209281_1000053 | Ga0209281_100005358 | 410 |
| 23 | 3300046460 | Ga0495638_0000854 | Ga0495638_0000854_6035_7327 | 410 |
| 24 | 3300048924 | Ga0496121_0050304 | Ga0496121_0050304_1338_2630 | 410 |
| 25 | 3300048927 | Ga0496124_0025344 | Ga0496124_0025344_3447_4739 | 410 |
| 26 | 3300053139 | Ga0500568_0001799 | Ga0500568_0001799_6001_7293 | 410 |
| 27 | 3300053153 | Ga0500616_0000328 | Ga0500616_0000328_59608_60900 | 410 |
| 28 | 3300027312 | Ga0209371_1000009 | Ga0209371_100000934 | 411 |
| 29 | 3300030500 | Ga0268256_1000010 | Ga0268256_100001034 | 411 |
| 30 | 3300041413 | Ga0439465_0004088 | Ga0439465_0004088_2747_4039 | 411 |
| 31 | 3300042006 | Ga0439432_033106 | Ga0439432_033106_126_1418 | 411 |
| 32 | 3300046474 | Ga0495605_0000331 | Ga0495605_0000331_19851_21143 | 411 |
| 33 | 3300046501 | Ga0495607_0026847 | Ga0495607_0026847_1503_2795 | 411 |
| 34 | 3300046513 | Ga0495616_0021617 | Ga0495616_0021617_473_1765 | 411 |
| 35 | 3300046515 | Ga0495620_0010432 | Ga0495620_0010432_1676_2968 | 411 |
| 36 | 3300046518 | Ga0495631_0003782 | Ga0495631_0003782_6613_7905 | 411 |
| 37 | 3300046519 | Ga0495632_0006079 | Ga0495632_0006079_5997_7289 | 411 |
| 38 | 3300046538 | Ga0495609_0031792 | Ga0495609_0031792_321_1613 | 411 |
| 39 | 3300046616 | Ga0495668_0007613 | Ga0495668_0007613_4666_5958 | 411 |
| 40 | 3300046660 | Ga0495625_0001965 | Ga0495625_0001965_14687_15979 | 411 |
| 41 | 3300046810 | Ga0495660_0007221 | Ga0495660_0007221_5152_6444 | 411 |
| 42 | 3300048925 | Ga0496122_0086661 | Ga0496122_0086661_233_1525 | 412 |
| 43 | 3300005262 | Ga0065165_1001869 | Ga0065165_10018698 | 414 |
| 44 | 3300049581 | Ga0501047_0001955 | Ga0501047_0001955_4128_5450 | 414 |
| 45 | 3300049584 | Ga0501068_0098395 | Ga0501068_0098395_183_1505 | 414 |
| 46 | 3300049585 | Ga0501069_0004546 | Ga0501069_0004546_149_1471 | 414 |
| 47 | 3300049586 | Ga0501070_0001389 | Ga0501070_0001389_449_1771 | 414 |
| 48 | 3300049588 | Ga0501072_0204362 | Ga0501072_0204362_71_1393 | 414 |
| 49 | 3300049589 | Ga0501073_0000206 | Ga0501073_0000206_28867_30189 | 414 |
| 50 | 3300049590 | Ga0501074_0000330 | Ga0501074_0000330_18704_20026 | 414 |
| 51 | 3300049744 | Ga0501083_0000293 | Ga0501083_0000293_14378_15700 | 414 |
| 52 | 3300049822 | Ga0501035_0170579 | Ga0501035_0170579_476_1798 | 414 |
| 53 | 3300049823 | Ga0501044_0034308 | Ga0501044_0034308_2344_3666 | 414 |
| 54 | 3300025294 | Ga0209025_1000074 | Ga0209025_1000074150 | 415 |
| 55 | 3300025294 | Ga0209025_1000080 | Ga0209025_1000080143 | 415 |
| 56 | 3300025929 | Ga0207664_10172947 | Ga0207664_101729472 | 415 |
| 57 | 3300025912 | Ga0207707_10111347 | Ga0207707_101113472 | 417 |
| 58 | 3300025917 | Ga0207660_10193806 | Ga0207660_101938061 | 417 |
| 59 | 3300005563 | Ga0068855_100010038 | Ga0068855_1000100385 | 419 |
| 60 | 3300009093 | Ga0105240_10049005 | Ga0105240_100490052 | 419 |
| 61 | 3300013104 | Ga0157370_10018273 | Ga0157370_100182735 | 419 |
| 62 | 3300025949 | Ga0207667_10031906 | Ga0207667_100319065 | 419 |
| 63 | 3300005356 | Ga0070674_100040340 | Ga0070674_1000403402 | 420 |
| 64 | 3300009098 | Ga0105245_10122532 | Ga0105245_101225322 | 420 |
| 65 | 3300009176 | Ga0105242_10085818 | Ga0105242_100858182 | 420 |
| 66 | 3300026075 | Ga0207708_10117069 | Ga0207708_101170692 | 420 |
| 67 | 3300026121 | Ga0207683_10137732 | Ga0207683_101377322 | 420 |
| 68 | 3300053094 | Ga0500566_0002633 | Ga0500566_0002633_6839_8116 | 420 |
| 69 | 3300032002 | Ga0307416_100153035 | Ga0307416_1001530352 | 421 |
| 70 | 3300048919 | Ga0496116_0001619 | Ga0496116_0001619_3761_5029 | 421 |
| 71 | iso_pu_bacteria | 2791355094 | 2792638428 | 421 |
| 72 | 3300003781 | Ga0055536_1003558 | Ga0055536_10035582 | 422 |
| 73 | 3300003781 | Ga0055536_1008275 | Ga0055536_10082754 | 422 |
| 74 | 3300003794 | Ga0055531_10024536 | Ga0055531_100245362 | 422 |
| 75 | 3300025292 | Ga0209676_1002222 | Ga0209676_10022224 | 422 |
| 76 | 3300046660 | Ga0495625_0000726 | Ga0495625_0000726_41120_42412 | 422 |
| 77 | iso_pu_bacteria | 2643221560 | 2643820667 | 422 |
| 78 | iso_pu_bacteria | 2791355091 | 2792622122 | 422 |
| 79 | iso_pu_bacteria | 2791355092 | 2792628313 | 422 |
| 80 | iso_pu_bacteria | 2937084907 | 2937091578 | 422 |
| 81 | 3300007788 | Ga0099795_10000284 | Ga0099795_100002845 | 423 |
| 82 | 3300010159 | Ga0099796_10004798 | Ga0099796_100047982 | 423 |
| 83 | 3300031251 | Ga0265327_10001708 | Ga0265327_1000170811 | 423 |
| 84 | iso_pu_bacteria | 2508501122 | 2509107461 | 423 |
| 85 | iso_pu_bacteria | 2509276019 | 2509374547 | 423 |
| 86 | iso_pu_bacteria | 2510065057 | 2510304464 | 423 |
| 87 | iso_pu_bacteria | 2511231052 | 2511500918 | 423 |
| 88 | iso_pu_bacteria | 2512047086 | 2512532340 | 423 |
| 89 | iso_pu_bacteria | 2512875026 | 2512972331 | 423 |
| 90 | iso_pu_bacteria | 2513237086 | 2513583544 | 423 |
| 91 | iso_pu_bacteria | 2513237089 | 2513603410 | 423 |
| 92 | iso_pu_bacteria | 2513237091 | 2513617529 | 423 |
| 93 | iso_pu_bacteria | 2513237140 | 2513882757 | 423 |
| 94 | iso_pu_bacteria | 2513237143 | 2513905302 | 423 |
| 95 | iso_pu_bacteria | 2513237160 | 2514004865 | 423 |
| 96 | iso_pu_bacteria | 2515154107 | 2515608043 | 423 |
| 97 | iso_pu_bacteria | 2516143018 | 2516208796 | 423 |
| 98 | iso_pu_bacteria | 2516653046 | 2516892195 | 423 |
| 99 | iso_pu_bacteria | 2517487022 | 2517569004 | 423 |
| 100 | iso_pu_bacteria | 2524023207 | 2524450241 | 423 |
| 101 | iso_pu_bacteria | 2551306084 | 2551676378 | 423 |
| 102 | iso_pu_bacteria | 2551306085 | 2551687485 | 423 |
| 103 | iso_pu_bacteria | 2551306087 | 2551699171 | 423 |
| 104 | iso_pu_bacteria | 2551306090 | 2551719052 | 423 |
| 105 | iso_pu_bacteria | 2551306091 | 2551730330 | 423 |
| 106 | iso_pu_bacteria | 2551306092 | 2551738827 | 423 |
| 107 | iso_pu_bacteria | 2551306093 | 2551745388 | 423 |
| 108 | iso_pu_bacteria | 2558860100 | 2558863575 | 423 |
| 109 | iso_pu_bacteria | 2657244999 | 2657682229 | 423 |
| 110 | iso_pu_bacteria | 2690316117 | 2692316909 | 423 |
| 111 | iso_pu_bacteria | 2751185821 | 2753458885 | 423 |
| 112 | iso_pu_bacteria | 2791355082 | 2792584077 | 423 |
| 113 | iso_pu_bacteria | 2802428858 | 2802717647 | 423 |
| 114 | iso_pu_bacteria | 2802428859 | 2802723426 | 423 |
| 115 | iso_pu_bacteria | 2802428860 | 2802731124 | 423 |
| 116 | iso_pu_bacteria | 2802428861 | 2802736130 | 423 |
| 117 | iso_pu_bacteria | 2802428862 | 2802743659 | 423 |
| 118 | iso_pu_bacteria | 2802428863 | 2802750629 | 423 |
| 119 | iso_pu_bacteria | 2802429268 | 2804751248 | 423 |
| 120 | iso_pu_bacteria | 2838074704 | 2838076354 | 423 |
| 121 | iso_pu_bacteria | 2847417321 | 2847418023 | 423 |
| 122 | iso_pu_bacteria | 2848992105 | 2848992999 | 423 |
| 123 | iso_pu_bacteria | 2850079185 | 2850080385 | 423 |
| 124 | iso_pu_bacteria | 2855825444 | 2855831269 | 423 |
| 125 | iso_pu_bacteria | 2855839649 | 2855840394 | 423 |
| 126 | iso_pu_bacteria | 2855872281 | 2855879061 | 423 |
| 127 | iso_pu_bacteria | 2858800743 | 2858800923 | 423 |
| 128 | iso_pu_bacteria | 2896384573 | 2896386556 | 423 |
| 129 | iso_pu_bacteria | 2915980308 | 2915986126 | 423 |
| 130 | iso_pu_bacteria | 2915986958 | 2915989992 | 423 |
| 131 | iso_pu_bacteria | 2915993759 | 2915996547 | 423 |
| 132 | iso_pu_bacteria | 2916000859 | 2916005850 | 423 |
| 133 | iso_pu_bacteria | 2916007675 | 2916010873 | 423 |
| 134 | iso_pu_bacteria | 2916014648 | 2916020946 | 423 |
| 135 | iso_pu_bacteria | 2916021584 | 2916027500 | 423 |
| 136 | iso_pu_bacteria | 2916028427 | 2916028866 | 423 |
| 137 | iso_pu_bacteria | 2916035215 | 2916035365 | 423 |
| 138 | iso_pu_bacteria | 2916041962 | 2916043067 | 423 |
| 139 | iso_pu_bacteria | 2916048683 | 2916054708 | 423 |
| 140 | iso_pu_bacteria | 2916055098 | 2916061407 | 423 |
| 141 | iso_pu_bacteria | 2916061851 | 2916068026 | 423 |
| 142 | iso_pu_bacteria | 2916068649 | 2916072047 | 423 |
| 143 | iso_pu_bacteria | 2920760137 | 2920762959 | 423 |
| 144 | iso_pu_bacteria | 2921201388 | 2921204299 | 423 |
| 145 | iso_pu_bacteria | 2921208531 | 2921215162 | 423 |
| 146 | iso_pu_bacteria | 2921237296 | 2921243942 | 423 |
| 147 | iso_pu_bacteria | 2921244191 | 2921245979 | 423 |
| 148 | iso_pu_bacteria | 2921250672 | 2921250910 | 423 |
| 149 | iso_pu_bacteria | 2921257292 | 2921261556 | 423 |
| 150 | iso_pu_bacteria | 2921263974 | 2921269368 | 423 |
| 151 | iso_pu_bacteria | 2921282425 | 2921288024 | 423 |
| 152 | iso_pu_bacteria | 2921289301 | 2921290184 | 423 |
| 153 | iso_pu_bacteria | 2921296804 | 2921303564 | 423 |
| 154 | iso_pu_bacteria | 2924144063 | 2924146909 | 423 |
| 155 | iso_pu_bacteria | 2924150972 | 2924153302 | 423 |
| 156 | iso_pu_bacteria | 2924158325 | 2924160519 | 423 |
| 157 | iso_pu_bacteria | 2924165586 | 2924166833 | 423 |
| 158 | iso_pu_bacteria | 2924172951 | 2924178536 | 423 |
| 159 | iso_pu_bacteria | 2924179722 | 2924181479 | 423 |
| 160 | iso_pu_bacteria | 2924186466 | 2924190303 | 423 |
| 161 | iso_pu_bacteria | 2924200457 | 2924204376 | 423 |
| 162 | iso_pu_bacteria | 2924207177 | 2924209856 | 423 |
| 163 | iso_pu_bacteria | 2924214083 | 2924216446 | 423 |
| 164 | iso_pu_bacteria | 2924221636 | 2924224422 | 423 |
| 165 | iso_pu_bacteria | 2924228884 | 2924234882 | 423 |
| 166 | iso_pu_bacteria | 2936996657 | 2937000473 | 423 |
| 167 | iso_pu_bacteria | 2937002841 | 2937009569 | 423 |
| 168 | iso_pu_bacteria | 2937009748 | 2937010833 | 423 |
| 169 | iso_pu_bacteria | 2937016420 | 2937022045 | 423 |
| 170 | iso_pu_bacteria | 2937023124 | 2937027978 | 423 |
| 171 | iso_pu_bacteria | 2937029754 | 2937029912 | 423 |
| 172 | iso_pu_bacteria | 2937036028 | 2937041575 | 423 |
| 173 | iso_pu_bacteria | 2937042894 | 2937046006 | 423 |
| 174 | iso_pu_bacteria | 2937049772 | 2937050292 | 423 |
| 175 | iso_pu_bacteria | 2937056579 | 2937061587 | 423 |
| 176 | iso_pu_bacteria | 2937063883 | 2937066466 | 423 |
| 177 | iso_pu_bacteria | 2937071275 | 2937073826 | 423 |
| 178 | iso_pu_bacteria | 2937078374 | 2937083019 | 423 |
| 179 | iso_pu_bacteria | 2937091812 | 2937098938 | 423 |
| 180 | iso_pu_bacteria | 2937098957 | 2937103689 | 423 |
| 181 | iso_pu_bacteria | 2937106411 | 2937113008 | 423 |
| 182 | iso_pu_bacteria | 2937113482 | 2937118227 | 423 |
| 183 | iso_pu_bacteria | 2937119839 | 2937121132 | 423 |
| 184 | iso_pu_bacteria | 2937126314 | 2937130139 | 423 |
| 185 | iso_pu_bacteria | 2957375807 | 2957380071 | 423 |
| 186 | iso_pu_bacteria | 2957382221 | 2957385122 | 423 |
| 187 | iso_pu_bacteria | 2957388812 | 2957389185 | 423 |
| 188 | iso_pu_bacteria | 2957395598 | 2957398651 | 423 |
| 189 | iso_pu_bacteria | 2957402308 | 2957405501 | 423 |
| 190 | iso_pu_bacteria | 2957408893 | 2957415226 | 423 |
| 191 | iso_pu_bacteria | 2957415311 | 2957418033 | 423 |
| 192 | iso_pu_bacteria | 2957422303 | 2957426802 | 423 |
| 193 | iso_pu_bacteria | 2957430029 | 2957433128 | 423 |
| 194 | iso_pu_bacteria | 2957437181 | 2957438952 | 423 |
| 195 | iso_pu_bacteria | 2957443900 | 2957446705 | 423 |
| 196 | iso_pu_bacteria | 2957450854 | 2957453493 | 423 |
| 197 | iso_pu_bacteria | 2957457609 | 2957457813 | 423 |
| 198 | iso_pu_bacteria | 2957464669 | 2957466461 | 423 |
| 199 | iso_pu_bacteria | 2957471148 | 2957473967 | 423 |
| 200 | iso_pu_bacteria | 2957478035 | 2957483716 | 423 |
| 201 | iso_pu_bacteria | 2957484790 | 2957485843 | 423 |
| 202 | iso_pu_bacteria | 2957491536 | 2957495942 | 423 |
| 203 | iso_pu_bacteria | 2957505466 | 2957511488 | 423 |
| 204 | iso_pu_bacteria | 2960584000 | 2960590036 | 423 |
| 205 | iso_pu_bacteria | 2960591022 | 2960595526 | 423 |
| 206 | iso_pu_bacteria | 2960597568 | 2960600628 | 423 |
| 207 | iso_pu_bacteria | 2960603979 | 2960609405 | 423 |
| 208 | iso_pu_bacteria | 2960610863 | 2960617075 | 423 |
| 209 | iso_pu_bacteria | 2960617483 | 2960617652 | 423 |
| 210 | iso_pu_bacteria | 2960624210 | 2960626110 | 423 |
| 211 | iso_pu_bacteria | 2960631154 | 2960633273 | 423 |
| 212 | iso_pu_bacteria | 2960637947 | 2960645336 | 423 |
| 213 | iso_pu_bacteria | 2960645483 | 2960648781 | 423 |
| 214 | iso_pu_bacteria | 2960652885 | 2960653739 | 423 |
| 215 | iso_pu_bacteria | 2960660292 | 2960662329 | 423 |
| 216 | iso_pu_bacteria | 2960667422 | 2960673872 | 423 |
| 217 | iso_pu_bacteria | 2960674078 | 2960676842 | 423 |
| 218 | iso_pu_bacteria | 2960680706 | 2960684116 | 423 |
| 219 | iso_pu_bacteria | 2960687367 | 2960688890 | 423 |
| 220 | iso_pu_bacteria | 2960693952 | 2960696327 | 423 |
| 221 | iso_pu_bacteria | 2964607997 | 2964613001 | 423 |
| 222 | iso_pu_bacteria | 2964615318 | 2964617629 | 423 |
| 223 | iso_pu_bacteria | 2964621998 | 2964627894 | 423 |
| 224 | iso_pu_bacteria | 2964628898 | 2964633170 | 423 |
| 225 | iso_pu_bacteria | 2964636051 | 2964642208 | 423 |
| 226 | iso_pu_bacteria | 2964643177 | 2964648757 | 423 |
| 227 | iso_pu_bacteria | 2964649959 | 2964653049 | 423 |
| 228 | iso_pu_bacteria | 2964656573 | 2964661081 | 423 |
| 229 | iso_pu_bacteria | 2964663802 | 2964666026 | 423 |
| 230 | iso_pu_bacteria | 2964670856 | 2964671786 | 423 |
| 231 | iso_pu_bacteria | 2964678106 | 2964684475 | 423 |
| 232 | iso_pu_bacteria | 2964685014 | 2964685409 | 423 |
| 233 | iso_pu_bacteria | 2964691889 | 2964695788 | 423 |
| 234 | iso_pu_bacteria | 2964698721 | 2964699552 | 423 |
| 235 | iso_pu_bacteria | 2964705432 | 2964712375 | 423 |
| 236 | iso_pu_bacteria | 2964712639 | 2964718482 | 423 |
| 237 | iso_pu_bacteria | 2964719344 | 2964725776 | 423 |
| 238 | iso_pu_bacteria | 2967664464 | 2967667317 | 423 |
| 239 | iso_pu_bacteria | 2967671571 | 2967672197 | 423 |
| 240 | iso_pu_bacteria | 2967678726 | 2967678871 | 423 |
| 241 | iso_pu_bacteria | 2967686174 | 2967686369 | 423 |
| 242 | iso_pu_bacteria | 2967693043 | 2967693192 | 423 |
| 243 | iso_pu_bacteria | 2967699805 | 2967701767 | 423 |
| 244 | iso_pu_bacteria | 2967706974 | 2967709220 | 423 |
| 245 | iso_pu_bacteria | 2967714385 | 2967716583 | 423 |
| 246 | iso_pu_bacteria | 2967721400 | 2967724805 | 423 |
| 247 | iso_pu_bacteria | 2967728569 | 2967734781 | 423 |
| 248 | iso_pu_bacteria | 2967735183 | 2967740951 | 423 |
| 249 | iso_pu_bacteria | 2967742019 | 2967742320 | 423 |
| 250 | iso_pu_bacteria | 2967748971 | 2967752158 | 423 |
| 251 | iso_pu_bacteria | 2967755722 | 2967757681 | 423 |
| 252 | iso_pu_bacteria | 2967762386 | 2967763766 | 423 |
| 253 | iso_pu_bacteria | 2967769361 | 2967774413 | 423 |
| 254 | iso_pu_bacteria | 2967775926 | 2967777179 | 423 |
| 255 | iso_pu_bacteria | 2970019648 | 2970026017 | 423 |
| 256 | iso_pu_bacteria | 2970026789 | 2970032864 | 423 |
| 257 | iso_pu_bacteria | 2970033650 | 2970037182 | 423 |
| 258 | iso_pu_bacteria | 2970040964 | 2970043338 | 423 |
| 259 | iso_pu_bacteria | 2970047711 | 2970049972 | 423 |
| 260 | iso_pu_bacteria | 2970054988 | 2970059661 | 423 |
| 261 | iso_pu_bacteria | 2970061556 | 2970065348 | 423 |
| 262 | iso_pu_bacteria | 2970068827 | 2970074028 | 423 |
| 263 | iso_pu_bacteria | 2970076120 | 2970077021 | 423 |
| 264 | iso_pu_bacteria | 2970082768 | 2970085700 | 423 |
| 265 | iso_pu_bacteria | 2970088815 | 2970093255 | 423 |
| 266 | iso_pu_bacteria | 2970095765 | 2970101657 | 423 |
| 267 | iso_pu_bacteria | 2970102677 | 2970108511 | 423 |
| 268 | iso_pu_bacteria | 2970109326 | 2970109872 | 423 |
| 269 | iso_pu_bacteria | 2970116247 | 2970118021 | 423 |
| 270 | iso_pu_bacteria | 2970122695 | 2970128225 | 423 |
| 271 | iso_pu_bacteria | 2970129317 | 2970129465 | 423 |
| 272 | iso_pu_bacteria | 2970136068 | 2970136974 | 423 |
| 273 | iso_pu_bacteria | 2970143518 | 2970149097 | 423 |
| 274 | iso_pu_bacteria | 2970149975 | 2970153867 | 423 |
| 275 | iso_pu_bacteria | 2970156795 | 2970162397 | 423 |
| 276 | iso_pu_bacteria | 2970164137 | 2970167451 | 423 |
| 277 | iso_pu_bacteria | 2970170962 | 2970171740 | 423 |
| 278 | iso_pu_bacteria | 2970177841 | 2970179222 | 423 |
| 279 | iso_pu_bacteria | 2970184632 | 2970189409 | 423 |
| 280 | iso_pu_bacteria | 2970191845 | 2970198377 | 423 |
| 281 | iso_pu_bacteria | 2977516862 | 2977520904 | 423 |
| 282 | iso_pu_bacteria | 2977523885 | 2977527222 | 423 |
| 283 | iso_pu_bacteria | 2977537788 | 2977537936 | 423 |
| 284 | iso_pu_bacteria | 2977544691 | 2977544885 | 423 |
| 285 | iso_pu_bacteria | 2977551784 | 2977551933 | 423 |
| 286 | iso_pu_bacteria | 2977558990 | 2977563145 | 423 |
| 287 | iso_pu_bacteria | 2977565890 | 2977568896 | 423 |
| 288 | iso_pu_bacteria | 2977572785 | 2977579014 | 423 |
| 289 | iso_pu_bacteria | 2977579622 | 2977581547 | 423 |
| 290 | iso_pu_bacteria | 643692032 | 643825000 | 423 |
| 291 | iso_pu_bacteria | 648276728 | 648740550 | 423 |
| 292 | iso_pu_bacteria | 8003992118 | 8003992810 | 423 |
| 293 | iso_pu_bacteria | 8003999396 | 8004000136 | 423 |
| 294 | iso_pu_bacteria | 8049293176 | 8049293830 | 423 |
| 295 | 3300005262 | Ga0065165_1001548 | Ga0065165_100154810 | 424 |
| 296 | 3300005548 | Ga0070665_100002410 | Ga0070665_10000241016 | 424 |
| 297 | 3300025304 | Ga0209257_1001790 | Ga0209257_100179025 | 424 |
| 298 | 3300031456 | Ga0307513_10014591 | Ga0307513_100145911 | 424 |
| 299 | 3300032004 | Ga0307414_10002909 | Ga0307414_100029098 | 424 |
| 300 | 3300038705 | Ga0237819_00516 | Ga0237819_00516_9934_11235 | 424 |
| 301 | 3300039145 | Ga0237816_01893 | Ga0237816_01893_280_1581 | 424 |
| 302 | 3300046471 | Ga0495650_0000461 | Ga0495650_0000461_17983_19284 | 424 |
| 303 | 3300046506 | Ga0495583_0008848 | Ga0495583_0008848_2132_3433 | 424 |
| 304 | 3300046558 | Ga0495633_0008112 | Ga0495633_0008112_1841_3142 | 424 |
| 305 | 3300047472 | Ga0495686_0000238 | Ga0495686_0000238_53390_54712 | 424 |
| 306 | 3300053119 | Ga0500595_004324 | Ga0500595_004324_4575_5879 | 424 |
| 307 | 3300053157 | Ga0500624_000161 | Ga0500624_000161_19426_20745 | 424 |
| 308 | 3300041404 | Ga0439436_0025113 | Ga0439436_0025113_404_1687 | 425 |
| 309 | 3300045051 | Ga0451576_0025375 | Ga0451576_0025375_4099_5457 | 425 |
| 310 | 3300053156 | Ga0500622_0001161 | Ga0500622_0001161_15977_17344 | 425 |
| 311 | iso_pu_bacteria | 2509276021 | 2509387828 | 425 |
| 312 | iso_pu_bacteria | 2509276033 | 2509443446 | 425 |
| 313 | iso_pu_bacteria | 2510065019 | 2510132192 | 425 |
| 314 | iso_pu_bacteria | 2510461069 | 2510840978 | 425 |
| 315 | iso_pu_bacteria | 2510461076 | 2510898526 | 425 |
| 316 | iso_pu_bacteria | 2510917022 | 2511133601 | 425 |
| 317 | iso_pu_bacteria | 2510917026 | 2511171853 | 425 |
| 318 | iso_pu_bacteria | 2510917028 | 2511182129 | 425 |
| 319 | iso_pu_bacteria | 2510917030 | 2511199581 | 425 |
| 320 | iso_pu_bacteria | 2511231027 | 2511390381 | 425 |
| 321 | iso_pu_bacteria | 2513237084 | 2513569026 | 425 |
| 322 | iso_pu_bacteria | 2513237085 | 2513580053 | 425 |
| 323 | iso_pu_bacteria | 2513237088 | 2513596142 | 425 |
| 324 | iso_pu_bacteria | 2513237093 | 2513635680 | 425 |
| 325 | iso_pu_bacteria | 2513237103 | 2513709315 | 425 |
| 326 | iso_pu_bacteria | 2513237138 | 2513865732 | 425 |
| 327 | iso_pu_bacteria | 2513237144 | 2513907633 | 425 |
| 328 | iso_pu_bacteria | 2513237146 | 2513925603 | 425 |
| 329 | iso_pu_bacteria | 2513237159 | 2513999462 | 425 |
| 330 | iso_pu_bacteria | 2513237162 | 2514023108 | 425 |
| 331 | iso_pu_bacteria | 2515075009 | 2515111172 | 425 |
| 332 | iso_pu_bacteria | 2515154113 | 2515636040 | 425 |
| 333 | iso_pu_bacteria | 2515154114 | 2515642692 | 425 |
| 334 | iso_pu_bacteria | 2515154116 | 2515658791 | 425 |
| 335 | iso_pu_bacteria | 2515154134 | 2515743897 | 425 |
| 336 | iso_pu_bacteria | 2516653077 | 2517039817 | 425 |
| 337 | iso_pu_bacteria | 2516653085 | 2517075339 | 425 |
| 338 | iso_pu_bacteria | 2517093000 | 2517093943 | 425 |
| 339 | iso_pu_bacteria | 2517287029 | 2517405758 | 425 |
| 340 | iso_pu_bacteria | 2524023209 | 2524457913 | 425 |
| 341 | iso_pu_bacteria | 2529292951 | 2530644003 | 425 |
| 342 | iso_pu_bacteria | 2534681796 | 2535515611 | 425 |
| 343 | iso_pu_bacteria | 2558860983 | 2561465974 | 425 |
| 344 | iso_pu_bacteria | 2582581283 | 2585165457 | 425 |
| 345 | iso_pu_bacteria | 2582581294 | 2585202976 | 425 |
| 346 | iso_pu_bacteria | 2582581298 | 2585220876 | 425 |
| 347 | iso_pu_bacteria | 2582581299 | 2585230517 | 425 |
| 348 | iso_pu_bacteria | 2582581304 | 2585256710 | 425 |
| 349 | iso_pu_bacteria | 2582581306 | 2585266281 | 425 |
| 350 | iso_pu_bacteria | 2582581307 | 2585275752 | 425 |
| 351 | iso_pu_bacteria | 2582581308 | 2585278801 | 425 |
| 352 | iso_pu_bacteria | 2582581315 | 2585325585 | 425 |
| 353 | iso_pu_bacteria | 2582581316 | 2585329740 | 425 |
| 354 | iso_pu_bacteria | 2582581865 | 2585387282 | 425 |
| 355 | iso_pu_bacteria | 2582581866 | 2585397785 | 425 |
| 356 | iso_pu_bacteria | 2582581867 | 2585400253 | 425 |
| 357 | iso_pu_bacteria | 2585427526 | 2585525530 | 425 |
| 358 | iso_pu_bacteria | 2585427527 | 2585535911 | 425 |
| 359 | iso_pu_bacteria | 2585427528 | 2585543823 | 425 |
| 360 | iso_pu_bacteria | 2585427529 | 2585550025 | 425 |
| 361 | iso_pu_bacteria | 2585427530 | 2585554006 | 425 |
| 362 | iso_pu_bacteria | 2585427531 | 2585559329 | 425 |
| 363 | iso_pu_bacteria | 2585427590 | 2585822977 | 425 |
| 364 | iso_pu_bacteria | 2585427593 | 2585839310 | 425 |
| 365 | iso_pu_bacteria | 2585427594 | 2585847313 | 425 |
| 366 | iso_pu_bacteria | 2585427608 | 2585901204 | 425 |
| 367 | iso_pu_bacteria | 2585427609 | 2585905294 | 425 |
| 368 | iso_pu_bacteria | 2585427633 | 2585994989 | 425 |
| 369 | iso_pu_bacteria | 2585427634 | 2585999531 | 425 |
| 370 | iso_pu_bacteria | 2585428125 | 2587979591 | 425 |
| 371 | iso_pu_bacteria | 2599185156 | 2599333883 | 425 |
| 372 | iso_pu_bacteria | 2599185170 | 2599418698 | 425 |
| 373 | iso_pu_bacteria | 2599185236 | 2599724217 | 425 |
| 374 | iso_pu_bacteria | 2599185352 | 2600191843 | 425 |
| 375 | iso_pu_bacteria | 2600254933 | 2600375171 | 425 |
| 376 | iso_pu_bacteria | 2615840626 | 2616305925 | 425 |
| 377 | iso_pu_bacteria | 2615840698 | 2616553830 | 425 |
| 378 | iso_pu_bacteria | 2617270742 | 2617381924 | 425 |
| 379 | iso_pu_bacteria | 2643221557 | 2643807295 | 425 |
| 380 | iso_pu_bacteria | 2643221558 | 2643810092 | 425 |
| 381 | iso_pu_bacteria | 2643221568 | 2643855990 | 425 |
| 382 | iso_pu_bacteria | 2643221599 | 2644007818 | 425 |
| 383 | iso_pu_bacteria | 2643221607 | 2644046676 | 425 |
| 384 | iso_pu_bacteria | 2643221610 | 2644069707 | 425 |
| 385 | iso_pu_bacteria | 2643221618 | 2644109086 | 425 |
| 386 | iso_pu_bacteria | 2643221626 | 2644151606 | 425 |
| 387 | iso_pu_bacteria | 2643221634 | 2644191079 | 425 |
| 388 | iso_pu_bacteria | 2643221636 | 2644202383 | 425 |
| 389 | iso_pu_bacteria | 2643221637 | 2644206299 | 425 |
| 390 | iso_pu_bacteria | 2643221643 | 2644242786 | 425 |
| 391 | iso_pu_bacteria | 2643221653 | 2644296947 | 425 |
| 392 | iso_pu_bacteria | 2643221655 | 2644311742 | 425 |
| 393 | iso_pu_bacteria | 2643221659 | 2644330013 | 425 |
| 394 | iso_pu_bacteria | 2643221668 | 2644380678 | 425 |
| 395 | iso_pu_bacteria | 2643221675 | 2644414583 | 425 |
| 396 | iso_pu_bacteria | 2643221680 | 2644448240 | 425 |
| 397 | iso_pu_bacteria | 2643221686 | 2644479465 | 425 |
| 398 | iso_pu_bacteria | 2643221688 | 2644493487 | 425 |
| 399 | iso_pu_bacteria | 2643221689 | 2644500906 | 425 |
| 400 | iso_pu_bacteria | 2643221698 | 2644543233 | 425 |
| 401 | iso_pu_bacteria | 2643221712 | 2644617540 | 425 |
| 402 | iso_pu_bacteria | 2643221718 | 2644649947 | 425 |
| 403 | iso_pu_bacteria | 2643221719 | 2644655201 | 425 |
| 404 | iso_pu_bacteria | 2643221723 | 2644673640 | 425 |
| 405 | iso_pu_bacteria | 2643221726 | 2644689453 | 425 |
| 406 | iso_pu_bacteria | 2667528174 | 2671112757 | 425 |
| 407 | iso_pu_bacteria | 2718217927 | 2719384745 | 425 |
| 408 | iso_pu_bacteria | 2718217997 | 2719664505 | 425 |
| 409 | iso_pu_bacteria | 2718218009 | 2719730897 | 425 |
| 410 | iso_pu_bacteria | 2718218199 | 2720490925 | 425 |
| 411 | iso_pu_bacteria | 2718218232 | 2720612289 | 425 |
| 412 | iso_pu_bacteria | 2718218233 | 2720619127 | 425 |
| 413 | iso_pu_bacteria | 2718218235 | 2720630529 | 425 |
| 414 | iso_pu_bacteria | 2718218269 | 2720774222 | 425 |
| 415 | iso_pu_bacteria | 2718218363 | 2721146241 | 425 |
| 416 | iso_pu_bacteria | 2718218365 | 2721157762 | 425 |
| 417 | iso_pu_bacteria | 2718218366 | 2721163121 | 425 |
| 418 | iso_pu_bacteria | 2718218423 | 2721398456 | 425 |
| 419 | iso_pu_bacteria | 2721755514 | 2722839291 | 425 |
| 420 | iso_pu_bacteria | 2721755556 | 2723025947 | 425 |
| 421 | iso_pu_bacteria | 2721755684 | 2723559493 | 425 |
| 422 | iso_pu_bacteria | 2721755685 | 2723566110 | 425 |
| 423 | iso_pu_bacteria | 2721755809 | 2724037269 | 425 |
| 424 | iso_pu_bacteria | 2721755810 | 2724043653 | 425 |
| 425 | iso_pu_bacteria | 2721755819 | 2724088829 | 425 |
| 426 | iso_pu_bacteria | 2721755822 | 2724103375 | 425 |
| 427 | iso_pu_bacteria | 2721755823 | 2724109213 | 425 |
| 428 | iso_pu_bacteria | 2724679232 | 2725951080 | 425 |
| 429 | iso_pu_bacteria | 2728369352 | 2730106883 | 425 |
| 430 | iso_pu_bacteria | 2728369365 | 2730163385 | 425 |
| 431 | iso_pu_bacteria | 2728369397 | 2730297394 | 425 |
| 432 | iso_pu_bacteria | 2738541293 | 2738803638 | 425 |
| 433 | iso_pu_bacteria | 2738541317 | 2738948795 | 425 |
| 434 | iso_pu_bacteria | 2738541333 | 2739039068 | 425 |
| 435 | iso_pu_bacteria | 2765235802 | 2765466322 | 425 |
| 436 | iso_pu_bacteria | 2765235942 | 2766067714 | 425 |
| 437 | iso_pu_bacteria | 2767802442 | 2770198957 | 425 |
| 438 | iso_pu_bacteria | 2775506902 | 2776270217 | 425 |
| 439 | iso_pu_bacteria | 2775506904 | 2776285056 | 425 |
| 440 | iso_pu_bacteria | 2775507049 | 2776912651 | 425 |
| 441 | iso_pu_bacteria | 2775507266 | 2778177360 | 425 |
| 442 | iso_pu_bacteria | 2791355253 | 2793282834 | 425 |
| 443 | iso_pu_bacteria | 2791355256 | 2793299746 | 425 |
| 444 | iso_pu_bacteria | 2791355259 | 2793316917 | 425 |
| 445 | iso_pu_bacteria | 2791355261 | 2793329346 | 425 |
| 446 | iso_pu_bacteria | 2791355262 | 2793336149 | 425 |
| 447 | iso_pu_bacteria | 2791355263 | 2793339909 | 425 |
| 448 | iso_pu_bacteria | 2791355264 | 2793350081 | 425 |
| 449 | iso_pu_bacteria | 2791355265 | 2793353463 | 425 |
| 450 | iso_pu_bacteria | 2791355266 | 2793358785 | 425 |
| 451 | iso_pu_bacteria | 2791355267 | 2793370495 | 425 |
| 452 | iso_pu_bacteria | 2802429605 | 2805930413 | 425 |
| 453 | iso_pu_bacteria | 2802429606 | 2805936163 | 425 |
| 454 | iso_pu_bacteria | 2802429633 | 2806049487 | 425 |
| 455 | iso_pu_bacteria | 2802429634 | 2806056582 | 425 |
| 456 | iso_pu_bacteria | 2802429635 | 2806063640 | 425 |
| 457 | iso_pu_bacteria | 2802429636 | 2806067637 | 425 |
| 458 | iso_pu_bacteria | 2802429637 | 2806077977 | 425 |
| 459 | iso_pu_bacteria | 2818991272 | 2819242662 | 425 |
| 460 | iso_pu_bacteria | 2818991448 | 2819613643 | 425 |
| 461 | iso_pu_bacteria | 2818991453 | 2819639354 | 425 |
| 462 | iso_pu_bacteria | 2818991461 | 2819684267 | 425 |
| 463 | iso_pu_bacteria | 2821123053 | 2821124144 | 425 |
| 464 | iso_pu_bacteria | 2838016132 | 2838017174 | 425 |
| 465 | iso_pu_bacteria | 2838022645 | 2838026922 | 425 |
| 466 | iso_pu_bacteria | 2838029111 | 2838031309 | 425 |
| 467 | iso_pu_bacteria | 2838035591 | 2838037611 | 425 |
| 468 | iso_pu_bacteria | 2838042994 | 2838047043 | 425 |
| 469 | iso_pu_bacteria | 2838048938 | 2838049342 | 425 |
| 470 | iso_pu_bacteria | 2838061910 | 2838067231 | 425 |
| 471 | iso_pu_bacteria | 2838068647 | 2838073221 | 425 |
| 472 | iso_pu_bacteria | 2838661181 | 2838662619 | 425 |
| 473 | iso_pu_bacteria | 2838668709 | 2838670742 | 425 |
| 474 | iso_pu_bacteria | 2838680041 | 2838681210 | 425 |
| 475 | iso_pu_bacteria | 2838686498 | 2838688744 | 425 |
| 476 | iso_pu_bacteria | 2838694306 | 2838694756 | 425 |
| 477 | iso_pu_bacteria | 2838701080 | 2838703113 | 425 |
| 478 | iso_pu_bacteria | 2838707686 | 2838708133 | 425 |
| 479 | iso_pu_bacteria | 2838729681 | 2838731039 | 425 |
| 480 | iso_pu_bacteria | 2838736955 | 2838738832 | 425 |
| 481 | iso_pu_bacteria | 2838742623 | 2838744067 | 425 |
| 482 | iso_pu_bacteria | 2839993093 | 2839998337 | 425 |
| 483 | iso_pu_bacteria | 2840764183 | 2840765930 | 425 |
| 484 | iso_pu_bacteria | 2841840854 | 2841842731 | 425 |
| 485 | iso_pu_bacteria | 2841851746 | 2841856967 | 425 |
| 486 | iso_pu_bacteria | 2841864319 | 2841870404 | 425 |
| 487 | iso_pu_bacteria | 2842077413 | 2842080635 | 425 |
| 488 | iso_pu_bacteria | 2842110456 | 2842116004 | 425 |
| 489 | iso_pu_bacteria | 2842118031 | 2842121254 | 425 |
| 490 | iso_pu_bacteria | 2842140634 | 2842142511 | 425 |
| 491 | iso_pu_bacteria | 2842146304 | 2842147663 | 425 |
| 492 | iso_pu_bacteria | 2842156927 | 2842159918 | 425 |
| 493 | iso_pu_bacteria | 2842163707 | 2842168161 | 425 |
| 494 | iso_pu_bacteria | 2842180545 | 2842183465 | 425 |
| 495 | iso_pu_bacteria | 2842192696 | 2842193547 | 425 |
| 496 | iso_pu_bacteria | 2842198810 | 2842202526 | 425 |
| 497 | iso_pu_bacteria | 2842205361 | 2842207804 | 425 |
| 498 | iso_pu_bacteria | 2842217011 | 2842220694 | 425 |
| 499 | iso_pu_bacteria | 2842229732 | 2842234055 | 425 |
| 500 | iso_pu_bacteria | 2842237096 | 2842237545 | 425 |
| 501 | iso_pu_bacteria | 2842243621 | 2842245531 | 425 |
| 502 | iso_pu_bacteria | 2842250916 | 2842252729 | 425 |
| 503 | iso_pu_bacteria | 2842257432 | 2842259819 | 425 |
| 504 | iso_pu_bacteria | 2842264693 | 2842269228 | 425 |
| 505 | iso_pu_bacteria | 2842271015 | 2842274658 | 425 |
| 506 | iso_pu_bacteria | 2842278818 | 2842281401 | 425 |
| 507 | iso_pu_bacteria | 2842285085 | 2842287227 | 425 |
| 508 | iso_pu_bacteria | 2842291075 | 2842294292 | 425 |
| 509 | iso_pu_bacteria | 2842298080 | 2842300469 | 425 |
| 510 | iso_pu_bacteria | 2842304105 | 2842306903 | 425 |
| 511 | iso_pu_bacteria | 2842311132 | 2842314565 | 425 |
| 512 | iso_pu_bacteria | 2842317721 | 2842318757 | 425 |
| 513 | iso_pu_bacteria | 2842341865 | 2842343712 | 425 |
| 514 | iso_pu_bacteria | 2842357229 | 2842358413 | 425 |
| 515 | iso_pu_bacteria | 2842363717 | 2842365060 | 425 |
| 516 | iso_pu_bacteria | 2842370503 | 2842371673 | 425 |
| 517 | iso_pu_bacteria | 2842377471 | 2842380689 | 425 |
| 518 | iso_pu_bacteria | 2842384541 | 2842387760 | 425 |
| 519 | iso_pu_bacteria | 2842395702 | 2842400845 | 425 |
| 520 | iso_pu_bacteria | 2842402390 | 2842404495 | 425 |
| 521 | iso_pu_bacteria | 2842409023 | 2842410820 | 425 |
| 522 | iso_pu_bacteria | 2842415677 | 2842417724 | 425 |
| 523 | iso_pu_bacteria | 2842422224 | 2842426606 | 425 |
| 524 | iso_pu_bacteria | 2842428310 | 2842433289 | 425 |
| 525 | iso_pu_bacteria | 2842434925 | 2842439714 | 425 |
| 526 | iso_pu_bacteria | 2842441272 | 2842446343 | 425 |
| 527 | iso_pu_bacteria | 2842447887 | 2842453481 | 425 |
| 528 | iso_pu_bacteria | 2842462802 | 2842467611 | 425 |
| 529 | iso_pu_bacteria | 2842469257 | 2842474226 | 425 |
| 530 | iso_pu_bacteria | 2842475841 | 2842478096 | 425 |
| 531 | iso_pu_bacteria | 2842482326 | 2842482748 | 425 |
| 532 | iso_pu_bacteria | 2842489311 | 2842494870 | 425 |
| 533 | iso_pu_bacteria | 2842495871 | 2842497392 | 425 |
| 534 | iso_pu_bacteria | 2842502639 | 2842504905 | 425 |
| 535 | iso_pu_bacteria | 2842509118 | 2842509620 | 425 |
| 536 | iso_pu_bacteria | 2842521101 | 2842525255 | 425 |
| 537 | iso_pu_bacteria | 2842871566 | 2842872350 | 425 |
| 538 | iso_pu_bacteria | 2842922631 | 2842923718 | 425 |
| 539 | iso_pu_bacteria | 2844163670 | 2844163909 | 425 |
| 540 | iso_pu_bacteria | 2844454524 | 2844455269 | 425 |
| 541 | iso_pu_bacteria | 2852387548 | 2852388960 | 425 |
| 542 | iso_pu_bacteria | 2854896431 | 2854898772 | 425 |
| 543 | iso_pu_bacteria | 2854916844 | 2854921644 | 425 |
| 544 | iso_pu_bacteria | 2857516855 | 2857520403 | 425 |
| 545 | iso_pu_bacteria | 2857531043 | 2857531725 | 425 |
| 546 | iso_pu_bacteria | 2891373044 | 2891376580 | 425 |
| 547 | iso_pu_bacteria | 2894652903 | 2894654985 | 425 |
| 548 | iso_pu_bacteria | 2899803654 | 2899806098 | 425 |
| 549 | iso_pu_bacteria | 2904578770 | 2904582312 | 425 |
| 550 | iso_pu_bacteria | 2913308742 | 2913311065 | 425 |
| 551 | iso_pu_bacteria | 2919100787 | 2919103714 | 425 |
| 552 | iso_pu_bacteria | 2919119836 | 2919122898 | 425 |
| 553 | iso_pu_bacteria | 2919166419 | 2919167244 | 425 |
| 554 | iso_pu_bacteria | 2919171160 | 2919171554 | 425 |
| 555 | iso_pu_bacteria | 2919408235 | 2919409196 | 425 |
| 556 | iso_pu_bacteria | 2920822456 | 2920823761 | 425 |
| 557 | iso_pu_bacteria | 2923556063 | 2923557682 | 425 |
| 558 | iso_pu_bacteria | 2928521798 | 2928524249 | 425 |
| 559 | iso_pu_bacteria | 2929138655 | 2929139332 | 425 |
| 560 | iso_pu_bacteria | 2933016740 | 2933018763 | 425 |
| 561 | iso_pu_bacteria | 2933570622 | 2933572982 | 425 |
| 562 | iso_pu_bacteria | 2933586486 | 2933592037 | 425 |
| 563 | iso_pu_bacteria | 2933599457 | 2933603414 | 425 |
| 564 | iso_pu_bacteria | 2935894831 | 2935895279 | 425 |
| 565 | iso_pu_bacteria | 2935901341 | 2935904266 | 425 |
| 566 | iso_pu_bacteria | 2936367885 | 2936368236 | 425 |
| 567 | iso_pu_bacteria | 2936375103 | 2936378891 | 425 |
| 568 | iso_pu_bacteria | 2936381700 | 2936386823 | 425 |
| 569 | iso_pu_bacteria | 2941499720 | 2941500307 | 425 |
| 570 | iso_pu_bacteria | 2954011201 | 2954013199 | 425 |
| 571 | iso_pu_bacteria | 2978969890 | 2978973677 | 425 |
| 572 | iso_pu_bacteria | 2984587000 | 2984591951 | 425 |
| 573 | iso_pu_bacteria | 2989349275 | 2989354283 | 425 |
| 574 | iso_pu_bacteria | 2989776772 | 2989778071 | 425 |
| 575 | iso_pu_bacteria | 2996887358 | 2996890861 | 425 |
| 576 | iso_pu_bacteria | 2996893221 | 2996895402 | 425 |
| 577 | iso_pu_bacteria | 3002141150 | 3002146180 | 425 |
| 578 | iso_pu_bacteria | 3005409236 | 3005412287 | 425 |
| 579 | iso_pu_bacteria | 3005416602 | 3005417036 | 425 |
| 580 | iso_pu_bacteria | 3005445848 | 3005446652 | 425 |
| 581 | iso_pu_bacteria | 3005452660 | 3005453336 | 425 |
| 582 | iso_pu_bacteria | 639633055 | 639647328 | 425 |
| 583 | iso_pu_bacteria | 8005246636 | 8005246685 | 425 |
| 584 | iso_pu_bacteria | 8005258706 | 8005262115 | 425 |
| 585 | iso_pu_bacteria | 8005275841 | 8005279463 | 425 |
| 586 | iso_pu_bacteria | 8005282627 | 8005287104 | 425 |
| 587 | iso_pu_bacteria | 8005289223 | 8005292687 | 425 |
| 588 | iso_pu_bacteria | 8005301065 | 8005304457 | 425 |
| 589 | iso_pu_bacteria | 8005307578 | 8005309038 | 425 |
| 590 | iso_pu_bacteria | 8005314921 | 8005315097 | 425 |
| 591 | iso_pu_bacteria | 8005321885 | 8005325388 | 425 |
| 592 | iso_pu_bacteria | 8005376324 | 8005376725 | 425 |
| 593 | iso_pu_bacteria | 8005382845 | 8005386108 | 425 |
| 594 | iso_pu_bacteria | 8005395548 | 8005397494 | 425 |
| 595 | iso_pu_bacteria | 8005430974 | 8005435410 | 425 |
| 596 | iso_pu_bacteria | 8005460587 | 8005461813 | 425 |
| 597 | iso_pu_bacteria | 8005484373 | 8005485732 | 425 |
| 598 | iso_pu_bacteria | 8005497431 | 8005499220 | 425 |
| 599 | iso_pu_bacteria | 8005542996 | 8005544241 | 425 |
| 600 | iso_pu_bacteria | 8005556819 | 8005563028 | 425 |
| 601 | iso_pu_bacteria | 8005563573 | 8005570325 | 425 |
| 602 | iso_pu_bacteria | 8005570704 | 8005574054 | 425 |
| 603 | iso_pu_bacteria | 8005619151 | 8005620413 | 425 |
| 604 | iso_pu_bacteria | 8005626139 | 8005629036 | 425 |
| 605 | iso_pu_bacteria | 8005645114 | 8005648124 | 425 |
| 606 | iso_pu_bacteria | 8005658619 | 8005660070 | 425 |
| 607 | iso_pu_bacteria | 8005668836 | 8005670636 | 425 |
| 608 | iso_pu_bacteria | 8005682033 | 8005684706 | 425 |
| 609 | iso_pu_bacteria | 8005688590 | 8005690878 | 425 |
| 610 | iso_pu_bacteria | 8005695170 | 8005698904 | 425 |
| 611 | iso_pu_bacteria | 8018127388 | 8018131184 | 425 |
| 612 | iso_pu_bacteria | 8018150411 | 8018153760 | 425 |
| 613 | iso_pu_bacteria | 8018163183 | 8018168287 | 425 |
| 614 | iso_pu_bacteria | 8018176218 | 8018177364 | 425 |
| 615 | iso_pu_bacteria | 8023680758 | 8023687110 | 425 |
| 616 | iso_pu_bacteria | 8024479707 | 8024480992 | 425 |
| 617 | iso_pu_bacteria | 8024486573 | 8024489853 | 425 |
| 618 | iso_pu_bacteria | 8024501048 | 8024503369 | 425 |
| 619 | iso_pu_bacteria | 8046767195 | 8046767562 | 425 |
| 620 | iso_pu_bacteria | 8054460903 | 8054461784 | 425 |
| 621 | iso_pu_bacteria | 8054558443 | 8054558764 | 425 |
| 622 | iso_pu_bacteria | 8055431914 | 8055434070 | 425 |
| 623 | iso_pu_bacteria | 8056375014 | 8056379456 | 425 |
| 624 | iso_pu_bacteria | 8056382006 | 8056384864 | 425 |
| 625 | iso_pu_bacteria | 8056875544 | 8056880026 | 425 |
| 626 | iso_pu_bacteria | 8057575449 | 8057579091 | 425 |
| 627 | iso_pu_bacteria | 8057874678 | 8057879632 | 425 |
| 628 | 3300006946 | Ga0079104_1002175 | Ga0079104_10021756 | 427 |
| 629 | 3300006946 | Ga0079104_1010103 | Ga0079104_10101032 | 427 |
| 630 | 3300021320 | Ga0214544_1000008 | Ga0214544_100000839 | 427 |
| 631 | 3300021321 | Ga0214542_1008369 | Ga0214542_10083696 | 427 |
| 632 | 3300021321 | Ga0214542_1010138 | Ga0214542_10101388 | 427 |
| 633 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003386 | 427 |
| 634 | 3300021327 | Ga0214543_1000004 | Ga0214543_100000417 | 427 |
| 635 | 3300022739 | Ga0228711_1000001 | Ga0228711_1000001160 | 427 |
| 636 | 3300022740 | Ga0228710_1000001 | Ga0228710_1000001164 | 427 |
| 637 | 3300027111 | Ga0209281_1000164 | Ga0209281_100016465 | 427 |
| 638 | 3300027111 | Ga0209281_1000377 | Ga0209281_100037718 | 427 |
| 639 | 3300027666 | Ga0209282_1000007 | Ga0209282_100000791 | 427 |
| 640 | 3300031251 | Ga0265327_10000778 | Ga0265327_1000077851 | 427 |
| 641 | 3300031251 | Ga0265327_10024281 | Ga0265327_100242812 | 427 |
| 642 | 3300031344 | Ga0265316_10006286 | Ga0265316_1000628612 | 427 |
| 643 | 3300031852 | Ga0307410_10095821 | Ga0307410_100958211 | 427 |
| 644 | 3300031967 | Ga0315914_1000006 | Ga0315914_1000006151 | 427 |
| 645 | 3300033430 | Ga0315913_1000002 | Ga0315913_100000291 | 427 |
| 646 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001395 | 427 |
| 647 | 3300042007 | Ga0439449_0006077 | Ga0439449_0006077_1833_3179 | 427 |
| 648 | 3300048919 | Ga0496116_0000036 | Ga0496116_0000036_153760_155052 | 427 |
| 649 | 3300048929 | Ga0496126_0000597 | Ga0496126_0000597_62037_63329 | 427 |
| 650 | 3300049571 | Ga0501034_0003022 | Ga0501034_0003022_5166_6461 | 427 |
| 651 | iso_pu_bacteria | 2537561587 | 2537877064 | 427 |
| 652 | iso_pu_bacteria | 2554235003 | 2554247015 | 427 |
| 653 | iso_pu_bacteria | 2558860242 | 2559294240 | 427 |
| 654 | iso_pu_bacteria | 2599185210 | 2599603425 | 427 |
| 655 | iso_pu_bacteria | 2600255279 | 2601608776 | 427 |
| 656 | iso_pu_bacteria | 2600255308 | 2601745550 | 427 |
| 657 | iso_pu_bacteria | 2643221582 | 2643918611 | 427 |
| 658 | iso_pu_bacteria | 2643221693 | 2644518844 | 427 |
| 659 | iso_pu_bacteria | 2808606387 | 2808985984 | 427 |
| 660 | iso_pu_bacteria | 2818991439 | 2819556106 | 427 |
| 661 | iso_pu_bacteria | 2838675328 | 2838676832 | 427 |
| 662 | iso_pu_bacteria | 2838714209 | 2838715716 | 427 |
| 663 | iso_pu_bacteria | 2838719591 | 2838720483 | 427 |
| 664 | iso_pu_bacteria | 2838724970 | 2838726472 | 427 |
| 665 | iso_pu_bacteria | 2841846520 | 2841847413 | 427 |
| 666 | iso_pu_bacteria | 2841859092 | 2841860048 | 427 |
| 667 | iso_pu_bacteria | 2842124991 | 2842126557 | 427 |
| 668 | iso_pu_bacteria | 2842130223 | 2842131725 | 427 |
| 669 | iso_pu_bacteria | 2842152218 | 2842153106 | 427 |
| 670 | iso_pu_bacteria | 2842170452 | 2842171960 | 427 |
| 671 | iso_pu_bacteria | 2842175837 | 2842176725 | 427 |
| 672 | iso_pu_bacteria | 2842187318 | 2842188825 | 427 |
| 673 | iso_pu_bacteria | 2842211629 | 2842213136 | 427 |
| 674 | iso_pu_bacteria | 2842224351 | 2842225245 | 427 |
| 675 | iso_pu_bacteria | 2842515876 | 2842516833 | 427 |
| 676 | iso_pu_bacteria | 2899792073 | 2899792116 | 427 |
| 677 | iso_pu_bacteria | 2899845264 | 2899846306 | 427 |
| 678 | iso_pu_bacteria | 2919114240 | 2919115919 | 427 |
| 679 | iso_pu_bacteria | 2926754445 | 2926756873 | 427 |
| 680 | iso_pu_bacteria | 2926760298 | 2926761098 | 427 |
| 681 | iso_pu_bacteria | 2933006813 | 2933007749 | 427 |
| 682 | iso_pu_bacteria | 2933011516 | 2933012525 | 427 |
| 683 | iso_pu_bacteria | 2933594066 | 2933594964 | 427 |
| 684 | iso_pu_bacteria | 2979089926 | 2979093619 | 427 |
| 685 | iso_pu_bacteria | 2979095461 | 2979098994 | 427 |
| 686 | iso_pu_bacteria | 2979100975 | 2979105598 | 427 |
| 687 | iso_pu_bacteria | 2984509177 | 2984512555 | 427 |
| 688 | iso_pu_bacteria | 2984518228 | 2984521084 | 427 |
| 689 | iso_pu_bacteria | 2984537506 | 2984540378 | 427 |
| 690 | iso_pu_bacteria | 2984601300 | 2984602575 | 427 |
| 691 | iso_pu_bacteria | 650716007 | 650739431 | 427 |
| 692 | iso_pu_bacteria | 8003570095 | 8003570473 | 427 |
| 693 | 3300005458 | Ga0070681_10111950 | Ga0070681_101119502 | 428 |
| 694 | 3300009174 | Ga0105241_10007637 | Ga0105241_100076378 | 428 |
| 695 | 3300009551 | Ga0105238_10019957 | Ga0105238_100199573 | 428 |
| 696 | 3300049570 | Ga0501033_0000038 | Ga0501033_0000038_29165_30451 | 428 |
| 697 | 3300049822 | Ga0501035_0000326 | Ga0501035_0000326_31474_32760 | 428 |
| 698 | 3300001979 | JGI24740J21852_10000602 | JGI24740J21852_100006027 | 429 |
| 699 | 3300002704 | JGI25155J39150_1000072 | JGI25155J39150_100007244 | 429 |
| 700 | 3300002705 | JGI25156J39149_1000086 | JGI25156J39149_100008648 | 429 |
| 701 | 3300002737 | JGI25162J39368_1000956 | JGI25162J39368_10009569 | 429 |
| 702 | 3300002737 | JGI25162J39368_1001709 | JGI25162J39368_10017096 | 429 |
| 703 | 3300002738 | JGI25154J39366_1000205 | JGI25154J39366_100020513 | 429 |
| 704 | 3300002741 | JGI25157J39369_1000113 | JGI25157J39369_100011348 | 429 |
| 705 | 3300002773 | JGI25152J39213_1000959 | JGI25152J39213_10009594 | 429 |
| 706 | 3300002774 | JGI25150J39212_1000031 | JGI25150J39212_100003122 | 429 |
| 707 | 3300002987 | JGI25159J45721_1000001 | JGI25159J45721_1000001312 | 429 |
| 708 | 3300002987 | JGI25159J45721_1000064 | JGI25159J45721_100006449 | 429 |
| 709 | 3300002987 | JGI25159J45721_1001419 | JGI25159J45721_10014194 | 429 |
| 710 | 3300003187 | JGI25151J46595_10000062 | JGI25151J46595_10000062102 | 429 |
| 711 | 3300003187 | JGI25151J46595_10007169 | JGI25151J46595_100071695 | 429 |
| 712 | 3300003187 | JGI25151J46595_10018956 | JGI25151J46595_100189562 | 429 |
| 713 | 3300003214 | JGI25165J46597_1001014 | JGI25165J46597_10010149 | 429 |
| 714 | 3300003214 | JGI25165J46597_1001037 | JGI25165J46597_10010378 | 429 |
| 715 | 3300003215 | JGI25153J46596_10000312 | JGI25153J46596_1000031216 | 429 |
| 716 | 3300003215 | JGI25153J46596_10005340 | JGI25153J46596_100053405 | 429 |
| 717 | 3300003322 | rootL2_10113901 | rootL2_101139012 | 429 |
| 718 | 3300003323 | rootH1_10015315 | rootH1_100153152 | 429 |
| 719 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_10000022 | 429 |
| 720 | 3300003354 | JGI25160J50197_1000052 | JGI25160J50197_100005214 | 429 |
| 721 | 3300003354 | JGI25160J50197_1024650 | JGI25160J50197_10246501 | 429 |
| 722 | 3300003374 | JGI25161J50226_1000073 | JGI25161J50226_100007366 | 429 |
| 723 | 3300003374 | JGI25161J50226_1000153 | JGI25161J50226_100015348 | 429 |
| 724 | 3300003374 | JGI25161J50226_1003967 | JGI25161J50226_10039671 | 429 |
| 725 | 3300003771 | Ga0055526_1002168 | Ga0055526_10021689 | 429 |
| 726 | 3300003771 | Ga0055526_1003266 | Ga0055526_10032662 | 429 |
| 727 | 3300003771 | Ga0055526_1003657 | Ga0055526_10036572 | 429 |
| 728 | 3300003771 | Ga0055526_1005117 | Ga0055526_10051177 | 429 |
| 729 | 3300003771 | Ga0055526_1014304 | Ga0055526_10143043 | 429 |
| 730 | 3300003771 | Ga0055526_1015152 | Ga0055526_10151522 | 429 |
| 731 | 3300003771 | Ga0055526_1020618 | Ga0055526_10206182 | 429 |
| 732 | 3300003775 | Ga0055524_1003026 | Ga0055524_10030262 | 429 |
| 733 | 3300003775 | Ga0055524_1005073 | Ga0055524_10050732 | 429 |
| 734 | 3300003775 | Ga0055524_1006865 | Ga0055524_10068651 | 429 |
| 735 | 3300003775 | Ga0055524_1017546 | Ga0055524_10175461 | 429 |
| 736 | 3300003781 | Ga0055536_1000427 | Ga0055536_100042724 | 429 |
| 737 | 3300003781 | Ga0055536_1005875 | Ga0055536_10058754 | 429 |
| 738 | 3300003790 | Ga0055528_1000097 | Ga0055528_100009755 | 429 |
| 739 | 3300003790 | Ga0055528_1000413 | Ga0055528_100041317 | 429 |
| 740 | 3300003792 | Ga0055540_1000234 | Ga0055540_100023429 | 429 |
| 741 | 3300003792 | Ga0055540_1003105 | Ga0055540_10031059 | 429 |
| 742 | 3300004625 | Ga0055543_1000035 | Ga0055543_1000035108 | 429 |
| 743 | 3300004625 | Ga0055543_1001724 | Ga0055543_10017247 | 429 |
| 744 | 3300005262 | Ga0065165_1000004 | Ga0065165_1000004380 | 429 |
| 745 | 3300005262 | Ga0065165_1001373 | Ga0065165_100137314 | 429 |
| 746 | 3300005262 | Ga0065165_1006808 | Ga0065165_10068081 | 429 |
| 747 | 3300005262 | Ga0065165_1010060 | Ga0065165_10100602 | 429 |
| 748 | 3300005327 | Ga0070658_10015409 | Ga0070658_100154093 | 429 |
| 749 | 3300005327 | Ga0070658_10016053 | Ga0070658_100160534 | 429 |
| 750 | 3300005327 | Ga0070658_10165504 | Ga0070658_101655042 | 429 |
| 751 | 3300005331 | Ga0070670_100000347 | Ga0070670_10000034734 | 429 |
| 752 | 3300005355 | Ga0070671_100025768 | Ga0070671_1000257682 | 429 |
| 753 | 3300005366 | Ga0070659_100028862 | Ga0070659_1000288622 | 429 |
| 754 | 3300005530 | Ga0070679_100012408 | Ga0070679_1000124084 | 429 |
| 755 | 3300005535 | Ga0070684_100036084 | Ga0070684_1000360844 | 429 |
| 756 | 3300005548 | Ga0070665_100196685 | Ga0070665_1001966852 | 429 |
| 757 | 3300005563 | Ga0068855_100010543 | Ga0068855_1000105433 | 429 |
| 758 | 3300005577 | Ga0068857_100178708 | Ga0068857_1001787081 | 429 |
| 759 | 3300005614 | Ga0068856_100018126 | Ga0068856_1000181266 | 429 |
| 760 | 3300005614 | Ga0068856_100046094 | Ga0068856_1000460943 | 429 |
| 761 | 3300005614 | Ga0068856_100199246 | Ga0068856_1001992462 | 429 |
| 762 | 3300005616 | Ga0068852_100024682 | Ga0068852_1000246822 | 429 |
| 763 | 3300005616 | Ga0068852_100038488 | Ga0068852_1000384883 | 429 |
| 764 | 3300005834 | Ga0068851_10005049 | Ga0068851_100050495 | 429 |
| 765 | 3300006038 | Ga0075365_10012052 | Ga0075365_100120525 | 429 |
| 766 | 3300006042 | Ga0075368_10015374 | Ga0075368_100153742 | 429 |
| 767 | 3300006048 | Ga0075363_100008956 | Ga0075363_1000089562 | 429 |
| 768 | 3300006051 | Ga0075364_10000177 | Ga0075364_1000017715 | 429 |
| 769 | 3300006175 | Ga0070712_100064141 | Ga0070712_1000641412 | 429 |
| 770 | 3300006178 | Ga0075367_10006431 | Ga0075367_100064315 | 429 |
| 771 | 3300006178 | Ga0075367_10007923 | Ga0075367_100079232 | 429 |
| 772 | 3300006178 | Ga0075367_10021879 | Ga0075367_100218792 | 429 |
| 773 | 3300006186 | Ga0075369_10023091 | Ga0075369_100230912 | 429 |
| 774 | 3300006186 | Ga0075369_10041985 | Ga0075369_100419851 | 429 |
| 775 | 3300006195 | Ga0075366_10004489 | Ga0075366_100044896 | 429 |
| 776 | 3300006237 | Ga0097621_100010551 | Ga0097621_1000105517 | 429 |
| 777 | 3300006353 | Ga0075370_10092350 | Ga0075370_100923501 | 429 |
| 778 | 3300006358 | Ga0068871_100052091 | Ga0068871_1000520913 | 429 |
| 779 | 3300006948 | Ga0099826_10000838 | Ga0099826_1000083813 | 429 |
| 780 | 3300006948 | Ga0099826_10085596 | Ga0099826_100855962 | 429 |
| 781 | 3300009011 | Ga0105251_10010972 | Ga0105251_100109722 | 429 |
| 782 | 3300009093 | Ga0105240_10000027 | Ga0105240_10000027307 | 429 |
| 783 | 3300009093 | Ga0105240_10011173 | Ga0105240_100111736 | 429 |
| 784 | 3300009148 | Ga0105243_10013570 | Ga0105243_100135706 | 429 |
| 785 | 3300009177 | Ga0105248_10004763 | Ga0105248_100047633 | 429 |
| 786 | 3300009177 | Ga0105248_10280267 | Ga0105248_102802672 | 429 |
| 787 | 3300009545 | Ga0105237_10004420 | Ga0105237_100044208 | 429 |
| 788 | 3300009765 | Ga0123341_1000006 | Ga0123341_1000006123 | 429 |
| 789 | 3300009766 | Ga0123342_1009880 | Ga0123342_10098803 | 429 |
| 790 | 3300010375 | Ga0105239_10010623 | Ga0105239_100106235 | 429 |
| 791 | 3300013100 | Ga0157373_10005723 | Ga0157373_100057232 | 429 |
| 792 | 3300013102 | Ga0157371_10000307 | Ga0157371_1000030760 | 429 |
| 793 | 3300013104 | Ga0157370_10000223 | Ga0157370_100002234 | 429 |
| 794 | 3300013104 | Ga0157370_10000577 | Ga0157370_100005778 | 429 |
| 795 | 3300013105 | Ga0157369_10000908 | Ga0157369_1000090816 | 429 |
| 796 | 3300013105 | Ga0157369_10109759 | Ga0157369_101097592 | 429 |
| 797 | 3300013307 | Ga0157372_10001580 | Ga0157372_1000158016 | 429 |
| 798 | 3300015262 | Ga0182007_10009549 | Ga0182007_100095492 | 429 |
| 799 | 3300015265 | Ga0182005_1001113 | Ga0182005_10011135 | 429 |
| 800 | 3300015690 | Ga0183363_1089 | Ga0183363_108911 | 429 |
| 801 | 3300025206 | Ga0209435_100036 | Ga0209435_10003676 | 429 |
| 802 | 3300025208 | Ga0209436_100047 | Ga0209436_10004749 | 429 |
| 803 | 3300025208 | Ga0209436_102304 | Ga0209436_1023042 | 429 |
| 804 | 3300025228 | Ga0209672_103187 | Ga0209672_1031872 | 429 |
| 805 | 3300025233 | Ga0209437_100033 | Ga0209437_100033171 | 429 |
| 806 | 3300025233 | Ga0209437_100036 | Ga0209437_100036423 | 429 |
| 807 | 3300025245 | Ga0207425_1000031 | Ga0207425_1000031218 | 429 |
| 808 | 3300025245 | Ga0207425_1001110 | Ga0207425_10011102 | 429 |
| 809 | 3300025246 | Ga0209646_1000132 | Ga0209646_100013276 | 429 |
| 810 | 3300025250 | Ga0209026_1000236 | Ga0209026_100023613 | 429 |
| 811 | 3300025256 | Ga0209759_1000269 | Ga0209759_100026913 | 429 |
| 812 | 3300025258 | Ga0209129_1000053 | Ga0209129_1000053219 | 429 |
| 813 | 3300025258 | Ga0209129_1000125 | Ga0209129_100012597 | 429 |
| 814 | 3300025258 | Ga0209129_1000611 | Ga0209129_100061113 | 429 |
| 815 | 3300025258 | Ga0209129_1001053 | Ga0209129_10010538 | 429 |
| 816 | 3300025258 | Ga0209129_1001178 | Ga0209129_10011785 | 429 |
| 817 | 3300025258 | Ga0209129_1001568 | Ga0209129_10015682 | 429 |
| 818 | 3300025258 | Ga0209129_1003548 | Ga0209129_10035482 | 429 |
| 819 | 3300025261 | Ga0209233_1000056 | Ga0209233_1000056167 | 429 |
| 820 | 3300025261 | Ga0209233_1000064 | Ga0209233_1000064253 | 429 |
| 821 | 3300025261 | Ga0209233_1000152 | Ga0209233_10001529 | 429 |
| 822 | 3300025272 | Ga0209455_1008421 | Ga0209455_10084212 | 429 |
| 823 | 3300025273 | Ga0209673_1000122 | Ga0209673_1000122142 | 429 |
| 824 | 3300025273 | Ga0209673_1000409 | Ga0209673_100040919 | 429 |
| 825 | 3300025273 | Ga0209673_1001508 | Ga0209673_100150814 | 429 |
| 826 | 3300025273 | Ga0209673_1001874 | Ga0209673_10018746 | 429 |
| 827 | 3300025273 | Ga0209673_1001941 | Ga0209673_10019418 | 429 |
| 828 | 3300025273 | Ga0209673_1002296 | Ga0209673_10022964 | 429 |
| 829 | 3300025273 | Ga0209673_1006574 | Ga0209673_10065743 | 429 |
| 830 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006650 | 429 |
| 831 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008538 | 429 |
| 832 | 3300025284 | Ga0209130_1015165 | Ga0209130_10151652 | 429 |
| 833 | 3300025292 | Ga0209676_1001841 | Ga0209676_100184111 | 429 |
| 834 | 3300025292 | Ga0209676_1012750 | Ga0209676_10127503 | 429 |
| 835 | 3300025294 | Ga0209025_1000087 | Ga0209025_1000087218 | 429 |
| 836 | 3300025294 | Ga0209025_1000100 | Ga0209025_1000100124 | 429 |
| 837 | 3300025294 | Ga0209025_1000165 | Ga0209025_100016543 | 429 |
| 838 | 3300025294 | Ga0209025_1000900 | Ga0209025_100090046 | 429 |
| 839 | 3300025294 | Ga0209025_1001226 | Ga0209025_100122616 | 429 |
| 840 | 3300025294 | Ga0209025_1001688 | Ga0209025_10016886 | 429 |
| 841 | 3300025294 | Ga0209025_1007426 | Ga0209025_10074263 | 429 |
| 842 | 3300025294 | Ga0209025_1012756 | Ga0209025_10127562 | 429 |
| 843 | 3300025294 | Ga0209025_1033604 | Ga0209025_10336042 | 429 |
| 844 | 3300025295 | Ga0209564_1000104 | Ga0209564_1000104220 | 429 |
| 845 | 3300025295 | Ga0209564_1000853 | Ga0209564_100085323 | 429 |
| 846 | 3300025295 | Ga0209564_1001099 | Ga0209564_10010998 | 429 |
| 847 | 3300025295 | Ga0209564_1001645 | Ga0209564_100164515 | 429 |
| 848 | 3300025295 | Ga0209564_1005387 | Ga0209564_10053876 | 429 |
| 849 | 3300025297 | Ga0209758_1000081 | Ga0209758_1000081218 | 429 |
| 850 | 3300025297 | Ga0209758_1000121 | Ga0209758_1000121146 | 429 |
| 851 | 3300025297 | Ga0209758_1000313 | Ga0209758_100031348 | 429 |
| 852 | 3300025297 | Ga0209758_1000624 | Ga0209758_100062418 | 429 |
| 853 | 3300025297 | Ga0209758_1003467 | Ga0209758_10034676 | 429 |
| 854 | 3300025297 | Ga0209758_1008055 | Ga0209758_10080556 | 429 |
| 855 | 3300025297 | Ga0209758_1014909 | Ga0209758_10149092 | 429 |
| 856 | 3300025298 | Ga0209050_1001263 | Ga0209050_100126324 | 429 |
| 857 | 3300025298 | Ga0209050_1012778 | Ga0209050_10127782 | 429 |
| 858 | 3300025299 | Ga0209256_1000351 | Ga0209256_100035176 | 429 |
| 859 | 3300025299 | Ga0209256_1001199 | Ga0209256_100119913 | 429 |
| 860 | 3300025299 | Ga0209256_1001393 | Ga0209256_100139316 | 429 |
| 861 | 3300025299 | Ga0209256_1001494 | Ga0209256_100149416 | 429 |
| 862 | 3300025299 | Ga0209256_1002645 | Ga0209256_10026459 | 429 |
| 863 | 3300025299 | Ga0209256_1003108 | Ga0209256_10031089 | 429 |
| 864 | 3300025299 | Ga0209256_1003692 | Ga0209256_10036923 | 429 |
| 865 | 3300025299 | Ga0209256_1008356 | Ga0209256_10083562 | 429 |
| 866 | 3300025302 | Ga0207426_1000016 | Ga0207426_100001624 | 429 |
| 867 | 3300025302 | Ga0207426_1000044 | Ga0207426_100004413 | 429 |
| 868 | 3300025302 | Ga0207426_1000106 | Ga0207426_1000106227 | 429 |
| 869 | 3300025302 | Ga0207426_1000743 | Ga0207426_100074314 | 429 |
| 870 | 3300025302 | Ga0207426_1001023 | Ga0207426_100102315 | 429 |
| 871 | 3300025303 | Ga0209051_1000339 | Ga0209051_100033952 | 429 |
| 872 | 3300025303 | Ga0209051_1000918 | Ga0209051_10009182 | 429 |
| 873 | 3300025303 | Ga0209051_1001825 | Ga0209051_100182510 | 429 |
| 874 | 3300025303 | Ga0209051_1014302 | Ga0209051_10143023 | 429 |
| 875 | 3300025304 | Ga0209257_1002795 | Ga0209257_10027959 | 429 |
| 876 | 3300025304 | Ga0209257_1002847 | Ga0209257_10028472 | 429 |
| 877 | 3300025304 | Ga0209257_1003481 | Ga0209257_10034818 | 429 |
| 878 | 3300025909 | Ga0207705_10029588 | Ga0207705_100295883 | 429 |
| 879 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024322 | 429 |
| 880 | 3300025913 | Ga0207695_10018654 | Ga0207695_100186544 | 429 |
| 881 | 3300025913 | Ga0207695_10025079 | Ga0207695_100250794 | 429 |
| 882 | 3300025914 | Ga0207671_10000986 | Ga0207671_1000098625 | 429 |
| 883 | 3300025921 | Ga0207652_10044177 | Ga0207652_100441772 | 429 |
| 884 | 3300025923 | Ga0207681_10113687 | Ga0207681_101136872 | 429 |
| 885 | 3300025925 | Ga0207650_10000567 | Ga0207650_1000056721 | 429 |
| 886 | 3300025931 | Ga0207644_10079078 | Ga0207644_100790782 | 429 |
| 887 | 3300025941 | Ga0207711_10036636 | Ga0207711_100366362 | 429 |
| 888 | 3300026023 | Ga0207677_10006032 | Ga0207677_100060326 | 429 |
| 889 | 3300026078 | Ga0207702_10164056 | Ga0207702_101640561 | 429 |
| 890 | 3300026142 | Ga0207698_10005638 | Ga0207698_100056384 | 429 |
| 891 | 3300026142 | Ga0207698_10028833 | Ga0207698_100288332 | 429 |
| 892 | 3300027312 | Ga0209371_1005859 | Ga0209371_10058592 | 429 |
| 893 | 3300027666 | Ga0209282_1000715 | Ga0209282_10007156 | 429 |
| 894 | 3300027666 | Ga0209282_1071011 | Ga0209282_10710111 | 429 |
| 895 | 3300028379 | Ga0268266_10032452 | Ga0268266_100324524 | 429 |
| 896 | 3300028379 | Ga0268266_10110435 | Ga0268266_101104352 | 429 |
| 897 | 3300028794 | Ga0307515_10000115 | Ga0307515_10000115126 | 429 |
| 898 | 3300028794 | Ga0307515_10001359 | Ga0307515_1000135950 | 429 |
| 899 | 3300028794 | Ga0307515_10002710 | Ga0307515_1000271011 | 429 |
| 900 | 3300030500 | Ga0268256_1005834 | Ga0268256_10058342 | 429 |
| 901 | 3300030744 | Ga0316181_1002016 | Ga0316181_10020162 | 429 |
| 902 | 3300031456 | Ga0307513_10008680 | Ga0307513_100086805 | 429 |
| 903 | 3300031911 | Ga0307412_10001806 | Ga0307412_100018062 | 429 |
| 904 | 3300031911 | Ga0307412_10079261 | Ga0307412_100792612 | 429 |
| 905 | 3300035695 | Ga0373927_0000780 | Ga0373927_0000780_5984_7276 | 429 |
| 906 | 3300037471 | Ga0395905_0007143 | Ga0395905_0007143_9664_10956 | 429 |
| 907 | 3300037471 | Ga0395905_0008439 | Ga0395905_0008439_4691_6082 | 429 |
| 908 | 3300037471 | Ga0395905_0127507 | Ga0395905_0127507_867_2201 | 429 |
| 909 | 3300041406 | Ga0439439_0021887 | Ga0439439_0021887_269_1564 | 429 |
| 910 | 3300041413 | Ga0439465_0017163 | Ga0439465_0017163_222_1517 | 429 |
| 911 | 3300041413 | Ga0439465_0020090 | Ga0439465_0020090_11_1303 | 429 |
| 912 | 3300041494 | Ga0451837_1135412 | Ga0451837_1135412_155_1447 | 429 |
| 913 | 3300041496 | Ga0451839_0324124 | Ga0451839_0324124_438_1730 | 429 |
| 914 | 3300041997 | Ga0439431_0013507 | Ga0439431_0013507_313_1611 | 429 |
| 915 | 3300045051 | Ga0451576_0244129 | Ga0451576_0244129_370_1677 | 429 |
| 916 | 3300045836 | Ga0466958_0014567 | Ga0466958_0014567_2649_3983 | 429 |
| 917 | 3300046454 | Ga0495592_0074268 | Ga0495592_0074268_167_1456 | 429 |
| 918 | 3300046459 | Ga0495629_0014314 | Ga0495629_0014314_747_2036 | 429 |
| 919 | 3300046460 | Ga0495638_0043878 | Ga0495638_0043878_677_1969 | 429 |
| 920 | 3300046471 | Ga0495650_0053217 | Ga0495650_0053217_295_1587 | 429 |
| 921 | 3300046492 | Ga0495585_0062382 | Ga0495585_0062382_236_1528 | 429 |
| 922 | 3300046506 | Ga0495583_0008582 | Ga0495583_0008582_335_1627 | 429 |
| 923 | 3300046507 | Ga0495606_0003594 | Ga0495606_0003594_8707_9996 | 429 |
| 924 | 3300046507 | Ga0495606_0029980 | Ga0495606_0029980_1223_2512 | 429 |
| 925 | 3300046512 | Ga0495610_0012464 | Ga0495610_0012464_2305_3597 | 429 |
| 926 | 3300046515 | Ga0495620_0047972 | Ga0495620_0047972_325_1617 | 429 |
| 927 | 3300046518 | Ga0495631_0027381 | Ga0495631_0027381_586_1878 | 429 |
| 928 | 3300046519 | Ga0495632_0002635 | Ga0495632_0002635_10117_11409 | 429 |
| 929 | 3300046522 | Ga0495643_0019999 | Ga0495643_0019999_839_2131 | 429 |
| 930 | 3300046522 | Ga0495643_0035161 | Ga0495643_0035161_176_1471 | 429 |
| 931 | 3300046524 | Ga0495648_0051940 | Ga0495648_0051940_879_2171 | 429 |
| 932 | 3300046529 | Ga0495652_0040107 | Ga0495652_0040107_2011_3300 | 429 |
| 933 | 3300046530 | Ga0495654_0000130 | Ga0495654_0000130_54625_55917 | 429 |
| 934 | 3300046536 | Ga0495587_0017692 | Ga0495587_0017692_421_1710 | 429 |
| 935 | 3300046557 | Ga0495622_0012970 | Ga0495622_0012970_1950_3239 | 429 |
| 936 | 3300046660 | Ga0495625_0077921 | Ga0495625_0077921_940_2232 | 429 |
| 937 | 3300046665 | Ga0495661_0106826 | Ga0495661_0106826_234_1526 | 429 |
| 938 | 3300046675 | Ga0495657_0033534 | Ga0495657_0033534_1490_2779 | 429 |
| 939 | 3300046809 | Ga0495600_0024098 | Ga0495600_0024098_616_1905 | 429 |
| 940 | 3300047469 | Ga0495673_0050131 | Ga0495673_0050131_224_1516 | 429 |
| 941 | 3300047470 | Ga0495681_0004767 | Ga0495681_0004767_3008_4312 | 429 |
| 942 | 3300047470 | Ga0495681_0058420 | Ga0495681_0058420_432_1724 | 429 |
| 943 | 3300047472 | Ga0495686_0000613 | Ga0495686_0000613_511_1800 | 429 |
| 944 | 3300047472 | Ga0495686_0012665 | Ga0495686_0012665_545_1837 | 429 |
| 945 | 3300047472 | Ga0495686_0128339 | Ga0495686_0128339_31_1431 | 429 |
| 946 | 3300048903 | Ga0496100_0187288 | Ga0496100_0187288_188_1477 | 429 |
| 947 | 3300048905 | Ga0496102_0023580 | Ga0496102_0023580_638_1927 | 429 |
| 948 | 3300048907 | Ga0496104_0238028 | Ga0496104_0238028_28_1320 | 429 |
| 949 | 3300048909 | Ga0496106_0001004 | Ga0496106_0001004_9626_10921 | 429 |
| 950 | 3300048913 | Ga0496110_0106678 | Ga0496110_0106678_826_2127 | 429 |
| 951 | 3300048916 | Ga0496113_0035330 | Ga0496113_0035330_157_1497 | 429 |
| 952 | 3300048917 | Ga0496114_0120299 | Ga0496114_0120299_760_2052 | 429 |
| 953 | 3300048919 | Ga0496116_0002976 | Ga0496116_0002976_81_1373 | 429 |
| 954 | 3300048919 | Ga0496116_0010396 | Ga0496116_0010396_5585_6877 | 429 |
| 955 | 3300048919 | Ga0496116_0017233 | Ga0496116_0017233_728_2017 | 429 |
| 956 | 3300048919 | Ga0496116_0100819 | Ga0496116_0100819_81_1373 | 429 |
| 957 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1586783_1588123 | 429 |
| 958 | 3300048920 | Ga0496117_0006548 | Ga0496117_0006548_5363_6655 | 429 |
| 959 | 3300048920 | Ga0496117_0007855 | Ga0496117_0007855_6461_7750 | 429 |
| 960 | 3300048920 | Ga0496117_0036258 | Ga0496117_0036258_44_1348 | 429 |
| 961 | 3300048920 | Ga0496117_0046076 | Ga0496117_0046076_1470_2762 | 429 |
| 962 | 3300048920 | Ga0496117_0051153 | Ga0496117_0051153_1122_2414 | 429 |
| 963 | 3300048920 | Ga0496117_0071672 | Ga0496117_0071672_135_1427 | 429 |
| 964 | 3300048921 | Ga0496118_0000084 | Ga0496118_0000084_26544_27884 | 429 |
| 965 | 3300048921 | Ga0496118_0000396 | Ga0496118_0000396_28876_30165 | 429 |
| 966 | 3300048921 | Ga0496118_0002631 | Ga0496118_0002631_4517_5809 | 429 |
| 967 | 3300048921 | Ga0496118_0006506 | Ga0496118_0006506_11121_12413 | 429 |
| 968 | 3300048921 | Ga0496118_0092593 | Ga0496118_0092593_249_1541 | 429 |
| 969 | 3300048922 | Ga0496119_0010878 | Ga0496119_0010878_4449_5738 | 429 |
| 970 | 3300048922 | Ga0496119_0019985 | Ga0496119_0019985_3597_4889 | 429 |
| 971 | 3300048922 | Ga0496119_0032929 | Ga0496119_0032929_1378_2718 | 429 |
| 972 | 3300048922 | Ga0496119_0051426 | Ga0496119_0051426_494_1786 | 429 |
| 973 | 3300048923 | Ga0496120_0000087 | Ga0496120_0000087_146483_147823 | 429 |
| 974 | 3300048923 | Ga0496120_0004845 | Ga0496120_0004845_2846_4135 | 429 |
| 975 | 3300048923 | Ga0496120_0028306 | Ga0496120_0028306_1594_2886 | 429 |
| 976 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_794779_796071 | 429 |
| 977 | 3300048924 | Ga0496121_0005778 | Ga0496121_0005778_5964_7253 | 429 |
| 978 | 3300048924 | Ga0496121_0009367 | Ga0496121_0009367_3360_4652 | 429 |
| 979 | 3300048924 | Ga0496121_0015300 | Ga0496121_0015300_3772_5064 | 429 |
| 980 | 3300048924 | Ga0496121_0020840 | Ga0496121_0020840_165_1460 | 429 |
| 981 | 3300048924 | Ga0496121_0046720 | Ga0496121_0046720_1475_2770 | 429 |
| 982 | 3300048924 | Ga0496121_0109694 | Ga0496121_0109694_469_1773 | 429 |
| 983 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_957572_958912 | 429 |
| 984 | 3300048925 | Ga0496122_0000009 | Ga0496122_0000009_67607_68899 | 429 |
| 985 | 3300048925 | Ga0496122_0000205 | Ga0496122_0000205_40002_41294 | 429 |
| 986 | 3300048925 | Ga0496122_0014055 | Ga0496122_0014055_610_1899 | 429 |
| 987 | 3300048925 | Ga0496122_0017027 | Ga0496122_0017027_375_1667 | 429 |
| 988 | 3300048925 | Ga0496122_0018436 | Ga0496122_0018436_768_2060 | 429 |
| 989 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_961303_962643 | 429 |
| 990 | 3300048926 | Ga0496123_0000034 | Ga0496123_0000034_256492_257784 | 429 |
| 991 | 3300048926 | Ga0496123_0000103 | Ga0496123_0000103_40002_41294 | 429 |
| 992 | 3300048926 | Ga0496123_0007399 | Ga0496123_0007399_650_1939 | 429 |
| 993 | 3300048926 | Ga0496123_0008628 | Ga0496123_0008628_2084_3376 | 429 |
| 994 | 3300048926 | Ga0496123_0009779 | Ga0496123_0009779_2210_3502 | 429 |
| 995 | 3300048926 | Ga0496123_0010695 | Ga0496123_0010695_3772_5064 | 429 |
| 996 | 3300048927 | Ga0496124_0000854 | Ga0496124_0000854_24139_25431 | 429 |
| 997 | 3300048927 | Ga0496124_0001267 | Ga0496124_0001267_32653_33945 | 429 |
| 998 | 3300048927 | Ga0496124_0009898 | Ga0496124_0009898_3360_4652 | 429 |
| 999 | 3300048927 | Ga0496124_0013954 | Ga0496124_0013954_341_1633 | 429 |
| 1000 | 3300048927 | Ga0496124_0035983 | Ga0496124_0035983_2680_3972 | 429 |
| 1001 | 3300048927 | Ga0496124_0100955 | Ga0496124_0100955_29_1324 | 429 |
| 1002 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_908746_910038 | 429 |
| 1003 | 3300048928 | Ga0496125_0000385 | Ga0496125_0000385_35650_36942 | 429 |
| 1004 | 3300048928 | Ga0496125_0013299 | Ga0496125_0013299_6180_7472 | 429 |
| 1005 | 3300048928 | Ga0496125_0018668 | Ga0496125_0018668_2213_3517 | 429 |
| 1006 | 3300048929 | Ga0496126_0001488 | Ga0496126_0001488_11021_12313 | 429 |
| 1007 | 3300048929 | Ga0496126_0122689 | Ga0496126_0122689_361_1650 | 429 |
| 1008 | 3300049570 | Ga0501033_0021895 | Ga0501033_0021895_3057_4349 | 429 |
| 1009 | 3300049571 | Ga0501034_0312590 | Ga0501034_0312590_68_1360 | 429 |
| 1010 | 3300049573 | Ga0501037_0057845 | Ga0501037_0057845_1207_2499 | 429 |
| 1011 | 3300049574 | Ga0501038_0167137 | Ga0501038_0167137_261_1553 | 429 |
| 1012 | 3300049579 | Ga0501043_0058918 | Ga0501043_0058918_678_1973 | 429 |
| 1013 | 3300049581 | Ga0501047_0178982 | Ga0501047_0178982_449_1768 | 429 |
| 1014 | 3300049744 | Ga0501083_0064521 | Ga0501083_0064521_846_2141 | 429 |
| 1015 | 3300050489 | nmdc:mga03683_51004_c1 | nmdc:mga03683_51004_c1_338_1678 | 429 |
| 1016 | 3300050491 | nmdc:mga00v17_13054_c1 | nmdc:mga00v17_13054_c1_320_1612 | 429 |
| 1017 | 3300050491 | nmdc:mga00v17_201_c1 | nmdc:mga00v17_201_c1_20146_21438 | 429 |
| 1018 | 3300050491 | nmdc:mga00v17_52_c1 | nmdc:mga00v17_52_c1_11271_12611 | 429 |
| 1019 | 3300050492 | nmdc:mga0yw44_4284_c1 | nmdc:mga0yw44_4284_c1_4949_6241 | 429 |
| 1020 | 3300050496 | nmdc:mga07m45_84678_c1 | nmdc:mga07m45_84678_c1_278_1573 | 429 |
| 1021 | 3300053087 | Ga0500643_032572 | Ga0500643_032572_233_1546 | 429 |
| 1022 | 3300053107 | Ga0500560_000407 | Ga0500560_000407_189_1493 | 429 |
| 1023 | 3300053125 | Ga0500618_000055 | Ga0500618_000055_52136_53644 | 429 |
| 1024 | 3300053125 | Ga0500618_000616 | Ga0500618_000616_17321_18625 | 429 |
| 1025 | 3300053125 | Ga0500618_002635 | Ga0500618_002635_599_1891 | 429 |
| 1026 | 3300053125 | Ga0500618_004048 | Ga0500618_004048_2111_3403 | 429 |
| 1027 | 3300053134 | Ga0500658_0001240 | Ga0500658_0001240_8438_9730 | 429 |
| 1028 | 3300053137 | Ga0500561_0000114 | Ga0500561_0000114_4996_6336 | 429 |
| 1029 | 3300053140 | Ga0500573_0048611 | Ga0500573_0048611_732_2030 | 429 |
| 1030 | 3300053153 | Ga0500616_0000224 | Ga0500616_0000224_72184_73497 | 429 |
| 1031 | 3300053153 | Ga0500616_0062932 | Ga0500616_0062932_56_1363 | 429 |
| 1032 | 3300053156 | Ga0500622_0000919 | Ga0500622_0000919_9574_10869 | 429 |
| 1033 | 3300053160 | Ga0500633_0000113 | Ga0500633_0000113_5779_7074 | 429 |
| 1034 | 3300053161 | Ga0500634_0014495 | Ga0500634_0014495_1686_2978 | 429 |
| 1035 | 3300053177 | Ga0500636_0000004 | Ga0500636_0000004_98109_99527 | 429 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rtf-assembly1.cif.gz_D | crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv | 0.8184 | 3 | 417 |
| 4rtf-assembly1.cif.gz_D | crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv | 0.8033 | 3 | 417 |
| 5oby-assembly1.cif.gz_A | mycoplasma genitalium dnak-nbd in complex with amp-pnp | 0.7925 | 3 | 419 |
| 6w6e-assembly1.cif.gz_I | the mycobacterium tuberculosis clpb disaggregase hexamer structure with a locally refined clpb middle domain and a dnak nucleotide binding domain | 0.7907 | 1 | 415 |
| 5obv-assembly1.cif.gz_A | mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with adp and pi. | 0.7894 | 1 | 426 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36928_307_378_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8703 | 280 | 347 | 3.30.420.40 |
| 4rtfD03 | Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 | 0.8598 | 305 | 354 | 3.90.640.10 |
| af_O07239_201_278_3.90.640.10 | Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 | 0.8417 | 303 | 349 | 3.90.640.10 |
| 4rtfD01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8366 | 3 | 175 | 3.30.420.40 |
| af_P36928_307_378_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8173 | 280 | 347 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520JBI4-F1-model_v4 | Hsp70 family protein | 0.9624 | 191 | 429 |
GO:0005524
GO:0140662 |
| AF-A0A520JBI4-F1-model_v4 | Hsp70 family protein | 0.9546 | 191 | 429 |
GO:0005524
GO:0140662 |
| AF-A0A839EQ70-F1-model_v4 | Putative chaperone protein | 0.9541 | 1 | 429 |
GO:0005524
GO:0140662 |
| AF-A0A2A2M2Q2-F1-model_v4 | Uncharacterized protein | 0.9527 | 237 | 429 |
GO:0005524
GO:0005634 GO:0005829 GO:0140662 |
| AF-A0A259I9A7-F1-model_v4 | deleted | 0.9498 | 281 | 429 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar