F488678

General Info

Members Datasets Scaffolds Average Seq Length
1034 539 2068 102

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0192413|Ga0373956_0192413_176_493
Length 105
Sequence MIMASTIRVRAIAGAETTEVQVLIQHPMDSGFVKDAQGALIPPHHIETVEFEAGGKTVFTALWGPAVSKDPFVKFSFKGAKKGDDLKITWVDNKGATDTTTAKIQ

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
99 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
100 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
202 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
310 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
365 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
366 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
367 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
368 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
371 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
372 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
373 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
374 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
375 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
376 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
377 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
378 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
379 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
380 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
381 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
385 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
388 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
389 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
390 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
391 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
396 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
397 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
401 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
402 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
403 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
404 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
405 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
406 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
407 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
408 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
409 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
410 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
411 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
412 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
413 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
414 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
415 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
416 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
417 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
418 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
419 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
420 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
421 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
422 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
423 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
424 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
425 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
426 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
427 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
428 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
429 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
430 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
431 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
432 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
433 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
434 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
435 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
436 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
437 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
438 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
439 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
440 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
441 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
442 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
443 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
444 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
445 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
446 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
447 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
448 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
449 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
450 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
451 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
452 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
453 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
454 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
455 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
456 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
457 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
458 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
459 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
460 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
461 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
462 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
463 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
464 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
465 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
466 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
467 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
468 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
469 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
470 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
471 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
472 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
473 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
474 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
475 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
476 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
477 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
478 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
479 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
480 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
481 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
482 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
483 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
484 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
485 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
486 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
487 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
488 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
489 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
490 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
491 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
492 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
493 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
494 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
495 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
496 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
497 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
498 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
499 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
500 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
501 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
502 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
503 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
504 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
505 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
506 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
507 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
508 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
509 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
510 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
511 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
512 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
513 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
514 641522639 Methylobacterium sp. 4-46 Isolate Nodule
515 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
516 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
517 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
518 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
519 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
520 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
521 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
522 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
523 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
524 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
525 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
526 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
527 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
528 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
529 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
530 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
531 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
532 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
533 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
534 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
535 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
536 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
537 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
538 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
539 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.88
Metatranscriptomes 0.58
Isolates 13.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.64
Nodule 10.74
Rhizoplane 5.42
Rhizosphere 65.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0192413 3300035119 Bacteria 966
2 JGI24735J21928_10046787 3300002067 Bacteria 1255
3 JGI25153J46596_10009968 3300003215 Bacteria 4343
4 JGI25160J50197_1011437 3300003354 Bacteria 3149
5 JGI25160J50197_1014777 3300003354 Bacteria 2595
6 JGI25404J52841_10037927 3300003659 Bacteria 1023
7 Ga0055526_1036204 3300003771 Bacteria 1314
8 Ga0055531_10002401 3300003794 Bacteria 12583
9 Ga0065165_1002203 3300005262 Bacteria 17455
10 Ga0070658_10080003 3300005327 Bacteria 2684
11 Ga0070658_10083289 3300005327 Bacteria 2629
12 Ga0070683_100034716 3300005329 Bacteria 4609
13 Ga0070683_100385832 3300005329 Bacteria 1335
14 Ga0070683_100388065 3300005329 Bacteria 1331
15 Ga0070670_100007013 3300005331 Bacteria 9546
16 Ga0068869_100529986 3300005334 Bacteria 987
17 Ga0068869_101696173 3300005334 Bacteria 564
18 Ga0070680_100007037 3300005336 Bacteria 8575
19 Ga0070680_100039194 3300005336 Bacteria 3834
20 Ga0070680_100063582 3300005336 Bacteria 3023
21 Ga0070680_100107970 3300005336 Bacteria 2315
22 Ga0070680_100159102 3300005336 Bacteria 1898
23 Ga0070680_100287225 3300005336 Bacteria 1394
24 Ga0070680_100494015 3300005336 Bacteria 1047
25 Ga0070682_100215967 3300005337 Bacteria 1362
26 Ga0070660_100052586 3300005339 Bacteria 3140
27 Ga0070660_100119833 3300005339 Bacteria 2099
28 Ga0070660_100467204 3300005339 Bacteria 1048
29 Ga0070660_100754671 3300005339 Bacteria 817
30 Ga0070689_101463685 3300005340 Bacteria 618
31 Ga0070691_10044183 3300005341 Bacteria 2112
32 Ga0070661_100079432 3300005344 Bacteria 2421
33 Ga0070661_100250111 3300005344 Bacteria 1368
34 Ga0070661_100587109 3300005344 Bacteria 900
35 Ga0070661_101827132 3300005344 Bacteria 516
36 Ga0070668_100755632 3300005347 Bacteria 861
37 Ga0070671_100956149 3300005355 Bacteria 749
38 Ga0070674_101139768 3300005356 Bacteria 690
39 Ga0070659_100014636 3300005366 Bacteria 5866
40 Ga0070659_100397031 3300005366 Bacteria 1164
41 Ga0070659_101082549 3300005366 Bacteria 706
42 Ga0070667_100209966 3300005367 Bacteria 1730
43 Ga0070709_10000732 3300005434 Bacteria 18548
44 Ga0070709_10015576 3300005434 Bacteria 4329
45 Ga0070709_11179763 3300005434 Bacteria 615
46 Ga0070714_100001031 3300005435 Bacteria 19841
47 Ga0070714_100007289 3300005435 Bacteria 8598
48 Ga0070714_100017631 3300005435 Bacteria 5787
49 Ga0070714_100056302 3300005435 Bacteria 3363
50 Ga0070714_100267804 3300005435 Bacteria 1583
51 Ga0070714_100348673 3300005435 Bacteria 1390
52 Ga0070714_101161618 3300005435 Bacteria 753
53 Ga0070713_100000447 3300005436 Bacteria 26301
54 Ga0070713_100014459 3300005436 Bacteria 5864
55 Ga0070713_100033021 3300005436 Bacteria 4142
56 Ga0070713_100108431 3300005436 Bacteria 2418
57 Ga0070713_100194115 3300005436 Bacteria 1831
58 Ga0070713_100394312 3300005436 Bacteria 1292
59 Ga0070713_100964540 3300005436 Bacteria 822
60 Ga0070713_101067179 3300005436 Bacteria 780
61 Ga0070710_10000211 3300005437 Bacteria 27400
62 Ga0070710_10002104 3300005437 Bacteria 9438
63 Ga0070710_10012645 3300005437 Bacteria 4198
64 Ga0070710_10212472 3300005437 Bacteria 1227
65 Ga0070711_100001113 3300005439 Bacteria 14371
66 Ga0070711_100005283 3300005439 Bacteria 7708
67 Ga0070711_100070596 3300005439 Bacteria 2460
68 Ga0070711_100735284 3300005439 Bacteria 833
69 Ga0070711_100845004 3300005439 Bacteria 779
70 Ga0070711_100958118 3300005439 Bacteria 733
71 Ga0070711_101209439 3300005439 Bacteria 654
72 Ga0070711_101976294 3300005439 Bacteria 513
73 Ga0070700_100605463 3300005441 Bacteria 859
74 Ga0070663_100312448 3300005455 Bacteria 1261
75 Ga0070663_100479318 3300005455 Bacteria 1030
76 Ga0070662_101624324 3300005457 Bacteria 558
77 Ga0070681_10016067 3300005458 Bacteria 7460
78 Ga0070681_10028615 3300005458 Bacteria 5603
79 Ga0070681_10029541 3300005458 Bacteria 5505
80 Ga0070681_10215626 3300005458 Bacteria 1836
81 Ga0070681_10332311 3300005458 Bacteria 1429
82 Ga0070681_10668688 3300005458 Bacteria 954
83 Ga0070681_10974112 3300005458 Bacteria 768
84 Ga0068867_101125393 3300005459 Bacteria 718
85 Ga0070706_100257254 3300005467 Bacteria 1630
86 Ga0070698_101773412 3300005471 Bacteria 570
87 Ga0070679_100022723 3300005530 Bacteria 6132
88 Ga0070679_100053904 3300005530 Bacteria 4003
89 Ga0070679_100169103 3300005530 Bacteria 2159
90 Ga0070679_100339038 3300005530 Bacteria 1451
91 Ga0070679_100412036 3300005530 Bacteria 1297
92 Ga0070679_100665422 3300005530 Bacteria 984
93 Ga0070679_101853197 3300005530 Bacteria 552
94 Ga0070684_100003114 3300005535 Bacteria 12386
95 Ga0070684_100006418 3300005535 Bacteria 9101
96 Ga0070684_100094412 3300005535 Bacteria 2664
97 Ga0070684_100203280 3300005535 Bacteria 1804
98 Ga0070684_101088044 3300005535 Bacteria 751
99 Ga0068853_100191889 3300005539 Bacteria 1856
100 Ga0068853_100333858 3300005539 Bacteria 1407
101 Ga0068853_100436256 3300005539 Bacteria 1230
102 Ga0068853_101010756 3300005539 Bacteria 800
103 Ga0070693_100396262 3300005547 Bacteria 956
104 Ga0070665_100204613 3300005548 Bacteria 1974
105 Ga0068855_100001526 3300005563 Bacteria 29026
106 Ga0068855_100049831 3300005563 Bacteria 4937
107 Ga0068855_100077550 3300005563 Bacteria 3855
108 Ga0068855_100763796 3300005563 Bacteria 1030
109 Ga0068855_101132127 3300005563 Bacteria 817
110 Ga0068855_101168190 3300005563 Bacteria 802
111 Ga0068855_101700242 3300005563 Bacteria 643
112 Ga0068855_102069546 3300005563 Bacteria 574
113 Ga0068855_102312343 3300005563 Bacteria 538
114 Ga0070664_100061476 3300005564 Bacteria 3201
115 Ga0070664_100123146 3300005564 Bacteria 2272
116 Ga0070664_101459994 3300005564 Bacteria 647
117 Ga0068857_100066062 3300005577 Bacteria 3218
118 Ga0068857_100089840 3300005577 Bacteria 2749
119 Ga0068857_101790586 3300005577 Bacteria 601
120 Ga0068854_100976138 3300005578 Bacteria 749
121 Ga0068854_101140289 3300005578 Bacteria 696
122 Ga0068856_100026292 3300005614 Bacteria 5675
123 Ga0068856_100078422 3300005614 Bacteria 3274
124 Ga0068856_100104868 3300005614 Bacteria 2821
125 Ga0068856_100915212 3300005614 Bacteria 896
126 Ga0068856_101645418 3300005614 Bacteria 655
127 Ga0068856_101660498 3300005614 Bacteria 652
128 Ga0068852_100016368 3300005616 Bacteria 5779
129 Ga0068852_100105735 3300005616 Bacteria 2550
130 Ga0068852_100155708 3300005616 Bacteria 2129
131 Ga0068852_100327923 3300005616 Bacteria 1489
132 Ga0068852_100597992 3300005616 Bacteria 1107
133 Ga0068852_100710594 3300005616 Bacteria 1015
134 Ga0068852_102446989 3300005616 Bacteria 542
135 Ga0068864_100175152 3300005618 Bacteria 1958
136 Ga0068851_10298551 3300005834 Bacteria 926
137 Ga0068858_100131521 3300005842 Bacteria 2347
138 Ga0081455_10663430 3300005937 Bacteria 670
139 Ga0081540_1029964 3300005983 Bacteria 3021
140 Ga0070717_10004501 3300006028 Bacteria 10072
141 Ga0070717_10021088 3300006028 Bacteria 5133
142 Ga0070717_10029633 3300006028 Bacteria 4392
143 Ga0070717_10065910 3300006028 Bacteria 3011
144 Ga0070717_10346459 3300006028 Bacteria 1327
145 Ga0075365_10015761 3300006038 Bacteria 4578
146 Ga0075365_10745473 3300006038 Bacteria 692
147 Ga0075365_10892850 3300006038 Bacteria 627
148 Ga0075363_100510595 3300006048 Bacteria 714
149 Ga0075364_10156016 3300006051 Bacteria 1539
150 Ga0075432_10388516 3300006058 Bacteria 600
151 Ga0070715_10003014 3300006163 Bacteria 5271
152 Ga0070715_10104459 3300006163 Bacteria 1327
153 Ga0070715_10153093 3300006163 Bacteria 1132
154 Ga0070716_100001713 3300006173 Bacteria 9880
155 Ga0070716_100023180 3300006173 Bacteria 3288
156 Ga0070716_101589397 3300006173 Bacteria 537
157 Ga0070712_100014263 3300006175 Bacteria 5102
158 Ga0070712_100035189 3300006175 Bacteria 3399
159 Ga0070712_100435800 3300006175 Bacteria 1089
160 Ga0075362_10060470 3300006177 Bacteria 1713
161 Ga0075367_10193340 3300006178 Bacteria 1270
162 Ga0075369_10023867 3300006186 Bacteria 2531
163 Ga0075369_10024161 3300006186 Bacteria 2516
164 Ga0075369_10126448 3300006186 Bacteria 1159
165 Ga0075369_10245709 3300006186 Bacteria 831
166 Ga0075366_10046585 3300006195 Bacteria 2569
167 Ga0075370_10004474 3300006353 Bacteria 6793
168 Ga0075370_10075418 3300006353 Bacteria 1933
169 Ga0075370_10336246 3300006353 Bacteria 901
170 Ga0068871_101288770 3300006358 Bacteria 687
171 Ga0075428_100043728 3300006844 Bacteria 4925
172 Ga0075431_100060080 3300006847 Bacteria 3923
173 Ga0075434_100083024 3300006871 Bacteria 3201
174 Ga0099825_1025118 3300006941 Bacteria 3368
175 Ga0099824_1007096 3300006942 Bacteria 15025
176 Ga0099823_1014418 3300006944 Bacteria 7897
177 Ga0099794_10136207 3300007265 Bacteria 1242
178 Ga0099795_10461240 3300007788 Bacteria 586
179 Ga0105244_10462639 3300009036 Bacteria 583
180 Ga0105240_10018842 3300009093 Bacteria 9243
181 Ga0105240_10027377 3300009093 Bacteria 7463
182 Ga0105240_10060502 3300009093 Bacteria 4722
183 Ga0105240_10131811 3300009093 Bacteria 2997
184 Ga0111539_10008587 3300009094 Bacteria 12973
185 Ga0105245_11036116 3300009098 Bacteria 866
186 Ga0105245_11866913 3300009098 Bacteria 654
187 Ga0105247_10121871 3300009101 Bacteria 1690
188 Ga0105247_11306263 3300009101 Bacteria 583
189 Ga0114129_10049105 3300009147 Bacteria 5931
190 Ga0105241_10012706 3300009174 Bacteria 6179
191 Ga0105241_10908967 3300009174 Bacteria 818
192 Ga0105241_11189511 3300009174 Bacteria 722
193 Ga0105241_11621052 3300009174 Bacteria 626
194 Ga0105241_12698217 3300009174 Bacteria 500
195 Ga0105248_10889387 3300009177 Bacteria 1005
196 Ga0105248_13424008 3300009177 Bacteria 504
197 Ga0105237_10003797 3300009545 Bacteria 17750
198 Ga0105237_10239142 3300009545 Bacteria 1817
199 Ga0105237_10242500 3300009545 Bacteria 1803
200 Ga0105238_10084387 3300009551 Bacteria 3166
201 Ga0105238_10106905 3300009551 Bacteria 2779
202 Ga0105238_11107804 3300009551 Bacteria 815
203 Ga0105238_11331907 3300009551 Bacteria 744
204 Ga0105238_11353923 3300009551 Bacteria 738
205 Ga0099796_10003072 3300010159 Bacteria 3801
206 Ga0105239_10031844 3300010375 Bacteria 5795
207 Ga0105239_10101474 3300010375 Bacteria 3183
208 Ga0105239_10127791 3300010375 Bacteria 2826
209 Ga0105239_10310549 3300010375 Bacteria 1777
210 Ga0105239_10503853 3300010375 Bacteria 1376
211 Ga0105239_10780972 3300010375 Bacteria 1094
212 Ga0105239_10791648 3300010375 Bacteria 1086
213 Ga0105246_10149093 3300011119 Bacteria 1768
214 Ga0157373_10114461 3300013100 Bacteria 1896
215 Ga0157373_10740066 3300013100 Bacteria 722
216 Ga0157371_10205462 3300013102 Bacteria 1413
217 Ga0157371_10712289 3300013102 Bacteria 752
218 Ga0157371_11025363 3300013102 Bacteria 630
219 Ga0157371_11085464 3300013102 Bacteria 613
220 Ga0157370_10025966 3300013104 Bacteria 5790
221 Ga0157370_10066941 3300013104 Bacteria 3396
222 Ga0157370_10514053 3300013104 Bacteria 1099
223 Ga0157370_10670535 3300013104 Bacteria 947
224 Ga0157370_11052988 3300013104 Bacteria 736
225 Ga0157370_11364596 3300013104 Bacteria 638
226 Ga0157369_10008800 3300013105 Bacteria 11568
227 Ga0157369_10028904 3300013105 Bacteria 6132
228 Ga0157369_10158242 3300013105 Bacteria 2392
229 Ga0157369_10466618 3300013105 Bacteria 1307
230 Ga0157369_10631815 3300013105 Bacteria 1105
231 Ga0157369_10947544 3300013105 Bacteria 882
232 Ga0157378_10307502 3300013297 Bacteria 1536
233 Ga0157378_10314333 3300013297 Bacteria 1520
234 Ga0157378_12963366 3300013297 Bacteria 527
235 Ga0163162_10162491 3300013306 Bacteria 2355
236 Ga0163162_11387568 3300013306 Bacteria 799
237 Ga0157372_10586480 3300013307 Bacteria 1299
238 Ga0157372_10707342 3300013307 Bacteria 1172
239 Ga0157372_10762867 3300013307 Bacteria 1125
240 Ga0157372_10880013 3300013307 Bacteria 1039
241 Ga0157372_11147969 3300013307 Bacteria 898
242 Ga0157372_13124524 3300013307 Bacteria 528
243 Ga0157375_10676498 3300013308 Bacteria 1187
244 Ga0157375_11302615 3300013308 Bacteria 854
245 Ga0163163_10416594 3300014325 Bacteria 1402
246 Ga0157376_10278601 3300014969 Bacteria 1574
247 Ga0206353_10012434 3300020082 Bacteria 1455
248 Ga0206353_10881856 3300020082 Bacteria 880
249 Ga0214544_1000087 3300021320 Bacteria 119600
250 Ga0214542_1000018 3300021321 Bacteria 202226
251 Ga0214545_1000009 3300021324 Bacteria 202915
252 Ga0214545_1044404 3300021324 Bacteria 1053
253 Ga0213872_10083520 3300021361 Bacteria 1433
254 Ga0213872_10129478 3300021361 Bacteria 1112
255 Ga0213874_10055189 3300021377 Bacteria 1230
256 Ga0213876_10508329 3300021384 Bacteria 641
257 Ga0224712_10524294 3300022467 Bacteria 574
258 Ga0207425_1014749 3300025245 Bacteria 1769
259 Ga0209148_1000694 3300025254 Bacteria 27288
260 Ga0209233_1023038 3300025261 Bacteria 1584
261 Ga0209233_1037703 3300025261 Bacteria 1072
262 Ga0209455_1050266 3300025272 Bacteria 587
263 Ga0209673_1067002 3300025273 Bacteria 870
264 Ga0209564_1006358 3300025295 Bacteria 6407
265 Ga0209564_1009222 3300025295 Bacteria 4732
266 Ga0209758_1000015 3300025297 Bacteria 851943
267 Ga0209758_1000224 3300025297 Bacteria 121530
268 Ga0209758_1000972 3300025297 Bacteria 38579
269 Ga0209758_1005118 3300025297 Bacteria 10363
270 Ga0209758_1095316 3300025297 Bacteria 860
271 Ga0209758_1124406 3300025297 Bacteria 691
272 Ga0209256_1004825 3300025299 Bacteria 8177
273 Ga0209256_1026895 3300025299 Bacteria 1648
274 Ga0207426_1000201 3300025302 Bacteria 143975
275 Ga0207426_1000617 3300025302 Bacteria 45527
276 Ga0207426_1007359 3300025302 Bacteria 4620
277 Ga0207426_1040679 3300025302 Bacteria 1446
278 Ga0209051_1081462 3300025303 Bacteria 932
279 Ga0209257_1000440 3300025304 Bacteria 79182
280 Ga0207656_10211783 3300025321 Bacteria 939
281 Ga0207692_10000494 3300025898 Bacteria 13955
282 Ga0207692_10025046 3300025898 Bacteria 2782
283 Ga0207692_10576400 3300025898 Bacteria 721
284 Ga0207692_10624337 3300025898 Bacteria 694
285 Ga0207647_10250617 3300025904 Bacteria 1016
286 Ga0207685_10111943 3300025905 Bacteria 1184
287 Ga0207685_10169865 3300025905 Bacteria 1003
288 Ga0207699_10000480 3300025906 Bacteria 20266
289 Ga0207699_10032324 3300025906 Bacteria 2948
290 Ga0207699_10052435 3300025906 Bacteria 2415
291 Ga0207699_10894648 3300025906 Bacteria 655
292 Ga0207705_10015389 3300025909 Bacteria 5489
293 Ga0207705_10033765 3300025909 Bacteria 3656
294 Ga0207705_10046309 3300025909 Bacteria 3125
295 Ga0207705_10068845 3300025909 Bacteria 2563
296 Ga0207705_10427929 3300025909 Bacteria 1025
297 Ga0207684_10217689 3300025910 Bacteria 1648
298 Ga0207654_10007752 3300025911 Bacteria 5419
299 Ga0207707_10075803 3300025912 Bacteria 2935
300 Ga0207707_10169698 3300025912 Bacteria 1907
301 Ga0207707_10204609 3300025912 Bacteria 1720
302 Ga0207707_11014086 3300025912 Bacteria 681
303 Ga0207695_10000065 3300025913 Bacteria 336949
304 Ga0207695_10181364 3300025913 Bacteria 2026
305 Ga0207695_10402757 3300025913 Bacteria 1253
306 Ga0207695_10868876 3300025913 Bacteria 782
307 Ga0207671_10001858 3300025914 Bacteria 23570
308 Ga0207671_10065742 3300025914 Bacteria 2698
309 Ga0207671_10081338 3300025914 Bacteria 2429
310 Ga0207671_10691996 3300025914 Bacteria 811
311 Ga0207693_10010321 3300025915 Bacteria 7581
312 Ga0207693_10014578 3300025915 Bacteria 6317
313 Ga0207693_10027366 3300025915 Bacteria 4508
314 Ga0207663_10000356 3300025916 Bacteria 19925
315 Ga0207663_10003833 3300025916 Bacteria 7424
316 Ga0207663_10226813 3300025916 Bacteria 1362
317 Ga0207663_11324839 3300025916 Bacteria 580
318 Ga0207660_10041607 3300025917 Bacteria 3221
319 Ga0207660_10043493 3300025917 Bacteria 3157
320 Ga0207660_10063865 3300025917 Bacteria 2656
321 Ga0207660_10066782 3300025917 Bacteria 2603
322 Ga0207660_10117379 3300025917 Bacteria 2011
323 Ga0207660_10145108 3300025917 Bacteria 1818
324 Ga0207660_10181152 3300025917 Bacteria 1636
325 Ga0207660_10759207 3300025917 Bacteria 791
326 Ga0207660_11447927 3300025917 Bacteria 556
327 Ga0207657_10022149 3300025919 Bacteria 5960
328 Ga0207657_10026499 3300025919 Bacteria 5326
329 Ga0207657_10416282 3300025919 Bacteria 1056
330 Ga0207657_10818821 3300025919 Bacteria 719
331 Ga0207649_10287197 3300025920 Bacteria 1198
332 Ga0207649_10655828 3300025920 Bacteria 811
333 Ga0207649_10763263 3300025920 Bacteria 753
334 Ga0207652_10024203 3300025921 Bacteria 5036
335 Ga0207652_10084924 3300025921 Bacteria 2774
336 Ga0207652_10097084 3300025921 Bacteria 2596
337 Ga0207652_10124179 3300025921 Bacteria 2299
338 Ga0207652_10175619 3300025921 Bacteria 1924
339 Ga0207652_10180971 3300025921 Bacteria 1894
340 Ga0207652_11789221 3300025921 Bacteria 519
341 Ga0207694_10086964 3300025924 Bacteria 2461
342 Ga0207694_11099881 3300025924 Bacteria 673
343 Ga0207650_10004408 3300025925 Bacteria 9616
344 Ga0207700_10005911 3300025928 Bacteria 7358
345 Ga0207700_10009620 3300025928 Bacteria 6051
346 Ga0207700_10096308 3300025928 Bacteria 2349
347 Ga0207700_10101814 3300025928 Bacteria 2292
348 Ga0207700_10158437 3300025928 Bacteria 1878
349 Ga0207700_10384761 3300025928 Bacteria 1227
350 Ga0207700_11149614 3300025928 Bacteria 693
351 Ga0207664_10020450 3300025929 Bacteria 4906
352 Ga0207664_10055501 3300025929 Bacteria 3143
353 Ga0207664_10061817 3300025929 Bacteria 2989
354 Ga0207664_10078039 3300025929 Bacteria 2685
355 Ga0207664_10310142 3300025929 Bacteria 1390
356 Ga0207664_10328088 3300025929 Bacteria 1351
357 Ga0207664_11937042 3300025929 Bacteria 512
358 Ga0207644_10672086 3300025931 Bacteria 863
359 Ga0207690_10147252 3300025932 Bacteria 1742
360 Ga0207709_11145062 3300025935 Bacteria 640
361 Ga0207670_10864786 3300025936 Bacteria 756
362 Ga0207665_10000289 3300025939 Bacteria 34924
363 Ga0207665_10001832 3300025939 Bacteria 14302
364 Ga0207665_10184275 3300025939 Bacteria 1513
365 Ga0207665_10197567 3300025939 Bacteria 1464
366 Ga0207711_10614311 3300025941 Bacteria 1014
367 Ga0207661_10000678 3300025944 Bacteria 22066
368 Ga0207661_10029561 3300025944 Bacteria 4210
369 Ga0207661_10487791 3300025944 Bacteria 1125
370 Ga0207679_11368932 3300025945 Bacteria 649
371 Ga0207667_10047269 3300025949 Bacteria 4555
372 Ga0207667_10083387 3300025949 Bacteria 3310
373 Ga0207667_10101848 3300025949 Bacteria 2962
374 Ga0207667_10134295 3300025949 Bacteria 2548
375 Ga0207667_10176109 3300025949 Bacteria 2197
376 Ga0207667_10711926 3300025949 Bacteria 1006
377 Ga0207667_11203977 3300025949 Bacteria 737
378 Ga0207668_11783044 3300025972 Bacteria 555
379 Ga0207640_10742549 3300025981 Bacteria 845
380 Ga0207640_10968623 3300025981 Bacteria 747
381 Ga0207640_11117153 3300025981 Bacteria 698
382 Ga0207658_10943638 3300025986 Bacteria 786
383 Ga0207677_11003656 3300026023 Bacteria 757
384 Ga0207677_11938672 3300026023 Bacteria 547
385 Ga0207703_10341875 3300026035 Bacteria 1376
386 Ga0207639_10086437 3300026041 Bacteria 2497
387 Ga0207639_10618708 3300026041 Bacteria 1000
388 Ga0207639_10621331 3300026041 Bacteria 998
389 Ga0207678_10375540 3300026067 Bacteria 1228
390 Ga0207678_10391839 3300026067 Bacteria 1202
391 Ga0207678_10525310 3300026067 Bacteria 1033
392 Ga0207702_10063731 3300026078 Bacteria 3153
393 Ga0207702_10103590 3300026078 Bacteria 2517
394 Ga0207702_10186579 3300026078 Bacteria 1913
395 Ga0207702_10214872 3300026078 Bacteria 1789
396 Ga0207702_10845533 3300026078 Bacteria 906
397 Ga0207702_11107406 3300026078 Bacteria 786
398 Ga0207674_10064038 3300026116 Bacteria 3709
399 Ga0207674_10068834 3300026116 Bacteria 3561
400 Ga0207698_10069481 3300026142 Bacteria 2785
401 Ga0207698_10071309 3300026142 Bacteria 2756
402 Ga0207698_10190020 3300026142 Bacteria 1828
403 Ga0207698_10617722 3300026142 Bacteria 1070
404 Ga0207698_10699725 3300026142 Bacteria 1008
405 Ga0207698_10753643 3300026142 Bacteria 973
406 Ga0209389_1000029 3300027296 Bacteria 140337
407 Ga0209389_1000076 3300027296 Bacteria 92447
408 Ga0209589_1000012 3300027357 Bacteria 229451
409 Ga0209589_1000013 3300027357 Bacteria 229273
410 Ga0209489_100013 3300027361 Bacteria 229831
411 Ga0209489_100416 3300027361 Bacteria 77981
412 Ga0209700_100014 3300027363 Bacteria 299349
413 Ga0207428_10085071 3300027907 Bacteria 2464
414 Ga0268266_10212046 3300028379 Bacteria 1776
415 Ga0265338_10019779 3300028800 Bacteria 7118
416 Ga0265338_10165592 3300028800 Bacteria 1702
417 Ga0265338_10269323 3300028800 Bacteria 1249
418 Ga0265773_1026883 3300031018 Bacteria 598
419 Ga0265330_10006264 3300031235 Bacteria 5883
420 Ga0265325_10309681 3300031241 Bacteria 703
421 Ga0265339_10047735 3300031249 Bacteria 2350
422 Ga0265313_10007846 3300031595 Bacteria 7200
423 Ga0265313_10023026 3300031595 Bacteria 3363
424 Ga0265313_10071548 3300031595 Bacteria 1596
425 Ga0307508_10000005 3300031616 Bacteria 286511
426 Ga0307508_10426850 3300031616 Bacteria 917
427 Ga0265314_10066904 3300031711 Bacteria 2422
428 Ga0265342_10000082 3300031712 Bacteria 102532
429 Ga0265342_10026636 3300031712 Bacteria 3619
430 Ga0307510_10007616 3300033180 Bacteria 12905
431 Ga0307510_10121436 3300033180 Bacteria 2316
432 Ga0373934_0163106 3300035086 Bacteria 914
433 Ga0373944_0183305 3300035089 Bacteria 752
434 Ga0373923_0137515 3300035111 Bacteria 1102
435 Ga0373945_0079344 3300035116 Bacteria 1255
436 Ga0373953_0080293 3300035117 Bacteria 1355
437 Ga0373954_0024158 3300035118 Bacteria 2769
438 Ga0373954_0263423 3300035118 Bacteria 849
439 Ga0373956_0163722 3300035119 Bacteria 1049
440 Ga0373957_0066071 3300035120 Bacteria 1408
441 Ga0373943_0034867 3300035170 Bacteria 2402
442 Ga0373955_0645384 3300035172 Bacteria 649
443 Ga0373961_0025585 3300035241 Bacteria 1606
444 Ga0373924_0002858 3300035410 Bacteria 5851
445 Ga0373931_0092941 3300035691 Bacteria 1684
446 Ga0373935_0063084 3300035692 Bacteria 2374
447 Ga0373927_0021218 3300035695 Bacteria 4255
448 Ga0373927_0261747 3300035695 Bacteria 1138
449 Ga0373933_0000114 3300035724 Bacteria 52016
450 Ga0373933_0479957 3300035724 Bacteria 814
451 Ga0373947_1084289 3300035725 Bacteria 546
452 Ga0373937_0074647 3300036401 Bacteria 3129
453 Ga0373937_1056233 3300036401 Bacteria 761
454 Ga0372808_044701 3300036459 Bacteria 634
455 Ga0373925_0008346 3300037068 Bacteria 7541
456 Ga0373925_0012108 3300037068 Bacteria 6243
457 Ga0373925_0621816 3300037068 Bacteria 890
458 Ga0395899_0159301 3300037312 Bacteria 1595
459 Ga0395899_0271719 3300037312 Bacteria 1156
460 Ga0395900_0052668 3300037418 Bacteria 4189
461 Ga0395900_0053769 3300037418 Bacteria 4145
462 Ga0395900_0084990 3300037418 Bacteria 3252
463 Ga0395900_0093104 3300037418 Bacteria 3096
464 Ga0395900_0227912 3300037418 Bacteria 1875
465 Ga0395900_0298738 3300037418 Bacteria 1597
466 Ga0395900_0351417 3300037418 Bacteria 1448
467 Ga0395898_0014967 3300037466 Bacteria 7965
468 Ga0395898_0034661 3300037466 Bacteria 5027
469 Ga0395898_0072959 3300037466 Bacteria 3315
470 Ga0395898_0138617 3300037466 Bacteria 2329
471 Ga0395898_0186341 3300037466 Bacteria 1983
472 Ga0395898_0214112 3300037466 Bacteria 1838
473 Ga0395905_0005511 3300037471 Bacteria 12915
474 Ga0395905_0084822 3300037471 Bacteria 2968
475 Ga0395901_0026879 3300038443 Bacteria 5908
476 Ga0395901_0065435 3300038443 Bacteria 3785
477 Ga0395901_0097039 3300038443 Bacteria 3089
478 Ga0395901_0112127 3300038443 Bacteria 2864
479 Ga0395901_0734695 3300038443 Bacteria 981
480 Ga0395901_0899648 3300038443 Bacteria 867
481 Ga0436365_0021907 3300039437 Bacteria 949
482 Ga0436365_0808505 3300039437 Bacteria 809
483 Ga0436360_0291987 3300039438 Bacteria 6332
484 Ga0436361_0183009 3300039447 Bacteria 576
485 Ga0436361_0759798 3300039447 Bacteria 2785
486 Ga0436361_0959035 3300039447 Bacteria 2510
487 Ga0436363_0385198 3300039450 Bacteria 836
488 Ga0436363_0439777 3300039450 Bacteria 8998
489 Ga0436363_0468515 3300039450 Bacteria 1037
490 Ga0436363_0514184 3300039450 Bacteria 951
491 Ga0436363_0973295 3300039450 Bacteria 1154
492 Ga0436362_1074496 3300039453 Bacteria 5861
493 Ga0436362_1127610 3300039453 Bacteria 568
494 Ga0451787_764725 3300041441 Bacteria 1277
495 Ga0451789_1221988 3300041443 Bacteria 1095
496 Ga0451793_1530076 3300041452 Bacteria 2503
497 Ga0451795_0965185 3300041456 Bacteria 771
498 Ga0451798_1113104 3300041458 Bacteria 547
499 Ga0451802_1193815 3300041460 Bacteria 777
500 Ga0451807_0896219 3300041486 Bacteria 1222
501 Ga0451845_0561026 3300041501 Bacteria 1422
502 Ga0451849_1468299 3300041505 Bacteria 1503
503 Ga0451843_0604583 3300041509 Bacteria 1231
504 Ga0451853_0997325 3300041512 Bacteria 1293
505 Ga0466969_0016425 3300044656 Bacteria 3873
506 Ga0466969_0078487 3300044656 Bacteria 1579
507 Ga0466972_0011618 3300044658 Bacteria 4421
508 Ga0466972_0185541 3300044658 Bacteria 975
509 Ga0466965_0025559 3300044683 Bacteria 2858
510 Ga0466965_0126248 3300044683 Bacteria 1324
511 Ga0466965_0226223 3300044683 Bacteria 998
512 Ga0466965_0779658 3300044683 Bacteria 552
513 Ga0466966_0002297 3300044684 Bacteria 12462
514 Ga0466966_0169498 3300044684 Bacteria 1327
515 Ga0466961_0000129 3300044693 Bacteria 50353
516 Ga0466961_0296449 3300044693 Bacteria 988
517 Ga0466961_0319671 3300044693 Bacteria 947
518 Ga0466963_0060863 3300044694 Bacteria 2522
519 Ga0466963_0137605 3300044694 Bacteria 1690
520 Ga0466963_0301623 3300044694 Bacteria 1127
521 Ga0466963_1068382 3300044694 Bacteria 568
522 Ga0466964_0034112 3300044706 Bacteria 2030
523 Ga0466964_0124045 3300044706 Bacteria 1168
524 Ga0466964_0213492 3300044706 Bacteria 933
525 Ga0466971_0021086 3300044719 Bacteria 2898
526 Ga0466971_0403232 3300044719 Bacteria 667
527 Ga0466971_0440412 3300044719 Bacteria 638
528 Ga0466968_0007308 3300044735 Bacteria 4196
529 Ga0466968_0387074 3300044735 Bacteria 684
530 Ga0466957_0025520 3300044842 Bacteria 3503
531 Ga0466957_0167399 3300044842 Bacteria 1430
532 Ga0466957_0171826 3300044842 Bacteria 1412
533 Ga0466959_0006120 3300045049 Bacteria 8313
534 Ga0466959_0461413 3300045049 Bacteria 861
535 Ga0466959_0479266 3300045049 Bacteria 842
536 Ga0466958_0254707 3300045836 Bacteria 1123
537 Ga0466958_0297884 3300045836 Bacteria 1035
538 Ga0466967_0029176 3300045976 Bacteria 4614
539 Ga0466967_0039786 3300045976 Bacteria 4045
540 Ga0466967_0173235 3300045976 Bacteria 2031
541 Ga0466967_0419565 3300045976 Bacteria 1304
542 Ga0466967_0458464 3300045976 Bacteria 1246
543 Ga0466967_1345815 3300045976 Bacteria 711
544 Ga0495592_0067706 3300046454 Bacteria 2608
545 Ga0495592_0158570 3300046454 Bacteria 1559
546 Ga0495592_0275854 3300046454 Bacteria 1101
547 Ga0495603_0047738 3300046455 Bacteria 2549
548 Ga0495603_0240840 3300046455 Bacteria 1042
549 Ga0495629_0151152 3300046459 Bacteria 1613
550 Ga0495629_0278124 3300046459 Bacteria 1149
551 Ga0495629_0286765 3300046459 Bacteria 1129
552 Ga0495629_0935539 3300046459 Bacteria 567
553 Ga0495638_0002281 3300046460 Bacteria 15850
554 Ga0495641_0111456 3300046461 Bacteria 1221
555 Ga0495641_0424705 3300046461 Bacteria 604
556 Ga0495651_0010124 3300046462 Bacteria 7242
557 Ga0495651_0016379 3300046462 Bacteria 5740
558 Ga0495651_0346429 3300046462 Bacteria 983
559 Ga0495653_0545695 3300046463 Bacteria 718
560 Ga0495582_0013743 3300046473 Bacteria 4458
561 Ga0495582_0151970 3300046473 Bacteria 1315
562 Ga0495639_0005620 3300046475 Bacteria 5399
563 Ga0495664_0007028 3300046477 Bacteria 6234
564 Ga0495664_0011419 3300046477 Bacteria 5008
565 Ga0495664_0046017 3300046477 Bacteria 2588
566 Ga0495585_0221297 3300046492 Bacteria 955
567 Ga0495585_0290860 3300046492 Bacteria 805
568 Ga0495594_0180966 3300046499 Bacteria 1200
569 Ga0495607_0156037 3300046501 Bacteria 1164
570 Ga0495583_0162088 3300046506 Bacteria 922
571 Ga0495606_0034748 3300046507 Bacteria 3456
572 Ga0495606_0301828 3300046507 Bacteria 867
573 Ga0495608_0300452 3300046511 Bacteria 994
574 Ga0495608_0401077 3300046511 Bacteria 839
575 Ga0495610_0214405 3300046512 Bacteria 781
576 Ga0495618_0310891 3300046514 Bacteria 978
577 Ga0495618_0761436 3300046514 Bacteria 566
578 Ga0495620_0273678 3300046515 Bacteria 643
579 Ga0495620_0284334 3300046515 Bacteria 629
580 Ga0495628_0032331 3300046516 Bacteria 4224
581 Ga0495628_0050469 3300046516 Bacteria 3291
582 Ga0495630_0036284 3300046517 Bacteria 3685
583 Ga0495630_0440496 3300046517 Bacteria 998
584 Ga0495630_0486338 3300046517 Bacteria 946
585 Ga0495631_0090578 3300046518 Bacteria 1317
586 Ga0495648_0003897 3300046524 Bacteria 12935
587 Ga0495648_0019285 3300046524 Bacteria 4801
588 Ga0495648_0128425 3300046524 Bacteria 1351
589 Ga0495642_0148664 3300046528 Bacteria 1013
590 Ga0495652_0006665 3300046529 Bacteria 10717
591 Ga0495652_0085443 3300046529 Bacteria 2593
592 Ga0495652_0299714 3300046529 Bacteria 1169
593 Ga0495652_0713591 3300046529 Bacteria 674
594 Ga0495665_0078537 3300046531 Bacteria 1736
595 Ga0495640_0385092 3300046533 Bacteria 862
596 Ga0495587_0014466 3300046536 Bacteria 4948
597 Ga0495609_0302073 3300046538 Bacteria 652
598 Ga0495645_0028158 3300046543 Bacteria 4083
599 Ga0495645_0114699 3300046543 Bacteria 1903
600 Ga0495622_0045393 3300046557 Bacteria 2041
601 Ga0495667_0075193 3300046559 Bacteria 2199
602 Ga0495634_0093381 3300046642 Bacteria 1951
603 Ga0495634_0144144 3300046642 Bacteria 1510
604 Ga0495611_0097717 3300046648 Bacteria 1361
605 Ga0495611_0128623 3300046648 Bacteria 1182
606 Ga0495625_0208839 3300046660 Bacteria 1284
607 Ga0495625_0717004 3300046660 Bacteria 589
608 Ga0495635_0011833 3300046663 Bacteria 6116
609 Ga0495635_0112373 3300046663 Bacteria 1860
610 Ga0495635_1029548 3300046663 Bacteria 523
611 Ga0495661_0062394 3300046665 Bacteria 2208
612 Ga0495588_0061742 3300046674 Bacteria 1942
613 Ga0495588_0081630 3300046674 Bacteria 1688
614 Ga0495657_0020349 3300046675 Bacteria 4771
615 Ga0495657_0135124 3300046675 Bacteria 1541
616 Ga0495599_0038942 3300046678 Bacteria 2988
617 Ga0495623_0153763 3300046679 Bacteria 1358
618 Ga0495623_0155439 3300046679 Bacteria 1348
619 Ga0495646_0015043 3300046680 Bacteria 4915
620 Ga0495646_0030035 3300046680 Bacteria 3395
621 Ga0495646_0091348 3300046680 Bacteria 1757
622 Ga0495658_0202899 3300046683 Bacteria 1236
623 Ga0495658_0305322 3300046683 Bacteria 1007
624 Ga0495613_0080774 3300046689 Bacteria 2363
625 Ga0495613_0092768 3300046689 Bacteria 2186
626 Ga0495613_0108256 3300046689 Bacteria 2004
627 Ga0495613_0242910 3300046689 Bacteria 1258
628 Ga0495624_0062744 3300046690 Bacteria 2324
629 Ga0495624_0115823 3300046690 Bacteria 1647
630 Ga0495649_0168666 3300046694 Bacteria 1146
631 Ga0495600_0301089 3300046809 Bacteria 1012
632 Ga0495600_0365940 3300046809 Bacteria 901
633 Ga0495581_0129575 3300047315 Bacteria 1470
634 Ga0495581_0185090 3300047315 Bacteria 1218
635 Ga0495581_0711693 3300047315 Bacteria 579
636 Ga0495604_0005727 3300047317 Bacteria 9854
637 Ga0495604_0192229 3300047317 Bacteria 1421
638 Ga0495604_0264638 3300047317 Bacteria 1167
639 Ga0495604_0576296 3300047317 Bacteria 724
640 Ga0495674_0019801 3300047319 Bacteria 6239
641 Ga0495674_0030816 3300047319 Bacteria 4874
642 Ga0495672_0141937 3300047320 Bacteria 1254
643 Ga0495676_0056563 3300047321 Bacteria 3101
644 Ga0495676_0555057 3300047321 Bacteria 750
645 Ga0495676_0598582 3300047321 Bacteria 718
646 Ga0495676_0656161 3300047321 Bacteria 681
647 Ga0495680_0006823 3300047322 Bacteria 10545
648 Ga0495683_0362905 3300047323 Bacteria 609
649 Ga0495675_0021068 3300047444 Bacteria 4149
650 Ga0495673_0021341 3300047469 Bacteria 3201
651 Ga0495673_0048751 3300047469 Bacteria 1866
652 Ga0495684_0043412 3300047471 Bacteria 3442
653 Ga0495684_0140995 3300047471 Bacteria 1807
654 Ga0495684_0161443 3300047471 Bacteria 1671
655 Ga0495684_0322099 3300047471 Bacteria 1105
656 Ga0495686_0115826 3300047472 Bacteria 1602
657 Ga0495686_0173712 3300047472 Bacteria 1252
658 Ga0495686_0463911 3300047472 Bacteria 671
659 Ga0495593_0022751 3300047673 Bacteria 3487
660 Ga0495593_0065310 3300047673 Bacteria 1898
661 Ga0495593_0093478 3300047673 Bacteria 1547
662 Ga0495593_0602176 3300047673 Bacteria 552
663 Ga0495602_0050884 3300048088 Bacteria 3697
664 Ga0495602_0169061 3300048088 Bacteria 1698
665 Ga0495602_0337391 3300048088 Bacteria 1091
666 Ga0495602_0522795 3300048088 Bacteria 826
667 Ga0495602_0840429 3300048088 Bacteria 614
668 Ga0496100_0318774 3300048903 Bacteria 1167
669 Ga0496100_1590744 3300048903 Bacteria 516
670 Ga0496101_0426449 3300048904 Bacteria 1045
671 Ga0496102_0064026 3300048905 Bacteria 3367
672 Ga0496102_0971760 3300048905 Bacteria 770
673 Ga0496103_0008405 3300048906 Bacteria 6134
674 Ga0496104_0004036 3300048907 Bacteria 12728
675 Ga0496104_0005388 3300048907 Bacteria 11198
676 Ga0496104_0176181 3300048907 Bacteria 2049
677 Ga0496104_0448165 3300048907 Bacteria 1202
678 Ga0496105_0001275 3300048908 Bacteria 17613
679 Ga0496105_0009543 3300048908 Bacteria 7595
680 Ga0496105_0080543 3300048908 Bacteria 2690
681 Ga0496105_0579331 3300048908 Bacteria 873
682 Ga0496105_0875758 3300048908 Bacteria 678
683 Ga0496106_0003991 3300048909 Bacteria 11026
684 Ga0496106_0159379 3300048909 Bacteria 1784
685 Ga0496106_0172559 3300048909 Bacteria 1714
686 Ga0496106_0264382 3300048909 Bacteria 1377
687 Ga0496106_0689411 3300048909 Bacteria 815
688 Ga0496107_0005978 3300048910 Bacteria 8339
689 Ga0496107_0229951 3300048910 Bacteria 1380
690 Ga0496107_1048327 3300048910 Bacteria 590
691 Ga0496108_0000581 3300048911 Bacteria 28520
692 Ga0496108_0086416 3300048911 Bacteria 2662
693 Ga0496108_0472175 3300048911 Bacteria 1096
694 Ga0496109_0000507 3300048912 Bacteria 33280
695 Ga0496109_0002379 3300048912 Bacteria 15713
696 Ga0496110_0011482 3300048913 Bacteria 7250
697 Ga0496110_0652287 3300048913 Bacteria 952
698 Ga0496110_1301985 3300048913 Bacteria 636
699 Ga0496110_1408097 3300048913 Bacteria 607
700 Ga0496111_0005375 3300048914 Bacteria 8193
701 Ga0496111_0482704 3300048914 Bacteria 913
702 Ga0496112_0000019 3300048915 Bacteria 185531
703 Ga0496112_0004823 3300048915 Bacteria 11515
704 Ga0496112_0016561 3300048915 Bacteria 6910
705 Ga0496112_0721333 3300048915 Bacteria 924
706 Ga0496113_0011391 3300048916 Bacteria 5928
707 Ga0496113_0029645 3300048916 Bacteria 3955
708 Ga0496113_0328596 3300048916 Bacteria 1226
709 Ga0496114_0045648 3300048917 Bacteria 3641
710 Ga0496114_0080506 3300048917 Bacteria 2751
711 Ga0496114_0100516 3300048917 Bacteria 2468
712 Ga0496114_0738166 3300048917 Bacteria 861
713 Ga0496114_1694137 3300048917 Bacteria 520
714 Ga0496115_0083685 3300048918 Bacteria 2601
715 Ga0496115_0194139 3300048918 Bacteria 1677
716 Ga0496115_0286035 3300048918 Bacteria 1353
717 Ga0496118_0035728 3300048921 Bacteria 4029
718 Ga0496118_0063743 3300048921 Bacteria 2710
719 Ga0496118_0202218 3300048921 Bacteria 1175
720 Ga0496119_0030804 3300048922 Bacteria 3609
721 Ga0496119_0041332 3300048922 Bacteria 2937
722 Ga0496120_0023580 3300048923 Bacteria 3850
723 Ga0496120_0046427 3300048923 Bacteria 2510
724 Ga0496121_0039009 3300048924 Bacteria 4194
725 Ga0496121_0053636 3300048924 Bacteria 3376
726 Ga0496121_0633204 3300048924 Bacteria 654
727 Ga0496122_0273367 3300048925 Bacteria 929
728 Ga0496123_0416420 3300048926 Bacteria 607
729 Ga0496125_0056378 3300048928 Bacteria 3191
730 Ga0496126_0027182 3300048929 Bacteria 5469
731 Ga0496126_0041848 3300048929 Bacteria 4236
732 Ga0496126_0066674 3300048929 Bacteria 3218
733 Ga0496126_0172089 3300048929 Bacteria 1844
734 Ga0496126_0256817 3300048929 Bacteria 1454
735 Ga0496126_0599007 3300048929 Bacteria 868
736 Ga0496126_0842327 3300048929 Bacteria 700
737 Ga0496126_0991842 3300048929 Bacteria 631
738 Ga0496126_1022583 3300048929 Bacteria 619
739 Ga0495682_0026256 3300049460 Bacteria 2163
740 Ga0501031_0348533 3300049568 Bacteria 958
741 Ga0501031_0353993 3300049568 Bacteria 950
742 Ga0501032_0014636 3300049569 Bacteria 5556
743 Ga0501033_0003525 3300049570 Bacteria 12801
744 Ga0501033_0191861 3300049570 Bacteria 1462
745 Ga0501034_0011514 3300049571 Bacteria 9167
746 Ga0501034_0026323 3300049571 Bacteria 5924
747 Ga0501034_0100582 3300049571 Bacteria 2885
748 Ga0501036_0057240 3300049572 Bacteria 3302
749 Ga0501036_0172827 3300049572 Bacteria 1820
750 Ga0501036_0212426 3300049572 Bacteria 1625
751 Ga0501037_0014971 3300049573 Bacteria 5704
752 Ga0501037_0176446 3300049573 Bacteria 1517
753 Ga0501038_0010109 3300049574 Bacteria 8638
754 Ga0501038_0032236 3300049574 Bacteria 4624
755 Ga0501038_0061390 3300049574 Bacteria 3214
756 Ga0501038_0127784 3300049574 Bacteria 2090
757 Ga0501039_0101097 3300049575 Bacteria 2250
758 Ga0501039_0339674 3300049575 Bacteria 1180
759 Ga0501040_0117720 3300049576 Bacteria 1862
760 Ga0501042_0002545 3300049578 Bacteria 11215
761 Ga0501043_0020509 3300049579 Bacteria 5185
762 Ga0501043_0051339 3300049579 Bacteria 3240
763 Ga0501043_0054115 3300049579 Bacteria 3151
764 Ga0501046_0026634 3300049580 Bacteria 4722
765 Ga0501046_0082467 3300049580 Bacteria 2483
766 Ga0501047_0009908 3300049581 Bacteria 9009
767 Ga0501047_0027170 3300049581 Bacteria 5512
768 Ga0501047_0064552 3300049581 Bacteria 3531
769 Ga0501047_0102168 3300049581 Bacteria 2746
770 Ga0501048_0005496 3300049582 Bacteria 9642
771 Ga0501048_0070461 3300049582 Bacteria 2469
772 Ga0501067_0002825 3300049583 Bacteria 9556
773 Ga0501067_0058453 3300049583 Bacteria 2136
774 Ga0501068_0009793 3300049584 Bacteria 5369
775 Ga0501068_0521638 3300049584 Bacteria 771
776 Ga0501069_0189424 3300049585 Bacteria 1190
777 Ga0501069_0703007 3300049585 Bacteria 610
778 Ga0501070_0026055 3300049586 Bacteria 4905
779 Ga0501070_0467715 3300049586 Bacteria 1015
780 Ga0501071_0748756 3300049587 Bacteria 753
781 Ga0501072_0273977 3300049588 Bacteria 1342
782 Ga0501073_0003590 3300049589 Bacteria 11666
783 Ga0501073_0014548 3300049589 Bacteria 5716
784 Ga0501073_0103295 3300049589 Bacteria 1979
785 Ga0501074_0023865 3300049590 Bacteria 4445
786 Ga0501077_0234769 3300049593 Bacteria 1166
787 Ga0501080_0086024 3300049742 Bacteria 2921
788 Ga0501080_0109870 3300049742 Bacteria 2555
789 Ga0501083_0010499 3300049744 Bacteria 6517
790 Ga0501083_0103698 3300049744 Bacteria 1874
791 Ga0501035_0035212 3300049822 Bacteria 4544
792 Ga0501035_0039873 3300049822 Bacteria 4247
793 Ga0501035_0486858 3300049822 Bacteria 1017
794 Ga0501044_0026586 3300049823 Bacteria 6125
795 Ga0501044_0119620 3300049823 Bacteria 2636
796 Ga0501044_0308943 3300049823 Bacteria 1508
797 Ga0501044_0344200 3300049823 Bacteria 1411
798 Ga0501045_0003604 3300049824 Bacteria 10638
799 Ga0501045_0883285 3300049824 Bacteria 657
800 nmdc:mga03683_32770_c1 3300050489 Bacteria 2092
801 nmdc:mga03n38_378600_c1 3300050490 Bacteria 775
802 nmdc:mga03n38_421976_c1 3300050490 Bacteria 738
803 nmdc:mga00v17_44083_c1 3300050491 Bacteria 2688
804 nmdc:mga0yw44_319739_c1 3300050492 Bacteria 1042
805 nmdc:mga0yw44_488160_c1 3300050492 Bacteria 836
806 nmdc:mga0k408_224991_c1 3300050493 Bacteria 1120
807 nmdc:mga07m45_117152_c1 3300050496 Bacteria 1537
808 nmdc:mga07m45_189786_c1 3300050496 Bacteria 1195
809 nmdc:mga07m45_907212_c1 3300050496 Bacteria 504
810 nmdc:mga05p37_275569_c1 3300050507 Bacteria 2009
811 nmdc:mga06r32_34461_c1 3300050510 Bacteria 4773
812 nmdc:mga08y16_16577_c1 3300050511 Bacteria 7749
813 nmdc:mga0rr50_545692_c1 3300050513 Bacteria 987
814 nmdc:mga0sz30_213409_c1 3300050516 Bacteria 858
815 nmdc:mga0sz30_6906_c2 3300050516 Bacteria 1626
816 nmdc:mga0sz30_96892_c1 3300050516 Bacteria 1287
817 Ga0495601_0022702 3300053077 Bacteria 3855
818 Ga0495601_0028119 3300053077 Bacteria 3481
819 Ga0495601_0257180 3300053077 Bacteria 1140
820 Ga0495601_0334044 3300053077 Bacteria 986
821 Ga0495601_0463950 3300053077 Bacteria 819
822 Ga0495601_0760047 3300053077 Bacteria 616
823 Ga0495612_0027589 3300053078 Bacteria 2284
824 Ga0495612_0055280 3300053078 Bacteria 1636
825 Ga0495612_0078851 3300053078 Bacteria 1382
826 Ga0500635_0109173 3300053080 Bacteria 1026
827 Ga0495595_0002381 3300053084 Bacteria 7334
828 Ga0495595_0092418 3300053084 Bacteria 1453
829 Ga0495595_0420733 3300053084 Bacteria 678
830 Ga0495619_0028465 3300053085 Bacteria 3605
831 Ga0495619_0045807 3300053085 Bacteria 2874
832 Ga0495619_0322085 3300053085 Bacteria 1070
833 Ga0495619_0514515 3300053085 Bacteria 823
834 Ga0495619_0772270 3300053085 Bacteria 651
835 Ga0495619_1116140 3300053085 Bacteria 524
836 Ga0500578_0676117 3300053086 Bacteria 558
837 Ga0500643_000062 3300053087 Bacteria 122407
838 Ga0500644_0154461 3300053088 Bacteria 923
839 Ga0500646_0261983 3300053090 Bacteria 611
840 Ga0500647_0084525 3300053091 Bacteria 1522
841 Ga0500647_0315562 3300053091 Bacteria 663
842 Ga0500583_0147721 3300053092 Bacteria 1169
843 Ga0500651_0073134 3300053093 Bacteria 2131
844 Ga0500651_0673923 3300053093 Bacteria 555
845 Ga0500566_0009283 3300053094 Bacteria 5816
846 Ga0500566_0062595 3300053094 Bacteria 2103
847 Ga0500566_0190275 3300053094 Bacteria 1045
848 Ga0500640_205624 3300053095 Bacteria 682
849 Ga0500650_0182646 3300053098 Bacteria 961
850 Ga0500553_268591 3300053101 Bacteria 500
851 Ga0500555_064463 3300053103 Bacteria 978
852 Ga0500556_0062248 3300053104 Bacteria 1376
853 Ga0500556_0349535 3300053104 Bacteria 572
854 Ga0500557_000043 3300053105 Bacteria 63389
855 Ga0500569_006585 3300053109 Bacteria 2558
856 Ga0500569_035234 3300053109 Bacteria 1434
857 Ga0500595_003786 3300053119 Bacteria 6958
858 Ga0500607_048744 3300053121 Bacteria 2263
859 Ga0500608_013748 3300053122 Bacteria 3596
860 Ga0500608_038663 3300053122 Bacteria 2283
861 Ga0500642_0000193 3300053130 Bacteria 24969
862 Ga0500642_0021444 3300053130 Bacteria 2559
863 Ga0500652_123749 3300053131 Bacteria 1081
864 Ga0500655_008973 3300053133 Bacteria 1799
865 Ga0500658_0030957 3300053134 Bacteria 2091
866 Ga0500559_0031651 3300053136 Bacteria 2269
867 Ga0500559_0336124 3300053136 Bacteria 707
868 Ga0500568_0012024 3300053139 Bacteria 3990
869 Ga0500577_0020288 3300053142 Bacteria 2171
870 Ga0500585_073008 3300053144 Bacteria 1239
871 Ga0500588_0356508 3300053146 Bacteria 556
872 Ga0500590_182459 3300053148 Bacteria 909
873 Ga0500604_0049520 3300053151 Bacteria 1292
874 Ga0500616_0122149 3300053153 Bacteria 1242
875 Ga0500619_007273 3300053154 Bacteria 2611
876 Ga0500620_015171 3300053155 Bacteria 2172
877 Ga0500622_0063052 3300053156 Bacteria 1887
878 Ga0500624_008204 3300053157 Bacteria 1458
879 Ga0500627_0084741 3300053158 Bacteria 1415
880 Ga0500634_0090295 3300053161 Bacteria 1557
881 Ga0500638_059449 3300053162 Bacteria 1838
882 Ga0500639_232946 3300053163 Bacteria 756
883 Ga0500639_274070 3300053163 Bacteria 656
884 Ga0500636_0000075 3300053177 Bacteria 48415
885 Ga0500636_0167194 3300053177 Bacteria 1193
886 Ga0500625_000791 3300053729 Bacteria 9601
887 Ga0500645_036548 3300053730 Bacteria 1461
888 Ga0500599_001855 3300053736 Bacteria 2489
889 Ga0501084_0326673 3300054114 Bacteria 1296
890 Ga0501084_0732055 3300054114 Bacteria 834
891 Ga0587073_0080212 3300059492 Bacteria 808
892 Ga0501082_0014060 3300060353 Bacteria 6884
893 Ga0466962_0052885 3300061719 Bacteria 1941
894 Ga0466962_0272532 3300061719 Bacteria 834
895 2507504842 2507262055 Bacteria 8048963
896 2508546197 2508501009 Bacteria 7784016
897 2508695129 2508501042 Bacteria 8719808
898 2511395455 2511231028 Bacteria 8046582
899 2513625424 2513237092 Bacteria 8341956
900 2513639553 2513237094 Bacteria 8789602
901 2513703351 2513237102 Bacteria 7703324
902 2513715708 2513237104 Bacteria 10034502
903 2513873914 2513237139 Bacteria 8737671
904 2514012887 2513237161 Bacteria 8871253
905 2515625865 2515154112 Bacteria 8294334
906 2524435743 2524023205 Bacteria 8918781
907 2545677467 2545555834 Bacteria 8130841
908 2617351700 2617270735 Bacteria 9163226
909 2617377248 2617270741 Bacteria 8201522
910 2745079039 2744054633 Bacteria 8678936
911 2793066047 2791355196 Bacteria 7323613
912 2805915997 2802429603 Bacteria 8777136
913 2824602574 2824600985 Bacteria 8488197
914 2824612646 2824609381 Bacteria 8672835
915 2824621108 2824617872 Bacteria 8814715
916 2824630115 2824626560 Bacteria 8813858
917 2824640730 2824635225 Bacteria 8785348
918 2824649823 2824644064 Bacteria 8743947
919 2824654461 2824653114 Bacteria 8493680
920 2824674855 2824671348 Bacteria 8369588
921 2824683558 2824679649 Bacteria 8248951
922 2824691923 2824687955 Bacteria 8360029
923 2824697652 2824696289 Bacteria 8335049
924 2824709661 2824704595 Bacteria 9667483
925 2824719828 2824714736 Bacteria 8717648
926 2824727932 2824723954 Bacteria 8758240
927 2824736249 2824732956 Bacteria 7810675
928 2824750285 2824746037 Bacteria 7911610
929 2824757115 2824753945 Bacteria 9787441
930 2824768451 2824763712 Bacteria 9792355
931 2824774944 2824773399 Bacteria 8360218
932 2838131017 2838122688 Bacteria 8803140
933 2841944458 2841941048 Bacteria 8688029
934 2841951599 2841949485 Bacteria 8680857
935 2841969235 2841966195 Bacteria 8673214
936 2841982900 2841974524 Bacteria 8931498
937 2841991018 2841983080 Bacteria 8395090
938 2842043884 2842038055 Bacteria 8002051
939 2842052126 2842045827 Bacteria 8006841
940 2844321822 2844315083 Bacteria 8138177
941 2847931470 2847930680 Bacteria 9342022
942 2847941752 2847939898 Bacteria 8606328
943 2857511567 2857509624 Bacteria 7472071
944 2874596836 2874590934 Bacteria 8299676
945 2874624420 2874620515 Bacteria 8290088
946 2874636707 2874628541 Bacteria 8630250
947 2874648641 2874645413 Bacteria 8214782
948 2876766414 2876761206 Bacteria 10111113
949 2876777300 2876771140 Bacteria 8287509
950 2876825382 2876818435 Bacteria 8274608
951 2879077631 2879074833 Bacteria 8279565
952 2879087493 2879083081 Bacteria 8587928
953 2879107224 2879099564 Bacteria 10442239
954 2879127661 2879127579 Bacteria 8294491
955 2879146066 2879142872 Bacteria 8267021
956 2881371003 2881364244 Bacteria 7710352
957 2881665695 2881665667 Bacteria 8175609
958 2885371400 2885366525 Bacteria 8326213
959 2888420773 2888419890 Bacteria 7857137
960 2903727628 2903727486 Bacteria 8281579
961 2904672241 2904666416 Bacteria 8226587
962 2904716182 2904711408 Bacteria 9771557
963 2906602882 2906602504 Bacteria 8295279
964 2906633525 2906626472 Bacteria 8826946
965 2906647590 2906643746 Bacteria 8722424
966 2908775764 2908775508 Bacteria 8092255
967 2922400798 2922393267 Bacteria 8285685
968 2932794687 2932794094 Bacteria 7915132
969 2932805502 2932801729 Bacteria 7987968
970 2932812580 2932809354 Bacteria 9135765
971 2932822942 2932818245 Bacteria 9955613
972 2935614959 2935608549 Bacteria 8203142
973 2935652986 2935648319 Bacteria 8801166
974 2935661569 2935656913 Bacteria 8965014
975 2935689588 2935684952 Bacteria 9590419
976 2935717107 2935713505 Bacteria 9608509
977 2935730059 2935722832 Bacteria 9608746
978 2935738522 2935732158 Bacteria 9706831
979 2935749230 2935741537 Bacteria 9707219
980 2935756941 2935750917 Bacteria 9590372
981 2935764445 2935760218 Bacteria 9817913
982 2935772772 2935769743 Bacteria 7878163
983 2935778091 2935777560 Bacteria 8077691
984 2935787319 2935785616 Bacteria 7962367
985 2935795893 2935793552 Bacteria 8012592
986 2935826002 2935819856 Bacteria 8261050
987 2935851621 2935847175 Bacteria 8228321
988 2935888901 2935883170 Bacteria 7964738
989 2935910357 2935908558 Bacteria 8568796
990 2935918357 2935916978 Bacteria 9113783
991 2935927732 2935926038 Bacteria 8601059
992 2935936396 2935934488 Bacteria 8602579
993 2935944051 2935942939 Bacteria 8599779
994 2935952488 2935951376 Bacteria 8602333
995 2935969328 2935967501 Bacteria 8603075
996 2935977907 2935975950 Bacteria 8347125
997 2935984789 2935984226 Bacteria 8302647
998 2936015702 2936011229 Bacteria 8801034
999 2936024336 2936019824 Bacteria 8804134
1000 2936031777 2936028420 Bacteria 8965941
1001 2936051599 2936046547 Bacteria 8903709
1002 2936055960 2936055302 Bacteria 8785755
1003 2940562855 2940556831 Bacteria 9590747
1004 2941532353 2941531003 Bacteria 7653939
1005 3005486418 3005483717 Bacteria 7877331
1006 3005509546 3005506211 Bacteria 6943378
1007 3005589021 3005587118 Bacteria 7794411
1008 3005602170 3005594810 Bacteria 8716512
1009 641640484 641522639 Bacteria 7737025
1010 8006929778 8006926726 Bacteria 6749210
1011 8016526598 8016522445 Bacteria 8156687
1012 8016531683 8016530956 Bacteria 8155261
1013 8016544881 8016539877 Bacteria 8155419
1014 8016557195 8016548790 Bacteria 8155074
1015 8016565547 8016557553 Bacteria 8154380
1016 8016569952 8016566248 Bacteria 8158151
1017 8016582531 8016575299 Bacteria 8154085
1018 8016586811 8016583857 Bacteria 10421953
1019 8016603165 8016595262 Bacteria 8149947
1020 8016617964 8016613128 Bacteria 8794220
1021 8016623608 8016622563 Bacteria 7999408
1022 8016636087 8016630954 Bacteria 9217207
1023 8019531505 8019530166 Bacteria 8155624
1024 8019540027 8019538911 Bacteria 7872763
1025 8019550629 8019547302 Bacteria 7996444
1026 8019622556 8019619141 Bacteria 9218857
1027 8019630557 8019629233 Bacteria 8687553
1028 8019640056 8019638758 Bacteria 9062356
1029 8019652878 8019648815 Bacteria 10014479
1030 8019667383 8019659431 Bacteria 8577854
1031 8019677157 8019668869 Bacteria 8791617
1032 8019678828 8019678201 Bacteria 8863603
1033 8019696704 8019687851 Bacteria 8712826
1034 8056970915 8056967851 Bacteria 9038162
1035 Ga0373956_0192413
1036 JGI24735J21928_10046787
1037 JGI25153J46596_10009968
1038 JGI25160J50197_1011437
1039 JGI25160J50197_1014777
1040 JGI25404J52841_10037927
1041 Ga0055526_1036204
1042 Ga0055531_10002401
1043 Ga0065165_1002203
1044 Ga0070658_10080003
1045 Ga0070658_10083289
1046 Ga0070683_100034716
1047 Ga0070683_100385832
1048 Ga0070683_100388065
1049 Ga0070670_100007013
1050 Ga0068869_100529986
1051 Ga0068869_101696173
1052 Ga0070680_100007037
1053 Ga0070680_100039194
1054 Ga0070680_100063582
1055 Ga0070680_100107970
1056 Ga0070680_100159102
1057 Ga0070680_100287225
1058 Ga0070680_100494015
1059 Ga0070682_100215967
1060 Ga0070660_100052586
1061 Ga0070660_100119833
1062 Ga0070660_100467204
1063 Ga0070660_100754671
1064 Ga0070689_101463685
1065 Ga0070691_10044183
1066 Ga0070661_100079432
1067 Ga0070661_100250111
1068 Ga0070661_100587109
1069 Ga0070661_101827132
1070 Ga0070668_100755632
1071 Ga0070671_100956149
1072 Ga0070674_101139768
1073 Ga0070659_100014636
1074 Ga0070659_100397031
1075 Ga0070659_101082549
1076 Ga0070667_100209966
1077 Ga0070709_10000732
1078 Ga0070709_10015576
1079 Ga0070709_11179763
1080 Ga0070714_100001031
1081 Ga0070714_100007289
1082 Ga0070714_100017631
1083 Ga0070714_100056302
1084 Ga0070714_100267804
1085 Ga0070714_100348673
1086 Ga0070714_101161618
1087 Ga0070713_100000447
1088 Ga0070713_100014459
1089 Ga0070713_100033021
1090 Ga0070713_100108431
1091 Ga0070713_100194115
1092 Ga0070713_100394312
1093 Ga0070713_100964540
1094 Ga0070713_101067179
1095 Ga0070710_10000211
1096 Ga0070710_10002104
1097 Ga0070710_10012645
1098 Ga0070710_10212472
1099 Ga0070711_100001113
1100 Ga0070711_100005283
1101 Ga0070711_100070596
1102 Ga0070711_100735284
1103 Ga0070711_100845004
1104 Ga0070711_100958118
1105 Ga0070711_101209439
1106 Ga0070711_101976294
1107 Ga0070700_100605463
1108 Ga0070663_100312448
1109 Ga0070663_100479318
1110 Ga0070662_101624324
1111 Ga0070681_10016067
1112 Ga0070681_10028615
1113 Ga0070681_10029541
1114 Ga0070681_10215626
1115 Ga0070681_10332311
1116 Ga0070681_10668688
1117 Ga0070681_10974112
1118 Ga0068867_101125393
1119 Ga0070706_100257254
1120 Ga0070698_101773412
1121 Ga0070679_100022723
1122 Ga0070679_100053904
1123 Ga0070679_100169103
1124 Ga0070679_100339038
1125 Ga0070679_100412036
1126 Ga0070679_100665422
1127 Ga0070679_101853197
1128 Ga0070684_100003114
1129 Ga0070684_100006418
1130 Ga0070684_100094412
1131 Ga0070684_100203280
1132 Ga0070684_101088044
1133 Ga0068853_100191889
1134 Ga0068853_100333858
1135 Ga0068853_100436256
1136 Ga0068853_101010756
1137 Ga0070693_100396262
1138 Ga0070665_100204613
1139 Ga0068855_100001526
1140 Ga0068855_100049831
1141 Ga0068855_100077550
1142 Ga0068855_100763796
1143 Ga0068855_101132127
1144 Ga0068855_101168190
1145 Ga0068855_101700242
1146 Ga0068855_102069546
1147 Ga0068855_102312343
1148 Ga0070664_100061476
1149 Ga0070664_100123146
1150 Ga0070664_101459994
1151 Ga0068857_100066062
1152 Ga0068857_100089840
1153 Ga0068857_101790586
1154 Ga0068854_100976138
1155 Ga0068854_101140289
1156 Ga0068856_100026292
1157 Ga0068856_100078422
1158 Ga0068856_100104868
1159 Ga0068856_100915212
1160 Ga0068856_101645418
1161 Ga0068856_101660498
1162 Ga0068852_100016368
1163 Ga0068852_100105735
1164 Ga0068852_100155708
1165 Ga0068852_100327923
1166 Ga0068852_100597992
1167 Ga0068852_100710594
1168 Ga0068852_102446989
1169 Ga0068864_100175152
1170 Ga0068851_10298551
1171 Ga0068858_100131521
1172 Ga0081455_10663430
1173 Ga0081540_1029964
1174 Ga0070717_10004501
1175 Ga0070717_10021088
1176 Ga0070717_10029633
1177 Ga0070717_10065910
1178 Ga0070717_10346459
1179 Ga0075365_10015761
1180 Ga0075365_10745473
1181 Ga0075365_10892850
1182 Ga0075363_100510595
1183 Ga0075364_10156016
1184 Ga0075432_10388516
1185 Ga0070715_10003014
1186 Ga0070715_10104459
1187 Ga0070715_10153093
1188 Ga0070716_100001713
1189 Ga0070716_100023180
1190 Ga0070716_101589397
1191 Ga0070712_100014263
1192 Ga0070712_100035189
1193 Ga0070712_100435800
1194 Ga0075362_10060470
1195 Ga0075367_10193340
1196 Ga0075369_10023867
1197 Ga0075369_10024161
1198 Ga0075369_10126448
1199 Ga0075369_10245709
1200 Ga0075366_10046585
1201 Ga0075370_10004474
1202 Ga0075370_10075418
1203 Ga0075370_10336246
1204 Ga0068871_101288770
1205 Ga0075428_100043728
1206 Ga0075431_100060080
1207 Ga0075434_100083024
1208 Ga0099825_1025118
1209 Ga0099824_1007096
1210 Ga0099823_1014418
1211 Ga0099794_10136207
1212 Ga0099795_10461240
1213 Ga0105244_10462639
1214 Ga0105240_10018842
1215 Ga0105240_10027377
1216 Ga0105240_10060502
1217 Ga0105240_10131811
1218 Ga0111539_10008587
1219 Ga0105245_11036116
1220 Ga0105245_11866913
1221 Ga0105247_10121871
1222 Ga0105247_11306263
1223 Ga0114129_10049105
1224 Ga0105241_10012706
1225 Ga0105241_10908967
1226 Ga0105241_11189511
1227 Ga0105241_11621052
1228 Ga0105241_12698217
1229 Ga0105248_10889387
1230 Ga0105248_13424008
1231 Ga0105237_10003797
1232 Ga0105237_10239142
1233 Ga0105237_10242500
1234 Ga0105238_10084387
1235 Ga0105238_10106905
1236 Ga0105238_11107804
1237 Ga0105238_11331907
1238 Ga0105238_11353923
1239 Ga0099796_10003072
1240 Ga0105239_10031844
1241 Ga0105239_10101474
1242 Ga0105239_10127791
1243 Ga0105239_10310549
1244 Ga0105239_10503853
1245 Ga0105239_10780972
1246 Ga0105239_10791648
1247 Ga0105246_10149093
1248 Ga0157373_10114461
1249 Ga0157373_10740066
1250 Ga0157371_10205462
1251 Ga0157371_10712289
1252 Ga0157371_11025363
1253 Ga0157371_11085464
1254 Ga0157370_10025966
1255 Ga0157370_10066941
1256 Ga0157370_10514053
1257 Ga0157370_10670535
1258 Ga0157370_11052988
1259 Ga0157370_11364596
1260 Ga0157369_10008800
1261 Ga0157369_10028904
1262 Ga0157369_10158242
1263 Ga0157369_10466618
1264 Ga0157369_10631815
1265 Ga0157369_10947544
1266 Ga0157378_10307502
1267 Ga0157378_10314333
1268 Ga0157378_12963366
1269 Ga0163162_10162491
1270 Ga0163162_11387568
1271 Ga0157372_10586480
1272 Ga0157372_10707342
1273 Ga0157372_10762867
1274 Ga0157372_10880013
1275 Ga0157372_11147969
1276 Ga0157372_13124524
1277 Ga0157375_10676498
1278 Ga0157375_11302615
1279 Ga0163163_10416594
1280 Ga0157376_10278601
1281 Ga0206353_10012434
1282 Ga0206353_10881856
1283 Ga0214544_1000087
1284 Ga0214542_1000018
1285 Ga0214545_1000009
1286 Ga0214545_1044404
1287 Ga0213872_10083520
1288 Ga0213872_10129478
1289 Ga0213874_10055189
1290 Ga0213876_10508329
1291 Ga0224712_10524294
1292 Ga0207425_1014749
1293 Ga0209148_1000694
1294 Ga0209233_1023038
1295 Ga0209233_1037703
1296 Ga0209455_1050266
1297 Ga0209673_1067002
1298 Ga0209564_1006358
1299 Ga0209564_1009222
1300 Ga0209758_1000015
1301 Ga0209758_1000224
1302 Ga0209758_1000972
1303 Ga0209758_1005118
1304 Ga0209758_1095316
1305 Ga0209758_1124406
1306 Ga0209256_1004825
1307 Ga0209256_1026895
1308 Ga0207426_1000201
1309 Ga0207426_1000617
1310 Ga0207426_1007359
1311 Ga0207426_1040679
1312 Ga0209051_1081462
1313 Ga0209257_1000440
1314 Ga0207656_10211783
1315 Ga0207692_10000494
1316 Ga0207692_10025046
1317 Ga0207692_10576400
1318 Ga0207692_10624337
1319 Ga0207647_10250617
1320 Ga0207685_10111943
1321 Ga0207685_10169865
1322 Ga0207699_10000480
1323 Ga0207699_10032324
1324 Ga0207699_10052435
1325 Ga0207699_10894648
1326 Ga0207705_10015389
1327 Ga0207705_10033765
1328 Ga0207705_10046309
1329 Ga0207705_10068845
1330 Ga0207705_10427929
1331 Ga0207684_10217689
1332 Ga0207654_10007752
1333 Ga0207707_10075803
1334 Ga0207707_10169698
1335 Ga0207707_10204609
1336 Ga0207707_11014086
1337 Ga0207695_10000065
1338 Ga0207695_10181364
1339 Ga0207695_10402757
1340 Ga0207695_10868876
1341 Ga0207671_10001858
1342 Ga0207671_10065742
1343 Ga0207671_10081338
1344 Ga0207671_10691996
1345 Ga0207693_10010321
1346 Ga0207693_10014578
1347 Ga0207693_10027366
1348 Ga0207663_10000356
1349 Ga0207663_10003833
1350 Ga0207663_10226813
1351 Ga0207663_11324839
1352 Ga0207660_10041607
1353 Ga0207660_10043493
1354 Ga0207660_10063865
1355 Ga0207660_10066782
1356 Ga0207660_10117379
1357 Ga0207660_10145108
1358 Ga0207660_10181152
1359 Ga0207660_10759207
1360 Ga0207660_11447927
1361 Ga0207657_10022149
1362 Ga0207657_10026499
1363 Ga0207657_10416282
1364 Ga0207657_10818821
1365 Ga0207649_10287197
1366 Ga0207649_10655828
1367 Ga0207649_10763263
1368 Ga0207652_10024203
1369 Ga0207652_10084924
1370 Ga0207652_10097084
1371 Ga0207652_10124179
1372 Ga0207652_10175619
1373 Ga0207652_10180971
1374 Ga0207652_11789221
1375 Ga0207694_10086964
1376 Ga0207694_11099881
1377 Ga0207650_10004408
1378 Ga0207700_10005911
1379 Ga0207700_10009620
1380 Ga0207700_10096308
1381 Ga0207700_10101814
1382 Ga0207700_10158437
1383 Ga0207700_10384761
1384 Ga0207700_11149614
1385 Ga0207664_10020450
1386 Ga0207664_10055501
1387 Ga0207664_10061817
1388 Ga0207664_10078039
1389 Ga0207664_10310142
1390 Ga0207664_10328088
1391 Ga0207664_11937042
1392 Ga0207644_10672086
1393 Ga0207690_10147252
1394 Ga0207709_11145062
1395 Ga0207670_10864786
1396 Ga0207665_10000289
1397 Ga0207665_10001832
1398 Ga0207665_10184275
1399 Ga0207665_10197567
1400 Ga0207711_10614311
1401 Ga0207661_10000678
1402 Ga0207661_10029561
1403 Ga0207661_10487791
1404 Ga0207679_11368932
1405 Ga0207667_10047269
1406 Ga0207667_10083387
1407 Ga0207667_10101848
1408 Ga0207667_10134295
1409 Ga0207667_10176109
1410 Ga0207667_10711926
1411 Ga0207667_11203977
1412 Ga0207668_11783044
1413 Ga0207640_10742549
1414 Ga0207640_10968623
1415 Ga0207640_11117153
1416 Ga0207658_10943638
1417 Ga0207677_11003656
1418 Ga0207677_11938672
1419 Ga0207703_10341875
1420 Ga0207639_10086437
1421 Ga0207639_10618708
1422 Ga0207639_10621331
1423 Ga0207678_10375540
1424 Ga0207678_10391839
1425 Ga0207678_10525310
1426 Ga0207702_10063731
1427 Ga0207702_10103590
1428 Ga0207702_10186579
1429 Ga0207702_10214872
1430 Ga0207702_10845533
1431 Ga0207702_11107406
1432 Ga0207674_10064038
1433 Ga0207674_10068834
1434 Ga0207698_10069481
1435 Ga0207698_10071309
1436 Ga0207698_10190020
1437 Ga0207698_10617722
1438 Ga0207698_10699725
1439 Ga0207698_10753643
1440 Ga0209389_1000029
1441 Ga0209389_1000076
1442 Ga0209589_1000012
1443 Ga0209589_1000013
1444 Ga0209489_100013
1445 Ga0209489_100416
1446 Ga0209700_100014
1447 Ga0207428_10085071
1448 Ga0268266_10212046
1449 Ga0265338_10019779
1450 Ga0265338_10165592
1451 Ga0265338_10269323
1452 Ga0265773_1026883
1453 Ga0265330_10006264
1454 Ga0265325_10309681
1455 Ga0265339_10047735
1456 Ga0265313_10007846
1457 Ga0265313_10023026
1458 Ga0265313_10071548
1459 Ga0307508_10000005
1460 Ga0307508_10426850
1461 Ga0265314_10066904
1462 Ga0265342_10000082
1463 Ga0265342_10026636
1464 Ga0307510_10007616
1465 Ga0307510_10121436
1466 Ga0373934_0163106
1467 Ga0373944_0183305
1468 Ga0373923_0137515
1469 Ga0373945_0079344
1470 Ga0373953_0080293
1471 Ga0373954_0024158
1472 Ga0373954_0263423
1473 Ga0373956_0163722
1474 Ga0373957_0066071
1475 Ga0373943_0034867
1476 Ga0373955_0645384
1477 Ga0373961_0025585
1478 Ga0373924_0002858
1479 Ga0373931_0092941
1480 Ga0373935_0063084
1481 Ga0373927_0021218
1482 Ga0373927_0261747
1483 Ga0373933_0000114
1484 Ga0373933_0479957
1485 Ga0373947_1084289
1486 Ga0373937_0074647
1487 Ga0373937_1056233
1488 Ga0372808_044701
1489 Ga0373925_0008346
1490 Ga0373925_0012108
1491 Ga0373925_0621816
1492 Ga0395899_0159301
1493 Ga0395899_0271719
1494 Ga0395900_0052668
1495 Ga0395900_0053769
1496 Ga0395900_0084990
1497 Ga0395900_0093104
1498 Ga0395900_0227912
1499 Ga0395900_0298738
1500 Ga0395900_0351417
1501 Ga0395898_0014967
1502 Ga0395898_0034661
1503 Ga0395898_0072959
1504 Ga0395898_0138617
1505 Ga0395898_0186341
1506 Ga0395898_0214112
1507 Ga0395905_0005511
1508 Ga0395905_0084822
1509 Ga0395901_0026879
1510 Ga0395901_0065435
1511 Ga0395901_0097039
1512 Ga0395901_0112127
1513 Ga0395901_0734695
1514 Ga0395901_0899648
1515 Ga0436365_0021907
1516 Ga0436365_0808505
1517 Ga0436360_0291987
1518 Ga0436361_0183009
1519 Ga0436361_0759798
1520 Ga0436361_0959035
1521 Ga0436363_0385198
1522 Ga0436363_0439777
1523 Ga0436363_0468515
1524 Ga0436363_0514184
1525 Ga0436363_0973295
1526 Ga0436362_1074496
1527 Ga0436362_1127610
1528 Ga0451787_764725
1529 Ga0451789_1221988
1530 Ga0451793_1530076
1531 Ga0451795_0965185
1532 Ga0451798_1113104
1533 Ga0451802_1193815
1534 Ga0451807_0896219
1535 Ga0451845_0561026
1536 Ga0451849_1468299
1537 Ga0451843_0604583
1538 Ga0451853_0997325
1539 Ga0466969_0016425
1540 Ga0466969_0078487
1541 Ga0466972_0011618
1542 Ga0466972_0185541
1543 Ga0466965_0025559
1544 Ga0466965_0126248
1545 Ga0466965_0226223
1546 Ga0466965_0779658
1547 Ga0466966_0002297
1548 Ga0466966_0169498
1549 Ga0466961_0000129
1550 Ga0466961_0296449
1551 Ga0466961_0319671
1552 Ga0466963_0060863
1553 Ga0466963_0137605
1554 Ga0466963_0301623
1555 Ga0466963_1068382
1556 Ga0466964_0034112
1557 Ga0466964_0124045
1558 Ga0466964_0213492
1559 Ga0466971_0021086
1560 Ga0466971_0403232
1561 Ga0466971_0440412
1562 Ga0466968_0007308
1563 Ga0466968_0387074
1564 Ga0466957_0025520
1565 Ga0466957_0167399
1566 Ga0466957_0171826
1567 Ga0466959_0006120
1568 Ga0466959_0461413
1569 Ga0466959_0479266
1570 Ga0466958_0254707
1571 Ga0466958_0297884
1572 Ga0466967_0029176
1573 Ga0466967_0039786
1574 Ga0466967_0173235
1575 Ga0466967_0419565
1576 Ga0466967_0458464
1577 Ga0466967_1345815
1578 Ga0495592_0067706
1579 Ga0495592_0158570
1580 Ga0495592_0275854
1581 Ga0495603_0047738
1582 Ga0495603_0240840
1583 Ga0495629_0151152
1584 Ga0495629_0278124
1585 Ga0495629_0286765
1586 Ga0495629_0935539
1587 Ga0495638_0002281
1588 Ga0495641_0111456
1589 Ga0495641_0424705
1590 Ga0495651_0010124
1591 Ga0495651_0016379
1592 Ga0495651_0346429
1593 Ga0495653_0545695
1594 Ga0495582_0013743
1595 Ga0495582_0151970
1596 Ga0495639_0005620
1597 Ga0495664_0007028
1598 Ga0495664_0011419
1599 Ga0495664_0046017
1600 Ga0495585_0221297
1601 Ga0495585_0290860
1602 Ga0495594_0180966
1603 Ga0495607_0156037
1604 Ga0495583_0162088
1605 Ga0495606_0034748
1606 Ga0495606_0301828
1607 Ga0495608_0300452
1608 Ga0495608_0401077
1609 Ga0495610_0214405
1610 Ga0495618_0310891
1611 Ga0495618_0761436
1612 Ga0495620_0273678
1613 Ga0495620_0284334
1614 Ga0495628_0032331
1615 Ga0495628_0050469
1616 Ga0495630_0036284
1617 Ga0495630_0440496
1618 Ga0495630_0486338
1619 Ga0495631_0090578
1620 Ga0495648_0003897
1621 Ga0495648_0019285
1622 Ga0495648_0128425
1623 Ga0495642_0148664
1624 Ga0495652_0006665
1625 Ga0495652_0085443
1626 Ga0495652_0299714
1627 Ga0495652_0713591
1628 Ga0495665_0078537
1629 Ga0495640_0385092
1630 Ga0495587_0014466
1631 Ga0495609_0302073
1632 Ga0495645_0028158
1633 Ga0495645_0114699
1634 Ga0495622_0045393
1635 Ga0495667_0075193
1636 Ga0495634_0093381
1637 Ga0495634_0144144
1638 Ga0495611_0097717
1639 Ga0495611_0128623
1640 Ga0495625_0208839
1641 Ga0495625_0717004
1642 Ga0495635_0011833
1643 Ga0495635_0112373
1644 Ga0495635_1029548
1645 Ga0495661_0062394
1646 Ga0495588_0061742
1647 Ga0495588_0081630
1648 Ga0495657_0020349
1649 Ga0495657_0135124
1650 Ga0495599_0038942
1651 Ga0495623_0153763
1652 Ga0495623_0155439
1653 Ga0495646_0015043
1654 Ga0495646_0030035
1655 Ga0495646_0091348
1656 Ga0495658_0202899
1657 Ga0495658_0305322
1658 Ga0495613_0080774
1659 Ga0495613_0092768
1660 Ga0495613_0108256
1661 Ga0495613_0242910
1662 Ga0495624_0062744
1663 Ga0495624_0115823
1664 Ga0495649_0168666
1665 Ga0495600_0301089
1666 Ga0495600_0365940
1667 Ga0495581_0129575
1668 Ga0495581_0185090
1669 Ga0495581_0711693
1670 Ga0495604_0005727
1671 Ga0495604_0192229
1672 Ga0495604_0264638
1673 Ga0495604_0576296
1674 Ga0495674_0019801
1675 Ga0495674_0030816
1676 Ga0495672_0141937
1677 Ga0495676_0056563
1678 Ga0495676_0555057
1679 Ga0495676_0598582
1680 Ga0495676_0656161
1681 Ga0495680_0006823
1682 Ga0495683_0362905
1683 Ga0495675_0021068
1684 Ga0495673_0021341
1685 Ga0495673_0048751
1686 Ga0495684_0043412
1687 Ga0495684_0140995
1688 Ga0495684_0161443
1689 Ga0495684_0322099
1690 Ga0495686_0115826
1691 Ga0495686_0173712
1692 Ga0495686_0463911
1693 Ga0495593_0022751
1694 Ga0495593_0065310
1695 Ga0495593_0093478
1696 Ga0495593_0602176
1697 Ga0495602_0050884
1698 Ga0495602_0169061
1699 Ga0495602_0337391
1700 Ga0495602_0522795
1701 Ga0495602_0840429
1702 Ga0496100_0318774
1703 Ga0496100_1590744
1704 Ga0496101_0426449
1705 Ga0496102_0064026
1706 Ga0496102_0971760
1707 Ga0496103_0008405
1708 Ga0496104_0004036
1709 Ga0496104_0005388
1710 Ga0496104_0176181
1711 Ga0496104_0448165
1712 Ga0496105_0001275
1713 Ga0496105_0009543
1714 Ga0496105_0080543
1715 Ga0496105_0579331
1716 Ga0496105_0875758
1717 Ga0496106_0003991
1718 Ga0496106_0159379
1719 Ga0496106_0172559
1720 Ga0496106_0264382
1721 Ga0496106_0689411
1722 Ga0496107_0005978
1723 Ga0496107_0229951
1724 Ga0496107_1048327
1725 Ga0496108_0000581
1726 Ga0496108_0086416
1727 Ga0496108_0472175
1728 Ga0496109_0000507
1729 Ga0496109_0002379
1730 Ga0496110_0011482
1731 Ga0496110_0652287
1732 Ga0496110_1301985
1733 Ga0496110_1408097
1734 Ga0496111_0005375
1735 Ga0496111_0482704
1736 Ga0496112_0000019
1737 Ga0496112_0004823
1738 Ga0496112_0016561
1739 Ga0496112_0721333
1740 Ga0496113_0011391
1741 Ga0496113_0029645
1742 Ga0496113_0328596
1743 Ga0496114_0045648
1744 Ga0496114_0080506
1745 Ga0496114_0100516
1746 Ga0496114_0738166
1747 Ga0496114_1694137
1748 Ga0496115_0083685
1749 Ga0496115_0194139
1750 Ga0496115_0286035
1751 Ga0496118_0035728
1752 Ga0496118_0063743
1753 Ga0496118_0202218
1754 Ga0496119_0030804
1755 Ga0496119_0041332
1756 Ga0496120_0023580
1757 Ga0496120_0046427
1758 Ga0496121_0039009
1759 Ga0496121_0053636
1760 Ga0496121_0633204
1761 Ga0496122_0273367
1762 Ga0496123_0416420
1763 Ga0496125_0056378
1764 Ga0496126_0027182
1765 Ga0496126_0041848
1766 Ga0496126_0066674
1767 Ga0496126_0172089
1768 Ga0496126_0256817
1769 Ga0496126_0599007
1770 Ga0496126_0842327
1771 Ga0496126_0991842
1772 Ga0496126_1022583
1773 Ga0495682_0026256
1774 Ga0501031_0348533
1775 Ga0501031_0353993
1776 Ga0501032_0014636
1777 Ga0501033_0003525
1778 Ga0501033_0191861
1779 Ga0501034_0011514
1780 Ga0501034_0026323
1781 Ga0501034_0100582
1782 Ga0501036_0057240
1783 Ga0501036_0172827
1784 Ga0501036_0212426
1785 Ga0501037_0014971
1786 Ga0501037_0176446
1787 Ga0501038_0010109
1788 Ga0501038_0032236
1789 Ga0501038_0061390
1790 Ga0501038_0127784
1791 Ga0501039_0101097
1792 Ga0501039_0339674
1793 Ga0501040_0117720
1794 Ga0501042_0002545
1795 Ga0501043_0020509
1796 Ga0501043_0051339
1797 Ga0501043_0054115
1798 Ga0501046_0026634
1799 Ga0501046_0082467
1800 Ga0501047_0009908
1801 Ga0501047_0027170
1802 Ga0501047_0064552
1803 Ga0501047_0102168
1804 Ga0501048_0005496
1805 Ga0501048_0070461
1806 Ga0501067_0002825
1807 Ga0501067_0058453
1808 Ga0501068_0009793
1809 Ga0501068_0521638
1810 Ga0501069_0189424
1811 Ga0501069_0703007
1812 Ga0501070_0026055
1813 Ga0501070_0467715
1814 Ga0501071_0748756
1815 Ga0501072_0273977
1816 Ga0501073_0003590
1817 Ga0501073_0014548
1818 Ga0501073_0103295
1819 Ga0501074_0023865
1820 Ga0501077_0234769
1821 Ga0501080_0086024
1822 Ga0501080_0109870
1823 Ga0501083_0010499
1824 Ga0501083_0103698
1825 Ga0501035_0035212
1826 Ga0501035_0039873
1827 Ga0501035_0486858
1828 Ga0501044_0026586
1829 Ga0501044_0119620
1830 Ga0501044_0308943
1831 Ga0501044_0344200
1832 Ga0501045_0003604
1833 Ga0501045_0883285
1834 nmdc:mga03683_32770_c1
1835 nmdc:mga03n38_378600_c1
1836 nmdc:mga03n38_421976_c1
1837 nmdc:mga00v17_44083_c1
1838 nmdc:mga0yw44_319739_c1
1839 nmdc:mga0yw44_488160_c1
1840 nmdc:mga0k408_224991_c1
1841 nmdc:mga07m45_117152_c1
1842 nmdc:mga07m45_189786_c1
1843 nmdc:mga07m45_907212_c1
1844 nmdc:mga05p37_275569_c1
1845 nmdc:mga06r32_34461_c1
1846 nmdc:mga08y16_16577_c1
1847 nmdc:mga0rr50_545692_c1
1848 nmdc:mga0sz30_213409_c1
1849 nmdc:mga0sz30_6906_c2
1850 nmdc:mga0sz30_96892_c1
1851 Ga0495601_0022702
1852 Ga0495601_0028119
1853 Ga0495601_0257180
1854 Ga0495601_0334044
1855 Ga0495601_0463950
1856 Ga0495601_0760047
1857 Ga0495612_0027589
1858 Ga0495612_0055280
1859 Ga0495612_0078851
1860 Ga0500635_0109173
1861 Ga0495595_0002381
1862 Ga0495595_0092418
1863 Ga0495595_0420733
1864 Ga0495619_0028465
1865 Ga0495619_0045807
1866 Ga0495619_0322085
1867 Ga0495619_0514515
1868 Ga0495619_0772270
1869 Ga0495619_1116140
1870 Ga0500578_0676117
1871 Ga0500643_000062
1872 Ga0500644_0154461
1873 Ga0500646_0261983
1874 Ga0500647_0084525
1875 Ga0500647_0315562
1876 Ga0500583_0147721
1877 Ga0500651_0073134
1878 Ga0500651_0673923
1879 Ga0500566_0009283
1880 Ga0500566_0062595
1881 Ga0500566_0190275
1882 Ga0500640_205624
1883 Ga0500650_0182646
1884 Ga0500553_268591
1885 Ga0500555_064463
1886 Ga0500556_0062248
1887 Ga0500556_0349535
1888 Ga0500557_000043
1889 Ga0500569_006585
1890 Ga0500569_035234
1891 Ga0500595_003786
1892 Ga0500607_048744
1893 Ga0500608_013748
1894 Ga0500608_038663
1895 Ga0500642_0000193
1896 Ga0500642_0021444
1897 Ga0500652_123749
1898 Ga0500655_008973
1899 Ga0500658_0030957
1900 Ga0500559_0031651
1901 Ga0500559_0336124
1902 Ga0500568_0012024
1903 Ga0500577_0020288
1904 Ga0500585_073008
1905 Ga0500588_0356508
1906 Ga0500590_182459
1907 Ga0500604_0049520
1908 Ga0500616_0122149
1909 Ga0500619_007273
1910 Ga0500620_015171
1911 Ga0500622_0063052
1912 Ga0500624_008204
1913 Ga0500627_0084741
1914 Ga0500634_0090295
1915 Ga0500638_059449
1916 Ga0500639_232946
1917 Ga0500639_274070
1918 Ga0500636_0000075
1919 Ga0500636_0167194
1920 Ga0500625_000791
1921 Ga0500645_036548
1922 Ga0500599_001855
1923 Ga0501084_0326673
1924 Ga0501084_0732055
1925 Ga0587073_0080212
1926 Ga0501082_0014060
1927 Ga0466962_0052885
1928 Ga0466962_0272532
1929 2507504842
1930 2508546197
1931 2508695129
1932 2511395455
1933 2513625424
1934 2513639553
1935 2513703351
1936 2513715708
1937 2513873914
1938 2514012887
1939 2515625865
1940 2524435743
1941 2545677467
1942 2617351700
1943 2617377248
1944 2745079039
1945 2793066047
1946 2805915997
1947 2824602574
1948 2824612646
1949 2824621108
1950 2824630115
1951 2824640730
1952 2824649823
1953 2824654461
1954 2824674855
1955 2824683558
1956 2824691923
1957 2824697652
1958 2824709661
1959 2824719828
1960 2824727932
1961 2824736249
1962 2824750285
1963 2824757115
1964 2824768451
1965 2824774944
1966 2838131017
1967 2841944458
1968 2841951599
1969 2841969235
1970 2841982900
1971 2841991018
1972 2842043884
1973 2842052126
1974 2844321822
1975 2847931470
1976 2847941752
1977 2857511567
1978 2874596836
1979 2874624420
1980 2874636707
1981 2874648641
1982 2876766414
1983 2876777300
1984 2876825382
1985 2879077631
1986 2879087493
1987 2879107224
1988 2879127661
1989 2879146066
1990 2881371003
1991 2881665695
1992 2885371400
1993 2888420773
1994 2903727628
1995 2904672241
1996 2904716182
1997 2906602882
1998 2906633525
1999 2906647590
2000 2908775764
2001 2922400798
2002 2932794687
2003 2932805502
2004 2932812580
2005 2932822942
2006 2935614959
2007 2935652986
2008 2935661569
2009 2935689588
2010 2935717107
2011 2935730059
2012 2935738522
2013 2935749230
2014 2935756941
2015 2935764445
2016 2935772772
2017 2935778091
2018 2935787319
2019 2935795893
2020 2935826002
2021 2935851621
2022 2935888901
2023 2935910357
2024 2935918357
2025 2935927732
2026 2935936396
2027 2935944051
2028 2935952488
2029 2935969328
2030 2935977907
2031 2935984789
2032 2936015702
2033 2936024336
2034 2936031777
2035 2936051599
2036 2936055960
2037 2940562855
2038 2941532353
2039 3005486418
2040 3005509546
2041 3005589021
2042 3005602170
2043 641640484
2044 8006929778
2045 8016526598
2046 8016531683
2047 8016544881
2048 8016557195
2049 8016565547
2050 8016569952
2051 8016582531
2052 8016586811
2053 8016603165
2054 8016617964
2055 8016623608
2056 8016636087
2057 8019531505
2058 8019540027
2059 8019550629
2060 8019622556
2061 8019630557
2062 8019640056
2063 8019652878
2064 8019667383
2065 8019677157
2066 8019678828
2067 8019696704
2068 8056970915

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

7

103

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8248 3 103
1v8h-assembly1.cif.gz_B crystal structure of tt0351 protein from thermus thermophilus hb8 0.8223 4 102
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8063 3 103
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.7961 3 103
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.7951 3 103
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8248 3 103 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8223 4 102 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7951 3 103 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7867 4 102 2.60.40.10
1mbyA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7689 41 102 2.40.50.930
ID Description Score Start End GO Terms
AF-A0A7W2A9W3-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9667 5 103
AF-A0A1Y5EQC0-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9634 6 103
AF-A0A430KLC7-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9619 5 103
AF-A0A2G2QK80-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9604 6 103
AF-I3UAU9-F1-model_v4 Sulfur oxidation protein SoxZ 0.9561 6 103

Map