F488678
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 539 | 2068 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300035119|Ga0373956_0192413|Ga0373956_0192413_176_493 |
| Length | 105 |
| Sequence | MIMASTIRVRAIAGAETTEVQVLIQHPMDSGFVKDAQGALIPPHHIETVEFEAGGKTVFTALWGPAVSKDPFVKFSFKGAKKGDDLKITWVDNKGATDTTTAKIQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 70 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 71 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 99 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 100 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 101 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 209 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 210 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 363 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 365 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 368 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 369 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 371 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 373 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 374 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 375 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 388 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 390 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 394 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 396 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 401 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 402 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 403 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 404 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 405 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 406 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 407 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 408 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 409 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 410 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 411 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 412 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 413 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 414 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 415 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 416 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 417 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 418 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 419 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 420 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 421 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 422 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 423 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 424 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 425 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 426 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 427 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 428 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 429 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 430 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 431 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 432 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 433 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 434 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 435 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 436 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 437 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 438 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 439 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 440 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 441 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 442 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 443 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 444 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 445 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 446 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 447 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 448 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 449 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 450 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 451 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 452 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 453 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 454 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 455 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 456 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 457 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 458 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 459 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 460 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 461 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 462 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 463 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 464 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 465 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 466 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 467 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 468 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 469 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 470 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 471 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 472 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 473 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 474 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 475 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 476 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 477 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 478 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 479 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 480 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 481 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 482 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 483 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 484 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 485 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 486 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 487 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 488 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 489 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 490 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 491 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 492 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 493 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 494 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 495 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 496 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 497 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 498 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 499 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 500 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 501 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 502 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 503 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 504 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 505 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 506 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 507 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 508 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 509 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 510 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 511 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 512 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 513 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 514 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 515 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 516 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 517 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 518 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 519 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 520 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 521 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 522 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 523 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 524 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 525 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 526 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 527 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 528 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 529 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 530 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 531 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 532 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 533 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 534 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 535 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 536 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 537 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 538 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 539 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.88 |
| Metatranscriptomes | 0.58 |
| Isolates | 13.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.64 |
| Nodule | 10.74 |
| Rhizoplane | 5.42 |
| Rhizosphere | 65.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373956_0192413 | 3300035119 | Bacteria | 966 |
| 2 | JGI24735J21928_10046787 | 3300002067 | Bacteria | 1255 |
| 3 | JGI25153J46596_10009968 | 3300003215 | Bacteria | 4343 |
| 4 | JGI25160J50197_1011437 | 3300003354 | Bacteria | 3149 |
| 5 | JGI25160J50197_1014777 | 3300003354 | Bacteria | 2595 |
| 6 | JGI25404J52841_10037927 | 3300003659 | Bacteria | 1023 |
| 7 | Ga0055526_1036204 | 3300003771 | Bacteria | 1314 |
| 8 | Ga0055531_10002401 | 3300003794 | Bacteria | 12583 |
| 9 | Ga0065165_1002203 | 3300005262 | Bacteria | 17455 |
| 10 | Ga0070658_10080003 | 3300005327 | Bacteria | 2684 |
| 11 | Ga0070658_10083289 | 3300005327 | Bacteria | 2629 |
| 12 | Ga0070683_100034716 | 3300005329 | Bacteria | 4609 |
| 13 | Ga0070683_100385832 | 3300005329 | Bacteria | 1335 |
| 14 | Ga0070683_100388065 | 3300005329 | Bacteria | 1331 |
| 15 | Ga0070670_100007013 | 3300005331 | Bacteria | 9546 |
| 16 | Ga0068869_100529986 | 3300005334 | Bacteria | 987 |
| 17 | Ga0068869_101696173 | 3300005334 | Bacteria | 564 |
| 18 | Ga0070680_100007037 | 3300005336 | Bacteria | 8575 |
| 19 | Ga0070680_100039194 | 3300005336 | Bacteria | 3834 |
| 20 | Ga0070680_100063582 | 3300005336 | Bacteria | 3023 |
| 21 | Ga0070680_100107970 | 3300005336 | Bacteria | 2315 |
| 22 | Ga0070680_100159102 | 3300005336 | Bacteria | 1898 |
| 23 | Ga0070680_100287225 | 3300005336 | Bacteria | 1394 |
| 24 | Ga0070680_100494015 | 3300005336 | Bacteria | 1047 |
| 25 | Ga0070682_100215967 | 3300005337 | Bacteria | 1362 |
| 26 | Ga0070660_100052586 | 3300005339 | Bacteria | 3140 |
| 27 | Ga0070660_100119833 | 3300005339 | Bacteria | 2099 |
| 28 | Ga0070660_100467204 | 3300005339 | Bacteria | 1048 |
| 29 | Ga0070660_100754671 | 3300005339 | Bacteria | 817 |
| 30 | Ga0070689_101463685 | 3300005340 | Bacteria | 618 |
| 31 | Ga0070691_10044183 | 3300005341 | Bacteria | 2112 |
| 32 | Ga0070661_100079432 | 3300005344 | Bacteria | 2421 |
| 33 | Ga0070661_100250111 | 3300005344 | Bacteria | 1368 |
| 34 | Ga0070661_100587109 | 3300005344 | Bacteria | 900 |
| 35 | Ga0070661_101827132 | 3300005344 | Bacteria | 516 |
| 36 | Ga0070668_100755632 | 3300005347 | Bacteria | 861 |
| 37 | Ga0070671_100956149 | 3300005355 | Bacteria | 749 |
| 38 | Ga0070674_101139768 | 3300005356 | Bacteria | 690 |
| 39 | Ga0070659_100014636 | 3300005366 | Bacteria | 5866 |
| 40 | Ga0070659_100397031 | 3300005366 | Bacteria | 1164 |
| 41 | Ga0070659_101082549 | 3300005366 | Bacteria | 706 |
| 42 | Ga0070667_100209966 | 3300005367 | Bacteria | 1730 |
| 43 | Ga0070709_10000732 | 3300005434 | Bacteria | 18548 |
| 44 | Ga0070709_10015576 | 3300005434 | Bacteria | 4329 |
| 45 | Ga0070709_11179763 | 3300005434 | Bacteria | 615 |
| 46 | Ga0070714_100001031 | 3300005435 | Bacteria | 19841 |
| 47 | Ga0070714_100007289 | 3300005435 | Bacteria | 8598 |
| 48 | Ga0070714_100017631 | 3300005435 | Bacteria | 5787 |
| 49 | Ga0070714_100056302 | 3300005435 | Bacteria | 3363 |
| 50 | Ga0070714_100267804 | 3300005435 | Bacteria | 1583 |
| 51 | Ga0070714_100348673 | 3300005435 | Bacteria | 1390 |
| 52 | Ga0070714_101161618 | 3300005435 | Bacteria | 753 |
| 53 | Ga0070713_100000447 | 3300005436 | Bacteria | 26301 |
| 54 | Ga0070713_100014459 | 3300005436 | Bacteria | 5864 |
| 55 | Ga0070713_100033021 | 3300005436 | Bacteria | 4142 |
| 56 | Ga0070713_100108431 | 3300005436 | Bacteria | 2418 |
| 57 | Ga0070713_100194115 | 3300005436 | Bacteria | 1831 |
| 58 | Ga0070713_100394312 | 3300005436 | Bacteria | 1292 |
| 59 | Ga0070713_100964540 | 3300005436 | Bacteria | 822 |
| 60 | Ga0070713_101067179 | 3300005436 | Bacteria | 780 |
| 61 | Ga0070710_10000211 | 3300005437 | Bacteria | 27400 |
| 62 | Ga0070710_10002104 | 3300005437 | Bacteria | 9438 |
| 63 | Ga0070710_10012645 | 3300005437 | Bacteria | 4198 |
| 64 | Ga0070710_10212472 | 3300005437 | Bacteria | 1227 |
| 65 | Ga0070711_100001113 | 3300005439 | Bacteria | 14371 |
| 66 | Ga0070711_100005283 | 3300005439 | Bacteria | 7708 |
| 67 | Ga0070711_100070596 | 3300005439 | Bacteria | 2460 |
| 68 | Ga0070711_100735284 | 3300005439 | Bacteria | 833 |
| 69 | Ga0070711_100845004 | 3300005439 | Bacteria | 779 |
| 70 | Ga0070711_100958118 | 3300005439 | Bacteria | 733 |
| 71 | Ga0070711_101209439 | 3300005439 | Bacteria | 654 |
| 72 | Ga0070711_101976294 | 3300005439 | Bacteria | 513 |
| 73 | Ga0070700_100605463 | 3300005441 | Bacteria | 859 |
| 74 | Ga0070663_100312448 | 3300005455 | Bacteria | 1261 |
| 75 | Ga0070663_100479318 | 3300005455 | Bacteria | 1030 |
| 76 | Ga0070662_101624324 | 3300005457 | Bacteria | 558 |
| 77 | Ga0070681_10016067 | 3300005458 | Bacteria | 7460 |
| 78 | Ga0070681_10028615 | 3300005458 | Bacteria | 5603 |
| 79 | Ga0070681_10029541 | 3300005458 | Bacteria | 5505 |
| 80 | Ga0070681_10215626 | 3300005458 | Bacteria | 1836 |
| 81 | Ga0070681_10332311 | 3300005458 | Bacteria | 1429 |
| 82 | Ga0070681_10668688 | 3300005458 | Bacteria | 954 |
| 83 | Ga0070681_10974112 | 3300005458 | Bacteria | 768 |
| 84 | Ga0068867_101125393 | 3300005459 | Bacteria | 718 |
| 85 | Ga0070706_100257254 | 3300005467 | Bacteria | 1630 |
| 86 | Ga0070698_101773412 | 3300005471 | Bacteria | 570 |
| 87 | Ga0070679_100022723 | 3300005530 | Bacteria | 6132 |
| 88 | Ga0070679_100053904 | 3300005530 | Bacteria | 4003 |
| 89 | Ga0070679_100169103 | 3300005530 | Bacteria | 2159 |
| 90 | Ga0070679_100339038 | 3300005530 | Bacteria | 1451 |
| 91 | Ga0070679_100412036 | 3300005530 | Bacteria | 1297 |
| 92 | Ga0070679_100665422 | 3300005530 | Bacteria | 984 |
| 93 | Ga0070679_101853197 | 3300005530 | Bacteria | 552 |
| 94 | Ga0070684_100003114 | 3300005535 | Bacteria | 12386 |
| 95 | Ga0070684_100006418 | 3300005535 | Bacteria | 9101 |
| 96 | Ga0070684_100094412 | 3300005535 | Bacteria | 2664 |
| 97 | Ga0070684_100203280 | 3300005535 | Bacteria | 1804 |
| 98 | Ga0070684_101088044 | 3300005535 | Bacteria | 751 |
| 99 | Ga0068853_100191889 | 3300005539 | Bacteria | 1856 |
| 100 | Ga0068853_100333858 | 3300005539 | Bacteria | 1407 |
| 101 | Ga0068853_100436256 | 3300005539 | Bacteria | 1230 |
| 102 | Ga0068853_101010756 | 3300005539 | Bacteria | 800 |
| 103 | Ga0070693_100396262 | 3300005547 | Bacteria | 956 |
| 104 | Ga0070665_100204613 | 3300005548 | Bacteria | 1974 |
| 105 | Ga0068855_100001526 | 3300005563 | Bacteria | 29026 |
| 106 | Ga0068855_100049831 | 3300005563 | Bacteria | 4937 |
| 107 | Ga0068855_100077550 | 3300005563 | Bacteria | 3855 |
| 108 | Ga0068855_100763796 | 3300005563 | Bacteria | 1030 |
| 109 | Ga0068855_101132127 | 3300005563 | Bacteria | 817 |
| 110 | Ga0068855_101168190 | 3300005563 | Bacteria | 802 |
| 111 | Ga0068855_101700242 | 3300005563 | Bacteria | 643 |
| 112 | Ga0068855_102069546 | 3300005563 | Bacteria | 574 |
| 113 | Ga0068855_102312343 | 3300005563 | Bacteria | 538 |
| 114 | Ga0070664_100061476 | 3300005564 | Bacteria | 3201 |
| 115 | Ga0070664_100123146 | 3300005564 | Bacteria | 2272 |
| 116 | Ga0070664_101459994 | 3300005564 | Bacteria | 647 |
| 117 | Ga0068857_100066062 | 3300005577 | Bacteria | 3218 |
| 118 | Ga0068857_100089840 | 3300005577 | Bacteria | 2749 |
| 119 | Ga0068857_101790586 | 3300005577 | Bacteria | 601 |
| 120 | Ga0068854_100976138 | 3300005578 | Bacteria | 749 |
| 121 | Ga0068854_101140289 | 3300005578 | Bacteria | 696 |
| 122 | Ga0068856_100026292 | 3300005614 | Bacteria | 5675 |
| 123 | Ga0068856_100078422 | 3300005614 | Bacteria | 3274 |
| 124 | Ga0068856_100104868 | 3300005614 | Bacteria | 2821 |
| 125 | Ga0068856_100915212 | 3300005614 | Bacteria | 896 |
| 126 | Ga0068856_101645418 | 3300005614 | Bacteria | 655 |
| 127 | Ga0068856_101660498 | 3300005614 | Bacteria | 652 |
| 128 | Ga0068852_100016368 | 3300005616 | Bacteria | 5779 |
| 129 | Ga0068852_100105735 | 3300005616 | Bacteria | 2550 |
| 130 | Ga0068852_100155708 | 3300005616 | Bacteria | 2129 |
| 131 | Ga0068852_100327923 | 3300005616 | Bacteria | 1489 |
| 132 | Ga0068852_100597992 | 3300005616 | Bacteria | 1107 |
| 133 | Ga0068852_100710594 | 3300005616 | Bacteria | 1015 |
| 134 | Ga0068852_102446989 | 3300005616 | Bacteria | 542 |
| 135 | Ga0068864_100175152 | 3300005618 | Bacteria | 1958 |
| 136 | Ga0068851_10298551 | 3300005834 | Bacteria | 926 |
| 137 | Ga0068858_100131521 | 3300005842 | Bacteria | 2347 |
| 138 | Ga0081455_10663430 | 3300005937 | Bacteria | 670 |
| 139 | Ga0081540_1029964 | 3300005983 | Bacteria | 3021 |
| 140 | Ga0070717_10004501 | 3300006028 | Bacteria | 10072 |
| 141 | Ga0070717_10021088 | 3300006028 | Bacteria | 5133 |
| 142 | Ga0070717_10029633 | 3300006028 | Bacteria | 4392 |
| 143 | Ga0070717_10065910 | 3300006028 | Bacteria | 3011 |
| 144 | Ga0070717_10346459 | 3300006028 | Bacteria | 1327 |
| 145 | Ga0075365_10015761 | 3300006038 | Bacteria | 4578 |
| 146 | Ga0075365_10745473 | 3300006038 | Bacteria | 692 |
| 147 | Ga0075365_10892850 | 3300006038 | Bacteria | 627 |
| 148 | Ga0075363_100510595 | 3300006048 | Bacteria | 714 |
| 149 | Ga0075364_10156016 | 3300006051 | Bacteria | 1539 |
| 150 | Ga0075432_10388516 | 3300006058 | Bacteria | 600 |
| 151 | Ga0070715_10003014 | 3300006163 | Bacteria | 5271 |
| 152 | Ga0070715_10104459 | 3300006163 | Bacteria | 1327 |
| 153 | Ga0070715_10153093 | 3300006163 | Bacteria | 1132 |
| 154 | Ga0070716_100001713 | 3300006173 | Bacteria | 9880 |
| 155 | Ga0070716_100023180 | 3300006173 | Bacteria | 3288 |
| 156 | Ga0070716_101589397 | 3300006173 | Bacteria | 537 |
| 157 | Ga0070712_100014263 | 3300006175 | Bacteria | 5102 |
| 158 | Ga0070712_100035189 | 3300006175 | Bacteria | 3399 |
| 159 | Ga0070712_100435800 | 3300006175 | Bacteria | 1089 |
| 160 | Ga0075362_10060470 | 3300006177 | Bacteria | 1713 |
| 161 | Ga0075367_10193340 | 3300006178 | Bacteria | 1270 |
| 162 | Ga0075369_10023867 | 3300006186 | Bacteria | 2531 |
| 163 | Ga0075369_10024161 | 3300006186 | Bacteria | 2516 |
| 164 | Ga0075369_10126448 | 3300006186 | Bacteria | 1159 |
| 165 | Ga0075369_10245709 | 3300006186 | Bacteria | 831 |
| 166 | Ga0075366_10046585 | 3300006195 | Bacteria | 2569 |
| 167 | Ga0075370_10004474 | 3300006353 | Bacteria | 6793 |
| 168 | Ga0075370_10075418 | 3300006353 | Bacteria | 1933 |
| 169 | Ga0075370_10336246 | 3300006353 | Bacteria | 901 |
| 170 | Ga0068871_101288770 | 3300006358 | Bacteria | 687 |
| 171 | Ga0075428_100043728 | 3300006844 | Bacteria | 4925 |
| 172 | Ga0075431_100060080 | 3300006847 | Bacteria | 3923 |
| 173 | Ga0075434_100083024 | 3300006871 | Bacteria | 3201 |
| 174 | Ga0099825_1025118 | 3300006941 | Bacteria | 3368 |
| 175 | Ga0099824_1007096 | 3300006942 | Bacteria | 15025 |
| 176 | Ga0099823_1014418 | 3300006944 | Bacteria | 7897 |
| 177 | Ga0099794_10136207 | 3300007265 | Bacteria | 1242 |
| 178 | Ga0099795_10461240 | 3300007788 | Bacteria | 586 |
| 179 | Ga0105244_10462639 | 3300009036 | Bacteria | 583 |
| 180 | Ga0105240_10018842 | 3300009093 | Bacteria | 9243 |
| 181 | Ga0105240_10027377 | 3300009093 | Bacteria | 7463 |
| 182 | Ga0105240_10060502 | 3300009093 | Bacteria | 4722 |
| 183 | Ga0105240_10131811 | 3300009093 | Bacteria | 2997 |
| 184 | Ga0111539_10008587 | 3300009094 | Bacteria | 12973 |
| 185 | Ga0105245_11036116 | 3300009098 | Bacteria | 866 |
| 186 | Ga0105245_11866913 | 3300009098 | Bacteria | 654 |
| 187 | Ga0105247_10121871 | 3300009101 | Bacteria | 1690 |
| 188 | Ga0105247_11306263 | 3300009101 | Bacteria | 583 |
| 189 | Ga0114129_10049105 | 3300009147 | Bacteria | 5931 |
| 190 | Ga0105241_10012706 | 3300009174 | Bacteria | 6179 |
| 191 | Ga0105241_10908967 | 3300009174 | Bacteria | 818 |
| 192 | Ga0105241_11189511 | 3300009174 | Bacteria | 722 |
| 193 | Ga0105241_11621052 | 3300009174 | Bacteria | 626 |
| 194 | Ga0105241_12698217 | 3300009174 | Bacteria | 500 |
| 195 | Ga0105248_10889387 | 3300009177 | Bacteria | 1005 |
| 196 | Ga0105248_13424008 | 3300009177 | Bacteria | 504 |
| 197 | Ga0105237_10003797 | 3300009545 | Bacteria | 17750 |
| 198 | Ga0105237_10239142 | 3300009545 | Bacteria | 1817 |
| 199 | Ga0105237_10242500 | 3300009545 | Bacteria | 1803 |
| 200 | Ga0105238_10084387 | 3300009551 | Bacteria | 3166 |
| 201 | Ga0105238_10106905 | 3300009551 | Bacteria | 2779 |
| 202 | Ga0105238_11107804 | 3300009551 | Bacteria | 815 |
| 203 | Ga0105238_11331907 | 3300009551 | Bacteria | 744 |
| 204 | Ga0105238_11353923 | 3300009551 | Bacteria | 738 |
| 205 | Ga0099796_10003072 | 3300010159 | Bacteria | 3801 |
| 206 | Ga0105239_10031844 | 3300010375 | Bacteria | 5795 |
| 207 | Ga0105239_10101474 | 3300010375 | Bacteria | 3183 |
| 208 | Ga0105239_10127791 | 3300010375 | Bacteria | 2826 |
| 209 | Ga0105239_10310549 | 3300010375 | Bacteria | 1777 |
| 210 | Ga0105239_10503853 | 3300010375 | Bacteria | 1376 |
| 211 | Ga0105239_10780972 | 3300010375 | Bacteria | 1094 |
| 212 | Ga0105239_10791648 | 3300010375 | Bacteria | 1086 |
| 213 | Ga0105246_10149093 | 3300011119 | Bacteria | 1768 |
| 214 | Ga0157373_10114461 | 3300013100 | Bacteria | 1896 |
| 215 | Ga0157373_10740066 | 3300013100 | Bacteria | 722 |
| 216 | Ga0157371_10205462 | 3300013102 | Bacteria | 1413 |
| 217 | Ga0157371_10712289 | 3300013102 | Bacteria | 752 |
| 218 | Ga0157371_11025363 | 3300013102 | Bacteria | 630 |
| 219 | Ga0157371_11085464 | 3300013102 | Bacteria | 613 |
| 220 | Ga0157370_10025966 | 3300013104 | Bacteria | 5790 |
| 221 | Ga0157370_10066941 | 3300013104 | Bacteria | 3396 |
| 222 | Ga0157370_10514053 | 3300013104 | Bacteria | 1099 |
| 223 | Ga0157370_10670535 | 3300013104 | Bacteria | 947 |
| 224 | Ga0157370_11052988 | 3300013104 | Bacteria | 736 |
| 225 | Ga0157370_11364596 | 3300013104 | Bacteria | 638 |
| 226 | Ga0157369_10008800 | 3300013105 | Bacteria | 11568 |
| 227 | Ga0157369_10028904 | 3300013105 | Bacteria | 6132 |
| 228 | Ga0157369_10158242 | 3300013105 | Bacteria | 2392 |
| 229 | Ga0157369_10466618 | 3300013105 | Bacteria | 1307 |
| 230 | Ga0157369_10631815 | 3300013105 | Bacteria | 1105 |
| 231 | Ga0157369_10947544 | 3300013105 | Bacteria | 882 |
| 232 | Ga0157378_10307502 | 3300013297 | Bacteria | 1536 |
| 233 | Ga0157378_10314333 | 3300013297 | Bacteria | 1520 |
| 234 | Ga0157378_12963366 | 3300013297 | Bacteria | 527 |
| 235 | Ga0163162_10162491 | 3300013306 | Bacteria | 2355 |
| 236 | Ga0163162_11387568 | 3300013306 | Bacteria | 799 |
| 237 | Ga0157372_10586480 | 3300013307 | Bacteria | 1299 |
| 238 | Ga0157372_10707342 | 3300013307 | Bacteria | 1172 |
| 239 | Ga0157372_10762867 | 3300013307 | Bacteria | 1125 |
| 240 | Ga0157372_10880013 | 3300013307 | Bacteria | 1039 |
| 241 | Ga0157372_11147969 | 3300013307 | Bacteria | 898 |
| 242 | Ga0157372_13124524 | 3300013307 | Bacteria | 528 |
| 243 | Ga0157375_10676498 | 3300013308 | Bacteria | 1187 |
| 244 | Ga0157375_11302615 | 3300013308 | Bacteria | 854 |
| 245 | Ga0163163_10416594 | 3300014325 | Bacteria | 1402 |
| 246 | Ga0157376_10278601 | 3300014969 | Bacteria | 1574 |
| 247 | Ga0206353_10012434 | 3300020082 | Bacteria | 1455 |
| 248 | Ga0206353_10881856 | 3300020082 | Bacteria | 880 |
| 249 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 250 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 251 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 252 | Ga0214545_1044404 | 3300021324 | Bacteria | 1053 |
| 253 | Ga0213872_10083520 | 3300021361 | Bacteria | 1433 |
| 254 | Ga0213872_10129478 | 3300021361 | Bacteria | 1112 |
| 255 | Ga0213874_10055189 | 3300021377 | Bacteria | 1230 |
| 256 | Ga0213876_10508329 | 3300021384 | Bacteria | 641 |
| 257 | Ga0224712_10524294 | 3300022467 | Bacteria | 574 |
| 258 | Ga0207425_1014749 | 3300025245 | Bacteria | 1769 |
| 259 | Ga0209148_1000694 | 3300025254 | Bacteria | 27288 |
| 260 | Ga0209233_1023038 | 3300025261 | Bacteria | 1584 |
| 261 | Ga0209233_1037703 | 3300025261 | Bacteria | 1072 |
| 262 | Ga0209455_1050266 | 3300025272 | Bacteria | 587 |
| 263 | Ga0209673_1067002 | 3300025273 | Bacteria | 870 |
| 264 | Ga0209564_1006358 | 3300025295 | Bacteria | 6407 |
| 265 | Ga0209564_1009222 | 3300025295 | Bacteria | 4732 |
| 266 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 267 | Ga0209758_1000224 | 3300025297 | Bacteria | 121530 |
| 268 | Ga0209758_1000972 | 3300025297 | Bacteria | 38579 |
| 269 | Ga0209758_1005118 | 3300025297 | Bacteria | 10363 |
| 270 | Ga0209758_1095316 | 3300025297 | Bacteria | 860 |
| 271 | Ga0209758_1124406 | 3300025297 | Bacteria | 691 |
| 272 | Ga0209256_1004825 | 3300025299 | Bacteria | 8177 |
| 273 | Ga0209256_1026895 | 3300025299 | Bacteria | 1648 |
| 274 | Ga0207426_1000201 | 3300025302 | Bacteria | 143975 |
| 275 | Ga0207426_1000617 | 3300025302 | Bacteria | 45527 |
| 276 | Ga0207426_1007359 | 3300025302 | Bacteria | 4620 |
| 277 | Ga0207426_1040679 | 3300025302 | Bacteria | 1446 |
| 278 | Ga0209051_1081462 | 3300025303 | Bacteria | 932 |
| 279 | Ga0209257_1000440 | 3300025304 | Bacteria | 79182 |
| 280 | Ga0207656_10211783 | 3300025321 | Bacteria | 939 |
| 281 | Ga0207692_10000494 | 3300025898 | Bacteria | 13955 |
| 282 | Ga0207692_10025046 | 3300025898 | Bacteria | 2782 |
| 283 | Ga0207692_10576400 | 3300025898 | Bacteria | 721 |
| 284 | Ga0207692_10624337 | 3300025898 | Bacteria | 694 |
| 285 | Ga0207647_10250617 | 3300025904 | Bacteria | 1016 |
| 286 | Ga0207685_10111943 | 3300025905 | Bacteria | 1184 |
| 287 | Ga0207685_10169865 | 3300025905 | Bacteria | 1003 |
| 288 | Ga0207699_10000480 | 3300025906 | Bacteria | 20266 |
| 289 | Ga0207699_10032324 | 3300025906 | Bacteria | 2948 |
| 290 | Ga0207699_10052435 | 3300025906 | Bacteria | 2415 |
| 291 | Ga0207699_10894648 | 3300025906 | Bacteria | 655 |
| 292 | Ga0207705_10015389 | 3300025909 | Bacteria | 5489 |
| 293 | Ga0207705_10033765 | 3300025909 | Bacteria | 3656 |
| 294 | Ga0207705_10046309 | 3300025909 | Bacteria | 3125 |
| 295 | Ga0207705_10068845 | 3300025909 | Bacteria | 2563 |
| 296 | Ga0207705_10427929 | 3300025909 | Bacteria | 1025 |
| 297 | Ga0207684_10217689 | 3300025910 | Bacteria | 1648 |
| 298 | Ga0207654_10007752 | 3300025911 | Bacteria | 5419 |
| 299 | Ga0207707_10075803 | 3300025912 | Bacteria | 2935 |
| 300 | Ga0207707_10169698 | 3300025912 | Bacteria | 1907 |
| 301 | Ga0207707_10204609 | 3300025912 | Bacteria | 1720 |
| 302 | Ga0207707_11014086 | 3300025912 | Bacteria | 681 |
| 303 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 304 | Ga0207695_10181364 | 3300025913 | Bacteria | 2026 |
| 305 | Ga0207695_10402757 | 3300025913 | Bacteria | 1253 |
| 306 | Ga0207695_10868876 | 3300025913 | Bacteria | 782 |
| 307 | Ga0207671_10001858 | 3300025914 | Bacteria | 23570 |
| 308 | Ga0207671_10065742 | 3300025914 | Bacteria | 2698 |
| 309 | Ga0207671_10081338 | 3300025914 | Bacteria | 2429 |
| 310 | Ga0207671_10691996 | 3300025914 | Bacteria | 811 |
| 311 | Ga0207693_10010321 | 3300025915 | Bacteria | 7581 |
| 312 | Ga0207693_10014578 | 3300025915 | Bacteria | 6317 |
| 313 | Ga0207693_10027366 | 3300025915 | Bacteria | 4508 |
| 314 | Ga0207663_10000356 | 3300025916 | Bacteria | 19925 |
| 315 | Ga0207663_10003833 | 3300025916 | Bacteria | 7424 |
| 316 | Ga0207663_10226813 | 3300025916 | Bacteria | 1362 |
| 317 | Ga0207663_11324839 | 3300025916 | Bacteria | 580 |
| 318 | Ga0207660_10041607 | 3300025917 | Bacteria | 3221 |
| 319 | Ga0207660_10043493 | 3300025917 | Bacteria | 3157 |
| 320 | Ga0207660_10063865 | 3300025917 | Bacteria | 2656 |
| 321 | Ga0207660_10066782 | 3300025917 | Bacteria | 2603 |
| 322 | Ga0207660_10117379 | 3300025917 | Bacteria | 2011 |
| 323 | Ga0207660_10145108 | 3300025917 | Bacteria | 1818 |
| 324 | Ga0207660_10181152 | 3300025917 | Bacteria | 1636 |
| 325 | Ga0207660_10759207 | 3300025917 | Bacteria | 791 |
| 326 | Ga0207660_11447927 | 3300025917 | Bacteria | 556 |
| 327 | Ga0207657_10022149 | 3300025919 | Bacteria | 5960 |
| 328 | Ga0207657_10026499 | 3300025919 | Bacteria | 5326 |
| 329 | Ga0207657_10416282 | 3300025919 | Bacteria | 1056 |
| 330 | Ga0207657_10818821 | 3300025919 | Bacteria | 719 |
| 331 | Ga0207649_10287197 | 3300025920 | Bacteria | 1198 |
| 332 | Ga0207649_10655828 | 3300025920 | Bacteria | 811 |
| 333 | Ga0207649_10763263 | 3300025920 | Bacteria | 753 |
| 334 | Ga0207652_10024203 | 3300025921 | Bacteria | 5036 |
| 335 | Ga0207652_10084924 | 3300025921 | Bacteria | 2774 |
| 336 | Ga0207652_10097084 | 3300025921 | Bacteria | 2596 |
| 337 | Ga0207652_10124179 | 3300025921 | Bacteria | 2299 |
| 338 | Ga0207652_10175619 | 3300025921 | Bacteria | 1924 |
| 339 | Ga0207652_10180971 | 3300025921 | Bacteria | 1894 |
| 340 | Ga0207652_11789221 | 3300025921 | Bacteria | 519 |
| 341 | Ga0207694_10086964 | 3300025924 | Bacteria | 2461 |
| 342 | Ga0207694_11099881 | 3300025924 | Bacteria | 673 |
| 343 | Ga0207650_10004408 | 3300025925 | Bacteria | 9616 |
| 344 | Ga0207700_10005911 | 3300025928 | Bacteria | 7358 |
| 345 | Ga0207700_10009620 | 3300025928 | Bacteria | 6051 |
| 346 | Ga0207700_10096308 | 3300025928 | Bacteria | 2349 |
| 347 | Ga0207700_10101814 | 3300025928 | Bacteria | 2292 |
| 348 | Ga0207700_10158437 | 3300025928 | Bacteria | 1878 |
| 349 | Ga0207700_10384761 | 3300025928 | Bacteria | 1227 |
| 350 | Ga0207700_11149614 | 3300025928 | Bacteria | 693 |
| 351 | Ga0207664_10020450 | 3300025929 | Bacteria | 4906 |
| 352 | Ga0207664_10055501 | 3300025929 | Bacteria | 3143 |
| 353 | Ga0207664_10061817 | 3300025929 | Bacteria | 2989 |
| 354 | Ga0207664_10078039 | 3300025929 | Bacteria | 2685 |
| 355 | Ga0207664_10310142 | 3300025929 | Bacteria | 1390 |
| 356 | Ga0207664_10328088 | 3300025929 | Bacteria | 1351 |
| 357 | Ga0207664_11937042 | 3300025929 | Bacteria | 512 |
| 358 | Ga0207644_10672086 | 3300025931 | Bacteria | 863 |
| 359 | Ga0207690_10147252 | 3300025932 | Bacteria | 1742 |
| 360 | Ga0207709_11145062 | 3300025935 | Bacteria | 640 |
| 361 | Ga0207670_10864786 | 3300025936 | Bacteria | 756 |
| 362 | Ga0207665_10000289 | 3300025939 | Bacteria | 34924 |
| 363 | Ga0207665_10001832 | 3300025939 | Bacteria | 14302 |
| 364 | Ga0207665_10184275 | 3300025939 | Bacteria | 1513 |
| 365 | Ga0207665_10197567 | 3300025939 | Bacteria | 1464 |
| 366 | Ga0207711_10614311 | 3300025941 | Bacteria | 1014 |
| 367 | Ga0207661_10000678 | 3300025944 | Bacteria | 22066 |
| 368 | Ga0207661_10029561 | 3300025944 | Bacteria | 4210 |
| 369 | Ga0207661_10487791 | 3300025944 | Bacteria | 1125 |
| 370 | Ga0207679_11368932 | 3300025945 | Bacteria | 649 |
| 371 | Ga0207667_10047269 | 3300025949 | Bacteria | 4555 |
| 372 | Ga0207667_10083387 | 3300025949 | Bacteria | 3310 |
| 373 | Ga0207667_10101848 | 3300025949 | Bacteria | 2962 |
| 374 | Ga0207667_10134295 | 3300025949 | Bacteria | 2548 |
| 375 | Ga0207667_10176109 | 3300025949 | Bacteria | 2197 |
| 376 | Ga0207667_10711926 | 3300025949 | Bacteria | 1006 |
| 377 | Ga0207667_11203977 | 3300025949 | Bacteria | 737 |
| 378 | Ga0207668_11783044 | 3300025972 | Bacteria | 555 |
| 379 | Ga0207640_10742549 | 3300025981 | Bacteria | 845 |
| 380 | Ga0207640_10968623 | 3300025981 | Bacteria | 747 |
| 381 | Ga0207640_11117153 | 3300025981 | Bacteria | 698 |
| 382 | Ga0207658_10943638 | 3300025986 | Bacteria | 786 |
| 383 | Ga0207677_11003656 | 3300026023 | Bacteria | 757 |
| 384 | Ga0207677_11938672 | 3300026023 | Bacteria | 547 |
| 385 | Ga0207703_10341875 | 3300026035 | Bacteria | 1376 |
| 386 | Ga0207639_10086437 | 3300026041 | Bacteria | 2497 |
| 387 | Ga0207639_10618708 | 3300026041 | Bacteria | 1000 |
| 388 | Ga0207639_10621331 | 3300026041 | Bacteria | 998 |
| 389 | Ga0207678_10375540 | 3300026067 | Bacteria | 1228 |
| 390 | Ga0207678_10391839 | 3300026067 | Bacteria | 1202 |
| 391 | Ga0207678_10525310 | 3300026067 | Bacteria | 1033 |
| 392 | Ga0207702_10063731 | 3300026078 | Bacteria | 3153 |
| 393 | Ga0207702_10103590 | 3300026078 | Bacteria | 2517 |
| 394 | Ga0207702_10186579 | 3300026078 | Bacteria | 1913 |
| 395 | Ga0207702_10214872 | 3300026078 | Bacteria | 1789 |
| 396 | Ga0207702_10845533 | 3300026078 | Bacteria | 906 |
| 397 | Ga0207702_11107406 | 3300026078 | Bacteria | 786 |
| 398 | Ga0207674_10064038 | 3300026116 | Bacteria | 3709 |
| 399 | Ga0207674_10068834 | 3300026116 | Bacteria | 3561 |
| 400 | Ga0207698_10069481 | 3300026142 | Bacteria | 2785 |
| 401 | Ga0207698_10071309 | 3300026142 | Bacteria | 2756 |
| 402 | Ga0207698_10190020 | 3300026142 | Bacteria | 1828 |
| 403 | Ga0207698_10617722 | 3300026142 | Bacteria | 1070 |
| 404 | Ga0207698_10699725 | 3300026142 | Bacteria | 1008 |
| 405 | Ga0207698_10753643 | 3300026142 | Bacteria | 973 |
| 406 | Ga0209389_1000029 | 3300027296 | Bacteria | 140337 |
| 407 | Ga0209389_1000076 | 3300027296 | Bacteria | 92447 |
| 408 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 409 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 410 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 411 | Ga0209489_100416 | 3300027361 | Bacteria | 77981 |
| 412 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 413 | Ga0207428_10085071 | 3300027907 | Bacteria | 2464 |
| 414 | Ga0268266_10212046 | 3300028379 | Bacteria | 1776 |
| 415 | Ga0265338_10019779 | 3300028800 | Bacteria | 7118 |
| 416 | Ga0265338_10165592 | 3300028800 | Bacteria | 1702 |
| 417 | Ga0265338_10269323 | 3300028800 | Bacteria | 1249 |
| 418 | Ga0265773_1026883 | 3300031018 | Bacteria | 598 |
| 419 | Ga0265330_10006264 | 3300031235 | Bacteria | 5883 |
| 420 | Ga0265325_10309681 | 3300031241 | Bacteria | 703 |
| 421 | Ga0265339_10047735 | 3300031249 | Bacteria | 2350 |
| 422 | Ga0265313_10007846 | 3300031595 | Bacteria | 7200 |
| 423 | Ga0265313_10023026 | 3300031595 | Bacteria | 3363 |
| 424 | Ga0265313_10071548 | 3300031595 | Bacteria | 1596 |
| 425 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 426 | Ga0307508_10426850 | 3300031616 | Bacteria | 917 |
| 427 | Ga0265314_10066904 | 3300031711 | Bacteria | 2422 |
| 428 | Ga0265342_10000082 | 3300031712 | Bacteria | 102532 |
| 429 | Ga0265342_10026636 | 3300031712 | Bacteria | 3619 |
| 430 | Ga0307510_10007616 | 3300033180 | Bacteria | 12905 |
| 431 | Ga0307510_10121436 | 3300033180 | Bacteria | 2316 |
| 432 | Ga0373934_0163106 | 3300035086 | Bacteria | 914 |
| 433 | Ga0373944_0183305 | 3300035089 | Bacteria | 752 |
| 434 | Ga0373923_0137515 | 3300035111 | Bacteria | 1102 |
| 435 | Ga0373945_0079344 | 3300035116 | Bacteria | 1255 |
| 436 | Ga0373953_0080293 | 3300035117 | Bacteria | 1355 |
| 437 | Ga0373954_0024158 | 3300035118 | Bacteria | 2769 |
| 438 | Ga0373954_0263423 | 3300035118 | Bacteria | 849 |
| 439 | Ga0373956_0163722 | 3300035119 | Bacteria | 1049 |
| 440 | Ga0373957_0066071 | 3300035120 | Bacteria | 1408 |
| 441 | Ga0373943_0034867 | 3300035170 | Bacteria | 2402 |
| 442 | Ga0373955_0645384 | 3300035172 | Bacteria | 649 |
| 443 | Ga0373961_0025585 | 3300035241 | Bacteria | 1606 |
| 444 | Ga0373924_0002858 | 3300035410 | Bacteria | 5851 |
| 445 | Ga0373931_0092941 | 3300035691 | Bacteria | 1684 |
| 446 | Ga0373935_0063084 | 3300035692 | Bacteria | 2374 |
| 447 | Ga0373927_0021218 | 3300035695 | Bacteria | 4255 |
| 448 | Ga0373927_0261747 | 3300035695 | Bacteria | 1138 |
| 449 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 450 | Ga0373933_0479957 | 3300035724 | Bacteria | 814 |
| 451 | Ga0373947_1084289 | 3300035725 | Bacteria | 546 |
| 452 | Ga0373937_0074647 | 3300036401 | Bacteria | 3129 |
| 453 | Ga0373937_1056233 | 3300036401 | Bacteria | 761 |
| 454 | Ga0372808_044701 | 3300036459 | Bacteria | 634 |
| 455 | Ga0373925_0008346 | 3300037068 | Bacteria | 7541 |
| 456 | Ga0373925_0012108 | 3300037068 | Bacteria | 6243 |
| 457 | Ga0373925_0621816 | 3300037068 | Bacteria | 890 |
| 458 | Ga0395899_0159301 | 3300037312 | Bacteria | 1595 |
| 459 | Ga0395899_0271719 | 3300037312 | Bacteria | 1156 |
| 460 | Ga0395900_0052668 | 3300037418 | Bacteria | 4189 |
| 461 | Ga0395900_0053769 | 3300037418 | Bacteria | 4145 |
| 462 | Ga0395900_0084990 | 3300037418 | Bacteria | 3252 |
| 463 | Ga0395900_0093104 | 3300037418 | Bacteria | 3096 |
| 464 | Ga0395900_0227912 | 3300037418 | Bacteria | 1875 |
| 465 | Ga0395900_0298738 | 3300037418 | Bacteria | 1597 |
| 466 | Ga0395900_0351417 | 3300037418 | Bacteria | 1448 |
| 467 | Ga0395898_0014967 | 3300037466 | Bacteria | 7965 |
| 468 | Ga0395898_0034661 | 3300037466 | Bacteria | 5027 |
| 469 | Ga0395898_0072959 | 3300037466 | Bacteria | 3315 |
| 470 | Ga0395898_0138617 | 3300037466 | Bacteria | 2329 |
| 471 | Ga0395898_0186341 | 3300037466 | Bacteria | 1983 |
| 472 | Ga0395898_0214112 | 3300037466 | Bacteria | 1838 |
| 473 | Ga0395905_0005511 | 3300037471 | Bacteria | 12915 |
| 474 | Ga0395905_0084822 | 3300037471 | Bacteria | 2968 |
| 475 | Ga0395901_0026879 | 3300038443 | Bacteria | 5908 |
| 476 | Ga0395901_0065435 | 3300038443 | Bacteria | 3785 |
| 477 | Ga0395901_0097039 | 3300038443 | Bacteria | 3089 |
| 478 | Ga0395901_0112127 | 3300038443 | Bacteria | 2864 |
| 479 | Ga0395901_0734695 | 3300038443 | Bacteria | 981 |
| 480 | Ga0395901_0899648 | 3300038443 | Bacteria | 867 |
| 481 | Ga0436365_0021907 | 3300039437 | Bacteria | 949 |
| 482 | Ga0436365_0808505 | 3300039437 | Bacteria | 809 |
| 483 | Ga0436360_0291987 | 3300039438 | Bacteria | 6332 |
| 484 | Ga0436361_0183009 | 3300039447 | Bacteria | 576 |
| 485 | Ga0436361_0759798 | 3300039447 | Bacteria | 2785 |
| 486 | Ga0436361_0959035 | 3300039447 | Bacteria | 2510 |
| 487 | Ga0436363_0385198 | 3300039450 | Bacteria | 836 |
| 488 | Ga0436363_0439777 | 3300039450 | Bacteria | 8998 |
| 489 | Ga0436363_0468515 | 3300039450 | Bacteria | 1037 |
| 490 | Ga0436363_0514184 | 3300039450 | Bacteria | 951 |
| 491 | Ga0436363_0973295 | 3300039450 | Bacteria | 1154 |
| 492 | Ga0436362_1074496 | 3300039453 | Bacteria | 5861 |
| 493 | Ga0436362_1127610 | 3300039453 | Bacteria | 568 |
| 494 | Ga0451787_764725 | 3300041441 | Bacteria | 1277 |
| 495 | Ga0451789_1221988 | 3300041443 | Bacteria | 1095 |
| 496 | Ga0451793_1530076 | 3300041452 | Bacteria | 2503 |
| 497 | Ga0451795_0965185 | 3300041456 | Bacteria | 771 |
| 498 | Ga0451798_1113104 | 3300041458 | Bacteria | 547 |
| 499 | Ga0451802_1193815 | 3300041460 | Bacteria | 777 |
| 500 | Ga0451807_0896219 | 3300041486 | Bacteria | 1222 |
| 501 | Ga0451845_0561026 | 3300041501 | Bacteria | 1422 |
| 502 | Ga0451849_1468299 | 3300041505 | Bacteria | 1503 |
| 503 | Ga0451843_0604583 | 3300041509 | Bacteria | 1231 |
| 504 | Ga0451853_0997325 | 3300041512 | Bacteria | 1293 |
| 505 | Ga0466969_0016425 | 3300044656 | Bacteria | 3873 |
| 506 | Ga0466969_0078487 | 3300044656 | Bacteria | 1579 |
| 507 | Ga0466972_0011618 | 3300044658 | Bacteria | 4421 |
| 508 | Ga0466972_0185541 | 3300044658 | Bacteria | 975 |
| 509 | Ga0466965_0025559 | 3300044683 | Bacteria | 2858 |
| 510 | Ga0466965_0126248 | 3300044683 | Bacteria | 1324 |
| 511 | Ga0466965_0226223 | 3300044683 | Bacteria | 998 |
| 512 | Ga0466965_0779658 | 3300044683 | Bacteria | 552 |
| 513 | Ga0466966_0002297 | 3300044684 | Bacteria | 12462 |
| 514 | Ga0466966_0169498 | 3300044684 | Bacteria | 1327 |
| 515 | Ga0466961_0000129 | 3300044693 | Bacteria | 50353 |
| 516 | Ga0466961_0296449 | 3300044693 | Bacteria | 988 |
| 517 | Ga0466961_0319671 | 3300044693 | Bacteria | 947 |
| 518 | Ga0466963_0060863 | 3300044694 | Bacteria | 2522 |
| 519 | Ga0466963_0137605 | 3300044694 | Bacteria | 1690 |
| 520 | Ga0466963_0301623 | 3300044694 | Bacteria | 1127 |
| 521 | Ga0466963_1068382 | 3300044694 | Bacteria | 568 |
| 522 | Ga0466964_0034112 | 3300044706 | Bacteria | 2030 |
| 523 | Ga0466964_0124045 | 3300044706 | Bacteria | 1168 |
| 524 | Ga0466964_0213492 | 3300044706 | Bacteria | 933 |
| 525 | Ga0466971_0021086 | 3300044719 | Bacteria | 2898 |
| 526 | Ga0466971_0403232 | 3300044719 | Bacteria | 667 |
| 527 | Ga0466971_0440412 | 3300044719 | Bacteria | 638 |
| 528 | Ga0466968_0007308 | 3300044735 | Bacteria | 4196 |
| 529 | Ga0466968_0387074 | 3300044735 | Bacteria | 684 |
| 530 | Ga0466957_0025520 | 3300044842 | Bacteria | 3503 |
| 531 | Ga0466957_0167399 | 3300044842 | Bacteria | 1430 |
| 532 | Ga0466957_0171826 | 3300044842 | Bacteria | 1412 |
| 533 | Ga0466959_0006120 | 3300045049 | Bacteria | 8313 |
| 534 | Ga0466959_0461413 | 3300045049 | Bacteria | 861 |
| 535 | Ga0466959_0479266 | 3300045049 | Bacteria | 842 |
| 536 | Ga0466958_0254707 | 3300045836 | Bacteria | 1123 |
| 537 | Ga0466958_0297884 | 3300045836 | Bacteria | 1035 |
| 538 | Ga0466967_0029176 | 3300045976 | Bacteria | 4614 |
| 539 | Ga0466967_0039786 | 3300045976 | Bacteria | 4045 |
| 540 | Ga0466967_0173235 | 3300045976 | Bacteria | 2031 |
| 541 | Ga0466967_0419565 | 3300045976 | Bacteria | 1304 |
| 542 | Ga0466967_0458464 | 3300045976 | Bacteria | 1246 |
| 543 | Ga0466967_1345815 | 3300045976 | Bacteria | 711 |
| 544 | Ga0495592_0067706 | 3300046454 | Bacteria | 2608 |
| 545 | Ga0495592_0158570 | 3300046454 | Bacteria | 1559 |
| 546 | Ga0495592_0275854 | 3300046454 | Bacteria | 1101 |
| 547 | Ga0495603_0047738 | 3300046455 | Bacteria | 2549 |
| 548 | Ga0495603_0240840 | 3300046455 | Bacteria | 1042 |
| 549 | Ga0495629_0151152 | 3300046459 | Bacteria | 1613 |
| 550 | Ga0495629_0278124 | 3300046459 | Bacteria | 1149 |
| 551 | Ga0495629_0286765 | 3300046459 | Bacteria | 1129 |
| 552 | Ga0495629_0935539 | 3300046459 | Bacteria | 567 |
| 553 | Ga0495638_0002281 | 3300046460 | Bacteria | 15850 |
| 554 | Ga0495641_0111456 | 3300046461 | Bacteria | 1221 |
| 555 | Ga0495641_0424705 | 3300046461 | Bacteria | 604 |
| 556 | Ga0495651_0010124 | 3300046462 | Bacteria | 7242 |
| 557 | Ga0495651_0016379 | 3300046462 | Bacteria | 5740 |
| 558 | Ga0495651_0346429 | 3300046462 | Bacteria | 983 |
| 559 | Ga0495653_0545695 | 3300046463 | Bacteria | 718 |
| 560 | Ga0495582_0013743 | 3300046473 | Bacteria | 4458 |
| 561 | Ga0495582_0151970 | 3300046473 | Bacteria | 1315 |
| 562 | Ga0495639_0005620 | 3300046475 | Bacteria | 5399 |
| 563 | Ga0495664_0007028 | 3300046477 | Bacteria | 6234 |
| 564 | Ga0495664_0011419 | 3300046477 | Bacteria | 5008 |
| 565 | Ga0495664_0046017 | 3300046477 | Bacteria | 2588 |
| 566 | Ga0495585_0221297 | 3300046492 | Bacteria | 955 |
| 567 | Ga0495585_0290860 | 3300046492 | Bacteria | 805 |
| 568 | Ga0495594_0180966 | 3300046499 | Bacteria | 1200 |
| 569 | Ga0495607_0156037 | 3300046501 | Bacteria | 1164 |
| 570 | Ga0495583_0162088 | 3300046506 | Bacteria | 922 |
| 571 | Ga0495606_0034748 | 3300046507 | Bacteria | 3456 |
| 572 | Ga0495606_0301828 | 3300046507 | Bacteria | 867 |
| 573 | Ga0495608_0300452 | 3300046511 | Bacteria | 994 |
| 574 | Ga0495608_0401077 | 3300046511 | Bacteria | 839 |
| 575 | Ga0495610_0214405 | 3300046512 | Bacteria | 781 |
| 576 | Ga0495618_0310891 | 3300046514 | Bacteria | 978 |
| 577 | Ga0495618_0761436 | 3300046514 | Bacteria | 566 |
| 578 | Ga0495620_0273678 | 3300046515 | Bacteria | 643 |
| 579 | Ga0495620_0284334 | 3300046515 | Bacteria | 629 |
| 580 | Ga0495628_0032331 | 3300046516 | Bacteria | 4224 |
| 581 | Ga0495628_0050469 | 3300046516 | Bacteria | 3291 |
| 582 | Ga0495630_0036284 | 3300046517 | Bacteria | 3685 |
| 583 | Ga0495630_0440496 | 3300046517 | Bacteria | 998 |
| 584 | Ga0495630_0486338 | 3300046517 | Bacteria | 946 |
| 585 | Ga0495631_0090578 | 3300046518 | Bacteria | 1317 |
| 586 | Ga0495648_0003897 | 3300046524 | Bacteria | 12935 |
| 587 | Ga0495648_0019285 | 3300046524 | Bacteria | 4801 |
| 588 | Ga0495648_0128425 | 3300046524 | Bacteria | 1351 |
| 589 | Ga0495642_0148664 | 3300046528 | Bacteria | 1013 |
| 590 | Ga0495652_0006665 | 3300046529 | Bacteria | 10717 |
| 591 | Ga0495652_0085443 | 3300046529 | Bacteria | 2593 |
| 592 | Ga0495652_0299714 | 3300046529 | Bacteria | 1169 |
| 593 | Ga0495652_0713591 | 3300046529 | Bacteria | 674 |
| 594 | Ga0495665_0078537 | 3300046531 | Bacteria | 1736 |
| 595 | Ga0495640_0385092 | 3300046533 | Bacteria | 862 |
| 596 | Ga0495587_0014466 | 3300046536 | Bacteria | 4948 |
| 597 | Ga0495609_0302073 | 3300046538 | Bacteria | 652 |
| 598 | Ga0495645_0028158 | 3300046543 | Bacteria | 4083 |
| 599 | Ga0495645_0114699 | 3300046543 | Bacteria | 1903 |
| 600 | Ga0495622_0045393 | 3300046557 | Bacteria | 2041 |
| 601 | Ga0495667_0075193 | 3300046559 | Bacteria | 2199 |
| 602 | Ga0495634_0093381 | 3300046642 | Bacteria | 1951 |
| 603 | Ga0495634_0144144 | 3300046642 | Bacteria | 1510 |
| 604 | Ga0495611_0097717 | 3300046648 | Bacteria | 1361 |
| 605 | Ga0495611_0128623 | 3300046648 | Bacteria | 1182 |
| 606 | Ga0495625_0208839 | 3300046660 | Bacteria | 1284 |
| 607 | Ga0495625_0717004 | 3300046660 | Bacteria | 589 |
| 608 | Ga0495635_0011833 | 3300046663 | Bacteria | 6116 |
| 609 | Ga0495635_0112373 | 3300046663 | Bacteria | 1860 |
| 610 | Ga0495635_1029548 | 3300046663 | Bacteria | 523 |
| 611 | Ga0495661_0062394 | 3300046665 | Bacteria | 2208 |
| 612 | Ga0495588_0061742 | 3300046674 | Bacteria | 1942 |
| 613 | Ga0495588_0081630 | 3300046674 | Bacteria | 1688 |
| 614 | Ga0495657_0020349 | 3300046675 | Bacteria | 4771 |
| 615 | Ga0495657_0135124 | 3300046675 | Bacteria | 1541 |
| 616 | Ga0495599_0038942 | 3300046678 | Bacteria | 2988 |
| 617 | Ga0495623_0153763 | 3300046679 | Bacteria | 1358 |
| 618 | Ga0495623_0155439 | 3300046679 | Bacteria | 1348 |
| 619 | Ga0495646_0015043 | 3300046680 | Bacteria | 4915 |
| 620 | Ga0495646_0030035 | 3300046680 | Bacteria | 3395 |
| 621 | Ga0495646_0091348 | 3300046680 | Bacteria | 1757 |
| 622 | Ga0495658_0202899 | 3300046683 | Bacteria | 1236 |
| 623 | Ga0495658_0305322 | 3300046683 | Bacteria | 1007 |
| 624 | Ga0495613_0080774 | 3300046689 | Bacteria | 2363 |
| 625 | Ga0495613_0092768 | 3300046689 | Bacteria | 2186 |
| 626 | Ga0495613_0108256 | 3300046689 | Bacteria | 2004 |
| 627 | Ga0495613_0242910 | 3300046689 | Bacteria | 1258 |
| 628 | Ga0495624_0062744 | 3300046690 | Bacteria | 2324 |
| 629 | Ga0495624_0115823 | 3300046690 | Bacteria | 1647 |
| 630 | Ga0495649_0168666 | 3300046694 | Bacteria | 1146 |
| 631 | Ga0495600_0301089 | 3300046809 | Bacteria | 1012 |
| 632 | Ga0495600_0365940 | 3300046809 | Bacteria | 901 |
| 633 | Ga0495581_0129575 | 3300047315 | Bacteria | 1470 |
| 634 | Ga0495581_0185090 | 3300047315 | Bacteria | 1218 |
| 635 | Ga0495581_0711693 | 3300047315 | Bacteria | 579 |
| 636 | Ga0495604_0005727 | 3300047317 | Bacteria | 9854 |
| 637 | Ga0495604_0192229 | 3300047317 | Bacteria | 1421 |
| 638 | Ga0495604_0264638 | 3300047317 | Bacteria | 1167 |
| 639 | Ga0495604_0576296 | 3300047317 | Bacteria | 724 |
| 640 | Ga0495674_0019801 | 3300047319 | Bacteria | 6239 |
| 641 | Ga0495674_0030816 | 3300047319 | Bacteria | 4874 |
| 642 | Ga0495672_0141937 | 3300047320 | Bacteria | 1254 |
| 643 | Ga0495676_0056563 | 3300047321 | Bacteria | 3101 |
| 644 | Ga0495676_0555057 | 3300047321 | Bacteria | 750 |
| 645 | Ga0495676_0598582 | 3300047321 | Bacteria | 718 |
| 646 | Ga0495676_0656161 | 3300047321 | Bacteria | 681 |
| 647 | Ga0495680_0006823 | 3300047322 | Bacteria | 10545 |
| 648 | Ga0495683_0362905 | 3300047323 | Bacteria | 609 |
| 649 | Ga0495675_0021068 | 3300047444 | Bacteria | 4149 |
| 650 | Ga0495673_0021341 | 3300047469 | Bacteria | 3201 |
| 651 | Ga0495673_0048751 | 3300047469 | Bacteria | 1866 |
| 652 | Ga0495684_0043412 | 3300047471 | Bacteria | 3442 |
| 653 | Ga0495684_0140995 | 3300047471 | Bacteria | 1807 |
| 654 | Ga0495684_0161443 | 3300047471 | Bacteria | 1671 |
| 655 | Ga0495684_0322099 | 3300047471 | Bacteria | 1105 |
| 656 | Ga0495686_0115826 | 3300047472 | Bacteria | 1602 |
| 657 | Ga0495686_0173712 | 3300047472 | Bacteria | 1252 |
| 658 | Ga0495686_0463911 | 3300047472 | Bacteria | 671 |
| 659 | Ga0495593_0022751 | 3300047673 | Bacteria | 3487 |
| 660 | Ga0495593_0065310 | 3300047673 | Bacteria | 1898 |
| 661 | Ga0495593_0093478 | 3300047673 | Bacteria | 1547 |
| 662 | Ga0495593_0602176 | 3300047673 | Bacteria | 552 |
| 663 | Ga0495602_0050884 | 3300048088 | Bacteria | 3697 |
| 664 | Ga0495602_0169061 | 3300048088 | Bacteria | 1698 |
| 665 | Ga0495602_0337391 | 3300048088 | Bacteria | 1091 |
| 666 | Ga0495602_0522795 | 3300048088 | Bacteria | 826 |
| 667 | Ga0495602_0840429 | 3300048088 | Bacteria | 614 |
| 668 | Ga0496100_0318774 | 3300048903 | Bacteria | 1167 |
| 669 | Ga0496100_1590744 | 3300048903 | Bacteria | 516 |
| 670 | Ga0496101_0426449 | 3300048904 | Bacteria | 1045 |
| 671 | Ga0496102_0064026 | 3300048905 | Bacteria | 3367 |
| 672 | Ga0496102_0971760 | 3300048905 | Bacteria | 770 |
| 673 | Ga0496103_0008405 | 3300048906 | Bacteria | 6134 |
| 674 | Ga0496104_0004036 | 3300048907 | Bacteria | 12728 |
| 675 | Ga0496104_0005388 | 3300048907 | Bacteria | 11198 |
| 676 | Ga0496104_0176181 | 3300048907 | Bacteria | 2049 |
| 677 | Ga0496104_0448165 | 3300048907 | Bacteria | 1202 |
| 678 | Ga0496105_0001275 | 3300048908 | Bacteria | 17613 |
| 679 | Ga0496105_0009543 | 3300048908 | Bacteria | 7595 |
| 680 | Ga0496105_0080543 | 3300048908 | Bacteria | 2690 |
| 681 | Ga0496105_0579331 | 3300048908 | Bacteria | 873 |
| 682 | Ga0496105_0875758 | 3300048908 | Bacteria | 678 |
| 683 | Ga0496106_0003991 | 3300048909 | Bacteria | 11026 |
| 684 | Ga0496106_0159379 | 3300048909 | Bacteria | 1784 |
| 685 | Ga0496106_0172559 | 3300048909 | Bacteria | 1714 |
| 686 | Ga0496106_0264382 | 3300048909 | Bacteria | 1377 |
| 687 | Ga0496106_0689411 | 3300048909 | Bacteria | 815 |
| 688 | Ga0496107_0005978 | 3300048910 | Bacteria | 8339 |
| 689 | Ga0496107_0229951 | 3300048910 | Bacteria | 1380 |
| 690 | Ga0496107_1048327 | 3300048910 | Bacteria | 590 |
| 691 | Ga0496108_0000581 | 3300048911 | Bacteria | 28520 |
| 692 | Ga0496108_0086416 | 3300048911 | Bacteria | 2662 |
| 693 | Ga0496108_0472175 | 3300048911 | Bacteria | 1096 |
| 694 | Ga0496109_0000507 | 3300048912 | Bacteria | 33280 |
| 695 | Ga0496109_0002379 | 3300048912 | Bacteria | 15713 |
| 696 | Ga0496110_0011482 | 3300048913 | Bacteria | 7250 |
| 697 | Ga0496110_0652287 | 3300048913 | Bacteria | 952 |
| 698 | Ga0496110_1301985 | 3300048913 | Bacteria | 636 |
| 699 | Ga0496110_1408097 | 3300048913 | Bacteria | 607 |
| 700 | Ga0496111_0005375 | 3300048914 | Bacteria | 8193 |
| 701 | Ga0496111_0482704 | 3300048914 | Bacteria | 913 |
| 702 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 703 | Ga0496112_0004823 | 3300048915 | Bacteria | 11515 |
| 704 | Ga0496112_0016561 | 3300048915 | Bacteria | 6910 |
| 705 | Ga0496112_0721333 | 3300048915 | Bacteria | 924 |
| 706 | Ga0496113_0011391 | 3300048916 | Bacteria | 5928 |
| 707 | Ga0496113_0029645 | 3300048916 | Bacteria | 3955 |
| 708 | Ga0496113_0328596 | 3300048916 | Bacteria | 1226 |
| 709 | Ga0496114_0045648 | 3300048917 | Bacteria | 3641 |
| 710 | Ga0496114_0080506 | 3300048917 | Bacteria | 2751 |
| 711 | Ga0496114_0100516 | 3300048917 | Bacteria | 2468 |
| 712 | Ga0496114_0738166 | 3300048917 | Bacteria | 861 |
| 713 | Ga0496114_1694137 | 3300048917 | Bacteria | 520 |
| 714 | Ga0496115_0083685 | 3300048918 | Bacteria | 2601 |
| 715 | Ga0496115_0194139 | 3300048918 | Bacteria | 1677 |
| 716 | Ga0496115_0286035 | 3300048918 | Bacteria | 1353 |
| 717 | Ga0496118_0035728 | 3300048921 | Bacteria | 4029 |
| 718 | Ga0496118_0063743 | 3300048921 | Bacteria | 2710 |
| 719 | Ga0496118_0202218 | 3300048921 | Bacteria | 1175 |
| 720 | Ga0496119_0030804 | 3300048922 | Bacteria | 3609 |
| 721 | Ga0496119_0041332 | 3300048922 | Bacteria | 2937 |
| 722 | Ga0496120_0023580 | 3300048923 | Bacteria | 3850 |
| 723 | Ga0496120_0046427 | 3300048923 | Bacteria | 2510 |
| 724 | Ga0496121_0039009 | 3300048924 | Bacteria | 4194 |
| 725 | Ga0496121_0053636 | 3300048924 | Bacteria | 3376 |
| 726 | Ga0496121_0633204 | 3300048924 | Bacteria | 654 |
| 727 | Ga0496122_0273367 | 3300048925 | Bacteria | 929 |
| 728 | Ga0496123_0416420 | 3300048926 | Bacteria | 607 |
| 729 | Ga0496125_0056378 | 3300048928 | Bacteria | 3191 |
| 730 | Ga0496126_0027182 | 3300048929 | Bacteria | 5469 |
| 731 | Ga0496126_0041848 | 3300048929 | Bacteria | 4236 |
| 732 | Ga0496126_0066674 | 3300048929 | Bacteria | 3218 |
| 733 | Ga0496126_0172089 | 3300048929 | Bacteria | 1844 |
| 734 | Ga0496126_0256817 | 3300048929 | Bacteria | 1454 |
| 735 | Ga0496126_0599007 | 3300048929 | Bacteria | 868 |
| 736 | Ga0496126_0842327 | 3300048929 | Bacteria | 700 |
| 737 | Ga0496126_0991842 | 3300048929 | Bacteria | 631 |
| 738 | Ga0496126_1022583 | 3300048929 | Bacteria | 619 |
| 739 | Ga0495682_0026256 | 3300049460 | Bacteria | 2163 |
| 740 | Ga0501031_0348533 | 3300049568 | Bacteria | 958 |
| 741 | Ga0501031_0353993 | 3300049568 | Bacteria | 950 |
| 742 | Ga0501032_0014636 | 3300049569 | Bacteria | 5556 |
| 743 | Ga0501033_0003525 | 3300049570 | Bacteria | 12801 |
| 744 | Ga0501033_0191861 | 3300049570 | Bacteria | 1462 |
| 745 | Ga0501034_0011514 | 3300049571 | Bacteria | 9167 |
| 746 | Ga0501034_0026323 | 3300049571 | Bacteria | 5924 |
| 747 | Ga0501034_0100582 | 3300049571 | Bacteria | 2885 |
| 748 | Ga0501036_0057240 | 3300049572 | Bacteria | 3302 |
| 749 | Ga0501036_0172827 | 3300049572 | Bacteria | 1820 |
| 750 | Ga0501036_0212426 | 3300049572 | Bacteria | 1625 |
| 751 | Ga0501037_0014971 | 3300049573 | Bacteria | 5704 |
| 752 | Ga0501037_0176446 | 3300049573 | Bacteria | 1517 |
| 753 | Ga0501038_0010109 | 3300049574 | Bacteria | 8638 |
| 754 | Ga0501038_0032236 | 3300049574 | Bacteria | 4624 |
| 755 | Ga0501038_0061390 | 3300049574 | Bacteria | 3214 |
| 756 | Ga0501038_0127784 | 3300049574 | Bacteria | 2090 |
| 757 | Ga0501039_0101097 | 3300049575 | Bacteria | 2250 |
| 758 | Ga0501039_0339674 | 3300049575 | Bacteria | 1180 |
| 759 | Ga0501040_0117720 | 3300049576 | Bacteria | 1862 |
| 760 | Ga0501042_0002545 | 3300049578 | Bacteria | 11215 |
| 761 | Ga0501043_0020509 | 3300049579 | Bacteria | 5185 |
| 762 | Ga0501043_0051339 | 3300049579 | Bacteria | 3240 |
| 763 | Ga0501043_0054115 | 3300049579 | Bacteria | 3151 |
| 764 | Ga0501046_0026634 | 3300049580 | Bacteria | 4722 |
| 765 | Ga0501046_0082467 | 3300049580 | Bacteria | 2483 |
| 766 | Ga0501047_0009908 | 3300049581 | Bacteria | 9009 |
| 767 | Ga0501047_0027170 | 3300049581 | Bacteria | 5512 |
| 768 | Ga0501047_0064552 | 3300049581 | Bacteria | 3531 |
| 769 | Ga0501047_0102168 | 3300049581 | Bacteria | 2746 |
| 770 | Ga0501048_0005496 | 3300049582 | Bacteria | 9642 |
| 771 | Ga0501048_0070461 | 3300049582 | Bacteria | 2469 |
| 772 | Ga0501067_0002825 | 3300049583 | Bacteria | 9556 |
| 773 | Ga0501067_0058453 | 3300049583 | Bacteria | 2136 |
| 774 | Ga0501068_0009793 | 3300049584 | Bacteria | 5369 |
| 775 | Ga0501068_0521638 | 3300049584 | Bacteria | 771 |
| 776 | Ga0501069_0189424 | 3300049585 | Bacteria | 1190 |
| 777 | Ga0501069_0703007 | 3300049585 | Bacteria | 610 |
| 778 | Ga0501070_0026055 | 3300049586 | Bacteria | 4905 |
| 779 | Ga0501070_0467715 | 3300049586 | Bacteria | 1015 |
| 780 | Ga0501071_0748756 | 3300049587 | Bacteria | 753 |
| 781 | Ga0501072_0273977 | 3300049588 | Bacteria | 1342 |
| 782 | Ga0501073_0003590 | 3300049589 | Bacteria | 11666 |
| 783 | Ga0501073_0014548 | 3300049589 | Bacteria | 5716 |
| 784 | Ga0501073_0103295 | 3300049589 | Bacteria | 1979 |
| 785 | Ga0501074_0023865 | 3300049590 | Bacteria | 4445 |
| 786 | Ga0501077_0234769 | 3300049593 | Bacteria | 1166 |
| 787 | Ga0501080_0086024 | 3300049742 | Bacteria | 2921 |
| 788 | Ga0501080_0109870 | 3300049742 | Bacteria | 2555 |
| 789 | Ga0501083_0010499 | 3300049744 | Bacteria | 6517 |
| 790 | Ga0501083_0103698 | 3300049744 | Bacteria | 1874 |
| 791 | Ga0501035_0035212 | 3300049822 | Bacteria | 4544 |
| 792 | Ga0501035_0039873 | 3300049822 | Bacteria | 4247 |
| 793 | Ga0501035_0486858 | 3300049822 | Bacteria | 1017 |
| 794 | Ga0501044_0026586 | 3300049823 | Bacteria | 6125 |
| 795 | Ga0501044_0119620 | 3300049823 | Bacteria | 2636 |
| 796 | Ga0501044_0308943 | 3300049823 | Bacteria | 1508 |
| 797 | Ga0501044_0344200 | 3300049823 | Bacteria | 1411 |
| 798 | Ga0501045_0003604 | 3300049824 | Bacteria | 10638 |
| 799 | Ga0501045_0883285 | 3300049824 | Bacteria | 657 |
| 800 | nmdc:mga03683_32770_c1 | 3300050489 | Bacteria | 2092 |
| 801 | nmdc:mga03n38_378600_c1 | 3300050490 | Bacteria | 775 |
| 802 | nmdc:mga03n38_421976_c1 | 3300050490 | Bacteria | 738 |
| 803 | nmdc:mga00v17_44083_c1 | 3300050491 | Bacteria | 2688 |
| 804 | nmdc:mga0yw44_319739_c1 | 3300050492 | Bacteria | 1042 |
| 805 | nmdc:mga0yw44_488160_c1 | 3300050492 | Bacteria | 836 |
| 806 | nmdc:mga0k408_224991_c1 | 3300050493 | Bacteria | 1120 |
| 807 | nmdc:mga07m45_117152_c1 | 3300050496 | Bacteria | 1537 |
| 808 | nmdc:mga07m45_189786_c1 | 3300050496 | Bacteria | 1195 |
| 809 | nmdc:mga07m45_907212_c1 | 3300050496 | Bacteria | 504 |
| 810 | nmdc:mga05p37_275569_c1 | 3300050507 | Bacteria | 2009 |
| 811 | nmdc:mga06r32_34461_c1 | 3300050510 | Bacteria | 4773 |
| 812 | nmdc:mga08y16_16577_c1 | 3300050511 | Bacteria | 7749 |
| 813 | nmdc:mga0rr50_545692_c1 | 3300050513 | Bacteria | 987 |
| 814 | nmdc:mga0sz30_213409_c1 | 3300050516 | Bacteria | 858 |
| 815 | nmdc:mga0sz30_6906_c2 | 3300050516 | Bacteria | 1626 |
| 816 | nmdc:mga0sz30_96892_c1 | 3300050516 | Bacteria | 1287 |
| 817 | Ga0495601_0022702 | 3300053077 | Bacteria | 3855 |
| 818 | Ga0495601_0028119 | 3300053077 | Bacteria | 3481 |
| 819 | Ga0495601_0257180 | 3300053077 | Bacteria | 1140 |
| 820 | Ga0495601_0334044 | 3300053077 | Bacteria | 986 |
| 821 | Ga0495601_0463950 | 3300053077 | Bacteria | 819 |
| 822 | Ga0495601_0760047 | 3300053077 | Bacteria | 616 |
| 823 | Ga0495612_0027589 | 3300053078 | Bacteria | 2284 |
| 824 | Ga0495612_0055280 | 3300053078 | Bacteria | 1636 |
| 825 | Ga0495612_0078851 | 3300053078 | Bacteria | 1382 |
| 826 | Ga0500635_0109173 | 3300053080 | Bacteria | 1026 |
| 827 | Ga0495595_0002381 | 3300053084 | Bacteria | 7334 |
| 828 | Ga0495595_0092418 | 3300053084 | Bacteria | 1453 |
| 829 | Ga0495595_0420733 | 3300053084 | Bacteria | 678 |
| 830 | Ga0495619_0028465 | 3300053085 | Bacteria | 3605 |
| 831 | Ga0495619_0045807 | 3300053085 | Bacteria | 2874 |
| 832 | Ga0495619_0322085 | 3300053085 | Bacteria | 1070 |
| 833 | Ga0495619_0514515 | 3300053085 | Bacteria | 823 |
| 834 | Ga0495619_0772270 | 3300053085 | Bacteria | 651 |
| 835 | Ga0495619_1116140 | 3300053085 | Bacteria | 524 |
| 836 | Ga0500578_0676117 | 3300053086 | Bacteria | 558 |
| 837 | Ga0500643_000062 | 3300053087 | Bacteria | 122407 |
| 838 | Ga0500644_0154461 | 3300053088 | Bacteria | 923 |
| 839 | Ga0500646_0261983 | 3300053090 | Bacteria | 611 |
| 840 | Ga0500647_0084525 | 3300053091 | Bacteria | 1522 |
| 841 | Ga0500647_0315562 | 3300053091 | Bacteria | 663 |
| 842 | Ga0500583_0147721 | 3300053092 | Bacteria | 1169 |
| 843 | Ga0500651_0073134 | 3300053093 | Bacteria | 2131 |
| 844 | Ga0500651_0673923 | 3300053093 | Bacteria | 555 |
| 845 | Ga0500566_0009283 | 3300053094 | Bacteria | 5816 |
| 846 | Ga0500566_0062595 | 3300053094 | Bacteria | 2103 |
| 847 | Ga0500566_0190275 | 3300053094 | Bacteria | 1045 |
| 848 | Ga0500640_205624 | 3300053095 | Bacteria | 682 |
| 849 | Ga0500650_0182646 | 3300053098 | Bacteria | 961 |
| 850 | Ga0500553_268591 | 3300053101 | Bacteria | 500 |
| 851 | Ga0500555_064463 | 3300053103 | Bacteria | 978 |
| 852 | Ga0500556_0062248 | 3300053104 | Bacteria | 1376 |
| 853 | Ga0500556_0349535 | 3300053104 | Bacteria | 572 |
| 854 | Ga0500557_000043 | 3300053105 | Bacteria | 63389 |
| 855 | Ga0500569_006585 | 3300053109 | Bacteria | 2558 |
| 856 | Ga0500569_035234 | 3300053109 | Bacteria | 1434 |
| 857 | Ga0500595_003786 | 3300053119 | Bacteria | 6958 |
| 858 | Ga0500607_048744 | 3300053121 | Bacteria | 2263 |
| 859 | Ga0500608_013748 | 3300053122 | Bacteria | 3596 |
| 860 | Ga0500608_038663 | 3300053122 | Bacteria | 2283 |
| 861 | Ga0500642_0000193 | 3300053130 | Bacteria | 24969 |
| 862 | Ga0500642_0021444 | 3300053130 | Bacteria | 2559 |
| 863 | Ga0500652_123749 | 3300053131 | Bacteria | 1081 |
| 864 | Ga0500655_008973 | 3300053133 | Bacteria | 1799 |
| 865 | Ga0500658_0030957 | 3300053134 | Bacteria | 2091 |
| 866 | Ga0500559_0031651 | 3300053136 | Bacteria | 2269 |
| 867 | Ga0500559_0336124 | 3300053136 | Bacteria | 707 |
| 868 | Ga0500568_0012024 | 3300053139 | Bacteria | 3990 |
| 869 | Ga0500577_0020288 | 3300053142 | Bacteria | 2171 |
| 870 | Ga0500585_073008 | 3300053144 | Bacteria | 1239 |
| 871 | Ga0500588_0356508 | 3300053146 | Bacteria | 556 |
| 872 | Ga0500590_182459 | 3300053148 | Bacteria | 909 |
| 873 | Ga0500604_0049520 | 3300053151 | Bacteria | 1292 |
| 874 | Ga0500616_0122149 | 3300053153 | Bacteria | 1242 |
| 875 | Ga0500619_007273 | 3300053154 | Bacteria | 2611 |
| 876 | Ga0500620_015171 | 3300053155 | Bacteria | 2172 |
| 877 | Ga0500622_0063052 | 3300053156 | Bacteria | 1887 |
| 878 | Ga0500624_008204 | 3300053157 | Bacteria | 1458 |
| 879 | Ga0500627_0084741 | 3300053158 | Bacteria | 1415 |
| 880 | Ga0500634_0090295 | 3300053161 | Bacteria | 1557 |
| 881 | Ga0500638_059449 | 3300053162 | Bacteria | 1838 |
| 882 | Ga0500639_232946 | 3300053163 | Bacteria | 756 |
| 883 | Ga0500639_274070 | 3300053163 | Bacteria | 656 |
| 884 | Ga0500636_0000075 | 3300053177 | Bacteria | 48415 |
| 885 | Ga0500636_0167194 | 3300053177 | Bacteria | 1193 |
| 886 | Ga0500625_000791 | 3300053729 | Bacteria | 9601 |
| 887 | Ga0500645_036548 | 3300053730 | Bacteria | 1461 |
| 888 | Ga0500599_001855 | 3300053736 | Bacteria | 2489 |
| 889 | Ga0501084_0326673 | 3300054114 | Bacteria | 1296 |
| 890 | Ga0501084_0732055 | 3300054114 | Bacteria | 834 |
| 891 | Ga0587073_0080212 | 3300059492 | Bacteria | 808 |
| 892 | Ga0501082_0014060 | 3300060353 | Bacteria | 6884 |
| 893 | Ga0466962_0052885 | 3300061719 | Bacteria | 1941 |
| 894 | Ga0466962_0272532 | 3300061719 | Bacteria | 834 |
| 895 | 2507504842 | 2507262055 | Bacteria | 8048963 |
| 896 | 2508546197 | 2508501009 | Bacteria | 7784016 |
| 897 | 2508695129 | 2508501042 | Bacteria | 8719808 |
| 898 | 2511395455 | 2511231028 | Bacteria | 8046582 |
| 899 | 2513625424 | 2513237092 | Bacteria | 8341956 |
| 900 | 2513639553 | 2513237094 | Bacteria | 8789602 |
| 901 | 2513703351 | 2513237102 | Bacteria | 7703324 |
| 902 | 2513715708 | 2513237104 | Bacteria | 10034502 |
| 903 | 2513873914 | 2513237139 | Bacteria | 8737671 |
| 904 | 2514012887 | 2513237161 | Bacteria | 8871253 |
| 905 | 2515625865 | 2515154112 | Bacteria | 8294334 |
| 906 | 2524435743 | 2524023205 | Bacteria | 8918781 |
| 907 | 2545677467 | 2545555834 | Bacteria | 8130841 |
| 908 | 2617351700 | 2617270735 | Bacteria | 9163226 |
| 909 | 2617377248 | 2617270741 | Bacteria | 8201522 |
| 910 | 2745079039 | 2744054633 | Bacteria | 8678936 |
| 911 | 2793066047 | 2791355196 | Bacteria | 7323613 |
| 912 | 2805915997 | 2802429603 | Bacteria | 8777136 |
| 913 | 2824602574 | 2824600985 | Bacteria | 8488197 |
| 914 | 2824612646 | 2824609381 | Bacteria | 8672835 |
| 915 | 2824621108 | 2824617872 | Bacteria | 8814715 |
| 916 | 2824630115 | 2824626560 | Bacteria | 8813858 |
| 917 | 2824640730 | 2824635225 | Bacteria | 8785348 |
| 918 | 2824649823 | 2824644064 | Bacteria | 8743947 |
| 919 | 2824654461 | 2824653114 | Bacteria | 8493680 |
| 920 | 2824674855 | 2824671348 | Bacteria | 8369588 |
| 921 | 2824683558 | 2824679649 | Bacteria | 8248951 |
| 922 | 2824691923 | 2824687955 | Bacteria | 8360029 |
| 923 | 2824697652 | 2824696289 | Bacteria | 8335049 |
| 924 | 2824709661 | 2824704595 | Bacteria | 9667483 |
| 925 | 2824719828 | 2824714736 | Bacteria | 8717648 |
| 926 | 2824727932 | 2824723954 | Bacteria | 8758240 |
| 927 | 2824736249 | 2824732956 | Bacteria | 7810675 |
| 928 | 2824750285 | 2824746037 | Bacteria | 7911610 |
| 929 | 2824757115 | 2824753945 | Bacteria | 9787441 |
| 930 | 2824768451 | 2824763712 | Bacteria | 9792355 |
| 931 | 2824774944 | 2824773399 | Bacteria | 8360218 |
| 932 | 2838131017 | 2838122688 | Bacteria | 8803140 |
| 933 | 2841944458 | 2841941048 | Bacteria | 8688029 |
| 934 | 2841951599 | 2841949485 | Bacteria | 8680857 |
| 935 | 2841969235 | 2841966195 | Bacteria | 8673214 |
| 936 | 2841982900 | 2841974524 | Bacteria | 8931498 |
| 937 | 2841991018 | 2841983080 | Bacteria | 8395090 |
| 938 | 2842043884 | 2842038055 | Bacteria | 8002051 |
| 939 | 2842052126 | 2842045827 | Bacteria | 8006841 |
| 940 | 2844321822 | 2844315083 | Bacteria | 8138177 |
| 941 | 2847931470 | 2847930680 | Bacteria | 9342022 |
| 942 | 2847941752 | 2847939898 | Bacteria | 8606328 |
| 943 | 2857511567 | 2857509624 | Bacteria | 7472071 |
| 944 | 2874596836 | 2874590934 | Bacteria | 8299676 |
| 945 | 2874624420 | 2874620515 | Bacteria | 8290088 |
| 946 | 2874636707 | 2874628541 | Bacteria | 8630250 |
| 947 | 2874648641 | 2874645413 | Bacteria | 8214782 |
| 948 | 2876766414 | 2876761206 | Bacteria | 10111113 |
| 949 | 2876777300 | 2876771140 | Bacteria | 8287509 |
| 950 | 2876825382 | 2876818435 | Bacteria | 8274608 |
| 951 | 2879077631 | 2879074833 | Bacteria | 8279565 |
| 952 | 2879087493 | 2879083081 | Bacteria | 8587928 |
| 953 | 2879107224 | 2879099564 | Bacteria | 10442239 |
| 954 | 2879127661 | 2879127579 | Bacteria | 8294491 |
| 955 | 2879146066 | 2879142872 | Bacteria | 8267021 |
| 956 | 2881371003 | 2881364244 | Bacteria | 7710352 |
| 957 | 2881665695 | 2881665667 | Bacteria | 8175609 |
| 958 | 2885371400 | 2885366525 | Bacteria | 8326213 |
| 959 | 2888420773 | 2888419890 | Bacteria | 7857137 |
| 960 | 2903727628 | 2903727486 | Bacteria | 8281579 |
| 961 | 2904672241 | 2904666416 | Bacteria | 8226587 |
| 962 | 2904716182 | 2904711408 | Bacteria | 9771557 |
| 963 | 2906602882 | 2906602504 | Bacteria | 8295279 |
| 964 | 2906633525 | 2906626472 | Bacteria | 8826946 |
| 965 | 2906647590 | 2906643746 | Bacteria | 8722424 |
| 966 | 2908775764 | 2908775508 | Bacteria | 8092255 |
| 967 | 2922400798 | 2922393267 | Bacteria | 8285685 |
| 968 | 2932794687 | 2932794094 | Bacteria | 7915132 |
| 969 | 2932805502 | 2932801729 | Bacteria | 7987968 |
| 970 | 2932812580 | 2932809354 | Bacteria | 9135765 |
| 971 | 2932822942 | 2932818245 | Bacteria | 9955613 |
| 972 | 2935614959 | 2935608549 | Bacteria | 8203142 |
| 973 | 2935652986 | 2935648319 | Bacteria | 8801166 |
| 974 | 2935661569 | 2935656913 | Bacteria | 8965014 |
| 975 | 2935689588 | 2935684952 | Bacteria | 9590419 |
| 976 | 2935717107 | 2935713505 | Bacteria | 9608509 |
| 977 | 2935730059 | 2935722832 | Bacteria | 9608746 |
| 978 | 2935738522 | 2935732158 | Bacteria | 9706831 |
| 979 | 2935749230 | 2935741537 | Bacteria | 9707219 |
| 980 | 2935756941 | 2935750917 | Bacteria | 9590372 |
| 981 | 2935764445 | 2935760218 | Bacteria | 9817913 |
| 982 | 2935772772 | 2935769743 | Bacteria | 7878163 |
| 983 | 2935778091 | 2935777560 | Bacteria | 8077691 |
| 984 | 2935787319 | 2935785616 | Bacteria | 7962367 |
| 985 | 2935795893 | 2935793552 | Bacteria | 8012592 |
| 986 | 2935826002 | 2935819856 | Bacteria | 8261050 |
| 987 | 2935851621 | 2935847175 | Bacteria | 8228321 |
| 988 | 2935888901 | 2935883170 | Bacteria | 7964738 |
| 989 | 2935910357 | 2935908558 | Bacteria | 8568796 |
| 990 | 2935918357 | 2935916978 | Bacteria | 9113783 |
| 991 | 2935927732 | 2935926038 | Bacteria | 8601059 |
| 992 | 2935936396 | 2935934488 | Bacteria | 8602579 |
| 993 | 2935944051 | 2935942939 | Bacteria | 8599779 |
| 994 | 2935952488 | 2935951376 | Bacteria | 8602333 |
| 995 | 2935969328 | 2935967501 | Bacteria | 8603075 |
| 996 | 2935977907 | 2935975950 | Bacteria | 8347125 |
| 997 | 2935984789 | 2935984226 | Bacteria | 8302647 |
| 998 | 2936015702 | 2936011229 | Bacteria | 8801034 |
| 999 | 2936024336 | 2936019824 | Bacteria | 8804134 |
| 1000 | 2936031777 | 2936028420 | Bacteria | 8965941 |
| 1001 | 2936051599 | 2936046547 | Bacteria | 8903709 |
| 1002 | 2936055960 | 2936055302 | Bacteria | 8785755 |
| 1003 | 2940562855 | 2940556831 | Bacteria | 9590747 |
| 1004 | 2941532353 | 2941531003 | Bacteria | 7653939 |
| 1005 | 3005486418 | 3005483717 | Bacteria | 7877331 |
| 1006 | 3005509546 | 3005506211 | Bacteria | 6943378 |
| 1007 | 3005589021 | 3005587118 | Bacteria | 7794411 |
| 1008 | 3005602170 | 3005594810 | Bacteria | 8716512 |
| 1009 | 641640484 | 641522639 | Bacteria | 7737025 |
| 1010 | 8006929778 | 8006926726 | Bacteria | 6749210 |
| 1011 | 8016526598 | 8016522445 | Bacteria | 8156687 |
| 1012 | 8016531683 | 8016530956 | Bacteria | 8155261 |
| 1013 | 8016544881 | 8016539877 | Bacteria | 8155419 |
| 1014 | 8016557195 | 8016548790 | Bacteria | 8155074 |
| 1015 | 8016565547 | 8016557553 | Bacteria | 8154380 |
| 1016 | 8016569952 | 8016566248 | Bacteria | 8158151 |
| 1017 | 8016582531 | 8016575299 | Bacteria | 8154085 |
| 1018 | 8016586811 | 8016583857 | Bacteria | 10421953 |
| 1019 | 8016603165 | 8016595262 | Bacteria | 8149947 |
| 1020 | 8016617964 | 8016613128 | Bacteria | 8794220 |
| 1021 | 8016623608 | 8016622563 | Bacteria | 7999408 |
| 1022 | 8016636087 | 8016630954 | Bacteria | 9217207 |
| 1023 | 8019531505 | 8019530166 | Bacteria | 8155624 |
| 1024 | 8019540027 | 8019538911 | Bacteria | 7872763 |
| 1025 | 8019550629 | 8019547302 | Bacteria | 7996444 |
| 1026 | 8019622556 | 8019619141 | Bacteria | 9218857 |
| 1027 | 8019630557 | 8019629233 | Bacteria | 8687553 |
| 1028 | 8019640056 | 8019638758 | Bacteria | 9062356 |
| 1029 | 8019652878 | 8019648815 | Bacteria | 10014479 |
| 1030 | 8019667383 | 8019659431 | Bacteria | 8577854 |
| 1031 | 8019677157 | 8019668869 | Bacteria | 8791617 |
| 1032 | 8019678828 | 8019678201 | Bacteria | 8863603 |
| 1033 | 8019696704 | 8019687851 | Bacteria | 8712826 |
| 1034 | 8056970915 | 8056967851 | Bacteria | 9038162 |
| 1035 | Ga0373956_0192413 | |||
| 1036 | JGI24735J21928_10046787 | |||
| 1037 | JGI25153J46596_10009968 | |||
| 1038 | JGI25160J50197_1011437 | |||
| 1039 | JGI25160J50197_1014777 | |||
| 1040 | JGI25404J52841_10037927 | |||
| 1041 | Ga0055526_1036204 | |||
| 1042 | Ga0055531_10002401 | |||
| 1043 | Ga0065165_1002203 | |||
| 1044 | Ga0070658_10080003 | |||
| 1045 | Ga0070658_10083289 | |||
| 1046 | Ga0070683_100034716 | |||
| 1047 | Ga0070683_100385832 | |||
| 1048 | Ga0070683_100388065 | |||
| 1049 | Ga0070670_100007013 | |||
| 1050 | Ga0068869_100529986 | |||
| 1051 | Ga0068869_101696173 | |||
| 1052 | Ga0070680_100007037 | |||
| 1053 | Ga0070680_100039194 | |||
| 1054 | Ga0070680_100063582 | |||
| 1055 | Ga0070680_100107970 | |||
| 1056 | Ga0070680_100159102 | |||
| 1057 | Ga0070680_100287225 | |||
| 1058 | Ga0070680_100494015 | |||
| 1059 | Ga0070682_100215967 | |||
| 1060 | Ga0070660_100052586 | |||
| 1061 | Ga0070660_100119833 | |||
| 1062 | Ga0070660_100467204 | |||
| 1063 | Ga0070660_100754671 | |||
| 1064 | Ga0070689_101463685 | |||
| 1065 | Ga0070691_10044183 | |||
| 1066 | Ga0070661_100079432 | |||
| 1067 | Ga0070661_100250111 | |||
| 1068 | Ga0070661_100587109 | |||
| 1069 | Ga0070661_101827132 | |||
| 1070 | Ga0070668_100755632 | |||
| 1071 | Ga0070671_100956149 | |||
| 1072 | Ga0070674_101139768 | |||
| 1073 | Ga0070659_100014636 | |||
| 1074 | Ga0070659_100397031 | |||
| 1075 | Ga0070659_101082549 | |||
| 1076 | Ga0070667_100209966 | |||
| 1077 | Ga0070709_10000732 | |||
| 1078 | Ga0070709_10015576 | |||
| 1079 | Ga0070709_11179763 | |||
| 1080 | Ga0070714_100001031 | |||
| 1081 | Ga0070714_100007289 | |||
| 1082 | Ga0070714_100017631 | |||
| 1083 | Ga0070714_100056302 | |||
| 1084 | Ga0070714_100267804 | |||
| 1085 | Ga0070714_100348673 | |||
| 1086 | Ga0070714_101161618 | |||
| 1087 | Ga0070713_100000447 | |||
| 1088 | Ga0070713_100014459 | |||
| 1089 | Ga0070713_100033021 | |||
| 1090 | Ga0070713_100108431 | |||
| 1091 | Ga0070713_100194115 | |||
| 1092 | Ga0070713_100394312 | |||
| 1093 | Ga0070713_100964540 | |||
| 1094 | Ga0070713_101067179 | |||
| 1095 | Ga0070710_10000211 | |||
| 1096 | Ga0070710_10002104 | |||
| 1097 | Ga0070710_10012645 | |||
| 1098 | Ga0070710_10212472 | |||
| 1099 | Ga0070711_100001113 | |||
| 1100 | Ga0070711_100005283 | |||
| 1101 | Ga0070711_100070596 | |||
| 1102 | Ga0070711_100735284 | |||
| 1103 | Ga0070711_100845004 | |||
| 1104 | Ga0070711_100958118 | |||
| 1105 | Ga0070711_101209439 | |||
| 1106 | Ga0070711_101976294 | |||
| 1107 | Ga0070700_100605463 | |||
| 1108 | Ga0070663_100312448 | |||
| 1109 | Ga0070663_100479318 | |||
| 1110 | Ga0070662_101624324 | |||
| 1111 | Ga0070681_10016067 | |||
| 1112 | Ga0070681_10028615 | |||
| 1113 | Ga0070681_10029541 | |||
| 1114 | Ga0070681_10215626 | |||
| 1115 | Ga0070681_10332311 | |||
| 1116 | Ga0070681_10668688 | |||
| 1117 | Ga0070681_10974112 | |||
| 1118 | Ga0068867_101125393 | |||
| 1119 | Ga0070706_100257254 | |||
| 1120 | Ga0070698_101773412 | |||
| 1121 | Ga0070679_100022723 | |||
| 1122 | Ga0070679_100053904 | |||
| 1123 | Ga0070679_100169103 | |||
| 1124 | Ga0070679_100339038 | |||
| 1125 | Ga0070679_100412036 | |||
| 1126 | Ga0070679_100665422 | |||
| 1127 | Ga0070679_101853197 | |||
| 1128 | Ga0070684_100003114 | |||
| 1129 | Ga0070684_100006418 | |||
| 1130 | Ga0070684_100094412 | |||
| 1131 | Ga0070684_100203280 | |||
| 1132 | Ga0070684_101088044 | |||
| 1133 | Ga0068853_100191889 | |||
| 1134 | Ga0068853_100333858 | |||
| 1135 | Ga0068853_100436256 | |||
| 1136 | Ga0068853_101010756 | |||
| 1137 | Ga0070693_100396262 | |||
| 1138 | Ga0070665_100204613 | |||
| 1139 | Ga0068855_100001526 | |||
| 1140 | Ga0068855_100049831 | |||
| 1141 | Ga0068855_100077550 | |||
| 1142 | Ga0068855_100763796 | |||
| 1143 | Ga0068855_101132127 | |||
| 1144 | Ga0068855_101168190 | |||
| 1145 | Ga0068855_101700242 | |||
| 1146 | Ga0068855_102069546 | |||
| 1147 | Ga0068855_102312343 | |||
| 1148 | Ga0070664_100061476 | |||
| 1149 | Ga0070664_100123146 | |||
| 1150 | Ga0070664_101459994 | |||
| 1151 | Ga0068857_100066062 | |||
| 1152 | Ga0068857_100089840 | |||
| 1153 | Ga0068857_101790586 | |||
| 1154 | Ga0068854_100976138 | |||
| 1155 | Ga0068854_101140289 | |||
| 1156 | Ga0068856_100026292 | |||
| 1157 | Ga0068856_100078422 | |||
| 1158 | Ga0068856_100104868 | |||
| 1159 | Ga0068856_100915212 | |||
| 1160 | Ga0068856_101645418 | |||
| 1161 | Ga0068856_101660498 | |||
| 1162 | Ga0068852_100016368 | |||
| 1163 | Ga0068852_100105735 | |||
| 1164 | Ga0068852_100155708 | |||
| 1165 | Ga0068852_100327923 | |||
| 1166 | Ga0068852_100597992 | |||
| 1167 | Ga0068852_100710594 | |||
| 1168 | Ga0068852_102446989 | |||
| 1169 | Ga0068864_100175152 | |||
| 1170 | Ga0068851_10298551 | |||
| 1171 | Ga0068858_100131521 | |||
| 1172 | Ga0081455_10663430 | |||
| 1173 | Ga0081540_1029964 | |||
| 1174 | Ga0070717_10004501 | |||
| 1175 | Ga0070717_10021088 | |||
| 1176 | Ga0070717_10029633 | |||
| 1177 | Ga0070717_10065910 | |||
| 1178 | Ga0070717_10346459 | |||
| 1179 | Ga0075365_10015761 | |||
| 1180 | Ga0075365_10745473 | |||
| 1181 | Ga0075365_10892850 | |||
| 1182 | Ga0075363_100510595 | |||
| 1183 | Ga0075364_10156016 | |||
| 1184 | Ga0075432_10388516 | |||
| 1185 | Ga0070715_10003014 | |||
| 1186 | Ga0070715_10104459 | |||
| 1187 | Ga0070715_10153093 | |||
| 1188 | Ga0070716_100001713 | |||
| 1189 | Ga0070716_100023180 | |||
| 1190 | Ga0070716_101589397 | |||
| 1191 | Ga0070712_100014263 | |||
| 1192 | Ga0070712_100035189 | |||
| 1193 | Ga0070712_100435800 | |||
| 1194 | Ga0075362_10060470 | |||
| 1195 | Ga0075367_10193340 | |||
| 1196 | Ga0075369_10023867 | |||
| 1197 | Ga0075369_10024161 | |||
| 1198 | Ga0075369_10126448 | |||
| 1199 | Ga0075369_10245709 | |||
| 1200 | Ga0075366_10046585 | |||
| 1201 | Ga0075370_10004474 | |||
| 1202 | Ga0075370_10075418 | |||
| 1203 | Ga0075370_10336246 | |||
| 1204 | Ga0068871_101288770 | |||
| 1205 | Ga0075428_100043728 | |||
| 1206 | Ga0075431_100060080 | |||
| 1207 | Ga0075434_100083024 | |||
| 1208 | Ga0099825_1025118 | |||
| 1209 | Ga0099824_1007096 | |||
| 1210 | Ga0099823_1014418 | |||
| 1211 | Ga0099794_10136207 | |||
| 1212 | Ga0099795_10461240 | |||
| 1213 | Ga0105244_10462639 | |||
| 1214 | Ga0105240_10018842 | |||
| 1215 | Ga0105240_10027377 | |||
| 1216 | Ga0105240_10060502 | |||
| 1217 | Ga0105240_10131811 | |||
| 1218 | Ga0111539_10008587 | |||
| 1219 | Ga0105245_11036116 | |||
| 1220 | Ga0105245_11866913 | |||
| 1221 | Ga0105247_10121871 | |||
| 1222 | Ga0105247_11306263 | |||
| 1223 | Ga0114129_10049105 | |||
| 1224 | Ga0105241_10012706 | |||
| 1225 | Ga0105241_10908967 | |||
| 1226 | Ga0105241_11189511 | |||
| 1227 | Ga0105241_11621052 | |||
| 1228 | Ga0105241_12698217 | |||
| 1229 | Ga0105248_10889387 | |||
| 1230 | Ga0105248_13424008 | |||
| 1231 | Ga0105237_10003797 | |||
| 1232 | Ga0105237_10239142 | |||
| 1233 | Ga0105237_10242500 | |||
| 1234 | Ga0105238_10084387 | |||
| 1235 | Ga0105238_10106905 | |||
| 1236 | Ga0105238_11107804 | |||
| 1237 | Ga0105238_11331907 | |||
| 1238 | Ga0105238_11353923 | |||
| 1239 | Ga0099796_10003072 | |||
| 1240 | Ga0105239_10031844 | |||
| 1241 | Ga0105239_10101474 | |||
| 1242 | Ga0105239_10127791 | |||
| 1243 | Ga0105239_10310549 | |||
| 1244 | Ga0105239_10503853 | |||
| 1245 | Ga0105239_10780972 | |||
| 1246 | Ga0105239_10791648 | |||
| 1247 | Ga0105246_10149093 | |||
| 1248 | Ga0157373_10114461 | |||
| 1249 | Ga0157373_10740066 | |||
| 1250 | Ga0157371_10205462 | |||
| 1251 | Ga0157371_10712289 | |||
| 1252 | Ga0157371_11025363 | |||
| 1253 | Ga0157371_11085464 | |||
| 1254 | Ga0157370_10025966 | |||
| 1255 | Ga0157370_10066941 | |||
| 1256 | Ga0157370_10514053 | |||
| 1257 | Ga0157370_10670535 | |||
| 1258 | Ga0157370_11052988 | |||
| 1259 | Ga0157370_11364596 | |||
| 1260 | Ga0157369_10008800 | |||
| 1261 | Ga0157369_10028904 | |||
| 1262 | Ga0157369_10158242 | |||
| 1263 | Ga0157369_10466618 | |||
| 1264 | Ga0157369_10631815 | |||
| 1265 | Ga0157369_10947544 | |||
| 1266 | Ga0157378_10307502 | |||
| 1267 | Ga0157378_10314333 | |||
| 1268 | Ga0157378_12963366 | |||
| 1269 | Ga0163162_10162491 | |||
| 1270 | Ga0163162_11387568 | |||
| 1271 | Ga0157372_10586480 | |||
| 1272 | Ga0157372_10707342 | |||
| 1273 | Ga0157372_10762867 | |||
| 1274 | Ga0157372_10880013 | |||
| 1275 | Ga0157372_11147969 | |||
| 1276 | Ga0157372_13124524 | |||
| 1277 | Ga0157375_10676498 | |||
| 1278 | Ga0157375_11302615 | |||
| 1279 | Ga0163163_10416594 | |||
| 1280 | Ga0157376_10278601 | |||
| 1281 | Ga0206353_10012434 | |||
| 1282 | Ga0206353_10881856 | |||
| 1283 | Ga0214544_1000087 | |||
| 1284 | Ga0214542_1000018 | |||
| 1285 | Ga0214545_1000009 | |||
| 1286 | Ga0214545_1044404 | |||
| 1287 | Ga0213872_10083520 | |||
| 1288 | Ga0213872_10129478 | |||
| 1289 | Ga0213874_10055189 | |||
| 1290 | Ga0213876_10508329 | |||
| 1291 | Ga0224712_10524294 | |||
| 1292 | Ga0207425_1014749 | |||
| 1293 | Ga0209148_1000694 | |||
| 1294 | Ga0209233_1023038 | |||
| 1295 | Ga0209233_1037703 | |||
| 1296 | Ga0209455_1050266 | |||
| 1297 | Ga0209673_1067002 | |||
| 1298 | Ga0209564_1006358 | |||
| 1299 | Ga0209564_1009222 | |||
| 1300 | Ga0209758_1000015 | |||
| 1301 | Ga0209758_1000224 | |||
| 1302 | Ga0209758_1000972 | |||
| 1303 | Ga0209758_1005118 | |||
| 1304 | Ga0209758_1095316 | |||
| 1305 | Ga0209758_1124406 | |||
| 1306 | Ga0209256_1004825 | |||
| 1307 | Ga0209256_1026895 | |||
| 1308 | Ga0207426_1000201 | |||
| 1309 | Ga0207426_1000617 | |||
| 1310 | Ga0207426_1007359 | |||
| 1311 | Ga0207426_1040679 | |||
| 1312 | Ga0209051_1081462 | |||
| 1313 | Ga0209257_1000440 | |||
| 1314 | Ga0207656_10211783 | |||
| 1315 | Ga0207692_10000494 | |||
| 1316 | Ga0207692_10025046 | |||
| 1317 | Ga0207692_10576400 | |||
| 1318 | Ga0207692_10624337 | |||
| 1319 | Ga0207647_10250617 | |||
| 1320 | Ga0207685_10111943 | |||
| 1321 | Ga0207685_10169865 | |||
| 1322 | Ga0207699_10000480 | |||
| 1323 | Ga0207699_10032324 | |||
| 1324 | Ga0207699_10052435 | |||
| 1325 | Ga0207699_10894648 | |||
| 1326 | Ga0207705_10015389 | |||
| 1327 | Ga0207705_10033765 | |||
| 1328 | Ga0207705_10046309 | |||
| 1329 | Ga0207705_10068845 | |||
| 1330 | Ga0207705_10427929 | |||
| 1331 | Ga0207684_10217689 | |||
| 1332 | Ga0207654_10007752 | |||
| 1333 | Ga0207707_10075803 | |||
| 1334 | Ga0207707_10169698 | |||
| 1335 | Ga0207707_10204609 | |||
| 1336 | Ga0207707_11014086 | |||
| 1337 | Ga0207695_10000065 | |||
| 1338 | Ga0207695_10181364 | |||
| 1339 | Ga0207695_10402757 | |||
| 1340 | Ga0207695_10868876 | |||
| 1341 | Ga0207671_10001858 | |||
| 1342 | Ga0207671_10065742 | |||
| 1343 | Ga0207671_10081338 | |||
| 1344 | Ga0207671_10691996 | |||
| 1345 | Ga0207693_10010321 | |||
| 1346 | Ga0207693_10014578 | |||
| 1347 | Ga0207693_10027366 | |||
| 1348 | Ga0207663_10000356 | |||
| 1349 | Ga0207663_10003833 | |||
| 1350 | Ga0207663_10226813 | |||
| 1351 | Ga0207663_11324839 | |||
| 1352 | Ga0207660_10041607 | |||
| 1353 | Ga0207660_10043493 | |||
| 1354 | Ga0207660_10063865 | |||
| 1355 | Ga0207660_10066782 | |||
| 1356 | Ga0207660_10117379 | |||
| 1357 | Ga0207660_10145108 | |||
| 1358 | Ga0207660_10181152 | |||
| 1359 | Ga0207660_10759207 | |||
| 1360 | Ga0207660_11447927 | |||
| 1361 | Ga0207657_10022149 | |||
| 1362 | Ga0207657_10026499 | |||
| 1363 | Ga0207657_10416282 | |||
| 1364 | Ga0207657_10818821 | |||
| 1365 | Ga0207649_10287197 | |||
| 1366 | Ga0207649_10655828 | |||
| 1367 | Ga0207649_10763263 | |||
| 1368 | Ga0207652_10024203 | |||
| 1369 | Ga0207652_10084924 | |||
| 1370 | Ga0207652_10097084 | |||
| 1371 | Ga0207652_10124179 | |||
| 1372 | Ga0207652_10175619 | |||
| 1373 | Ga0207652_10180971 | |||
| 1374 | Ga0207652_11789221 | |||
| 1375 | Ga0207694_10086964 | |||
| 1376 | Ga0207694_11099881 | |||
| 1377 | Ga0207650_10004408 | |||
| 1378 | Ga0207700_10005911 | |||
| 1379 | Ga0207700_10009620 | |||
| 1380 | Ga0207700_10096308 | |||
| 1381 | Ga0207700_10101814 | |||
| 1382 | Ga0207700_10158437 | |||
| 1383 | Ga0207700_10384761 | |||
| 1384 | Ga0207700_11149614 | |||
| 1385 | Ga0207664_10020450 | |||
| 1386 | Ga0207664_10055501 | |||
| 1387 | Ga0207664_10061817 | |||
| 1388 | Ga0207664_10078039 | |||
| 1389 | Ga0207664_10310142 | |||
| 1390 | Ga0207664_10328088 | |||
| 1391 | Ga0207664_11937042 | |||
| 1392 | Ga0207644_10672086 | |||
| 1393 | Ga0207690_10147252 | |||
| 1394 | Ga0207709_11145062 | |||
| 1395 | Ga0207670_10864786 | |||
| 1396 | Ga0207665_10000289 | |||
| 1397 | Ga0207665_10001832 | |||
| 1398 | Ga0207665_10184275 | |||
| 1399 | Ga0207665_10197567 | |||
| 1400 | Ga0207711_10614311 | |||
| 1401 | Ga0207661_10000678 | |||
| 1402 | Ga0207661_10029561 | |||
| 1403 | Ga0207661_10487791 | |||
| 1404 | Ga0207679_11368932 | |||
| 1405 | Ga0207667_10047269 | |||
| 1406 | Ga0207667_10083387 | |||
| 1407 | Ga0207667_10101848 | |||
| 1408 | Ga0207667_10134295 | |||
| 1409 | Ga0207667_10176109 | |||
| 1410 | Ga0207667_10711926 | |||
| 1411 | Ga0207667_11203977 | |||
| 1412 | Ga0207668_11783044 | |||
| 1413 | Ga0207640_10742549 | |||
| 1414 | Ga0207640_10968623 | |||
| 1415 | Ga0207640_11117153 | |||
| 1416 | Ga0207658_10943638 | |||
| 1417 | Ga0207677_11003656 | |||
| 1418 | Ga0207677_11938672 | |||
| 1419 | Ga0207703_10341875 | |||
| 1420 | Ga0207639_10086437 | |||
| 1421 | Ga0207639_10618708 | |||
| 1422 | Ga0207639_10621331 | |||
| 1423 | Ga0207678_10375540 | |||
| 1424 | Ga0207678_10391839 | |||
| 1425 | Ga0207678_10525310 | |||
| 1426 | Ga0207702_10063731 | |||
| 1427 | Ga0207702_10103590 | |||
| 1428 | Ga0207702_10186579 | |||
| 1429 | Ga0207702_10214872 | |||
| 1430 | Ga0207702_10845533 | |||
| 1431 | Ga0207702_11107406 | |||
| 1432 | Ga0207674_10064038 | |||
| 1433 | Ga0207674_10068834 | |||
| 1434 | Ga0207698_10069481 | |||
| 1435 | Ga0207698_10071309 | |||
| 1436 | Ga0207698_10190020 | |||
| 1437 | Ga0207698_10617722 | |||
| 1438 | Ga0207698_10699725 | |||
| 1439 | Ga0207698_10753643 | |||
| 1440 | Ga0209389_1000029 | |||
| 1441 | Ga0209389_1000076 | |||
| 1442 | Ga0209589_1000012 | |||
| 1443 | Ga0209589_1000013 | |||
| 1444 | Ga0209489_100013 | |||
| 1445 | Ga0209489_100416 | |||
| 1446 | Ga0209700_100014 | |||
| 1447 | Ga0207428_10085071 | |||
| 1448 | Ga0268266_10212046 | |||
| 1449 | Ga0265338_10019779 | |||
| 1450 | Ga0265338_10165592 | |||
| 1451 | Ga0265338_10269323 | |||
| 1452 | Ga0265773_1026883 | |||
| 1453 | Ga0265330_10006264 | |||
| 1454 | Ga0265325_10309681 | |||
| 1455 | Ga0265339_10047735 | |||
| 1456 | Ga0265313_10007846 | |||
| 1457 | Ga0265313_10023026 | |||
| 1458 | Ga0265313_10071548 | |||
| 1459 | Ga0307508_10000005 | |||
| 1460 | Ga0307508_10426850 | |||
| 1461 | Ga0265314_10066904 | |||
| 1462 | Ga0265342_10000082 | |||
| 1463 | Ga0265342_10026636 | |||
| 1464 | Ga0307510_10007616 | |||
| 1465 | Ga0307510_10121436 | |||
| 1466 | Ga0373934_0163106 | |||
| 1467 | Ga0373944_0183305 | |||
| 1468 | Ga0373923_0137515 | |||
| 1469 | Ga0373945_0079344 | |||
| 1470 | Ga0373953_0080293 | |||
| 1471 | Ga0373954_0024158 | |||
| 1472 | Ga0373954_0263423 | |||
| 1473 | Ga0373956_0163722 | |||
| 1474 | Ga0373957_0066071 | |||
| 1475 | Ga0373943_0034867 | |||
| 1476 | Ga0373955_0645384 | |||
| 1477 | Ga0373961_0025585 | |||
| 1478 | Ga0373924_0002858 | |||
| 1479 | Ga0373931_0092941 | |||
| 1480 | Ga0373935_0063084 | |||
| 1481 | Ga0373927_0021218 | |||
| 1482 | Ga0373927_0261747 | |||
| 1483 | Ga0373933_0000114 | |||
| 1484 | Ga0373933_0479957 | |||
| 1485 | Ga0373947_1084289 | |||
| 1486 | Ga0373937_0074647 | |||
| 1487 | Ga0373937_1056233 | |||
| 1488 | Ga0372808_044701 | |||
| 1489 | Ga0373925_0008346 | |||
| 1490 | Ga0373925_0012108 | |||
| 1491 | Ga0373925_0621816 | |||
| 1492 | Ga0395899_0159301 | |||
| 1493 | Ga0395899_0271719 | |||
| 1494 | Ga0395900_0052668 | |||
| 1495 | Ga0395900_0053769 | |||
| 1496 | Ga0395900_0084990 | |||
| 1497 | Ga0395900_0093104 | |||
| 1498 | Ga0395900_0227912 | |||
| 1499 | Ga0395900_0298738 | |||
| 1500 | Ga0395900_0351417 | |||
| 1501 | Ga0395898_0014967 | |||
| 1502 | Ga0395898_0034661 | |||
| 1503 | Ga0395898_0072959 | |||
| 1504 | Ga0395898_0138617 | |||
| 1505 | Ga0395898_0186341 | |||
| 1506 | Ga0395898_0214112 | |||
| 1507 | Ga0395905_0005511 | |||
| 1508 | Ga0395905_0084822 | |||
| 1509 | Ga0395901_0026879 | |||
| 1510 | Ga0395901_0065435 | |||
| 1511 | Ga0395901_0097039 | |||
| 1512 | Ga0395901_0112127 | |||
| 1513 | Ga0395901_0734695 | |||
| 1514 | Ga0395901_0899648 | |||
| 1515 | Ga0436365_0021907 | |||
| 1516 | Ga0436365_0808505 | |||
| 1517 | Ga0436360_0291987 | |||
| 1518 | Ga0436361_0183009 | |||
| 1519 | Ga0436361_0759798 | |||
| 1520 | Ga0436361_0959035 | |||
| 1521 | Ga0436363_0385198 | |||
| 1522 | Ga0436363_0439777 | |||
| 1523 | Ga0436363_0468515 | |||
| 1524 | Ga0436363_0514184 | |||
| 1525 | Ga0436363_0973295 | |||
| 1526 | Ga0436362_1074496 | |||
| 1527 | Ga0436362_1127610 | |||
| 1528 | Ga0451787_764725 | |||
| 1529 | Ga0451789_1221988 | |||
| 1530 | Ga0451793_1530076 | |||
| 1531 | Ga0451795_0965185 | |||
| 1532 | Ga0451798_1113104 | |||
| 1533 | Ga0451802_1193815 | |||
| 1534 | Ga0451807_0896219 | |||
| 1535 | Ga0451845_0561026 | |||
| 1536 | Ga0451849_1468299 | |||
| 1537 | Ga0451843_0604583 | |||
| 1538 | Ga0451853_0997325 | |||
| 1539 | Ga0466969_0016425 | |||
| 1540 | Ga0466969_0078487 | |||
| 1541 | Ga0466972_0011618 | |||
| 1542 | Ga0466972_0185541 | |||
| 1543 | Ga0466965_0025559 | |||
| 1544 | Ga0466965_0126248 | |||
| 1545 | Ga0466965_0226223 | |||
| 1546 | Ga0466965_0779658 | |||
| 1547 | Ga0466966_0002297 | |||
| 1548 | Ga0466966_0169498 | |||
| 1549 | Ga0466961_0000129 | |||
| 1550 | Ga0466961_0296449 | |||
| 1551 | Ga0466961_0319671 | |||
| 1552 | Ga0466963_0060863 | |||
| 1553 | Ga0466963_0137605 | |||
| 1554 | Ga0466963_0301623 | |||
| 1555 | Ga0466963_1068382 | |||
| 1556 | Ga0466964_0034112 | |||
| 1557 | Ga0466964_0124045 | |||
| 1558 | Ga0466964_0213492 | |||
| 1559 | Ga0466971_0021086 | |||
| 1560 | Ga0466971_0403232 | |||
| 1561 | Ga0466971_0440412 | |||
| 1562 | Ga0466968_0007308 | |||
| 1563 | Ga0466968_0387074 | |||
| 1564 | Ga0466957_0025520 | |||
| 1565 | Ga0466957_0167399 | |||
| 1566 | Ga0466957_0171826 | |||
| 1567 | Ga0466959_0006120 | |||
| 1568 | Ga0466959_0461413 | |||
| 1569 | Ga0466959_0479266 | |||
| 1570 | Ga0466958_0254707 | |||
| 1571 | Ga0466958_0297884 | |||
| 1572 | Ga0466967_0029176 | |||
| 1573 | Ga0466967_0039786 | |||
| 1574 | Ga0466967_0173235 | |||
| 1575 | Ga0466967_0419565 | |||
| 1576 | Ga0466967_0458464 | |||
| 1577 | Ga0466967_1345815 | |||
| 1578 | Ga0495592_0067706 | |||
| 1579 | Ga0495592_0158570 | |||
| 1580 | Ga0495592_0275854 | |||
| 1581 | Ga0495603_0047738 | |||
| 1582 | Ga0495603_0240840 | |||
| 1583 | Ga0495629_0151152 | |||
| 1584 | Ga0495629_0278124 | |||
| 1585 | Ga0495629_0286765 | |||
| 1586 | Ga0495629_0935539 | |||
| 1587 | Ga0495638_0002281 | |||
| 1588 | Ga0495641_0111456 | |||
| 1589 | Ga0495641_0424705 | |||
| 1590 | Ga0495651_0010124 | |||
| 1591 | Ga0495651_0016379 | |||
| 1592 | Ga0495651_0346429 | |||
| 1593 | Ga0495653_0545695 | |||
| 1594 | Ga0495582_0013743 | |||
| 1595 | Ga0495582_0151970 | |||
| 1596 | Ga0495639_0005620 | |||
| 1597 | Ga0495664_0007028 | |||
| 1598 | Ga0495664_0011419 | |||
| 1599 | Ga0495664_0046017 | |||
| 1600 | Ga0495585_0221297 | |||
| 1601 | Ga0495585_0290860 | |||
| 1602 | Ga0495594_0180966 | |||
| 1603 | Ga0495607_0156037 | |||
| 1604 | Ga0495583_0162088 | |||
| 1605 | Ga0495606_0034748 | |||
| 1606 | Ga0495606_0301828 | |||
| 1607 | Ga0495608_0300452 | |||
| 1608 | Ga0495608_0401077 | |||
| 1609 | Ga0495610_0214405 | |||
| 1610 | Ga0495618_0310891 | |||
| 1611 | Ga0495618_0761436 | |||
| 1612 | Ga0495620_0273678 | |||
| 1613 | Ga0495620_0284334 | |||
| 1614 | Ga0495628_0032331 | |||
| 1615 | Ga0495628_0050469 | |||
| 1616 | Ga0495630_0036284 | |||
| 1617 | Ga0495630_0440496 | |||
| 1618 | Ga0495630_0486338 | |||
| 1619 | Ga0495631_0090578 | |||
| 1620 | Ga0495648_0003897 | |||
| 1621 | Ga0495648_0019285 | |||
| 1622 | Ga0495648_0128425 | |||
| 1623 | Ga0495642_0148664 | |||
| 1624 | Ga0495652_0006665 | |||
| 1625 | Ga0495652_0085443 | |||
| 1626 | Ga0495652_0299714 | |||
| 1627 | Ga0495652_0713591 | |||
| 1628 | Ga0495665_0078537 | |||
| 1629 | Ga0495640_0385092 | |||
| 1630 | Ga0495587_0014466 | |||
| 1631 | Ga0495609_0302073 | |||
| 1632 | Ga0495645_0028158 | |||
| 1633 | Ga0495645_0114699 | |||
| 1634 | Ga0495622_0045393 | |||
| 1635 | Ga0495667_0075193 | |||
| 1636 | Ga0495634_0093381 | |||
| 1637 | Ga0495634_0144144 | |||
| 1638 | Ga0495611_0097717 | |||
| 1639 | Ga0495611_0128623 | |||
| 1640 | Ga0495625_0208839 | |||
| 1641 | Ga0495625_0717004 | |||
| 1642 | Ga0495635_0011833 | |||
| 1643 | Ga0495635_0112373 | |||
| 1644 | Ga0495635_1029548 | |||
| 1645 | Ga0495661_0062394 | |||
| 1646 | Ga0495588_0061742 | |||
| 1647 | Ga0495588_0081630 | |||
| 1648 | Ga0495657_0020349 | |||
| 1649 | Ga0495657_0135124 | |||
| 1650 | Ga0495599_0038942 | |||
| 1651 | Ga0495623_0153763 | |||
| 1652 | Ga0495623_0155439 | |||
| 1653 | Ga0495646_0015043 | |||
| 1654 | Ga0495646_0030035 | |||
| 1655 | Ga0495646_0091348 | |||
| 1656 | Ga0495658_0202899 | |||
| 1657 | Ga0495658_0305322 | |||
| 1658 | Ga0495613_0080774 | |||
| 1659 | Ga0495613_0092768 | |||
| 1660 | Ga0495613_0108256 | |||
| 1661 | Ga0495613_0242910 | |||
| 1662 | Ga0495624_0062744 | |||
| 1663 | Ga0495624_0115823 | |||
| 1664 | Ga0495649_0168666 | |||
| 1665 | Ga0495600_0301089 | |||
| 1666 | Ga0495600_0365940 | |||
| 1667 | Ga0495581_0129575 | |||
| 1668 | Ga0495581_0185090 | |||
| 1669 | Ga0495581_0711693 | |||
| 1670 | Ga0495604_0005727 | |||
| 1671 | Ga0495604_0192229 | |||
| 1672 | Ga0495604_0264638 | |||
| 1673 | Ga0495604_0576296 | |||
| 1674 | Ga0495674_0019801 | |||
| 1675 | Ga0495674_0030816 | |||
| 1676 | Ga0495672_0141937 | |||
| 1677 | Ga0495676_0056563 | |||
| 1678 | Ga0495676_0555057 | |||
| 1679 | Ga0495676_0598582 | |||
| 1680 | Ga0495676_0656161 | |||
| 1681 | Ga0495680_0006823 | |||
| 1682 | Ga0495683_0362905 | |||
| 1683 | Ga0495675_0021068 | |||
| 1684 | Ga0495673_0021341 | |||
| 1685 | Ga0495673_0048751 | |||
| 1686 | Ga0495684_0043412 | |||
| 1687 | Ga0495684_0140995 | |||
| 1688 | Ga0495684_0161443 | |||
| 1689 | Ga0495684_0322099 | |||
| 1690 | Ga0495686_0115826 | |||
| 1691 | Ga0495686_0173712 | |||
| 1692 | Ga0495686_0463911 | |||
| 1693 | Ga0495593_0022751 | |||
| 1694 | Ga0495593_0065310 | |||
| 1695 | Ga0495593_0093478 | |||
| 1696 | Ga0495593_0602176 | |||
| 1697 | Ga0495602_0050884 | |||
| 1698 | Ga0495602_0169061 | |||
| 1699 | Ga0495602_0337391 | |||
| 1700 | Ga0495602_0522795 | |||
| 1701 | Ga0495602_0840429 | |||
| 1702 | Ga0496100_0318774 | |||
| 1703 | Ga0496100_1590744 | |||
| 1704 | Ga0496101_0426449 | |||
| 1705 | Ga0496102_0064026 | |||
| 1706 | Ga0496102_0971760 | |||
| 1707 | Ga0496103_0008405 | |||
| 1708 | Ga0496104_0004036 | |||
| 1709 | Ga0496104_0005388 | |||
| 1710 | Ga0496104_0176181 | |||
| 1711 | Ga0496104_0448165 | |||
| 1712 | Ga0496105_0001275 | |||
| 1713 | Ga0496105_0009543 | |||
| 1714 | Ga0496105_0080543 | |||
| 1715 | Ga0496105_0579331 | |||
| 1716 | Ga0496105_0875758 | |||
| 1717 | Ga0496106_0003991 | |||
| 1718 | Ga0496106_0159379 | |||
| 1719 | Ga0496106_0172559 | |||
| 1720 | Ga0496106_0264382 | |||
| 1721 | Ga0496106_0689411 | |||
| 1722 | Ga0496107_0005978 | |||
| 1723 | Ga0496107_0229951 | |||
| 1724 | Ga0496107_1048327 | |||
| 1725 | Ga0496108_0000581 | |||
| 1726 | Ga0496108_0086416 | |||
| 1727 | Ga0496108_0472175 | |||
| 1728 | Ga0496109_0000507 | |||
| 1729 | Ga0496109_0002379 | |||
| 1730 | Ga0496110_0011482 | |||
| 1731 | Ga0496110_0652287 | |||
| 1732 | Ga0496110_1301985 | |||
| 1733 | Ga0496110_1408097 | |||
| 1734 | Ga0496111_0005375 | |||
| 1735 | Ga0496111_0482704 | |||
| 1736 | Ga0496112_0000019 | |||
| 1737 | Ga0496112_0004823 | |||
| 1738 | Ga0496112_0016561 | |||
| 1739 | Ga0496112_0721333 | |||
| 1740 | Ga0496113_0011391 | |||
| 1741 | Ga0496113_0029645 | |||
| 1742 | Ga0496113_0328596 | |||
| 1743 | Ga0496114_0045648 | |||
| 1744 | Ga0496114_0080506 | |||
| 1745 | Ga0496114_0100516 | |||
| 1746 | Ga0496114_0738166 | |||
| 1747 | Ga0496114_1694137 | |||
| 1748 | Ga0496115_0083685 | |||
| 1749 | Ga0496115_0194139 | |||
| 1750 | Ga0496115_0286035 | |||
| 1751 | Ga0496118_0035728 | |||
| 1752 | Ga0496118_0063743 | |||
| 1753 | Ga0496118_0202218 | |||
| 1754 | Ga0496119_0030804 | |||
| 1755 | Ga0496119_0041332 | |||
| 1756 | Ga0496120_0023580 | |||
| 1757 | Ga0496120_0046427 | |||
| 1758 | Ga0496121_0039009 | |||
| 1759 | Ga0496121_0053636 | |||
| 1760 | Ga0496121_0633204 | |||
| 1761 | Ga0496122_0273367 | |||
| 1762 | Ga0496123_0416420 | |||
| 1763 | Ga0496125_0056378 | |||
| 1764 | Ga0496126_0027182 | |||
| 1765 | Ga0496126_0041848 | |||
| 1766 | Ga0496126_0066674 | |||
| 1767 | Ga0496126_0172089 | |||
| 1768 | Ga0496126_0256817 | |||
| 1769 | Ga0496126_0599007 | |||
| 1770 | Ga0496126_0842327 | |||
| 1771 | Ga0496126_0991842 | |||
| 1772 | Ga0496126_1022583 | |||
| 1773 | Ga0495682_0026256 | |||
| 1774 | Ga0501031_0348533 | |||
| 1775 | Ga0501031_0353993 | |||
| 1776 | Ga0501032_0014636 | |||
| 1777 | Ga0501033_0003525 | |||
| 1778 | Ga0501033_0191861 | |||
| 1779 | Ga0501034_0011514 | |||
| 1780 | Ga0501034_0026323 | |||
| 1781 | Ga0501034_0100582 | |||
| 1782 | Ga0501036_0057240 | |||
| 1783 | Ga0501036_0172827 | |||
| 1784 | Ga0501036_0212426 | |||
| 1785 | Ga0501037_0014971 | |||
| 1786 | Ga0501037_0176446 | |||
| 1787 | Ga0501038_0010109 | |||
| 1788 | Ga0501038_0032236 | |||
| 1789 | Ga0501038_0061390 | |||
| 1790 | Ga0501038_0127784 | |||
| 1791 | Ga0501039_0101097 | |||
| 1792 | Ga0501039_0339674 | |||
| 1793 | Ga0501040_0117720 | |||
| 1794 | Ga0501042_0002545 | |||
| 1795 | Ga0501043_0020509 | |||
| 1796 | Ga0501043_0051339 | |||
| 1797 | Ga0501043_0054115 | |||
| 1798 | Ga0501046_0026634 | |||
| 1799 | Ga0501046_0082467 | |||
| 1800 | Ga0501047_0009908 | |||
| 1801 | Ga0501047_0027170 | |||
| 1802 | Ga0501047_0064552 | |||
| 1803 | Ga0501047_0102168 | |||
| 1804 | Ga0501048_0005496 | |||
| 1805 | Ga0501048_0070461 | |||
| 1806 | Ga0501067_0002825 | |||
| 1807 | Ga0501067_0058453 | |||
| 1808 | Ga0501068_0009793 | |||
| 1809 | Ga0501068_0521638 | |||
| 1810 | Ga0501069_0189424 | |||
| 1811 | Ga0501069_0703007 | |||
| 1812 | Ga0501070_0026055 | |||
| 1813 | Ga0501070_0467715 | |||
| 1814 | Ga0501071_0748756 | |||
| 1815 | Ga0501072_0273977 | |||
| 1816 | Ga0501073_0003590 | |||
| 1817 | Ga0501073_0014548 | |||
| 1818 | Ga0501073_0103295 | |||
| 1819 | Ga0501074_0023865 | |||
| 1820 | Ga0501077_0234769 | |||
| 1821 | Ga0501080_0086024 | |||
| 1822 | Ga0501080_0109870 | |||
| 1823 | Ga0501083_0010499 | |||
| 1824 | Ga0501083_0103698 | |||
| 1825 | Ga0501035_0035212 | |||
| 1826 | Ga0501035_0039873 | |||
| 1827 | Ga0501035_0486858 | |||
| 1828 | Ga0501044_0026586 | |||
| 1829 | Ga0501044_0119620 | |||
| 1830 | Ga0501044_0308943 | |||
| 1831 | Ga0501044_0344200 | |||
| 1832 | Ga0501045_0003604 | |||
| 1833 | Ga0501045_0883285 | |||
| 1834 | nmdc:mga03683_32770_c1 | |||
| 1835 | nmdc:mga03n38_378600_c1 | |||
| 1836 | nmdc:mga03n38_421976_c1 | |||
| 1837 | nmdc:mga00v17_44083_c1 | |||
| 1838 | nmdc:mga0yw44_319739_c1 | |||
| 1839 | nmdc:mga0yw44_488160_c1 | |||
| 1840 | nmdc:mga0k408_224991_c1 | |||
| 1841 | nmdc:mga07m45_117152_c1 | |||
| 1842 | nmdc:mga07m45_189786_c1 | |||
| 1843 | nmdc:mga07m45_907212_c1 | |||
| 1844 | nmdc:mga05p37_275569_c1 | |||
| 1845 | nmdc:mga06r32_34461_c1 | |||
| 1846 | nmdc:mga08y16_16577_c1 | |||
| 1847 | nmdc:mga0rr50_545692_c1 | |||
| 1848 | nmdc:mga0sz30_213409_c1 | |||
| 1849 | nmdc:mga0sz30_6906_c2 | |||
| 1850 | nmdc:mga0sz30_96892_c1 | |||
| 1851 | Ga0495601_0022702 | |||
| 1852 | Ga0495601_0028119 | |||
| 1853 | Ga0495601_0257180 | |||
| 1854 | Ga0495601_0334044 | |||
| 1855 | Ga0495601_0463950 | |||
| 1856 | Ga0495601_0760047 | |||
| 1857 | Ga0495612_0027589 | |||
| 1858 | Ga0495612_0055280 | |||
| 1859 | Ga0495612_0078851 | |||
| 1860 | Ga0500635_0109173 | |||
| 1861 | Ga0495595_0002381 | |||
| 1862 | Ga0495595_0092418 | |||
| 1863 | Ga0495595_0420733 | |||
| 1864 | Ga0495619_0028465 | |||
| 1865 | Ga0495619_0045807 | |||
| 1866 | Ga0495619_0322085 | |||
| 1867 | Ga0495619_0514515 | |||
| 1868 | Ga0495619_0772270 | |||
| 1869 | Ga0495619_1116140 | |||
| 1870 | Ga0500578_0676117 | |||
| 1871 | Ga0500643_000062 | |||
| 1872 | Ga0500644_0154461 | |||
| 1873 | Ga0500646_0261983 | |||
| 1874 | Ga0500647_0084525 | |||
| 1875 | Ga0500647_0315562 | |||
| 1876 | Ga0500583_0147721 | |||
| 1877 | Ga0500651_0073134 | |||
| 1878 | Ga0500651_0673923 | |||
| 1879 | Ga0500566_0009283 | |||
| 1880 | Ga0500566_0062595 | |||
| 1881 | Ga0500566_0190275 | |||
| 1882 | Ga0500640_205624 | |||
| 1883 | Ga0500650_0182646 | |||
| 1884 | Ga0500553_268591 | |||
| 1885 | Ga0500555_064463 | |||
| 1886 | Ga0500556_0062248 | |||
| 1887 | Ga0500556_0349535 | |||
| 1888 | Ga0500557_000043 | |||
| 1889 | Ga0500569_006585 | |||
| 1890 | Ga0500569_035234 | |||
| 1891 | Ga0500595_003786 | |||
| 1892 | Ga0500607_048744 | |||
| 1893 | Ga0500608_013748 | |||
| 1894 | Ga0500608_038663 | |||
| 1895 | Ga0500642_0000193 | |||
| 1896 | Ga0500642_0021444 | |||
| 1897 | Ga0500652_123749 | |||
| 1898 | Ga0500655_008973 | |||
| 1899 | Ga0500658_0030957 | |||
| 1900 | Ga0500559_0031651 | |||
| 1901 | Ga0500559_0336124 | |||
| 1902 | Ga0500568_0012024 | |||
| 1903 | Ga0500577_0020288 | |||
| 1904 | Ga0500585_073008 | |||
| 1905 | Ga0500588_0356508 | |||
| 1906 | Ga0500590_182459 | |||
| 1907 | Ga0500604_0049520 | |||
| 1908 | Ga0500616_0122149 | |||
| 1909 | Ga0500619_007273 | |||
| 1910 | Ga0500620_015171 | |||
| 1911 | Ga0500622_0063052 | |||
| 1912 | Ga0500624_008204 | |||
| 1913 | Ga0500627_0084741 | |||
| 1914 | Ga0500634_0090295 | |||
| 1915 | Ga0500638_059449 | |||
| 1916 | Ga0500639_232946 | |||
| 1917 | Ga0500639_274070 | |||
| 1918 | Ga0500636_0000075 | |||
| 1919 | Ga0500636_0167194 | |||
| 1920 | Ga0500625_000791 | |||
| 1921 | Ga0500645_036548 | |||
| 1922 | Ga0500599_001855 | |||
| 1923 | Ga0501084_0326673 | |||
| 1924 | Ga0501084_0732055 | |||
| 1925 | Ga0587073_0080212 | |||
| 1926 | Ga0501082_0014060 | |||
| 1927 | Ga0466962_0052885 | |||
| 1928 | Ga0466962_0272532 | |||
| 1929 | 2507504842 | |||
| 1930 | 2508546197 | |||
| 1931 | 2508695129 | |||
| 1932 | 2511395455 | |||
| 1933 | 2513625424 | |||
| 1934 | 2513639553 | |||
| 1935 | 2513703351 | |||
| 1936 | 2513715708 | |||
| 1937 | 2513873914 | |||
| 1938 | 2514012887 | |||
| 1939 | 2515625865 | |||
| 1940 | 2524435743 | |||
| 1941 | 2545677467 | |||
| 1942 | 2617351700 | |||
| 1943 | 2617377248 | |||
| 1944 | 2745079039 | |||
| 1945 | 2793066047 | |||
| 1946 | 2805915997 | |||
| 1947 | 2824602574 | |||
| 1948 | 2824612646 | |||
| 1949 | 2824621108 | |||
| 1950 | 2824630115 | |||
| 1951 | 2824640730 | |||
| 1952 | 2824649823 | |||
| 1953 | 2824654461 | |||
| 1954 | 2824674855 | |||
| 1955 | 2824683558 | |||
| 1956 | 2824691923 | |||
| 1957 | 2824697652 | |||
| 1958 | 2824709661 | |||
| 1959 | 2824719828 | |||
| 1960 | 2824727932 | |||
| 1961 | 2824736249 | |||
| 1962 | 2824750285 | |||
| 1963 | 2824757115 | |||
| 1964 | 2824768451 | |||
| 1965 | 2824774944 | |||
| 1966 | 2838131017 | |||
| 1967 | 2841944458 | |||
| 1968 | 2841951599 | |||
| 1969 | 2841969235 | |||
| 1970 | 2841982900 | |||
| 1971 | 2841991018 | |||
| 1972 | 2842043884 | |||
| 1973 | 2842052126 | |||
| 1974 | 2844321822 | |||
| 1975 | 2847931470 | |||
| 1976 | 2847941752 | |||
| 1977 | 2857511567 | |||
| 1978 | 2874596836 | |||
| 1979 | 2874624420 | |||
| 1980 | 2874636707 | |||
| 1981 | 2874648641 | |||
| 1982 | 2876766414 | |||
| 1983 | 2876777300 | |||
| 1984 | 2876825382 | |||
| 1985 | 2879077631 | |||
| 1986 | 2879087493 | |||
| 1987 | 2879107224 | |||
| 1988 | 2879127661 | |||
| 1989 | 2879146066 | |||
| 1990 | 2881371003 | |||
| 1991 | 2881665695 | |||
| 1992 | 2885371400 | |||
| 1993 | 2888420773 | |||
| 1994 | 2903727628 | |||
| 1995 | 2904672241 | |||
| 1996 | 2904716182 | |||
| 1997 | 2906602882 | |||
| 1998 | 2906633525 | |||
| 1999 | 2906647590 | |||
| 2000 | 2908775764 | |||
| 2001 | 2922400798 | |||
| 2002 | 2932794687 | |||
| 2003 | 2932805502 | |||
| 2004 | 2932812580 | |||
| 2005 | 2932822942 | |||
| 2006 | 2935614959 | |||
| 2007 | 2935652986 | |||
| 2008 | 2935661569 | |||
| 2009 | 2935689588 | |||
| 2010 | 2935717107 | |||
| 2011 | 2935730059 | |||
| 2012 | 2935738522 | |||
| 2013 | 2935749230 | |||
| 2014 | 2935756941 | |||
| 2015 | 2935764445 | |||
| 2016 | 2935772772 | |||
| 2017 | 2935778091 | |||
| 2018 | 2935787319 | |||
| 2019 | 2935795893 | |||
| 2020 | 2935826002 | |||
| 2021 | 2935851621 | |||
| 2022 | 2935888901 | |||
| 2023 | 2935910357 | |||
| 2024 | 2935918357 | |||
| 2025 | 2935927732 | |||
| 2026 | 2935936396 | |||
| 2027 | 2935944051 | |||
| 2028 | 2935952488 | |||
| 2029 | 2935969328 | |||
| 2030 | 2935977907 | |||
| 2031 | 2935984789 | |||
| 2032 | 2936015702 | |||
| 2033 | 2936024336 | |||
| 2034 | 2936031777 | |||
| 2035 | 2936051599 | |||
| 2036 | 2936055960 | |||
| 2037 | 2940562855 | |||
| 2038 | 2941532353 | |||
| 2039 | 3005486418 | |||
| 2040 | 3005509546 | |||
| 2041 | 3005589021 | |||
| 2042 | 3005602170 | |||
| 2043 | 641640484 | |||
| 2044 | 8006929778 | |||
| 2045 | 8016526598 | |||
| 2046 | 8016531683 | |||
| 2047 | 8016544881 | |||
| 2048 | 8016557195 | |||
| 2049 | 8016565547 | |||
| 2050 | 8016569952 | |||
| 2051 | 8016582531 | |||
| 2052 | 8016586811 | |||
| 2053 | 8016603165 | |||
| 2054 | 8016617964 | |||
| 2055 | 8016623608 | |||
| 2056 | 8016636087 | |||
| 2057 | 8019531505 | |||
| 2058 | 8019540027 | |||
| 2059 | 8019550629 | |||
| 2060 | 8019622556 | |||
| 2061 | 8019630557 | |||
| 2062 | 8019640056 | |||
| 2063 | 8019652878 | |||
| 2064 | 8019667383 | |||
| 2065 | 8019677157 | |||
| 2066 | 8019678828 | |||
| 2067 | 8019696704 | |||
| 2068 | 8056970915 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8248 | 3 | 103 |
| 1v8h-assembly1.cif.gz_B | crystal structure of tt0351 protein from thermus thermophilus hb8 | 0.8223 | 4 | 102 |
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8063 | 3 | 103 |
| 2oxh-assembly1.cif.gz_Z | the soxyz complex of paracoccus pantotrophus | 0.7961 | 3 | 103 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.7951 | 3 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8248 | 3 | 103 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8223 | 4 | 102 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7951 | 3 | 103 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7867 | 4 | 102 | 2.60.40.10 |
| 1mbyA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.7689 | 41 | 102 | 2.40.50.930 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W2A9W3-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9667 | 5 | 103 |
|
| AF-A0A1Y5EQC0-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9634 | 6 | 103 |
|
| AF-A0A430KLC7-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9619 | 5 | 103 |
|
| AF-A0A2G2QK80-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9604 | 6 | 103 |
|
| AF-I3UAU9-F1-model_v4 | Sulfur oxidation protein SoxZ | 0.9561 | 6 | 103 |
|