metagRoot

F488610

General Info

Members	Datasets	Scaffolds	Average Seq Length
1031	660	2062	242

Family's Representative Sequence

Representative Sequence	3300005985\|Ga0081539_10000157\|Ga0081539_1000015751
Length	229
Sequence	MSALLEVADVHIAYGKVEAVRGVSLEVGGNEIVTIIGANGAGKSTLLNAIMGVLPLKGRVAFAGEDMARLEIEDRVALGISLVPEHRELFSTMKATAAQSFERVYTLFPRLAERRKQLAGTLSGGEQQMLAMGRALMGAPRLLMLDEPSLGLAPIIVADIFRTIGELRAAGVSVLLVEQNAQAALKIADRAYVMELGEFVLSGVASDIAANSRVAASYLGFTHEGASAV

Samples

	Sample ID	Description	Type	Environment
1	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
4	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
5	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
6	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
7	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
8	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
9	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
10	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
11	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
12	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
17	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
28	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
37	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
40	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
41	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
42	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
43	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
44	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
45	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
46	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
47	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
48	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
49	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
50	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
51	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
52	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
53	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
54	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
55	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
56	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
57	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
58	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
59	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
60	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
61	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
62	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
63	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
64	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
65	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
66	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
67	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
69	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
76	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
77	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
78	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
82	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
85	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
91	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
92	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
93	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
94	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
95	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
96	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
97	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
98	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
99	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
102	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
103	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
104	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
105	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
106	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
107	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
108	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
109	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
110	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
116	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
117	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
119	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
170	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
171	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
172	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
173	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
176	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
180	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
181	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
182	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
183	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
184	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
185	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
186	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
187	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
188	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
189	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
190	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
191	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
192	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
193	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
194	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
195	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
196	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
197	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
198	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
199	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
200	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
201	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
202	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
203	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
204	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
205	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
206	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
207	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
208	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
209	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
210	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
211	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
212	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
213	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
214	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
215	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
216	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
217	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
218	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
219	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
220	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
221	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
222	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
223	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
224	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
225	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
226	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
227	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
228	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
229	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
230	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
231	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
232	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
233	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
234	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
235	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
236	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
237	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
238	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
239	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
240	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
241	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
242	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
243	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
244	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
245	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
246	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
247	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
248	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
249	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
250	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
251	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
252	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
253	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
254	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
255	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
256	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
257	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
258	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
259	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
260	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
261	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
262	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
263	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
264	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
265	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
266	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
267	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
268	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
269	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
270	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
271	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
272	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
273	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
274	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
275	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
276	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
277	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
278	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
279	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
280	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
281	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
282	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
283	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
284	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
285	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
286	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
287	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
288	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
289	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
290	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
291	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
292	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
293	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
294	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
295	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
296	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
297	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
298	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
299	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
300	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
301	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
302	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
303	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
304	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
305	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
306	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
307	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
308	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
309	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
310	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
311	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
312	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
313	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
314	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
315	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
316	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
317	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
318	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
319	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
320	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
321	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
322	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
323	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
324	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
325	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
326	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
327	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
328	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
329	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
330	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
331	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
332	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
333	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
334	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
335	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
336	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
337	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
338	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
339	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
340	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
341	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
342	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
343	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
344	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
345	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
346	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
347	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
348	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
349	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
350	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
351	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
352	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
353	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
354	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
355	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
356	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
357	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
358	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
359	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
360	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
361	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
362	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
363	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
364	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
365	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
366	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
367	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
368	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
369	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
370	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
371	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
372	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
373	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
374	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
375	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
376	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
377	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
378	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
379	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
380	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
381	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
382	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
383	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
384	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
385	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
386	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
387	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
388	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
389	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
390	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
391	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
392	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
393	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
394	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
395	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
396	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
397	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
398	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
399	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
400	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
401	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
402	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
403	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
404	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
405	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
406	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
407	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
408	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
409	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
410	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
411	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
412	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
413	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
414	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
415	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
416	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
417	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
418	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
419	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
420	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
421	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
422	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
423	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
424	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
425	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
426	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
427	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
428	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
429	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
430	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
431	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
432	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
433	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
434	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
435	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
436	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
437	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
438	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
439	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
440	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
441	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
442	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
443	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
444	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
445	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
446	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
447	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
448	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
449	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
450	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
451	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
452	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
453	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
454	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
455	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
456	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
457	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
458	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
459	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
460	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
461	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
462	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
463	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
464	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
465	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
466	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
467	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
468	2791355199
469	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
470	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
471	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
472	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
473	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
474	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
475	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
476	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
477	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
478	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
479	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
480	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
481	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
482	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
483	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
484	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
485	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
486	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
487	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
488	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
489	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
490	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
491	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
492	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
493	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
494	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
495	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
496	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
497	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
498	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
499	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
500	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
501	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
502	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
503	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
504	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
505	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
506	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
507	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
508	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
509	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
510	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
511	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
512	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
513	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
514	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
515	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
516	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
517	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
518	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
519	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
520	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
521	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
522	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
523	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
524	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
525	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
526	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
527	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
528	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
529	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
530	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
531	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
532	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
533	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
534	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
535	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
536	2904699407
537	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
538	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
539	2906610324
540	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
541	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
542	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
543	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
544	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
545	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
546	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
547	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
548	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
549	2922368715
550	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
551	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
552	2922425934
553	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
554	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
555	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
556	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
557	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
558	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
559	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
560	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
561	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
562	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
563	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
564	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
565	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
566	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
567	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
568	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
569	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
570	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
571	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
572	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
573	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
574	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
575	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
576	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
577	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
578	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
579	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
580	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
581	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
582	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
583	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
584	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
585	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
586	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
587	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
588	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
589	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
590	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
591	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
592	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
593	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
594	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
595	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
596	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
597	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
598	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
599	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
600	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
601	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
602	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
603	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
604	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
605	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
606	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
607	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
608	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
609	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
610	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
611	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
612	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
613	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
614	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
615	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
616	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
617	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
618	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
619	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
620	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
621	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
622	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
623	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
624	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
625	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
626	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
627	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
628	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
629	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
630	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
631	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
632	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
633	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
634	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
635	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
636	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
637	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
638	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
639	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
640	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
641	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
642	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
643	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
644	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
645	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
646	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
647	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
648	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
649	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
650	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
651	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
652	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
653	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
654	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
655	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
656	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
657	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
658	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
659	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule
660	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	78.46
Metatranscriptomes	0
Isolates	21.54

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	13.97
Nodule	16.88
Rhizoplane	4.36
Rhizosphere	52.47
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0081539_10000157	3300005985	Bacteria	158278
2	JGI25406J46586_10000233	3300003203	Bacteria	24719
3	JGI25406J46586_10014781	3300003203	Bacteria	3312
4	JGI25153J46596_10003109	3300003215	Bacteria	9360
5	JGI25153J46596_10006692	3300003215	Bacteria	5794
6	JGI25153J46596_10006901	3300003215	Bacteria	5669
7	JGI25153J46596_10007168	3300003215	Bacteria	5529
8	JGI25160J50197_1002717	3300003354	Bacteria	8137
9	JGI25160J50197_1002793	3300003354	Bacteria	7993
10	JGI25404J52841_10009156	3300003659	Bacteria	2116
11	Ga0055526_1028100	3300003771	Bacteria	1712
12	Ga0055526_1037239	3300003771	Bacteria	1275
13	Ga0055524_1024893	3300003775	Bacteria	1886
14	Ga0055531_10005040	3300003794	Bacteria	7829
15	Ga0055543_1010561	3300004625	Bacteria	1930
16	Ga0065165_1001167	3300005262	Bacteria	30545
17	Ga0065165_1002365	3300005262	Bacteria	16315
18	Ga0065165_1004614	3300005262	Bacteria	8377
19	Ga0070676_10098242	3300005328	Bacteria	1805
20	Ga0070683_100151538	3300005329	Bacteria	2198
21	Ga0068869_100600464	3300005334	Bacteria	930
22	Ga0070682_100494167	3300005337	Bacteria	947
23	Ga0068868_100003791	3300005338	Bacteria	10551
24	Ga0068868_100005952	3300005338	Bacteria	8601
25	Ga0070660_100685900	3300005339	Bacteria	859
26	Ga0070689_100305291	3300005340	Bacteria	1326
27	Ga0070689_100371337	3300005340	Bacteria	1204
28	Ga0070687_100202447	3300005343	Bacteria	1204
29	Ga0070661_100454071	3300005344	Bacteria	1020
30	Ga0070668_100070775	3300005347	Bacteria	2716
31	Ga0070668_100123195	3300005347	Bacteria	2074
32	Ga0070668_100438028	3300005347	Bacteria	1121
33	Ga0070671_100026970	3300005355	Bacteria	4726
34	Ga0070674_100028834	3300005356	Bacteria	3648
35	Ga0070688_100460316	3300005365	Bacteria	952
36	Ga0070667_100138459	3300005367	Bacteria	2130
37	Ga0070667_100723424	3300005367	Bacteria	922
38	Ga0070667_100813763	3300005367	Bacteria	868
39	Ga0070714_100081216	3300005435	Bacteria	2822
40	Ga0070714_100154798	3300005435	Bacteria	2069
41	Ga0070713_100076654	3300005436	Bacteria	2840
42	Ga0070713_100121261	3300005436	Bacteria	2294
43	Ga0070701_10128612	3300005438	Bacteria	1437
44	Ga0070711_100117909	3300005439	Bacteria	1958
45	Ga0070700_100303296	3300005441	Bacteria	1167
46	Ga0070708_100112222	3300005445	Bacteria	2507
47	Ga0070663_100029001	3300005455	Bacteria	3775
48	Ga0070663_100051373	3300005455	Bacteria	2936
49	Ga0070663_100077055	3300005455	Bacteria	2440
50	Ga0070663_100296199	3300005455	Bacteria	1293
51	Ga0070663_100354043	3300005455	Bacteria	1189
52	Ga0070663_100431545	3300005455	Bacteria	1083
53	Ga0070678_100123490	3300005456	Bacteria	2045
54	Ga0070678_100388653	3300005456	Bacteria	1209
55	Ga0070662_100048025	3300005457	Bacteria	3073
56	Ga0070662_100173361	3300005457	Bacteria	1696
57	Ga0070662_100262189	3300005457	Bacteria	1392
58	Ga0070662_100421936	3300005457	Bacteria	1104
59	Ga0070681_10386740	3300005458	Bacteria	1310
60	Ga0068867_100138531	3300005459	Bacteria	1900
61	Ga0070707_100040752	3300005468	Bacteria	4443
62	Ga0070679_100414275	3300005530	Bacteria	1293
63	Ga0068853_100037952	3300005539	Bacteria	4102
64	Ga0068853_100870639	3300005539	Bacteria	864
65	Ga0070695_100300271	3300005545	Bacteria	1187
66	Ga0070693_100144990	3300005547	Bacteria	1498
67	Ga0070665_100004629	3300005548	Bacteria	14379
68	Ga0070665_100017342	3300005548	Bacteria	7227
69	Ga0070665_100055288	3300005548	Bacteria	3981
70	Ga0070665_100061338	3300005548	Bacteria	3769
71	Ga0070665_100102146	3300005548	Bacteria	2870
72	Ga0070665_100375135	3300005548	Bacteria	1429
73	Ga0070665_100606593	3300005548	Bacteria	1107
74	Ga0070665_100964745	3300005548	Bacteria	865
75	Ga0070665_101076840	3300005548	Bacteria	815
76	Ga0068855_100224614	3300005563	Bacteria	2105
77	Ga0068855_100796719	3300005563	Bacteria	1004
78	Ga0070664_100226640	3300005564	Bacteria	1674
79	Ga0068857_100212254	3300005577	Bacteria	1767
80	Ga0068854_100332233	3300005578	Bacteria	1239
81	Ga0068856_100000137	3300005614	Bacteria	73762
82	Ga0068856_100067105	3300005614	Bacteria	3545
83	Ga0068856_100411833	3300005614	Bacteria	1372
84	Ga0068852_100158408	3300005616	Bacteria	2111
85	Ga0068852_100158557	3300005616	Bacteria	2110
86	Ga0068859_100059281	3300005617	Bacteria	3856
87	Ga0068859_100162661	3300005617	Bacteria	2311
88	Ga0068859_100950759	3300005617	Bacteria	942
89	Ga0068864_100390668	3300005618	Bacteria	1320
90	Ga0068866_10209877	3300005718	Bacteria	1168
91	Ga0068861_100054426	3300005719	Bacteria	3048
92	Ga0068861_100127349	3300005719	Bacteria	2062
93	Ga0068863_100322968	3300005841	Bacteria	1499
94	Ga0068858_100027993	3300005842	Bacteria	5236
95	Ga0068858_100072012	3300005842	Bacteria	3206
96	Ga0068858_100148098	3300005842	Bacteria	2206
97	Ga0068860_100019679	3300005843	Bacteria	6545
98	Ga0068860_100546185	3300005843	Bacteria	1160
99	Ga0068860_100619528	3300005843	Bacteria	1089
100	Ga0068862_100169583	3300005844	Bacteria	1953
101	Ga0068862_100358560	3300005844	Bacteria	1354
102	Ga0068862_100480102	3300005844	Bacteria	1176
103	Ga0081455_10007493	3300005937	Bacteria	11483
104	Ga0081455_10165226	3300005937	Bacteria	1692
105	Ga0081455_10324142	3300005937	Bacteria	1096
106	Ga0081540_1005657	3300005983	Bacteria	9294
107	Ga0081540_1016780	3300005983	Bacteria	4564
108	Ga0081540_1019710	3300005983	Bacteria	4086
109	Ga0081540_1032245	3300005983	Bacteria	2865
110	Ga0081540_1044694	3300005983	Bacteria	2258
111	Ga0081539_10002599	3300005985	Bacteria	24763
112	Ga0081539_10022796	3300005985	Bacteria	4126
113	Ga0081539_10043656	3300005985	Bacteria	2596
114	Ga0081539_10112609	3300005985	Bacteria	1366
115	Ga0070717_10047127	3300006028	Bacteria	3530
116	Ga0070717_10074934	3300006028	Bacteria	2830
117	Ga0075365_10008447	3300006038	Bacteria	5848
118	Ga0075365_10012998	3300006038	Bacteria	4966
119	Ga0075365_10133182	3300006038	Bacteria	1721
120	Ga0075365_10176105	3300006038	Bacteria	1494
121	Ga0075365_10284661	3300006038	Bacteria	1163
122	Ga0075368_10002578	3300006042	Bacteria	5945
123	Ga0075368_10062537	3300006042	Bacteria	1492
124	Ga0075363_100031275	3300006048	Bacteria	2759
125	Ga0075363_100039346	3300006048	Bacteria	2488
126	Ga0075363_100071697	3300006048	Bacteria	1883
127	Ga0075363_100215142	3300006048	Bacteria	1100
128	Ga0075364_10066031	3300006051	Bacteria	2376
129	Ga0075362_10100011	3300006177	Bacteria	1355
130	Ga0075367_10001394	3300006178	Bacteria	10346
131	Ga0075367_10012975	3300006178	Bacteria	4464
132	Ga0075367_10034882	3300006178	Bacteria	2909
133	Ga0075367_10041778	3300006178	Bacteria	2682
134	Ga0075367_10083384	3300006178	Bacteria	1936
135	Ga0075369_10084304	3300006186	Bacteria	1412
136	Ga0075366_10029117	3300006195	Bacteria	3243
137	Ga0075366_10334458	3300006195	Bacteria	928
138	Ga0097621_100045501	3300006237	Bacteria	3545
139	Ga0075370_10001262	3300006353	Bacteria	10776
140	Ga0075370_10262459	3300006353	Bacteria	1024
141	Ga0075370_10281096	3300006353	Bacteria	988
142	Ga0068871_100613090	3300006358	Bacteria	990
143	Ga0075433_10488424	3300006852	Bacteria	1084
144	Ga0075434_100104354	3300006871	Bacteria	2844
145	Ga0068865_100276285	3300006881	Bacteria	1336
146	Ga0075436_100167642	3300006914	Bacteria	1550
147	Ga0097620_100059286	3300006931	Bacteria	3856
148	Ga0097620_100162658	3300006931	Bacteria	2311
149	Ga0097620_100950748	3300006931	Bacteria	942
150	Ga0099824_1008303	3300006942	Bacteria	13338
151	Ga0099824_1022009	3300006942	Bacteria	4298
152	Ga0099794_10012053	3300007265	Bacteria	3717
153	Ga0105251_10094610	3300009011	Bacteria	1370
154	Ga0105250_10043823	3300009092	Bacteria	1794
155	Ga0105240_10000121	3300009093	Bacteria	163057
156	Ga0105240_10031167	3300009093	Bacteria	6919
157	Ga0111539_10264263	3300009094	Bacteria	2003
158	Ga0111539_10953423	3300009094	Bacteria	998
159	Ga0105245_10273940	3300009098	Bacteria	1647
160	Ga0105245_10282026	3300009098	Bacteria	1624
161	Ga0105245_10571510	3300009098	Bacteria	1154
162	Ga0105247_10030808	3300009101	Bacteria	3253
163	Ga0105247_10101421	3300009101	Bacteria	1840
164	Ga0105243_10874529	3300009148	Bacteria	892
165	Ga0105241_10054690	3300009174	Bacteria	3056
166	Ga0105242_10497260	3300009176	Bacteria	1159
167	Ga0105242_10667443	3300009176	Bacteria	1013
168	Ga0105248_10130064	3300009177	Bacteria	2840
169	Ga0105237_10016562	3300009545	Bacteria	7659
170	Ga0105237_10099042	3300009545	Bacteria	2907
171	Ga0105237_10794386	3300009545	Bacteria	953
172	Ga0105237_10935097	3300009545	Bacteria	874
173	Ga0105249_10137175	3300009553	Bacteria	2342
174	Ga0105239_10008448	3300010375	Bacteria	11712
175	Ga0105239_10066232	3300010375	Bacteria	3968
176	Ga0105239_11038701	3300010375	Bacteria	943
177	Ga0105246_10161324	3300011119	Bacteria	1708
178	Ga0157371_10082442	3300013102	Bacteria	2277
179	Ga0157369_10006548	3300013105	Bacteria	13480
180	Ga0157374_10090050	3300013296	Bacteria	2924
181	Ga0157374_10370475	3300013296	Bacteria	1425
182	Ga0157378_10084842	3300013297	Bacteria	2868
183	Ga0157378_10254232	3300013297	Bacteria	1683
184	Ga0157378_10393520	3300013297	Bacteria	1364
185	Ga0163162_10171792	3300013306	Bacteria	2292
186	Ga0163162_10349456	3300013306	Bacteria	1611
187	Ga0163162_10971496	3300013306	Bacteria	960
188	Ga0157372_10052615	3300013307	Bacteria	4535
189	Ga0157375_10266632	3300013308	Bacteria	1874
190	Ga0157375_10453163	3300013308	Bacteria	1448
191	Ga0157375_10647836	3300013308	Bacteria	1213
192	Ga0163163_10268923	3300014325	Bacteria	1756
193	Ga0163163_10840603	3300014325	Bacteria	981
194	Ga0157380_10609065	3300014326	Bacteria	1082
195	Ga0157376_10361432	3300014969	Bacteria	1392
196	Ga0182007_10084122	3300015262	Bacteria	1045
197	Ga0163161_10433180	3300017792	Bacteria	1060
198	Ga0214544_1000011	3300021320	Bacteria	262952
199	Ga0214542_1000009	3300021321	Bacteria	262861
200	Ga0214545_1000007	3300021324	Bacteria	262984
201	Ga0214543_1000020	3300021327	Bacteria	262861
202	Ga0213872_10099024	3300021361	Bacteria	1301
203	Ga0213876_10017171	3300021384	Bacteria	3821
204	Ga0213876_10055144	3300021384	Bacteria	2098
205	Ga0213871_10004133	3300021441	Bacteria	2875
206	Ga0209563_102736	3300025230	Bacteria	3871
207	Ga0209677_106149	3300025253	Bacteria	2923
208	Ga0209148_1000300	3300025254	Bacteria	71458
209	Ga0209233_1004101	3300025261	Bacteria	5019
210	Ga0209233_1008642	3300025261	Bacteria	3134
211	Ga0209455_1006377	3300025272	Bacteria	3490
212	Ga0209673_1041479	3300025273	Bacteria	1305
213	Ga0209564_1008994	3300025295	Bacteria	4826
214	Ga0209564_1021745	3300025295	Bacteria	2294
215	Ga0209758_1000015	3300025297	Bacteria	851943
216	Ga0209758_1001468	3300025297	Bacteria	27665
217	Ga0209758_1001864	3300025297	Bacteria	23116
218	Ga0209758_1002683	3300025297	Bacteria	17553
219	Ga0209758_1004096	3300025297	Bacteria	12498
220	Ga0209256_1004771	3300025299	Bacteria	8264
221	Ga0209256_1019960	3300025299	Bacteria	2112
222	Ga0207426_1001932	3300025302	Bacteria	14885
223	Ga0207426_1003610	3300025302	Bacteria	8206
224	Ga0209257_1001688	3300025304	Bacteria	24840
225	Ga0209257_1014108	3300025304	Bacteria	3469
226	Ga0207697_10067446	3300025315	Bacteria	1496
227	Ga0207697_10076913	3300025315	Bacteria	1403
228	Ga0207697_10103044	3300025315	Bacteria	1218
229	Ga0207710_10056004	3300025900	Bacteria	1779
230	Ga0207688_10020180	3300025901	Bacteria	3637
231	Ga0207688_10020254	3300025901	Bacteria	3631
232	Ga0207680_10118134	3300025903	Bacteria	1730
233	Ga0207647_10009749	3300025904	Bacteria	6815
234	Ga0207643_10162205	3300025908	Bacteria	1345
235	Ga0207643_10403805	3300025908	Bacteria	864
236	Ga0207654_10120242	3300025911	Bacteria	1648
237	Ga0207707_10000613	3300025912	Bacteria	35676
238	Ga0207695_10000006	3300025913	Bacteria	1135309
239	Ga0207695_10020632	3300025913	Bacteria	7543
240	Ga0207695_10125057	3300025913	Bacteria	2535
241	Ga0207671_10021492	3300025914	Bacteria	4895
242	Ga0207671_10094149	3300025914	Bacteria	2261
243	Ga0207671_10163779	3300025914	Bacteria	1723
244	Ga0207671_10293118	3300025914	Bacteria	1285
245	Ga0207671_10368340	3300025914	Bacteria	1141
246	Ga0207693_10092965	3300025915	Bacteria	2364
247	Ga0207662_10090012	3300025918	Bacteria	1886
248	Ga0207657_10006552	3300025919	Bacteria	12056
249	Ga0207649_10675564	3300025920	Bacteria	800
250	Ga0207652_10023738	3300025921	Bacteria	5083
251	Ga0207652_10265663	3300025921	Bacteria	1548
252	Ga0207646_10069265	3300025922	Bacteria	3151
253	Ga0207650_10040713	3300025925	Bacteria	3401
254	Ga0207650_10336515	3300025925	Bacteria	1239
255	Ga0207687_10008467	3300025927	Bacteria	6727
256	Ga0207687_10218402	3300025927	Bacteria	1499
257	Ga0207700_10062135	3300025928	Bacteria	2836
258	Ga0207700_10726759	3300025928	Bacteria	887
259	Ga0207664_10165830	3300025929	Bacteria	1887
260	Ga0207664_10210920	3300025929	Bacteria	1680
261	Ga0207644_10209671	3300025931	Bacteria	1540
262	Ga0207644_10413187	3300025931	Bacteria	1104
263	Ga0207644_10526090	3300025931	Bacteria	977
264	Ga0207706_10048646	3300025933	Bacteria	3749
265	Ga0207706_10129302	3300025933	Bacteria	2221
266	Ga0207706_10196538	3300025933	Bacteria	1769
267	Ga0207686_10034931	3300025934	Bacteria	3013
268	Ga0207686_10227992	3300025934	Bacteria	1349
269	Ga0207709_10022565	3300025935	Bacteria	3571
270	Ga0207669_10005788	3300025937	Bacteria	5584
271	Ga0207704_10799041	3300025938	Bacteria	788
272	Ga0207665_10168978	3300025939	Bacteria	1578
273	Ga0207691_10213345	3300025940	Bacteria	1676
274	Ga0207691_10537233	3300025940	Bacteria	992
275	Ga0207689_10033801	3300025942	Bacteria	4247
276	Ga0207689_10060594	3300025942	Bacteria	3112
277	Ga0207661_10290886	3300025944	Bacteria	1462
278	Ga0207679_10427194	3300025945	Bacteria	1171
279	Ga0207667_10043759	3300025949	Bacteria	4750
280	Ga0207667_10664290	3300025949	Bacteria	1047
281	Ga0207712_10212719	3300025961	Bacteria	1541
282	Ga0207712_10285337	3300025961	Bacteria	1349
283	Ga0207668_10049194	3300025972	Bacteria	2896
284	Ga0207640_10008004	3300025981	Bacteria	5840
285	Ga0207658_10456595	3300025986	Bacteria	1132
286	Ga0207677_10116688	3300026023	Bacteria	1999
287	Ga0207703_10098817	3300026035	Bacteria	2469
288	Ga0207703_10110364	3300026035	Bacteria	2346
289	Ga0207703_10674036	3300026035	Bacteria	982
290	Ga0207639_10174484	3300026041	Bacteria	1823
291	Ga0207639_10488144	3300026041	Bacteria	1124
292	Ga0207639_10600646	3300026041	Bacteria	1015
293	Ga0207678_10017766	3300026067	Bacteria	6245
294	Ga0207678_10045553	3300026067	Bacteria	3793
295	Ga0207678_10103531	3300026067	Bacteria	2430
296	Ga0207702_10000063	3300026078	Bacteria	123034
297	Ga0207641_10083326	3300026088	Bacteria	2781
298	Ga0207641_10341446	3300026088	Bacteria	1425
299	Ga0207648_10300546	3300026089	Bacteria	1439
300	Ga0207648_10374533	3300026089	Bacteria	1286
301	Ga0207676_10078760	3300026095	Bacteria	2670
302	Ga0207676_10267134	3300026095	Bacteria	1548
303	Ga0207676_10348468	3300026095	Bacteria	1369
304	Ga0207674_10088725	3300026116	Bacteria	3085
305	Ga0207674_10154547	3300026116	Bacteria	2250
306	Ga0207675_100285092	3300026118	Bacteria	1605
307	Ga0207675_100523341	3300026118	Bacteria	1182
308	Ga0207683_10130636	3300026121	Bacteria	2259
309	Ga0207683_10179416	3300026121	Bacteria	1920
310	Ga0207683_10317978	3300026121	Bacteria	1426
311	Ga0207698_10041987	3300026142	Bacteria	3413
312	Ga0207698_10099520	3300026142	Bacteria	2405
313	Ga0209389_1000012	3300027296	Bacteria	213243
314	Ga0209389_1000069	3300027296	Bacteria	98063
315	Ga0209589_1000077	3300027357	Bacteria	98063
316	Ga0209489_100019	3300027361	Bacteria	213243
317	Ga0209489_100020	3300027361	Bacteria	207541
318	Ga0209700_100018	3300027363	Bacteria	238200
319	Ga0209588_1059642	3300027671	Bacteria	1234
320	Ga0209813_10085362	3300027866	Bacteria	1051
321	Ga0207428_10207262	3300027907	Bacteria	1474
322	Ga0268266_10003840	3300028379	Bacteria	14672
323	Ga0268266_10021889	3300028379	Bacteria	5447
324	Ga0268266_10034518	3300028379	Bacteria	4302
325	Ga0268266_10108774	3300028379	Bacteria	2453
326	Ga0268266_10340135	3300028379	Bacteria	1408
327	Ga0268266_10351443	3300028379	Bacteria	1385
328	Ga0268266_10493670	3300028379	Bacteria	1168
329	Ga0268266_11090997	3300028379	Bacteria	772
330	Ga0268265_10096091	3300028380	Bacteria	2380
331	Ga0268265_10241095	3300028380	Bacteria	1595
332	Ga0268265_10706549	3300028380	Bacteria	974
333	Ga0268264_10002781	3300028381	Bacteria	15267
334	Ga0265334_10014881	3300028573	Bacteria	3238
335	Ga0265330_10048056	3300031235	Bacteria	1876
336	Ga0265328_10021367	3300031239	Bacteria	2470
337	Ga0265325_10041402	3300031241	Bacteria	2414
338	Ga0265340_10002373	3300031247	Bacteria	10714
339	Ga0265340_10026354	3300031247	Bacteria	2940
340	Ga0265339_10002052	3300031249	Bacteria	14798
341	Ga0265331_10058755	3300031250	Bacteria	1820
342	Ga0307513_10097538	3300031456	Bacteria	2974
343	Ga0307509_10209644	3300031507	Bacteria	1774
344	Ga0307408_100971292	3300031548	Bacteria	781
345	Ga0307508_10000012	3300031616	Bacteria	243167
346	Ga0307508_10013966	3300031616	Bacteria	7327
347	Ga0307508_10131661	3300031616	Bacteria	2105
348	Ga0307508_10207693	3300031616	Bacteria	1559
349	Ga0265314_10007457	3300031711	Bacteria	9488
350	Ga0265342_10150161	3300031712	Bacteria	1294
351	Ga0265342_10157241	3300031712	Bacteria	1258
352	Ga0307516_10076120	3300031730	Bacteria	3209
353	Ga0307405_10436833	3300031731	Bacteria	1034
354	Ga0307406_10775644	3300031901	Bacteria	807
355	Ga0307412_10609005	3300031911	Bacteria	926
356	Ga0307412_10861103	3300031911	Bacteria	791
357	Ga0307409_101019315	3300031995	Bacteria	846
358	Ga0307411_10270984	3300032005	Bacteria	1346
359	Ga0307415_100056057	3300032126	Bacteria	2700
360	Ga0307507_10136108	3300033179	Bacteria	1902
361	Ga0307507_10264011	3300033179	Bacteria	1096
362	Ga0307510_10010708	3300033180	Bacteria	10903
363	Ga0307510_10027511	3300033180	Bacteria	6515
364	Ga0307510_10128834	3300033180	Bacteria	2211
365	Ga0373938_0038704	3300034957	Bacteria	1052
366	Ga0373934_0025438	3300035086	Bacteria	2292
367	Ga0373936_0021555	3300035113	Bacteria	2506
368	Ga0373953_0000338	3300035117	Bacteria	12592
369	Ga0373954_0000194	3300035118	Bacteria	21982
370	Ga0373956_0003246	3300035119	Bacteria	6561
371	Ga0373956_0118063	3300035119	Bacteria	1238
372	Ga0373957_0019923	3300035120	Bacteria	2365
373	Ga0373943_0095744	3300035170	Bacteria	1544
374	Ga0373955_0003154	3300035172	Bacteria	7212
375	Ga0373924_0018288	3300035410	Bacteria	2698
376	Ga0373931_0009747	3300035691	Bacteria	4598
377	Ga0373935_0043887	3300035692	Bacteria	2816
378	Ga0373935_0154674	3300035692	Bacteria	1559
379	Ga0373935_0224751	3300035692	Bacteria	1305
380	Ga0373935_0293185	3300035692	Bacteria	1148
381	Ga0373927_0003718	3300035695	Bacteria	10844
382	Ga0373927_0008557	3300035695	Bacteria	6877
383	Ga0373933_0000108	3300035724	Bacteria	53024
384	Ga0373933_0003363	3300035724	Bacteria	8915
385	Ga0373933_0126141	3300035724	Bacteria	1606
386	Ga0373947_0050685	3300035725	Bacteria	2496
387	Ga0373947_0104969	3300035725	Bacteria	1780
388	Ga0373937_0011517	3300036401	Bacteria	7761
389	Ga0373937_0101404	3300036401	Bacteria	2671
390	Ga0373925_0027502	3300037068	Bacteria	4162
391	Ga0395900_0001756	3300037418	Bacteria	24872
392	Ga0395900_0010446	3300037418	Bacteria	9497
393	Ga0395898_0005085	3300037466	Bacteria	14256
394	Ga0395898_0023342	3300037466	Bacteria	6252
395	Ga0395898_0024069	3300037466	Bacteria	6146
396	Ga0395898_0035306	3300037466	Bacteria	4974
397	Ga0395898_0337613	3300037466	Bacteria	1437
398	Ga0395905_0018632	3300037471	Bacteria	6584
399	Ga0395905_0025441	3300037471	Bacteria	5582
400	Ga0436364_0697116	3300037853	Bacteria	1638
401	Ga0395901_0017340	3300038443	Bacteria	7351
402	Ga0436365_0068519	3300039437	Bacteria	1822
403	Ga0436365_0457714	3300039437	Bacteria	7003
404	Ga0436365_0592130	3300039437	Bacteria	8188
405	Ga0436365_1486980	3300039437	Bacteria	2468
406	Ga0436360_0794974	3300039438	Bacteria	1198
407	Ga0436361_0246805	3300039447	Bacteria	1387
408	Ga0436361_0792065	3300039447	Bacteria	1222
409	Ga0436363_0927651	3300039450	Bacteria	1279
410	Ga0436362_0210097	3300039453	Bacteria	1496
411	Ga0436362_0371526	3300039453	Bacteria	837
412	Ga0436362_1086659	3300039453	Bacteria	1230
413	Ga0439461_0017440	3300041410	Bacteria	1396
414	Ga0439465_0083186	3300041413	Bacteria	1088
415	Ga0439465_0088923	3300041413	Bacteria	1055
416	Ga0451802_0336070	3300041460	Bacteria	1218
417	Ga0451843_0367960	3300041509	Bacteria	1073
418	Ga0466969_0054903	3300044656	Bacteria	1950
419	Ga0466969_0106885	3300044656	Bacteria	1313
420	Ga0466972_0000100	3300044658	Bacteria	76018
421	Ga0466965_0022896	3300044683	Bacteria	3014
422	Ga0466965_0023179	3300044683	Bacteria	2996
423	Ga0466965_0121747	3300044683	Bacteria	1348
424	Ga0466966_0001421	3300044684	Bacteria	15430
425	Ga0466961_0000138	3300044693	Bacteria	48960
426	Ga0466961_0065519	3300044693	Bacteria	2309
427	Ga0466968_0005962	3300044735	Bacteria	4569
428	Ga0466970_0091407	3300044765	Bacteria	1652
429	Ga0466957_0070517	3300044842	Bacteria	2160
430	Ga0466960_0109289	3300044901	Bacteria	1434
431	Ga0466960_0122694	3300044901	Bacteria	1362
432	Ga0466960_0163358	3300044901	Bacteria	1197
433	Ga0466959_0011733	3300045049	Bacteria	6305
434	Ga0466959_0023353	3300045049	Bacteria	4576
435	Ga0466959_0375190	3300045049	Bacteria	968
436	Ga0466959_0506118	3300045049	Bacteria	816
437	Ga0451576_0323667	3300045051	Bacteria	1614
438	Ga0466958_0054618	3300045836	Bacteria	2422
439	Ga0466958_0236609	3300045836	Bacteria	1167
440	Ga0466967_0328838	3300045976	Bacteria	1476
441	Ga0495617_111595	3300046452	Bacteria	884
442	Ga0495592_0000339	3300046454	Bacteria	38389
443	Ga0495592_0030651	3300046454	Bacteria	4068
444	Ga0495592_0250316	3300046454	Bacteria	1171
445	Ga0495603_0011788	3300046455	Bacteria	5292
446	Ga0495603_0030491	3300046455	Bacteria	3247
447	Ga0495603_0071465	3300046455	Bacteria	2040
448	Ga0495603_0165152	3300046455	Bacteria	1283
449	Ga0495629_0002796	3300046459	Bacteria	13308
450	Ga0495629_0003050	3300046459	Bacteria	12734
451	Ga0495638_0024812	3300046460	Bacteria	3903
452	Ga0495638_0049805	3300046460	Bacteria	2617
453	Ga0495638_0062728	3300046460	Bacteria	2293
454	Ga0495638_0191169	3300046460	Bacteria	1161
455	Ga0495651_0004273	3300046462	Bacteria	10957
456	Ga0495651_0062477	3300046462	Bacteria	2849
457	Ga0495651_0087137	3300046462	Bacteria	2348
458	Ga0495653_0002916	3300046463	Bacteria	13678
459	Ga0495653_0129190	3300046463	Bacteria	1791
460	Ga0495650_0035664	3300046471	Bacteria	2187
461	Ga0495650_0057506	3300046471	Bacteria	1574
462	Ga0495605_0032176	3300046474	Bacteria	2672
463	Ga0495639_0177376	3300046475	Bacteria	1036
464	Ga0495664_0012145	3300046477	Bacteria	4872
465	Ga0495664_0013716	3300046477	Bacteria	4596
466	Ga0495664_0108342	3300046477	Bacteria	1676
467	Ga0495664_0126934	3300046477	Bacteria	1543
468	Ga0495584_0028785	3300046491	Bacteria	2816
469	Ga0495585_0111251	3300046492	Bacteria	1456
470	Ga0495594_0128904	3300046499	Bacteria	1432
471	Ga0495596_0165067	3300046500	Bacteria	861
472	Ga0495583_0078227	3300046506	Bacteria	1441
473	Ga0495606_0005828	3300046507	Bacteria	11621
474	Ga0495606_0049283	3300046507	Bacteria	2763
475	Ga0495606_0150221	3300046507	Bacteria	1368
476	Ga0495606_0220341	3300046507	Bacteria	1069
477	Ga0495606_0242598	3300046507	Bacteria	1004
478	Ga0495608_0019386	3300046511	Bacteria	4681
479	Ga0495610_0160617	3300046512	Bacteria	950
480	Ga0495616_0045289	3300046513	Bacteria	2227
481	Ga0495616_0096899	3300046513	Bacteria	1388
482	Ga0495618_0013768	3300046514	Bacteria	4921
483	Ga0495620_0049157	3300046515	Bacteria	1806
484	Ga0495628_0029505	3300046516	Bacteria	4445
485	Ga0495628_0165622	3300046516	Bacteria	1678
486	Ga0495630_0341122	3300046517	Bacteria	1146
487	Ga0495631_0070160	3300046518	Bacteria	1515
488	Ga0495637_0140343	3300046520	Bacteria	917
489	Ga0495644_0055054	3300046523	Bacteria	1494
490	Ga0495644_0171462	3300046523	Bacteria	833
491	Ga0495648_0014854	3300046524	Bacteria	5674
492	Ga0495648_0097974	3300046524	Bacteria	1625
493	Ga0495648_0164692	3300046524	Bacteria	1142
494	Ga0495648_0167356	3300046524	Bacteria	1130
495	Ga0495648_0277754	3300046524	Bacteria	795
496	Ga0495652_0007414	3300046529	Bacteria	10113
497	Ga0495652_0068307	3300046529	Bacteria	2977
498	Ga0495654_0072879	3300046530	Bacteria	1625
499	Ga0495665_0314426	3300046531	Bacteria	800
500	Ga0495640_0038177	3300046533	Bacteria	3379
501	Ga0495640_0237206	3300046533	Bacteria	1145
502	Ga0495598_0018738	3300046537	Bacteria	1803
503	Ga0495621_0151913	3300046539	Bacteria	911
504	Ga0495597_0111405	3300046542	Bacteria	1147
505	Ga0495597_0121799	3300046542	Bacteria	1087
506	Ga0495597_0141775	3300046542	Bacteria	991
507	Ga0495645_0011332	3300046543	Bacteria	6270
508	Ga0495622_0005349	3300046557	Bacteria	5959
509	Ga0495622_0026113	3300046557	Bacteria	2728
510	Ga0495622_0030309	3300046557	Bacteria	2528
511	Ga0495622_0043886	3300046557	Bacteria	2078
512	Ga0495622_0089425	3300046557	Bacteria	1415
513	Ga0495667_0003330	3300046559	Bacteria	10755
514	Ga0495656_0119010	3300046615	Bacteria	1244
515	Ga0495668_0223264	3300046616	Bacteria	1031
516	Ga0495634_0002330	3300046642	Bacteria	15886
517	Ga0495634_0020617	3300046642	Bacteria	4672
518	Ga0495634_0062354	3300046642	Bacteria	2476
519	Ga0495611_0087192	3300046648	Bacteria	1440
520	Ga0495611_0109689	3300046648	Bacteria	1284
521	Ga0495625_0186962	3300046660	Bacteria	1374
522	Ga0495625_0274426	3300046660	Bacteria	1087
523	Ga0495635_0004181	3300046663	Bacteria	10017
524	Ga0495635_0343567	3300046663	Bacteria	996
525	Ga0495659_0031283	3300046664	Bacteria	1856
526	Ga0495588_0117080	3300046674	Bacteria	1404
527	Ga0495657_0007045	3300046675	Bacteria	8721
528	Ga0495657_0013461	3300046675	Bacteria	6035
529	Ga0495657_0032417	3300046675	Bacteria	3645
530	Ga0495599_0008603	3300046678	Bacteria	6213
531	Ga0495599_0023698	3300046678	Bacteria	3837
532	Ga0495599_0179530	3300046678	Bacteria	1305
533	Ga0495623_0031410	3300046679	Bacteria	3414
534	Ga0495623_0063605	3300046679	Bacteria	2309
535	Ga0495646_0000902	3300046680	Bacteria	16844
536	Ga0495646_0023142	3300046680	Bacteria	3912
537	Ga0495646_0078983	3300046680	Bacteria	1922
538	Ga0495647_0249932	3300046681	Bacteria	789
539	Ga0495669_0018135	3300046684	Bacteria	3024
540	Ga0495669_0177127	3300046684	Bacteria	1015
541	Ga0495613_0010474	3300046689	Bacteria	6884
542	Ga0495624_0122226	3300046690	Bacteria	1598
543	Ga0495670_0006876	3300046691	Bacteria	5596
544	Ga0495670_0097403	3300046691	Bacteria	1511
545	Ga0495670_0107269	3300046691	Bacteria	1443
546	Ga0495671_0149486	3300046692	Bacteria	1137
547	Ga0495649_0118857	3300046694	Bacteria	1398
548	Ga0495589_0197710	3300046794	Bacteria	949
549	Ga0495600_0002595	3300046809	Bacteria	10414
550	Ga0495600_0053949	3300046809	Bacteria	2625
551	Ga0495581_0209439	3300047315	Bacteria	1140
552	Ga0495604_0005790	3300047317	Bacteria	9806
553	Ga0495604_0046362	3300047317	Bacteria	3388
554	Ga0495604_0256579	3300047317	Bacteria	1190
555	Ga0495604_0312394	3300047317	Bacteria	1052
556	Ga0495636_0157320	3300047318	Bacteria	1022
557	Ga0495674_0166269	3300047319	Bacteria	1843
558	Ga0495674_0270430	3300047319	Bacteria	1394
559	Ga0495674_0412353	3300047319	Bacteria	1089
560	Ga0495672_0040718	3300047320	Bacteria	2815
561	Ga0495672_0040736	3300047320	Bacteria	2814
562	Ga0495676_0032444	3300047321	Bacteria	4408
563	Ga0495676_0082329	3300047321	Bacteria	2436
564	Ga0495676_0301554	3300047321	Bacteria	1080
565	Ga0495680_0015880	3300047322	Bacteria	6481
566	Ga0495680_0020633	3300047322	Bacteria	5537
567	Ga0495683_0096934	3300047323	Bacteria	1422
568	Ga0495683_0155863	3300047323	Bacteria	1059
569	Ga0495687_028376	3300047443	Bacteria	2604
570	Ga0495675_0000801	3300047444	Bacteria	19376
571	Ga0495677_0041915	3300047445	Bacteria	1676
572	Ga0495684_0002197	3300047471	Bacteria	15622
573	Ga0495686_0197946	3300047472	Bacteria	1155
574	Ga0495593_0000197	3300047673	Bacteria	31593
575	Ga0495593_0014166	3300047673	Bacteria	4537
576	Ga0495602_0054577	3300048088	Bacteria	3526
577	Ga0495602_0179492	3300048088	Bacteria	1634
578	Ga0495602_0381603	3300048088	Bacteria	1009
579	Ga0495614_0070598	3300048089	Bacteria	1505
580	Ga0496100_0141848	3300048903	Bacteria	1704
581	Ga0496100_0513748	3300048903	Bacteria	924
582	Ga0496101_0012466	3300048904	Bacteria	5673
583	Ga0496101_0170614	3300048904	Bacteria	1672
584	Ga0496101_0180217	3300048904	Bacteria	1627
585	Ga0496101_0238341	3300048904	Bacteria	1415
586	Ga0496102_0069096	3300048905	Bacteria	3242
587	Ga0496102_0094833	3300048905	Bacteria	2765
588	Ga0496102_0490056	3300048905	Bacteria	1151
589	Ga0496102_0852657	3300048905	Bacteria	833
590	Ga0496103_0282878	3300048906	Bacteria	1067
591	Ga0496103_0409798	3300048906	Bacteria	870
592	Ga0496104_0002918	3300048907	Bacteria	14731
593	Ga0496104_0064908	3300048907	Bacteria	3463
594	Ga0496104_0266429	3300048907	Bacteria	1626
595	Ga0496105_0002457	3300048908	Bacteria	13412
596	Ga0496105_0016466	3300048908	Bacteria	5903
597	Ga0496105_0023125	3300048908	Bacteria	5040
598	Ga0496106_0002213	3300048909	Bacteria	14507
599	Ga0496106_0068753	3300048909	Bacteria	2702
600	Ga0496107_0022554	3300048910	Bacteria	4448
601	Ga0496107_0200918	3300048910	Bacteria	1482
602	Ga0496109_0197482	3300048912	Bacteria	1891
603	Ga0496109_0639189	3300048912	Bacteria	1001
604	Ga0496110_0067758	3300048913	Bacteria	3158
605	Ga0496110_0161328	3300048913	Bacteria	2032
606	Ga0496110_0210294	3300048913	Bacteria	1768
607	Ga0496111_0090614	3300048914	Bacteria	2240
608	Ga0496111_0096390	3300048914	Bacteria	2171
609	Ga0496111_0277638	3300048914	Bacteria	1243
610	Ga0496112_0000035	3300048915	Bacteria	106983
611	Ga0496112_0012881	3300048915	Bacteria	7699
612	Ga0496112_0065317	3300048915	Bacteria	3591
613	Ga0496112_0596809	3300048915	Bacteria	1036
614	Ga0496113_0157326	3300048916	Bacteria	1795
615	Ga0496113_0220430	3300048916	Bacteria	1511
616	Ga0496114_0230187	3300048917	Bacteria	1628
617	Ga0496114_0261935	3300048917	Bacteria	1522
618	Ga0496114_0391963	3300048917	Bacteria	1230
619	Ga0496114_0430594	3300048917	Bacteria	1169
620	Ga0496115_0001562	3300048918	Bacteria	16472
621	Ga0496115_0030634	3300048918	Bacteria	4234
622	Ga0496115_0233826	3300048918	Bacteria	1515
623	Ga0496116_0080308	3300048919	Bacteria	2026
624	Ga0496116_0096514	3300048919	Bacteria	1780
625	Ga0496116_0169658	3300048919	Bacteria	1184
626	Ga0496117_0319666	3300048920	Bacteria	814
627	Ga0496118_0003764	3300048921	Bacteria	18746
628	Ga0496118_0083383	3300048921	Bacteria	2235
629	Ga0496119_0014834	3300048922	Bacteria	6060
630	Ga0496119_0140710	3300048922	Bacteria	1303
631	Ga0496119_0208074	3300048922	Bacteria	1008
632	Ga0496120_0015117	3300048923	Bacteria	5106
633	Ga0496121_0002004	3300048924	Bacteria	32342
634	Ga0496121_0003594	3300048924	Bacteria	21886
635	Ga0496121_0029332	3300048924	Bacteria	5091
636	Ga0496121_0049788	3300048924	Bacteria	3548
637	Ga0496121_0055105	3300048924	Bacteria	3315
638	Ga0496121_0079650	3300048924	Bacteria	2600
639	Ga0496121_0100954	3300048924	Bacteria	2226
640	Ga0496121_0107036	3300048924	Bacteria	2142
641	Ga0496121_0159796	3300048924	Bacteria	1649
642	Ga0496121_0160632	3300048924	Bacteria	1643
643	Ga0496121_0221465	3300048924	Bacteria	1332
644	Ga0496122_0230101	3300048925	Bacteria	1055
645	Ga0496124_0004431	3300048927	Bacteria	16374
646	Ga0496124_0115904	3300048927	Bacteria	2149
647	Ga0496124_0264123	3300048927	Bacteria	1265
648	Ga0496125_0009386	3300048928	Bacteria	10066
649	Ga0496125_0015958	3300048928	Bacteria	7234
650	Ga0496125_0033475	3300048928	Bacteria	4548
651	Ga0496125_0049939	3300048928	Bacteria	3469
652	Ga0496125_0156536	3300048928	Bacteria	1556
653	Ga0496125_0287582	3300048928	Bacteria	1014
654	Ga0496126_0005839	3300048929	Bacteria	13910
655	Ga0496126_0015269	3300048929	Bacteria	7730
656	Ga0496126_0016304	3300048929	Bacteria	7433
657	Ga0496126_0021771	3300048929	Bacteria	6253
658	Ga0496126_0042045	3300048929	Bacteria	4224
659	Ga0496126_0074097	3300048929	Bacteria	3024
660	Ga0496126_0087995	3300048929	Bacteria	2737
661	Ga0496126_0148053	3300048929	Bacteria	2014
662	Ga0496126_0257808	3300048929	Bacteria	1451
663	Ga0496126_0320479	3300048929	Bacteria	1274
664	Ga0496126_0359417	3300048929	Bacteria	1189
665	Ga0496126_0362065	3300048929	Bacteria	1184
666	Ga0496126_0670038	3300048929	Bacteria	809
667	Ga0501031_0001791	3300049568	Bacteria	13478
668	Ga0501031_0094928	3300049568	Bacteria	1946
669	Ga0501032_0000073	3300049569	Bacteria	85584
670	Ga0501032_0134943	3300049569	Bacteria	1627
671	Ga0501033_0000136	3300049570	Bacteria	70952
672	Ga0501033_0170514	3300049570	Bacteria	1563
673	Ga0501034_0000251	3300049571	Bacteria	99406
674	Ga0501036_0000036	3300049572	Bacteria	87244
675	Ga0501036_0198686	3300049572	Bacteria	1687
676	Ga0501037_0001715	3300049573	Bacteria	15897
677	Ga0501038_0000428	3300049574	Bacteria	36623
678	Ga0501038_0184091	3300049574	Bacteria	1684
679	Ga0501039_0000273	3300049575	Bacteria	37431
680	Ga0501042_0019699	3300049578	Bacteria	4690
681	Ga0501043_0000165	3300049579	Bacteria	59980
682	Ga0501046_0001143	3300049580	Bacteria	25820
683	Ga0501046_0132247	3300049580	Bacteria	1892
684	Ga0501047_0000340	3300049581	Bacteria	53278
685	Ga0501047_0069206	3300049581	Bacteria	3399
686	Ga0501048_0004991	3300049582	Bacteria	10119
687	Ga0501067_0014425	3300049583	Bacteria	4375
688	Ga0501068_0003807	3300049584	Bacteria	8179
689	Ga0501069_0005466	3300049585	Bacteria	6608
690	Ga0501069_0163778	3300049585	Bacteria	1281
691	Ga0501070_0006502	3300049586	Bacteria	9938
692	Ga0501070_0241660	3300049586	Bacteria	1478
693	Ga0501070_0305476	3300049586	Bacteria	1295
694	Ga0501071_0081590	3300049587	Bacteria	2367
695	Ga0501072_0001213	3300049588	Bacteria	19257
696	Ga0501073_0000037	3300049589	Bacteria	87345
697	Ga0501073_0107389	3300049589	Bacteria	1937
698	Ga0501074_0000133	3300049590	Bacteria	38342
699	Ga0501074_0192975	3300049590	Bacteria	1452
700	Ga0501076_0247087	3300049592	Bacteria	1460
701	Ga0501079_0001057	3300049741	Bacteria	19118
702	Ga0501080_0113721	3300049742	Bacteria	2509
703	Ga0501083_0100479	3300049744	Bacteria	1907
704	Ga0501035_0000142	3300049822	Bacteria	87561
705	Ga0501035_0074180	3300049822	Bacteria	3010
706	Ga0501044_0000414	3300049823	Bacteria	52784
707	Ga0501045_0025367	3300049824	Bacteria	4261
708	nmdc:mga03n38_71195_c1	3300050490	Bacteria	1610
709	nmdc:mga03n38_957_c1	3300050490	Bacteria	7831
710	nmdc:mga00v17_141809_c1	3300050491	Bacteria	1541
711	nmdc:mga00v17_71532_c1	3300050491	Bacteria	2150
712	nmdc:mga0yw44_131934_c1	3300050492	Bacteria	1618
713	nmdc:mga0yw44_227370_c1	3300050492	Bacteria	1238
714	nmdc:mga0yw44_38444_c1	3300050492	Bacteria	2832
715	nmdc:mga0yw44_413426_c1	3300050492	Bacteria	913
716	nmdc:mga0yw44_469248_c1	3300050492	Bacteria	853
717	nmdc:mga0yw44_52344_c1	3300050492	Bacteria	2475
718	nmdc:mga0yw44_6610_c1	3300050492	Bacteria	5619
719	nmdc:mga0k408_193695_c1	3300050493	Bacteria	1213
720	nmdc:mga0k408_225342_c1	3300050493	Bacteria	1119
721	nmdc:mga0k408_34806_c1	3300050493	Bacteria	2885
722	nmdc:mga0k408_39579_c1	3300050493	Bacteria	2710
723	nmdc:mga06z11_2498_c1	3300050494	Bacteria	7030
724	nmdc:mga06z11_36176_c1	3300050494	Bacteria	2436
725	nmdc:mga04h51_101107_c1	3300050495	Bacteria	1051
726	nmdc:mga04h51_127848_c1	3300050495	Bacteria	953
727	nmdc:mga07m45_153225_c1	3300050496	Bacteria	1337
728	nmdc:mga07m45_20753_c1	3300050496	Bacteria	3570
729	nmdc:mga07m45_2419_c1	3300050496	Bacteria	8757
730	nmdc:mga08y16_127311_c1	3300050511	Bacteria	2649
731	nmdc:mga0n895_45691_c1	3300050512	Bacteria	4274
732	nmdc:mga0a205_126412_c1	3300050515	Bacteria	2456
733	nmdc:mga0sz30_193234_c1	3300050516	Bacteria	903
734	nmdc:mga0sz30_4553_c1	3300050516	Bacteria	5021
735	Ga0495601_0025532	3300053077	Bacteria	3644
736	Ga0500635_0004941	3300053080	Bacteria	3465
737	Ga0495595_0035155	3300053084	Bacteria	2269
738	Ga0495595_0041145	3300053084	Bacteria	2113
739	Ga0495619_0001183	3300053085	Bacteria	17177
740	Ga0495619_0121113	3300053085	Bacteria	1794
741	Ga0495619_0186825	3300053085	Bacteria	1434
742	Ga0500643_000048	3300053087	Bacteria	147879
743	Ga0500581_153408	3300053089	Bacteria	1078
744	Ga0500646_0101211	3300053090	Bacteria	905
745	Ga0500647_0051056	3300053091	Bacteria	1989
746	Ga0500647_0101004	3300053091	Bacteria	1377
747	Ga0500583_0120699	3300053092	Bacteria	1296
748	Ga0500651_0290554	3300053093	Bacteria	940
749	Ga0500651_0307144	3300053093	Bacteria	909
750	Ga0500566_0000223	3300053094	Bacteria	30380
751	Ga0500566_0001615	3300053094	Bacteria	13269
752	Ga0500566_0098026	3300053094	Bacteria	1611
753	Ga0500640_022290	3300053095	Bacteria	2736
754	Ga0500641_0133850	3300053096	Bacteria	1070
755	Ga0500648_142067	3300053097	Bacteria	1288
756	Ga0500648_164213	3300053097	Bacteria	1164
757	Ga0500554_084251	3300053102	Bacteria	1050
758	Ga0500556_0000003	3300053104	Bacteria	679379
759	Ga0500557_000083	3300053105	Bacteria	32931
760	Ga0500562_042218	3300053108	Bacteria	1213
761	Ga0500572_003205	3300053111	Bacteria	3773
762	Ga0500594_0051718	3300053118	Bacteria	1159
763	Ga0500595_004510	3300053119	Bacteria	6232
764	Ga0500595_028692	3300053119	Bacteria	1895
765	Ga0500597_201579	3300053120	Bacteria	835
766	Ga0500607_021788	3300053121	Bacteria	3606
767	Ga0500608_033386	3300053122	Bacteria	2448
768	Ga0500608_168909	3300053122	Bacteria	940
769	Ga0500614_007794	3300053123	Bacteria	2262
770	Ga0500642_0025939	3300053130	Bacteria	2387
771	Ga0500642_0061598	3300053130	Bacteria	1686
772	Ga0500658_0145192	3300053134	Bacteria	1066
773	Ga0500559_0009186	3300053136	Bacteria	4292
774	Ga0500559_0011419	3300053136	Bacteria	3792
775	Ga0500568_0029325	3300053139	Bacteria	2285
776	Ga0500577_0030134	3300053142	Bacteria	1886
777	Ga0500589_047932	3300053147	Bacteria	1987
778	Ga0500590_084088	3300053148	Bacteria	1558
779	Ga0500603_000178	3300053150	Bacteria	16265
780	Ga0500603_000237	3300053150	Bacteria	14490
781	Ga0500603_061699	3300053150	Bacteria	1050
782	Ga0500616_0000033	3300053153	Bacteria	398830
783	Ga0500616_0000038	3300053153	Bacteria	386801
784	Ga0500620_124284	3300053155	Bacteria	904
785	Ga0500627_0093096	3300053158	Bacteria	1349
786	Ga0500630_000468	3300053159	Bacteria	17761
787	Ga0500633_0120489	3300053160	Bacteria	976
788	Ga0500634_0072138	3300053161	Bacteria	1804
789	Ga0500634_0081768	3300053161	Bacteria	1662
790	Ga0500639_004846	3300053163	Bacteria	6855
791	Ga0500639_080372	3300053163	Bacteria	1643
792	Ga0500636_0000148	3300053177	Bacteria	36338
793	Ga0500637_0038025	3300053178	Bacteria	2709
794	Ga0500637_0110806	3300053178	Bacteria	1591
795	Ga0500649_056549	3300053722	Bacteria	1641
796	Ga0500611_029951	3300053727	Bacteria	1118
797	Ga0500645_045000	3300053730	Bacteria	1297
798	Ga0500596_000423	3300053735	Bacteria	7778
799	Ga0500599_000986	3300053736	Bacteria	3184
800	Ga0500601_000280	3300053737	Bacteria	9696
801	Ga0500601_004972	3300053737	Bacteria	1453
802	Ga0501084_0006462	3300054114	Bacteria	9639
803	Ga0501082_0002719	3300060353	Bacteria	15447
804	Ga0501082_0646313	3300060353	Bacteria	926
805	Ga0466962_0082347	3300061719	Bacteria	1539
806	2507505905	2507262055	Bacteria	8048963
807	2508540096	2508501009	Bacteria	7784016
808	2508696166	2508501042	Bacteria	8719808
809	2509151543	2508501128	Bacteria	8613869
810	2511396610	2511231028	Bacteria	8046582
811	2513627460	2513237092	Bacteria	8341956
812	2513638346	2513237094	Bacteria	8789602
813	2513649878	2513237095	Bacteria	8976980
814	2513659775	2513237096	Bacteria	8722461
815	2513676898	2513237098	Bacteria	9902361
816	2513696305	2513237101	Bacteria	7952346
817	2513705895	2513237102	Bacteria	7703324
818	2513715407	2513237104	Bacteria	10034502
819	2513857238	2513237137	Bacteria	9558895
820	2513877261	2513237139	Bacteria	8737671
821	2513891624	2513237141	Bacteria	8496279
822	2513918851	2513237145	Bacteria	8979722
823	2514014636	2513237161	Bacteria	8871253
824	2515631378	2515154112	Bacteria	8294334
825	2517105683	2517093001	Bacteria	9002274
826	2517888178	2517572143	Bacteria	9484767
827	2524442988	2524023205	Bacteria	8918781
828	2524468617	2524023210	Bacteria	9029266
829	2524533354	2524023228	Bacteria	10118060
830	2528855113	2528768022	Bacteria	10457665
831	2617347787	2617270735	Bacteria	9163226
832	2617374710	2617270741	Bacteria	8201522
833	2644290508	2643221651	Bacteria	4798932
834	2671119362	2667528175	Bacteria	7532676
835	2723842262	2721755755	Bacteria	8322773
836	2745081922	2744054633	Bacteria	8678936
837	2793061557	2791355196	Bacteria	7323613
838	2793073446	2791355197	Bacteria	8420563
839	2793077967
840	2805916139	2802429603	Bacteria	8777136
841	2818240878	2816332527	Bacteria	8933356
842	2824605516	2824600985	Bacteria	8488197
843	2824610814	2824609381	Bacteria	8672835
844	2824623174	2824617872	Bacteria	8814715
845	2824627806	2824626560	Bacteria	8813858
846	2824642676	2824635225	Bacteria	8785348
847	2824650566	2824644064	Bacteria	8743947
848	2824653866	2824653114	Bacteria	8493680
849	2824663779	2824661429	Bacteria	9877870
850	2824676101	2824671348	Bacteria	8369588
851	2824686518	2824679649	Bacteria	8248951
852	2824692454	2824687955	Bacteria	8360029
853	2824699877	2824696289	Bacteria	8335049
854	2824713630	2824704595	Bacteria	9667483
855	2824720414	2824714736	Bacteria	8717648
856	2824730639	2824723954	Bacteria	8758240
857	2824740318	2824732956	Bacteria	7810675
858	2824753677	2824746037	Bacteria	7911610
859	2824763430	2824753945	Bacteria	9787441
860	2824772167	2824763712	Bacteria	9792355
861	2824775730	2824773399	Bacteria	8360218
862	2838125106	2838122688	Bacteria	8803140
863	2841945844	2841941048	Bacteria	8688029
864	2841957742	2841949485	Bacteria	8680857
865	2841960574	2841957949	Bacteria	8652217
866	2841973345	2841966195	Bacteria	8673214
867	2841979491	2841974524	Bacteria	8931498
868	2841989384	2841983080	Bacteria	8395090
869	2842044375	2842038055	Bacteria	8002051
870	2842051636	2842045827	Bacteria	8006841
871	2844316228	2844315083	Bacteria	8138177
872	2847939460	2847930680	Bacteria	9342022
873	2847941210	2847939898	Bacteria	8606328
874	2849082201	2849076700	Bacteria	7039503
875	2857513323	2857509624	Bacteria	7472071
876	2874596359	2874590934	Bacteria	8299676
877	2874610149	2874604998	Bacteria	7834745
878	2874620228	2874612657	Bacteria	8252029
879	2874622452	2874620515	Bacteria	8290088
880	2874633331	2874628541	Bacteria	8630250
881	2874650347	2874645413	Bacteria	8214782
882	2876761648	2876761206	Bacteria	10111113
883	2876776824	2876771140	Bacteria	8287509
884	2876813545	2876808645	Bacteria	8824342
885	2876824614	2876818435	Bacteria	8274608
886	2879080961	2879074833	Bacteria	8279565
887	2879091098	2879083081	Bacteria	8587928
888	2879106661	2879099564	Bacteria	10442239
889	2879117017	2879110137	Bacteria	8907982
890	2879133807	2879127579	Bacteria	8294491
891	2879143067	2879142872	Bacteria	8267021
892	2881369621	2881364244	Bacteria	7710352
893	2881670143	2881665667	Bacteria	8175609
894	2885367730	2885366525	Bacteria	8326213
895	2885380638	2885374607	Bacteria	8927485
896	2885390783	2885383462	Bacteria	9473874
897	2885418275	2885409591	Bacteria	9235467
898	2888387731	2888378607	Bacteria	9652610
899	2888389951	2888388044	Bacteria	7304136
900	2888421151	2888419890	Bacteria	7857137
901	2889036383	2889033259	Bacteria	9099371
902	2903728435	2903727486	Bacteria	8281579
903	2903754030	2903748898	Bacteria	9972761
904	2903776660	2903768456	Bacteria	9749579
905	2904671541	2904666416	Bacteria	8226587
906	2904695752	2904690495	Bacteria	9412302
907	2904710023
908	2904719833	2904711408	Bacteria	9771557
909	2906606577	2906602504	Bacteria	8295279
910	2906614464
911	2906630877	2906626472	Bacteria	8826946
912	2906643412	2906635258	Bacteria	8601019
913	2906650295	2906643746	Bacteria	8722424
914	2906666604	2906660503	Bacteria	8595048
915	2908746706	2908739725	Bacteria	8628932
916	2908764267	2908756301	Bacteria	8864324
917	2908777193	2908775508	Bacteria	8092255
918	2919078947	2919073203	Bacteria	6531949
919	2922366739	2922361189	Bacteria	7436256
920	2922377437
921	2922389358	2922386360	Bacteria	7017218
922	2922398529	2922393267	Bacteria	8285685
923	2922426300
924	2929622227	2929615660	Bacteria	9193770
925	2929630126	2929624759	Bacteria	9339455
926	2932787943	2932784394	Bacteria	9704911
927	2932796052	2932794094	Bacteria	7915132
928	2932807629	2932801729	Bacteria	7987968
929	2932813318	2932809354	Bacteria	9135765
930	2932820015	2932818245	Bacteria	9955613
931	2932832921	2932828146	Bacteria	9745859
932	2933584159	2933577622	Bacteria	9116884
933	2935614327	2935608549	Bacteria	8203142
934	2935620406	2935616580	Bacteria	9032984
935	2935632683	2935630451	Bacteria	8169952
936	2935640730	2935638405	Bacteria	10015038
937	2935649357	2935648319	Bacteria	8801166
938	2935657871	2935656913	Bacteria	8965014
939	2935668922	2935665750	Bacteria	9571747
940	2935681352	2935675223	Bacteria	9928132
941	2935687231	2935684952	Bacteria	9590419
942	2935696798	2935694250	Bacteria	9291695
943	2935709110	2935703347	Bacteria	10242284
944	2935716919	2935713505	Bacteria	9608509
945	2935722956	2935722832	Bacteria	9608746
946	2935734513	2935732158	Bacteria	9706831
947	2935744696	2935741537	Bacteria	9707219
948	2935753197	2935750917	Bacteria	9590372
949	2935767601	2935760218	Bacteria	9817913
950	2935770196	2935769743	Bacteria	7878163
951	2935777774	2935777560	Bacteria	8077691
952	2935786750	2935785616	Bacteria	7962367
953	2935794804	2935793552	Bacteria	8012592
954	2935804840	2935801545	Bacteria	9301974
955	2935815989	2935810662	Bacteria	9401221
956	2935826545	2935819856	Bacteria	8261050
957	2935832237	2935827899	Bacteria	10038562
958	2935840933	2935837841	Bacteria	9454360
959	2935851161	2935847175	Bacteria	8228321
960	2935859292	2935855204	Bacteria	9035059
961	2935864476	2935864058	Bacteria	9784707
962	2935875172	2935873716	Bacteria	9632195
963	2935887334	2935883170	Bacteria	7964738
964	2935913210	2935908558	Bacteria	8568796
965	2935922632	2935916978	Bacteria	9113783
966	2935930865	2935926038	Bacteria	8601059
967	2935939801	2935934488	Bacteria	8602579
968	2935946750	2935942939	Bacteria	8599779
969	2935956049	2935951376	Bacteria	8602333
970	2935964954	2935959822	Bacteria	7869783
971	2935972842	2935967501	Bacteria	8603075
972	2935978241	2935975950	Bacteria	8347125
973	2935985633	2935984226	Bacteria	8302647
974	2935995853	2935992306	Bacteria	9802711
975	2936005764	2936002035	Bacteria	9362176
976	2936012090	2936011229	Bacteria	8801034
977	2936020829	2936019824	Bacteria	8804134
978	2936029383	2936028420	Bacteria	8965941
979	2936041892	2936037263	Bacteria	9446081
980	2936048293	2936046547	Bacteria	8903709
981	2936056596	2936055302	Bacteria	8785755
982	2940559110	2940556831	Bacteria	9590747
983	2941508653	2941507105	Bacteria	8166816
984	2941516483	2941515067	Bacteria	8166720
985	2941524501	2941523033	Bacteria	8169134
986	2941534605	2941531003	Bacteria	7653939
987	2941541805	2941538514	Bacteria	9402094
988	3005475662	3005474847	Bacteria	9259049
989	3005489738	3005483717	Bacteria	7877331
990	3005592189	3005587118	Bacteria	7794411
991	3005595839	3005594810	Bacteria	8716512
992	3005711795	3005710791	Bacteria	7622528
993	3005719044	3005718088	Bacteria	8283608
994	8006932284	8006926726	Bacteria	6749210
995	8006937002	8006933436	Bacteria	10410654
996	8006966332	8006964411	Bacteria	8966052
997	8006976967	8006973647	Bacteria	10679141
998	8006993150	8006984368	Bacteria	9651211
999	8006997002	8006994254	Bacteria	8309700
1000	8016517280	8016511872	Bacteria	9921665
1001	8016526953	8016522445	Bacteria	8156687
1002	8016532038	8016530956	Bacteria	8155261
1003	8016556841	8016548790	Bacteria	8155074
1004	8016565194	8016557553	Bacteria	8154380
1005	8016570326	8016566248	Bacteria	8158151
1006	8016582874	8016575299	Bacteria	8154085
1007	8016585421	8016583857	Bacteria	10421953
1008	8016602837	8016595262	Bacteria	8149947
1009	8016605706	8016603502	Bacteria	8731218
1010	8016623956	8016622563	Bacteria	7999408
1011	8016634907	8016630954	Bacteria	9217207
1012	8017059315	8017057580	Bacteria	10023680
1013	8019539675	8019538911	Bacteria	7872763
1014	8019550976	8019547302	Bacteria	7996444
1015	8019561674	8019555841	Bacteria	9642137
1016	8019571748	8019565922	Bacteria	9639779
1017	8019576312	8019576017	Bacteria	10049540
1018	8019594185	8019586578	Bacteria	10212056
1019	8019607377	8019597564	Bacteria	10041141
1020	8019611135	8019608314	Bacteria	10042931
1021	8019621984	8019619141	Bacteria	9218857
1022	8019631336	8019629233	Bacteria	8687553
1023	8019639284	8019638758	Bacteria	9062356
1024	8019651421	8019648815	Bacteria	10014479
1025	8019677606	8019668869	Bacteria	8791617
1026	8019693319	8019687851	Bacteria	8712826
1027	8055743524	8055742211	Bacteria	9226248
1028	8056678188	8056673599	Bacteria	7871253
1029	8056683420	8056681323	Bacteria	8472857
1030	8056692715	8056689827	Bacteria	6712655
1031	8056974183	8056967851	Bacteria	9038162
1032	Ga0081539_10000157
1033	JGI25406J46586_10000233
1034	JGI25406J46586_10014781
1035	JGI25153J46596_10003109
1036	JGI25153J46596_10006692
1037	JGI25153J46596_10006901
1038	JGI25153J46596_10007168
1039	JGI25160J50197_1002717
1040	JGI25160J50197_1002793
1041	JGI25404J52841_10009156
1042	Ga0055526_1028100
1043	Ga0055526_1037239
1044	Ga0055524_1024893
1045	Ga0055531_10005040
1046	Ga0055543_1010561
1047	Ga0065165_1001167
1048	Ga0065165_1002365
1049	Ga0065165_1004614
1050	Ga0070676_10098242
1051	Ga0070683_100151538
1052	Ga0068869_100600464
1053	Ga0070682_100494167
1054	Ga0068868_100003791
1055	Ga0068868_100005952
1056	Ga0070660_100685900
1057	Ga0070689_100305291
1058	Ga0070689_100371337
1059	Ga0070687_100202447
1060	Ga0070661_100454071
1061	Ga0070668_100070775
1062	Ga0070668_100123195
1063	Ga0070668_100438028
1064	Ga0070671_100026970
1065	Ga0070674_100028834
1066	Ga0070688_100460316
1067	Ga0070667_100138459
1068	Ga0070667_100723424
1069	Ga0070667_100813763
1070	Ga0070714_100081216
1071	Ga0070714_100154798
1072	Ga0070713_100076654
1073	Ga0070713_100121261
1074	Ga0070701_10128612
1075	Ga0070711_100117909
1076	Ga0070700_100303296
1077	Ga0070708_100112222
1078	Ga0070663_100029001
1079	Ga0070663_100051373
1080	Ga0070663_100077055
1081	Ga0070663_100296199
1082	Ga0070663_100354043
1083	Ga0070663_100431545
1084	Ga0070678_100123490
1085	Ga0070678_100388653
1086	Ga0070662_100048025
1087	Ga0070662_100173361
1088	Ga0070662_100262189
1089	Ga0070662_100421936
1090	Ga0070681_10386740
1091	Ga0068867_100138531
1092	Ga0070707_100040752
1093	Ga0070679_100414275
1094	Ga0068853_100037952
1095	Ga0068853_100870639
1096	Ga0070695_100300271
1097	Ga0070693_100144990
1098	Ga0070665_100004629
1099	Ga0070665_100017342
1100	Ga0070665_100055288
1101	Ga0070665_100061338
1102	Ga0070665_100102146
1103	Ga0070665_100375135
1104	Ga0070665_100606593
1105	Ga0070665_100964745
1106	Ga0070665_101076840
1107	Ga0068855_100224614
1108	Ga0068855_100796719
1109	Ga0070664_100226640
1110	Ga0068857_100212254
1111	Ga0068854_100332233
1112	Ga0068856_100000137
1113	Ga0068856_100067105
1114	Ga0068856_100411833
1115	Ga0068852_100158408
1116	Ga0068852_100158557
1117	Ga0068859_100059281
1118	Ga0068859_100162661
1119	Ga0068859_100950759
1120	Ga0068864_100390668
1121	Ga0068866_10209877
1122	Ga0068861_100054426
1123	Ga0068861_100127349
1124	Ga0068863_100322968
1125	Ga0068858_100027993
1126	Ga0068858_100072012
1127	Ga0068858_100148098
1128	Ga0068860_100019679
1129	Ga0068860_100546185
1130	Ga0068860_100619528
1131	Ga0068862_100169583
1132	Ga0068862_100358560
1133	Ga0068862_100480102
1134	Ga0081455_10007493
1135	Ga0081455_10165226
1136	Ga0081455_10324142
1137	Ga0081540_1005657
1138	Ga0081540_1016780
1139	Ga0081540_1019710
1140	Ga0081540_1032245
1141	Ga0081540_1044694
1142	Ga0081539_10002599
1143	Ga0081539_10022796
1144	Ga0081539_10043656
1145	Ga0081539_10112609
1146	Ga0070717_10047127
1147	Ga0070717_10074934
1148	Ga0075365_10008447
1149	Ga0075365_10012998
1150	Ga0075365_10133182
1151	Ga0075365_10176105
1152	Ga0075365_10284661
1153	Ga0075368_10002578
1154	Ga0075368_10062537
1155	Ga0075363_100031275
1156	Ga0075363_100039346
1157	Ga0075363_100071697
1158	Ga0075363_100215142
1159	Ga0075364_10066031
1160	Ga0075362_10100011
1161	Ga0075367_10001394
1162	Ga0075367_10012975
1163	Ga0075367_10034882
1164	Ga0075367_10041778
1165	Ga0075367_10083384
1166	Ga0075369_10084304
1167	Ga0075366_10029117
1168	Ga0075366_10334458
1169	Ga0097621_100045501
1170	Ga0075370_10001262
1171	Ga0075370_10262459
1172	Ga0075370_10281096
1173	Ga0068871_100613090
1174	Ga0075433_10488424
1175	Ga0075434_100104354
1176	Ga0068865_100276285
1177	Ga0075436_100167642
1178	Ga0097620_100059286
1179	Ga0097620_100162658
1180	Ga0097620_100950748
1181	Ga0099824_1008303
1182	Ga0099824_1022009
1183	Ga0099794_10012053
1184	Ga0105251_10094610
1185	Ga0105250_10043823
1186	Ga0105240_10000121
1187	Ga0105240_10031167
1188	Ga0111539_10264263
1189	Ga0111539_10953423
1190	Ga0105245_10273940
1191	Ga0105245_10282026
1192	Ga0105245_10571510
1193	Ga0105247_10030808
1194	Ga0105247_10101421
1195	Ga0105243_10874529
1196	Ga0105241_10054690
1197	Ga0105242_10497260
1198	Ga0105242_10667443
1199	Ga0105248_10130064
1200	Ga0105237_10016562
1201	Ga0105237_10099042
1202	Ga0105237_10794386
1203	Ga0105237_10935097
1204	Ga0105249_10137175
1205	Ga0105239_10008448
1206	Ga0105239_10066232
1207	Ga0105239_11038701
1208	Ga0105246_10161324
1209	Ga0157371_10082442
1210	Ga0157369_10006548
1211	Ga0157374_10090050
1212	Ga0157374_10370475
1213	Ga0157378_10084842
1214	Ga0157378_10254232
1215	Ga0157378_10393520
1216	Ga0163162_10171792
1217	Ga0163162_10349456
1218	Ga0163162_10971496
1219	Ga0157372_10052615
1220	Ga0157375_10266632
1221	Ga0157375_10453163
1222	Ga0157375_10647836
1223	Ga0163163_10268923
1224	Ga0163163_10840603
1225	Ga0157380_10609065
1226	Ga0157376_10361432
1227	Ga0182007_10084122
1228	Ga0163161_10433180
1229	Ga0214544_1000011
1230	Ga0214542_1000009
1231	Ga0214545_1000007
1232	Ga0214543_1000020
1233	Ga0213872_10099024
1234	Ga0213876_10017171
1235	Ga0213876_10055144
1236	Ga0213871_10004133
1237	Ga0209563_102736
1238	Ga0209677_106149
1239	Ga0209148_1000300
1240	Ga0209233_1004101
1241	Ga0209233_1008642
1242	Ga0209455_1006377
1243	Ga0209673_1041479
1244	Ga0209564_1008994
1245	Ga0209564_1021745
1246	Ga0209758_1000015
1247	Ga0209758_1001468
1248	Ga0209758_1001864
1249	Ga0209758_1002683
1250	Ga0209758_1004096
1251	Ga0209256_1004771
1252	Ga0209256_1019960
1253	Ga0207426_1001932
1254	Ga0207426_1003610
1255	Ga0209257_1001688
1256	Ga0209257_1014108
1257	Ga0207697_10067446
1258	Ga0207697_10076913
1259	Ga0207697_10103044
1260	Ga0207710_10056004
1261	Ga0207688_10020180
1262	Ga0207688_10020254
1263	Ga0207680_10118134
1264	Ga0207647_10009749
1265	Ga0207643_10162205
1266	Ga0207643_10403805
1267	Ga0207654_10120242
1268	Ga0207707_10000613
1269	Ga0207695_10000006
1270	Ga0207695_10020632
1271	Ga0207695_10125057
1272	Ga0207671_10021492
1273	Ga0207671_10094149
1274	Ga0207671_10163779
1275	Ga0207671_10293118
1276	Ga0207671_10368340
1277	Ga0207693_10092965
1278	Ga0207662_10090012
1279	Ga0207657_10006552
1280	Ga0207649_10675564
1281	Ga0207652_10023738
1282	Ga0207652_10265663
1283	Ga0207646_10069265
1284	Ga0207650_10040713
1285	Ga0207650_10336515
1286	Ga0207687_10008467
1287	Ga0207687_10218402
1288	Ga0207700_10062135
1289	Ga0207700_10726759
1290	Ga0207664_10165830
1291	Ga0207664_10210920
1292	Ga0207644_10209671
1293	Ga0207644_10413187
1294	Ga0207644_10526090
1295	Ga0207706_10048646
1296	Ga0207706_10129302
1297	Ga0207706_10196538
1298	Ga0207686_10034931
1299	Ga0207686_10227992
1300	Ga0207709_10022565
1301	Ga0207669_10005788
1302	Ga0207704_10799041
1303	Ga0207665_10168978
1304	Ga0207691_10213345
1305	Ga0207691_10537233
1306	Ga0207689_10033801
1307	Ga0207689_10060594
1308	Ga0207661_10290886
1309	Ga0207679_10427194
1310	Ga0207667_10043759
1311	Ga0207667_10664290
1312	Ga0207712_10212719
1313	Ga0207712_10285337
1314	Ga0207668_10049194
1315	Ga0207640_10008004
1316	Ga0207658_10456595
1317	Ga0207677_10116688
1318	Ga0207703_10098817
1319	Ga0207703_10110364
1320	Ga0207703_10674036
1321	Ga0207639_10174484
1322	Ga0207639_10488144
1323	Ga0207639_10600646
1324	Ga0207678_10017766
1325	Ga0207678_10045553
1326	Ga0207678_10103531
1327	Ga0207702_10000063
1328	Ga0207641_10083326
1329	Ga0207641_10341446
1330	Ga0207648_10300546
1331	Ga0207648_10374533
1332	Ga0207676_10078760
1333	Ga0207676_10267134
1334	Ga0207676_10348468
1335	Ga0207674_10088725
1336	Ga0207674_10154547
1337	Ga0207675_100285092
1338	Ga0207675_100523341
1339	Ga0207683_10130636
1340	Ga0207683_10179416
1341	Ga0207683_10317978
1342	Ga0207698_10041987
1343	Ga0207698_10099520
1344	Ga0209389_1000012
1345	Ga0209389_1000069
1346	Ga0209589_1000077
1347	Ga0209489_100019
1348	Ga0209489_100020
1349	Ga0209700_100018
1350	Ga0209588_1059642
1351	Ga0209813_10085362
1352	Ga0207428_10207262
1353	Ga0268266_10003840
1354	Ga0268266_10021889
1355	Ga0268266_10034518
1356	Ga0268266_10108774
1357	Ga0268266_10340135
1358	Ga0268266_10351443
1359	Ga0268266_10493670
1360	Ga0268266_11090997
1361	Ga0268265_10096091
1362	Ga0268265_10241095
1363	Ga0268265_10706549
1364	Ga0268264_10002781
1365	Ga0265334_10014881
1366	Ga0265330_10048056
1367	Ga0265328_10021367
1368	Ga0265325_10041402
1369	Ga0265340_10002373
1370	Ga0265340_10026354
1371	Ga0265339_10002052
1372	Ga0265331_10058755
1373	Ga0307513_10097538
1374	Ga0307509_10209644
1375	Ga0307408_100971292
1376	Ga0307508_10000012
1377	Ga0307508_10013966
1378	Ga0307508_10131661
1379	Ga0307508_10207693
1380	Ga0265314_10007457
1381	Ga0265342_10150161
1382	Ga0265342_10157241
1383	Ga0307516_10076120
1384	Ga0307405_10436833
1385	Ga0307406_10775644
1386	Ga0307412_10609005
1387	Ga0307412_10861103
1388	Ga0307409_101019315
1389	Ga0307411_10270984
1390	Ga0307415_100056057
1391	Ga0307507_10136108
1392	Ga0307507_10264011
1393	Ga0307510_10010708
1394	Ga0307510_10027511
1395	Ga0307510_10128834
1396	Ga0373938_0038704
1397	Ga0373934_0025438
1398	Ga0373936_0021555
1399	Ga0373953_0000338
1400	Ga0373954_0000194
1401	Ga0373956_0003246
1402	Ga0373956_0118063
1403	Ga0373957_0019923
1404	Ga0373943_0095744
1405	Ga0373955_0003154
1406	Ga0373924_0018288
1407	Ga0373931_0009747
1408	Ga0373935_0043887
1409	Ga0373935_0154674
1410	Ga0373935_0224751
1411	Ga0373935_0293185
1412	Ga0373927_0003718
1413	Ga0373927_0008557
1414	Ga0373933_0000108
1415	Ga0373933_0003363
1416	Ga0373933_0126141
1417	Ga0373947_0050685
1418	Ga0373947_0104969
1419	Ga0373937_0011517
1420	Ga0373937_0101404
1421	Ga0373925_0027502
1422	Ga0395900_0001756
1423	Ga0395900_0010446
1424	Ga0395898_0005085
1425	Ga0395898_0023342
1426	Ga0395898_0024069
1427	Ga0395898_0035306
1428	Ga0395898_0337613
1429	Ga0395905_0018632
1430	Ga0395905_0025441
1431	Ga0436364_0697116
1432	Ga0395901_0017340
1433	Ga0436365_0068519
1434	Ga0436365_0457714
1435	Ga0436365_0592130
1436	Ga0436365_1486980
1437	Ga0436360_0794974
1438	Ga0436361_0246805
1439	Ga0436361_0792065
1440	Ga0436363_0927651
1441	Ga0436362_0210097
1442	Ga0436362_0371526
1443	Ga0436362_1086659
1444	Ga0439461_0017440
1445	Ga0439465_0083186
1446	Ga0439465_0088923
1447	Ga0451802_0336070
1448	Ga0451843_0367960
1449	Ga0466969_0054903
1450	Ga0466969_0106885
1451	Ga0466972_0000100
1452	Ga0466965_0022896
1453	Ga0466965_0023179
1454	Ga0466965_0121747
1455	Ga0466966_0001421
1456	Ga0466961_0000138
1457	Ga0466961_0065519
1458	Ga0466968_0005962
1459	Ga0466970_0091407
1460	Ga0466957_0070517
1461	Ga0466960_0109289
1462	Ga0466960_0122694
1463	Ga0466960_0163358
1464	Ga0466959_0011733
1465	Ga0466959_0023353
1466	Ga0466959_0375190
1467	Ga0466959_0506118
1468	Ga0451576_0323667
1469	Ga0466958_0054618
1470	Ga0466958_0236609
1471	Ga0466967_0328838
1472	Ga0495617_111595
1473	Ga0495592_0000339
1474	Ga0495592_0030651
1475	Ga0495592_0250316
1476	Ga0495603_0011788
1477	Ga0495603_0030491
1478	Ga0495603_0071465
1479	Ga0495603_0165152
1480	Ga0495629_0002796
1481	Ga0495629_0003050
1482	Ga0495638_0024812
1483	Ga0495638_0049805
1484	Ga0495638_0062728
1485	Ga0495638_0191169
1486	Ga0495651_0004273
1487	Ga0495651_0062477
1488	Ga0495651_0087137
1489	Ga0495653_0002916
1490	Ga0495653_0129190
1491	Ga0495650_0035664
1492	Ga0495650_0057506
1493	Ga0495605_0032176
1494	Ga0495639_0177376
1495	Ga0495664_0012145
1496	Ga0495664_0013716
1497	Ga0495664_0108342
1498	Ga0495664_0126934
1499	Ga0495584_0028785
1500	Ga0495585_0111251
1501	Ga0495594_0128904
1502	Ga0495596_0165067
1503	Ga0495583_0078227
1504	Ga0495606_0005828
1505	Ga0495606_0049283
1506	Ga0495606_0150221
1507	Ga0495606_0220341
1508	Ga0495606_0242598
1509	Ga0495608_0019386
1510	Ga0495610_0160617
1511	Ga0495616_0045289
1512	Ga0495616_0096899
1513	Ga0495618_0013768
1514	Ga0495620_0049157
1515	Ga0495628_0029505
1516	Ga0495628_0165622
1517	Ga0495630_0341122
1518	Ga0495631_0070160
1519	Ga0495637_0140343
1520	Ga0495644_0055054
1521	Ga0495644_0171462
1522	Ga0495648_0014854
1523	Ga0495648_0097974
1524	Ga0495648_0164692
1525	Ga0495648_0167356
1526	Ga0495648_0277754
1527	Ga0495652_0007414
1528	Ga0495652_0068307
1529	Ga0495654_0072879
1530	Ga0495665_0314426
1531	Ga0495640_0038177
1532	Ga0495640_0237206
1533	Ga0495598_0018738
1534	Ga0495621_0151913
1535	Ga0495597_0111405
1536	Ga0495597_0121799
1537	Ga0495597_0141775
1538	Ga0495645_0011332
1539	Ga0495622_0005349
1540	Ga0495622_0026113
1541	Ga0495622_0030309
1542	Ga0495622_0043886
1543	Ga0495622_0089425
1544	Ga0495667_0003330
1545	Ga0495656_0119010
1546	Ga0495668_0223264
1547	Ga0495634_0002330
1548	Ga0495634_0020617
1549	Ga0495634_0062354
1550	Ga0495611_0087192
1551	Ga0495611_0109689
1552	Ga0495625_0186962
1553	Ga0495625_0274426
1554	Ga0495635_0004181
1555	Ga0495635_0343567
1556	Ga0495659_0031283
1557	Ga0495588_0117080
1558	Ga0495657_0007045
1559	Ga0495657_0013461
1560	Ga0495657_0032417
1561	Ga0495599_0008603
1562	Ga0495599_0023698
1563	Ga0495599_0179530
1564	Ga0495623_0031410
1565	Ga0495623_0063605
1566	Ga0495646_0000902
1567	Ga0495646_0023142
1568	Ga0495646_0078983
1569	Ga0495647_0249932
1570	Ga0495669_0018135
1571	Ga0495669_0177127
1572	Ga0495613_0010474
1573	Ga0495624_0122226
1574	Ga0495670_0006876
1575	Ga0495670_0097403
1576	Ga0495670_0107269
1577	Ga0495671_0149486
1578	Ga0495649_0118857
1579	Ga0495589_0197710
1580	Ga0495600_0002595
1581	Ga0495600_0053949
1582	Ga0495581_0209439
1583	Ga0495604_0005790
1584	Ga0495604_0046362
1585	Ga0495604_0256579
1586	Ga0495604_0312394
1587	Ga0495636_0157320
1588	Ga0495674_0166269
1589	Ga0495674_0270430
1590	Ga0495674_0412353
1591	Ga0495672_0040718
1592	Ga0495672_0040736
1593	Ga0495676_0032444
1594	Ga0495676_0082329
1595	Ga0495676_0301554
1596	Ga0495680_0015880
1597	Ga0495680_0020633
1598	Ga0495683_0096934
1599	Ga0495683_0155863
1600	Ga0495687_028376
1601	Ga0495675_0000801
1602	Ga0495677_0041915
1603	Ga0495684_0002197
1604	Ga0495686_0197946
1605	Ga0495593_0000197
1606	Ga0495593_0014166
1607	Ga0495602_0054577
1608	Ga0495602_0179492
1609	Ga0495602_0381603
1610	Ga0495614_0070598
1611	Ga0496100_0141848
1612	Ga0496100_0513748
1613	Ga0496101_0012466
1614	Ga0496101_0170614
1615	Ga0496101_0180217
1616	Ga0496101_0238341
1617	Ga0496102_0069096
1618	Ga0496102_0094833
1619	Ga0496102_0490056
1620	Ga0496102_0852657
1621	Ga0496103_0282878
1622	Ga0496103_0409798
1623	Ga0496104_0002918
1624	Ga0496104_0064908
1625	Ga0496104_0266429
1626	Ga0496105_0002457
1627	Ga0496105_0016466
1628	Ga0496105_0023125
1629	Ga0496106_0002213
1630	Ga0496106_0068753
1631	Ga0496107_0022554
1632	Ga0496107_0200918
1633	Ga0496109_0197482
1634	Ga0496109_0639189
1635	Ga0496110_0067758
1636	Ga0496110_0161328
1637	Ga0496110_0210294
1638	Ga0496111_0090614
1639	Ga0496111_0096390
1640	Ga0496111_0277638
1641	Ga0496112_0000035
1642	Ga0496112_0012881
1643	Ga0496112_0065317
1644	Ga0496112_0596809
1645	Ga0496113_0157326
1646	Ga0496113_0220430
1647	Ga0496114_0230187
1648	Ga0496114_0261935
1649	Ga0496114_0391963
1650	Ga0496114_0430594
1651	Ga0496115_0001562
1652	Ga0496115_0030634
1653	Ga0496115_0233826
1654	Ga0496116_0080308
1655	Ga0496116_0096514
1656	Ga0496116_0169658
1657	Ga0496117_0319666
1658	Ga0496118_0003764
1659	Ga0496118_0083383
1660	Ga0496119_0014834
1661	Ga0496119_0140710
1662	Ga0496119_0208074
1663	Ga0496120_0015117
1664	Ga0496121_0002004
1665	Ga0496121_0003594
1666	Ga0496121_0029332
1667	Ga0496121_0049788
1668	Ga0496121_0055105
1669	Ga0496121_0079650
1670	Ga0496121_0100954
1671	Ga0496121_0107036
1672	Ga0496121_0159796
1673	Ga0496121_0160632
1674	Ga0496121_0221465
1675	Ga0496122_0230101
1676	Ga0496124_0004431
1677	Ga0496124_0115904
1678	Ga0496124_0264123
1679	Ga0496125_0009386
1680	Ga0496125_0015958
1681	Ga0496125_0033475
1682	Ga0496125_0049939
1683	Ga0496125_0156536
1684	Ga0496125_0287582
1685	Ga0496126_0005839
1686	Ga0496126_0015269
1687	Ga0496126_0016304
1688	Ga0496126_0021771
1689	Ga0496126_0042045
1690	Ga0496126_0074097
1691	Ga0496126_0087995
1692	Ga0496126_0148053
1693	Ga0496126_0257808
1694	Ga0496126_0320479
1695	Ga0496126_0359417
1696	Ga0496126_0362065
1697	Ga0496126_0670038
1698	Ga0501031_0001791
1699	Ga0501031_0094928
1700	Ga0501032_0000073
1701	Ga0501032_0134943
1702	Ga0501033_0000136
1703	Ga0501033_0170514
1704	Ga0501034_0000251
1705	Ga0501036_0000036
1706	Ga0501036_0198686
1707	Ga0501037_0001715
1708	Ga0501038_0000428
1709	Ga0501038_0184091
1710	Ga0501039_0000273
1711	Ga0501042_0019699
1712	Ga0501043_0000165
1713	Ga0501046_0001143
1714	Ga0501046_0132247
1715	Ga0501047_0000340
1716	Ga0501047_0069206
1717	Ga0501048_0004991
1718	Ga0501067_0014425
1719	Ga0501068_0003807
1720	Ga0501069_0005466
1721	Ga0501069_0163778
1722	Ga0501070_0006502
1723	Ga0501070_0241660
1724	Ga0501070_0305476
1725	Ga0501071_0081590
1726	Ga0501072_0001213
1727	Ga0501073_0000037
1728	Ga0501073_0107389
1729	Ga0501074_0000133
1730	Ga0501074_0192975
1731	Ga0501076_0247087
1732	Ga0501079_0001057
1733	Ga0501080_0113721
1734	Ga0501083_0100479
1735	Ga0501035_0000142
1736	Ga0501035_0074180
1737	Ga0501044_0000414
1738	Ga0501045_0025367
1739	nmdc:mga03n38_71195_c1
1740	nmdc:mga03n38_957_c1
1741	nmdc:mga00v17_141809_c1
1742	nmdc:mga00v17_71532_c1
1743	nmdc:mga0yw44_131934_c1
1744	nmdc:mga0yw44_227370_c1
1745	nmdc:mga0yw44_38444_c1
1746	nmdc:mga0yw44_413426_c1
1747	nmdc:mga0yw44_469248_c1
1748	nmdc:mga0yw44_52344_c1
1749	nmdc:mga0yw44_6610_c1
1750	nmdc:mga0k408_193695_c1
1751	nmdc:mga0k408_225342_c1
1752	nmdc:mga0k408_34806_c1
1753	nmdc:mga0k408_39579_c1
1754	nmdc:mga06z11_2498_c1
1755	nmdc:mga06z11_36176_c1
1756	nmdc:mga04h51_101107_c1
1757	nmdc:mga04h51_127848_c1
1758	nmdc:mga07m45_153225_c1
1759	nmdc:mga07m45_20753_c1
1760	nmdc:mga07m45_2419_c1
1761	nmdc:mga08y16_127311_c1
1762	nmdc:mga0n895_45691_c1
1763	nmdc:mga0a205_126412_c1
1764	nmdc:mga0sz30_193234_c1
1765	nmdc:mga0sz30_4553_c1
1766	Ga0495601_0025532
1767	Ga0500635_0004941
1768	Ga0495595_0035155
1769	Ga0495595_0041145
1770	Ga0495619_0001183
1771	Ga0495619_0121113
1772	Ga0495619_0186825
1773	Ga0500643_000048
1774	Ga0500581_153408
1775	Ga0500646_0101211
1776	Ga0500647_0051056
1777	Ga0500647_0101004
1778	Ga0500583_0120699
1779	Ga0500651_0290554
1780	Ga0500651_0307144
1781	Ga0500566_0000223
1782	Ga0500566_0001615
1783	Ga0500566_0098026
1784	Ga0500640_022290
1785	Ga0500641_0133850
1786	Ga0500648_142067
1787	Ga0500648_164213
1788	Ga0500554_084251
1789	Ga0500556_0000003
1790	Ga0500557_000083
1791	Ga0500562_042218
1792	Ga0500572_003205
1793	Ga0500594_0051718
1794	Ga0500595_004510
1795	Ga0500595_028692
1796	Ga0500597_201579
1797	Ga0500607_021788
1798	Ga0500608_033386
1799	Ga0500608_168909
1800	Ga0500614_007794
1801	Ga0500642_0025939
1802	Ga0500642_0061598
1803	Ga0500658_0145192
1804	Ga0500559_0009186
1805	Ga0500559_0011419
1806	Ga0500568_0029325
1807	Ga0500577_0030134
1808	Ga0500589_047932
1809	Ga0500590_084088
1810	Ga0500603_000178
1811	Ga0500603_000237
1812	Ga0500603_061699
1813	Ga0500616_0000033
1814	Ga0500616_0000038
1815	Ga0500620_124284
1816	Ga0500627_0093096
1817	Ga0500630_000468
1818	Ga0500633_0120489
1819	Ga0500634_0072138
1820	Ga0500634_0081768
1821	Ga0500639_004846
1822	Ga0500639_080372
1823	Ga0500636_0000148
1824	Ga0500637_0038025
1825	Ga0500637_0110806
1826	Ga0500649_056549
1827	Ga0500611_029951
1828	Ga0500645_045000
1829	Ga0500596_000423
1830	Ga0500599_000986
1831	Ga0500601_000280
1832	Ga0500601_004972
1833	Ga0501084_0006462
1834	Ga0501082_0002719
1835	Ga0501082_0646313
1836	Ga0466962_0082347
1837	2507505905
1838	2508540096
1839	2508696166
1840	2509151543
1841	2511396610
1842	2513627460
1843	2513638346
1844	2513649878
1845	2513659775
1846	2513676898
1847	2513696305
1848	2513705895
1849	2513715407
1850	2513857238
1851	2513877261
1852	2513891624
1853	2513918851
1854	2514014636
1855	2515631378
1856	2517105683
1857	2517888178
1858	2524442988
1859	2524468617
1860	2524533354
1861	2528855113
1862	2617347787
1863	2617374710
1864	2644290508
1865	2671119362
1866	2723842262
1867	2745081922
1868	2793061557
1869	2793073446
1870	2793077967
1871	2805916139
1872	2818240878
1873	2824605516
1874	2824610814
1875	2824623174
1876	2824627806
1877	2824642676
1878	2824650566
1879	2824653866
1880	2824663779
1881	2824676101
1882	2824686518
1883	2824692454
1884	2824699877
1885	2824713630
1886	2824720414
1887	2824730639
1888	2824740318
1889	2824753677
1890	2824763430
1891	2824772167
1892	2824775730
1893	2838125106
1894	2841945844
1895	2841957742
1896	2841960574
1897	2841973345
1898	2841979491
1899	2841989384
1900	2842044375
1901	2842051636
1902	2844316228
1903	2847939460
1904	2847941210
1905	2849082201
1906	2857513323
1907	2874596359
1908	2874610149
1909	2874620228
1910	2874622452
1911	2874633331
1912	2874650347
1913	2876761648
1914	2876776824
1915	2876813545
1916	2876824614
1917	2879080961
1918	2879091098
1919	2879106661
1920	2879117017
1921	2879133807
1922	2879143067
1923	2881369621
1924	2881670143
1925	2885367730
1926	2885380638
1927	2885390783
1928	2885418275
1929	2888387731
1930	2888389951
1931	2888421151
1932	2889036383
1933	2903728435
1934	2903754030
1935	2903776660
1936	2904671541
1937	2904695752
1938	2904710023
1939	2904719833
1940	2906606577
1941	2906614464
1942	2906630877
1943	2906643412
1944	2906650295
1945	2906666604
1946	2908746706
1947	2908764267
1948	2908777193
1949	2919078947
1950	2922366739
1951	2922377437
1952	2922389358
1953	2922398529
1954	2922426300
1955	2929622227
1956	2929630126
1957	2932787943
1958	2932796052
1959	2932807629
1960	2932813318
1961	2932820015
1962	2932832921
1963	2933584159
1964	2935614327
1965	2935620406
1966	2935632683
1967	2935640730
1968	2935649357
1969	2935657871
1970	2935668922
1971	2935681352
1972	2935687231
1973	2935696798
1974	2935709110
1975	2935716919
1976	2935722956
1977	2935734513
1978	2935744696
1979	2935753197
1980	2935767601
1981	2935770196
1982	2935777774
1983	2935786750
1984	2935794804
1985	2935804840
1986	2935815989
1987	2935826545
1988	2935832237
1989	2935840933
1990	2935851161
1991	2935859292
1992	2935864476
1993	2935875172
1994	2935887334
1995	2935913210
1996	2935922632
1997	2935930865
1998	2935939801
1999	2935946750
2000	2935956049
2001	2935964954
2002	2935972842
2003	2935978241
2004	2935985633
2005	2935995853
2006	2936005764
2007	2936012090
2008	2936020829
2009	2936029383
2010	2936041892
2011	2936048293
2012	2936056596
2013	2940559110
2014	2941508653
2015	2941516483
2016	2941524501
2017	2941534605
2018	2941541805
2019	3005475662
2020	3005489738
2021	3005592189
2022	3005595839
2023	3005711795
2024	3005719044
2025	8006932284
2026	8006937002
2027	8006966332
2028	8006976967
2029	8006993150
2030	8006997002
2031	8016517280
2032	8016526953
2033	8016532038
2034	8016556841
2035	8016565194
2036	8016570326
2037	8016582874
2038	8016585421
2039	8016602837
2040	8016605706
2041	8016623956
2042	8016634907
2043	8017059315
2044	8019539675
2045	8019550976
2046	8019561674
2047	8019571748
2048	8019576312
2049	8019594185
2050	8019607377
2051	8019611135
2052	8019621984
2053	8019631336
2054	8019639284
2055	8019651421
2056	8019677606
2057	8019693319
2058	8055743524
2059	8056678188
2060	8056683420
2061	8056692715
2062	8056974183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

150

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1ji0-assembly1.cif.gz_A	crystal structure analysis of the abc transporter from thermotoga maritima	0.9611	1	235
1ji0-assembly1.cif.gz_A	crystal structure analysis of the abc transporter from thermotoga maritima	0.9377	1	235
4yer-assembly1.cif.gz_A	crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution	0.9261	1	222
6b89-assembly1.cif.gz_A	e. coli lptb in complex with adp and novobiocin	0.9256	5	232
4yer-assembly1.cif.gz_B	crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution	0.9252	1	222

ID	Description	Score	Start	End	Superfamily
af_P22731_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9824	2	235	3.40.50.300
af_P22731_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9661	2	235	3.40.50.300
af_Q58664_1_235_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9636	5	234	3.40.50.300
1ji0A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9445	1	235	3.40.50.300
af_Q58664_1_235_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9397	5	234	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A417Z7G5-F1-model_v4	ABC transporter ATP-binding protein	0.9853	2	235	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-H5SB50-F1-model_v4	Branched-chain amino acid ABC transporter ATP-binding protein	0.9773	6	235	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A1Q7D5U6-F1-model_v4	ABC transporter ATP-binding protein	0.9772	2	231	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A2E7F6C8-F1-model_v4	ABC transporter ATP-binding protein	0.9767	4	234	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A0Q3SXW4-F1-model_v4	ABC transporter ATP-binding protein	0.9746	5	235	GO:0005524 GO:0015658 GO:0015807 GO:0016887

F488610

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

20

150

0.94

Structural Annotation

Top 5 Hits

Map