F488606
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1031 | 357 | 2062 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100376866|Ga0070708_1003768662 |
| Length | 96 |
| Sequence | MRIGVRLFASLREAAGTELVELDLPDGSTAEEAWRRLAEAHPSLAGRRRSLAVAVNRRYARFDEPLAPGDEVVFVPPVSGGSQSMPSSRRRLRNVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 114 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 217 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 218 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 238 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 239 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 240 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 241 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 242 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 245 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 246 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 247 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 248 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 249 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 250 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 251 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 252 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 253 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 254 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 255 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 256 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 257 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 258 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 259 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 265 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 266 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 267 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 298 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 325 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 326 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 327 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 330 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 354 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 96.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100376866 | 3300005445 | Bacteria | 1338 |
| 2 | MRS1b_contig_727244 | 2162886011 | Unclassified | 1012 |
| 3 | MBSR1b_contig_6780580 | 2162886012 | Bacteria | 824 |
| 4 | JGI25165J46597_1009672 | 3300003214 | Bacteria | 1439 |
| 5 | JGI25405J52794_10001416 | 3300003911 | Bacteria | 3938 |
| 6 | Ga0058860_11767753 | 3300004801 | Unclassified | 895 |
| 7 | Ga0065704_10686811 | 3300005289 | Unclassified | 566 |
| 8 | Ga0065712_10002257 | 3300005290 | Bacteria | 4870 |
| 9 | Ga0065712_10002777 | 3300005290 | Bacteria | 5095 |
| 10 | Ga0065715_10013103 | 3300005293 | Bacteria | 2158 |
| 11 | Ga0065715_10301656 | 3300005293 | Unclassified | 1039 |
| 12 | Ga0065715_10394114 | 3300005293 | Bacteria | 890 |
| 13 | Ga0065707_10001335 | 3300005295 | Bacteria | 11321 |
| 14 | Ga0065707_10171174 | 3300005295 | Unclassified | 1478 |
| 15 | Ga0065707_10360981 | 3300005295 | Unclassified | 904 |
| 16 | Ga0065707_10467478 | 3300005295 | Unclassified | 785 |
| 17 | Ga0065707_10580217 | 3300005295 | Bacteria | 693 |
| 18 | Ga0065707_10816276 | 3300005295 | Unclassified | 594 |
| 19 | Ga0070676_10303923 | 3300005328 | Unclassified | 1082 |
| 20 | Ga0070676_10654905 | 3300005328 | Bacteria | 763 |
| 21 | Ga0070683_100650272 | 3300005329 | Unclassified | 1009 |
| 22 | Ga0070690_100152307 | 3300005330 | Unclassified | 1579 |
| 23 | Ga0070690_100280859 | 3300005330 | Unclassified | 1188 |
| 24 | Ga0070690_100684629 | 3300005330 | Bacteria | 786 |
| 25 | Ga0070670_100000785 | 3300005331 | Bacteria | 24698 |
| 26 | Ga0070677_10060769 | 3300005333 | Bacteria | 1558 |
| 27 | Ga0068869_100030357 | 3300005334 | Bacteria | 3794 |
| 28 | Ga0068869_100833432 | 3300005334 | Bacteria | 795 |
| 29 | Ga0068869_101326445 | 3300005334 | Unclassified | 635 |
| 30 | Ga0070666_10018952 | 3300005335 | Unclassified | 4434 |
| 31 | Ga0070666_10565365 | 3300005335 | Bacteria | 828 |
| 32 | Ga0070680_100131696 | 3300005336 | Bacteria | 2093 |
| 33 | Ga0070680_100644686 | 3300005336 | Unclassified | 910 |
| 34 | Ga0070682_100801986 | 3300005337 | Unclassified | 765 |
| 35 | Ga0068868_100032349 | 3300005338 | Bacteria | 4023 |
| 36 | Ga0070689_100153375 | 3300005340 | Bacteria | 1859 |
| 37 | Ga0070691_10056032 | 3300005341 | Bacteria | 1889 |
| 38 | Ga0070691_10317104 | 3300005341 | Bacteria | 856 |
| 39 | Ga0070687_100555063 | 3300005343 | Unclassified | 782 |
| 40 | Ga0070661_100019298 | 3300005344 | Bacteria | 4859 |
| 41 | Ga0070692_10126232 | 3300005345 | Unclassified | 1433 |
| 42 | Ga0070692_11373994 | 3300005345 | Bacteria | 509 |
| 43 | Ga0070668_100157871 | 3300005347 | Bacteria | 1838 |
| 44 | Ga0070669_100007755 | 3300005353 | Bacteria | 7673 |
| 45 | Ga0070669_100254834 | 3300005353 | Bacteria | 1398 |
| 46 | Ga0070669_100395856 | 3300005353 | Bacteria | 1129 |
| 47 | Ga0070675_100205291 | 3300005354 | Bacteria | 1711 |
| 48 | Ga0070675_100233584 | 3300005354 | Bacteria | 1605 |
| 49 | Ga0070675_100479106 | 3300005354 | Bacteria | 1119 |
| 50 | Ga0070671_100045667 | 3300005355 | Bacteria | 3642 |
| 51 | Ga0070674_101799423 | 3300005356 | Unclassified | 555 |
| 52 | Ga0070673_100200946 | 3300005364 | Bacteria | 1716 |
| 53 | Ga0070673_100281993 | 3300005364 | Bacteria | 1457 |
| 54 | Ga0070688_100134226 | 3300005365 | Bacteria | 1674 |
| 55 | Ga0070688_100453548 | 3300005365 | Bacteria | 959 |
| 56 | Ga0070659_100311591 | 3300005366 | Unclassified | 1314 |
| 57 | Ga0070659_101580129 | 3300005366 | Unclassified | 585 |
| 58 | Ga0070667_100394665 | 3300005367 | Unclassified | 1258 |
| 59 | Ga0070703_10138432 | 3300005406 | Bacteria | 902 |
| 60 | Ga0070703_10155327 | 3300005406 | Unclassified | 863 |
| 61 | Ga0070701_10963137 | 3300005438 | Bacteria | 593 |
| 62 | Ga0070701_11204575 | 3300005438 | Bacteria | 537 |
| 63 | Ga0070711_100037165 | 3300005439 | Bacteria | 3266 |
| 64 | Ga0070711_100773403 | 3300005439 | Unclassified | 813 |
| 65 | Ga0070705_100055050 | 3300005440 | Bacteria | 2336 |
| 66 | Ga0070705_100127054 | 3300005440 | Unclassified | 1657 |
| 67 | Ga0070705_100680316 | 3300005440 | Bacteria | 806 |
| 68 | Ga0070705_100735474 | 3300005440 | Unclassified | 778 |
| 69 | Ga0070705_101066761 | 3300005440 | Bacteria | 659 |
| 70 | Ga0070705_101365913 | 3300005440 | Bacteria | 589 |
| 71 | Ga0070700_100196244 | 3300005441 | Unclassified | 1415 |
| 72 | Ga0070700_100930747 | 3300005441 | Bacteria | 710 |
| 73 | Ga0070694_100044413 | 3300005444 | Bacteria | 2974 |
| 74 | Ga0070694_100082135 | 3300005444 | Bacteria | 2243 |
| 75 | Ga0070694_100146635 | 3300005444 | Bacteria | 1720 |
| 76 | Ga0070694_100437801 | 3300005444 | Bacteria | 1030 |
| 77 | Ga0070694_100457020 | 3300005444 | Bacteria | 1009 |
| 78 | Ga0070694_100911231 | 3300005444 | Bacteria | 726 |
| 79 | Ga0070694_100932455 | 3300005444 | Unclassified | 718 |
| 80 | Ga0070708_100353126 | 3300005445 | Unclassified | 1386 |
| 81 | Ga0070663_100227161 | 3300005455 | Bacteria | 1468 |
| 82 | Ga0070663_100236773 | 3300005455 | Bacteria | 1440 |
| 83 | Ga0070678_100114653 | 3300005456 | Bacteria | 2114 |
| 84 | Ga0070662_100185064 | 3300005457 | Bacteria | 1644 |
| 85 | Ga0070662_100229496 | 3300005457 | Unclassified | 1484 |
| 86 | Ga0070662_100374604 | 3300005457 | Bacteria | 1171 |
| 87 | Ga0070662_100391635 | 3300005457 | Bacteria | 1145 |
| 88 | Ga0070662_100408767 | 3300005457 | Bacteria | 1121 |
| 89 | Ga0070681_10010565 | 3300005458 | Bacteria | 9119 |
| 90 | Ga0070681_10018600 | 3300005458 | Bacteria | 6947 |
| 91 | Ga0070681_10044729 | 3300005458 | Unclassified | 4432 |
| 92 | Ga0068867_100087998 | 3300005459 | Bacteria | 2353 |
| 93 | Ga0068867_100388382 | 3300005459 | Bacteria | 1174 |
| 94 | Ga0070685_10225040 | 3300005466 | Unclassified | 1231 |
| 95 | Ga0070685_11426346 | 3300005466 | Bacteria | 532 |
| 96 | Ga0070706_100029329 | 3300005467 | Bacteria | 5070 |
| 97 | Ga0070706_100061378 | 3300005467 | Bacteria | 3471 |
| 98 | Ga0070706_100630820 | 3300005467 | Bacteria | 995 |
| 99 | Ga0070706_101651460 | 3300005467 | Unclassified | 584 |
| 100 | Ga0070707_100052951 | 3300005468 | Bacteria | 3891 |
| 101 | Ga0070707_100056072 | 3300005468 | Unclassified | 3778 |
| 102 | Ga0070707_100202837 | 3300005468 | Bacteria | 1933 |
| 103 | Ga0070707_100698813 | 3300005468 | Bacteria | 977 |
| 104 | Ga0070698_100005467 | 3300005471 | Bacteria | 13869 |
| 105 | Ga0070698_100375879 | 3300005471 | Unclassified | 1353 |
| 106 | Ga0070698_100451015 | 3300005471 | Bacteria | 1222 |
| 107 | Ga0070698_101177949 | 3300005471 | Unclassified | 715 |
| 108 | Ga0070699_100021770 | 3300005518 | Bacteria | 5526 |
| 109 | Ga0070699_100347870 | 3300005518 | Unclassified | 1335 |
| 110 | Ga0070699_100735113 | 3300005518 | Unclassified | 902 |
| 111 | Ga0070699_101830126 | 3300005518 | Bacteria | 556 |
| 112 | Ga0070679_100120303 | 3300005530 | Bacteria | 2611 |
| 113 | Ga0070679_100159762 | 3300005530 | Bacteria | 2228 |
| 114 | Ga0070684_100404023 | 3300005535 | Unclassified | 1259 |
| 115 | Ga0070697_100012867 | 3300005536 | Bacteria | 6555 |
| 116 | Ga0070697_100046361 | 3300005536 | Bacteria | 3523 |
| 117 | Ga0070697_100111880 | 3300005536 | Bacteria | 2276 |
| 118 | Ga0070697_100445016 | 3300005536 | Bacteria | 1128 |
| 119 | Ga0070697_100455359 | 3300005536 | Unclassified | 1115 |
| 120 | Ga0070697_100558728 | 3300005536 | Bacteria | 1004 |
| 121 | Ga0070697_100622238 | 3300005536 | Bacteria | 950 |
| 122 | Ga0068853_100141923 | 3300005539 | Bacteria | 2156 |
| 123 | Ga0070672_100056574 | 3300005543 | Bacteria | 3077 |
| 124 | Ga0070672_100113353 | 3300005543 | Bacteria | 2213 |
| 125 | Ga0070672_100860854 | 3300005543 | Unclassified | 799 |
| 126 | Ga0070672_101967065 | 3300005543 | Bacteria | 526 |
| 127 | Ga0070686_100029154 | 3300005544 | Unclassified | 3354 |
| 128 | Ga0070695_100378764 | 3300005545 | Bacteria | 1067 |
| 129 | Ga0070695_101275944 | 3300005545 | Bacteria | 606 |
| 130 | Ga0070696_100036308 | 3300005546 | Bacteria | 3397 |
| 131 | Ga0070696_100111904 | 3300005546 | Bacteria | 1967 |
| 132 | Ga0070696_100187425 | 3300005546 | Bacteria | 1538 |
| 133 | Ga0070696_100296656 | 3300005546 | Bacteria | 1237 |
| 134 | Ga0070696_101553673 | 3300005546 | Bacteria | 568 |
| 135 | Ga0070696_101576576 | 3300005546 | Bacteria | 564 |
| 136 | Ga0070696_102016638 | 3300005546 | Bacteria | 501 |
| 137 | Ga0070693_100094760 | 3300005547 | Bacteria | 1807 |
| 138 | Ga0070665_100138414 | 3300005548 | Bacteria | 2438 |
| 139 | Ga0070704_100036390 | 3300005549 | Bacteria | 3355 |
| 140 | Ga0070704_100301640 | 3300005549 | Bacteria | 1335 |
| 141 | Ga0070704_100672411 | 3300005549 | Bacteria | 916 |
| 142 | Ga0070704_100869366 | 3300005549 | Bacteria | 809 |
| 143 | Ga0070704_100897300 | 3300005549 | Unclassified | 797 |
| 144 | Ga0070704_101264110 | 3300005549 | Bacteria | 675 |
| 145 | Ga0070704_101459498 | 3300005549 | Bacteria | 628 |
| 146 | Ga0068855_100376152 | 3300005563 | Bacteria | 1560 |
| 147 | Ga0070664_100001110 | 3300005564 | Bacteria | 21299 |
| 148 | Ga0068857_100084476 | 3300005577 | Bacteria | 2837 |
| 149 | Ga0068857_100717932 | 3300005577 | Bacteria | 950 |
| 150 | Ga0068857_101223252 | 3300005577 | Bacteria | 728 |
| 151 | Ga0068854_100072033 | 3300005578 | Bacteria | 2530 |
| 152 | Ga0068854_100290230 | 3300005578 | Bacteria | 1320 |
| 153 | Ga0068856_100022118 | 3300005614 | Bacteria | 6183 |
| 154 | Ga0070702_100152063 | 3300005615 | Unclassified | 1487 |
| 155 | Ga0070702_101225150 | 3300005615 | Bacteria | 606 |
| 156 | Ga0068852_100411171 | 3300005616 | Unclassified | 1333 |
| 157 | Ga0068852_100587844 | 3300005616 | Bacteria | 1117 |
| 158 | Ga0068859_100017152 | 3300005617 | Bacteria | 7272 |
| 159 | Ga0068859_100025958 | 3300005617 | Bacteria | 5877 |
| 160 | Ga0068859_100238962 | 3300005617 | Bacteria | 1905 |
| 161 | Ga0068859_100406663 | 3300005617 | Unclassified | 1457 |
| 162 | Ga0068859_102416130 | 3300005617 | Unclassified | 579 |
| 163 | Ga0068864_100427279 | 3300005618 | Bacteria | 1263 |
| 164 | Ga0068864_100501235 | 3300005618 | Bacteria | 1168 |
| 165 | Ga0068866_10161108 | 3300005718 | Bacteria | 1308 |
| 166 | Ga0068866_10279666 | 3300005718 | Bacteria | 1033 |
| 167 | Ga0068861_100150506 | 3300005719 | Bacteria | 1909 |
| 168 | Ga0068861_100477746 | 3300005719 | Unclassified | 1122 |
| 169 | Ga0068861_100538451 | 3300005719 | Bacteria | 1062 |
| 170 | Ga0068861_100607985 | 3300005719 | Bacteria | 1004 |
| 171 | Ga0068861_100669492 | 3300005719 | Unclassified | 961 |
| 172 | Ga0068861_101843833 | 3300005719 | Bacteria | 601 |
| 173 | Ga0068861_101923847 | 3300005719 | Bacteria | 589 |
| 174 | Ga0068870_10176720 | 3300005840 | Bacteria | 1278 |
| 175 | Ga0068870_10206418 | 3300005840 | Unclassified | 1194 |
| 176 | Ga0068870_10355712 | 3300005840 | Bacteria | 941 |
| 177 | Ga0068863_100232906 | 3300005841 | Bacteria | 1777 |
| 178 | Ga0068863_101637737 | 3300005841 | Bacteria | 653 |
| 179 | Ga0068858_101426373 | 3300005842 | Bacteria | 682 |
| 180 | Ga0068858_101557842 | 3300005842 | Unclassified | 652 |
| 181 | Ga0068860_100221681 | 3300005843 | Bacteria | 1837 |
| 182 | Ga0068860_101059566 | 3300005843 | Unclassified | 830 |
| 183 | Ga0068860_101095395 | 3300005843 | Bacteria | 816 |
| 184 | Ga0068860_101673070 | 3300005843 | Bacteria | 658 |
| 185 | Ga0068862_100023106 | 3300005844 | Bacteria | 5207 |
| 186 | Ga0068862_100506416 | 3300005844 | Bacteria | 1147 |
| 187 | Ga0068862_100567574 | 3300005844 | Unclassified | 1085 |
| 188 | Ga0068862_102131660 | 3300005844 | Bacteria | 572 |
| 189 | Ga0081455_10002416 | 3300005937 | Bacteria | 22277 |
| 190 | Ga0081455_10147538 | 3300005937 | Bacteria | 1817 |
| 191 | Ga0081538_10009092 | 3300005981 | Bacteria | 8336 |
| 192 | Ga0081538_10253644 | 3300005981 | Unclassified | 669 |
| 193 | Ga0075368_10150330 | 3300006042 | Bacteria | 973 |
| 194 | Ga0075363_100123778 | 3300006048 | Bacteria | 1446 |
| 195 | Ga0075363_100391096 | 3300006048 | Bacteria | 816 |
| 196 | Ga0075432_10035052 | 3300006058 | Bacteria | 1744 |
| 197 | Ga0075432_10175920 | 3300006058 | Unclassified | 835 |
| 198 | Ga0070716_100035913 | 3300006173 | Bacteria | 2728 |
| 199 | Ga0070716_100336482 | 3300006173 | Bacteria | 1063 |
| 200 | Ga0070712_100069890 | 3300006175 | Bacteria | 2506 |
| 201 | Ga0070712_101859585 | 3300006175 | Unclassified | 527 |
| 202 | Ga0075367_10024419 | 3300006178 | Bacteria | 3408 |
| 203 | Ga0075367_10094596 | 3300006178 | Bacteria | 1822 |
| 204 | Ga0075366_10190961 | 3300006195 | Bacteria | 1245 |
| 205 | Ga0097621_100444707 | 3300006237 | Unclassified | 1167 |
| 206 | Ga0097621_100792877 | 3300006237 | Bacteria | 877 |
| 207 | Ga0097621_100801949 | 3300006237 | Unclassified | 872 |
| 208 | Ga0075370_10318196 | 3300006353 | Unclassified | 927 |
| 209 | Ga0068871_100687879 | 3300006358 | Bacteria | 936 |
| 210 | Ga0075428_100001519 | 3300006844 | Bacteria | 24799 |
| 211 | Ga0075428_100006976 | 3300006844 | Bacteria | 12531 |
| 212 | Ga0075428_100014051 | 3300006844 | Bacteria | 8911 |
| 213 | Ga0075428_100022801 | 3300006844 | Bacteria | 6928 |
| 214 | Ga0075428_100101440 | 3300006844 | Unclassified | 3137 |
| 215 | Ga0075428_100107468 | 3300006844 | Bacteria | 3041 |
| 216 | Ga0075428_100181801 | 3300006844 | Bacteria | 2276 |
| 217 | Ga0075428_100451161 | 3300006844 | Unclassified | 1377 |
| 218 | Ga0075428_100453839 | 3300006844 | Bacteria | 1373 |
| 219 | Ga0075428_101434893 | 3300006844 | Bacteria | 724 |
| 220 | Ga0075430_100005925 | 3300006846 | Bacteria | 10322 |
| 221 | Ga0075430_100157637 | 3300006846 | Bacteria | 1889 |
| 222 | Ga0075430_100259778 | 3300006846 | Bacteria | 1438 |
| 223 | Ga0075430_100294370 | 3300006846 | Bacteria | 1343 |
| 224 | Ga0075431_100001686 | 3300006847 | Bacteria | 20728 |
| 225 | Ga0075431_100016515 | 3300006847 | Bacteria | 7492 |
| 226 | Ga0075431_100044729 | 3300006847 | Bacteria | 4565 |
| 227 | Ga0075431_100096527 | 3300006847 | Bacteria | 3051 |
| 228 | Ga0075431_100107887 | 3300006847 | Bacteria | 2873 |
| 229 | Ga0075431_100335174 | 3300006847 | Bacteria | 1523 |
| 230 | Ga0075431_100375883 | 3300006847 | Unclassified | 1426 |
| 231 | Ga0075431_100504541 | 3300006847 | Bacteria | 1201 |
| 232 | Ga0075431_100676384 | 3300006847 | Bacteria | 1011 |
| 233 | Ga0075431_101072018 | 3300006847 | Unclassified | 771 |
| 234 | Ga0075431_101072501 | 3300006847 | Bacteria | 771 |
| 235 | Ga0075431_101757340 | 3300006847 | Bacteria | 577 |
| 236 | Ga0075433_10000446 | 3300006852 | Bacteria | 26719 |
| 237 | Ga0075433_10007564 | 3300006852 | Bacteria | 8618 |
| 238 | Ga0075433_10023127 | 3300006852 | Bacteria | 5227 |
| 239 | Ga0075433_10036578 | 3300006852 | Unclassified | 4230 |
| 240 | Ga0075433_10083007 | 3300006852 | Bacteria | 2827 |
| 241 | Ga0075433_10099686 | 3300006852 | Bacteria | 2572 |
| 242 | Ga0075433_10421278 | 3300006852 | Bacteria | 1177 |
| 243 | Ga0075433_10476322 | 3300006852 | Unclassified | 1100 |
| 244 | Ga0075433_10897157 | 3300006852 | Unclassified | 773 |
| 245 | Ga0075433_11024829 | 3300006852 | Bacteria | 719 |
| 246 | Ga0075433_11026516 | 3300006852 | Bacteria | 718 |
| 247 | Ga0075433_11250910 | 3300006852 | Unclassified | 644 |
| 248 | Ga0075433_11612052 | 3300006852 | Unclassified | 560 |
| 249 | Ga0075433_11721521 | 3300006852 | Bacteria | 540 |
| 250 | Ga0075434_100001490 | 3300006871 | Bacteria | 19748 |
| 251 | Ga0075434_100012190 | 3300006871 | Bacteria | 8145 |
| 252 | Ga0075434_100016451 | 3300006871 | Bacteria | 7110 |
| 253 | Ga0075434_100029643 | 3300006871 | Bacteria | 5385 |
| 254 | Ga0075434_100043984 | 3300006871 | Bacteria | 4430 |
| 255 | Ga0075434_100059577 | 3300006871 | Bacteria | 3796 |
| 256 | Ga0075434_100064015 | 3300006871 | Bacteria | 3661 |
| 257 | Ga0075434_100090000 | 3300006871 | Bacteria | 3070 |
| 258 | Ga0075434_100107500 | 3300006871 | Bacteria | 2800 |
| 259 | Ga0075434_100121773 | 3300006871 | Bacteria | 2625 |
| 260 | Ga0075434_100327168 | 3300006871 | Bacteria | 1553 |
| 261 | Ga0075434_100427500 | 3300006871 | Unclassified | 1346 |
| 262 | Ga0075434_101406567 | 3300006871 | Unclassified | 707 |
| 263 | Ga0075429_100002919 | 3300006880 | Bacteria | 14502 |
| 264 | Ga0075429_100038449 | 3300006880 | Bacteria | 4165 |
| 265 | Ga0075429_100042378 | 3300006880 | Unclassified | 3962 |
| 266 | Ga0075429_100128482 | 3300006880 | Bacteria | 2217 |
| 267 | Ga0075429_100192990 | 3300006880 | Bacteria | 1784 |
| 268 | Ga0075429_100705130 | 3300006880 | Unclassified | 884 |
| 269 | Ga0075429_100723437 | 3300006880 | Unclassified | 872 |
| 270 | Ga0068865_100409513 | 3300006881 | Bacteria | 1112 |
| 271 | Ga0068865_100455993 | 3300006881 | Bacteria | 1058 |
| 272 | Ga0068865_100547597 | 3300006881 | Bacteria | 971 |
| 273 | Ga0068865_101389722 | 3300006881 | Bacteria | 626 |
| 274 | Ga0075436_100010183 | 3300006914 | Bacteria | 6439 |
| 275 | Ga0075436_100023881 | 3300006914 | Bacteria | 4202 |
| 276 | Ga0075436_100033659 | 3300006914 | Bacteria | 3533 |
| 277 | Ga0075436_100147557 | 3300006914 | Unclassified | 1654 |
| 278 | Ga0075436_100210906 | 3300006914 | Unclassified | 1377 |
| 279 | Ga0075436_100407122 | 3300006914 | Bacteria | 986 |
| 280 | Ga0075436_100443399 | 3300006914 | Unclassified | 945 |
| 281 | Ga0075436_101157539 | 3300006914 | Unclassified | 583 |
| 282 | Ga0097620_100017152 | 3300006931 | Bacteria | 7272 |
| 283 | Ga0097620_100025962 | 3300006931 | Bacteria | 5877 |
| 284 | Ga0097620_100238957 | 3300006931 | Bacteria | 1905 |
| 285 | Ga0097620_100406675 | 3300006931 | Unclassified | 1457 |
| 286 | Ga0097620_102415366 | 3300006931 | Unclassified | 579 |
| 287 | Ga0075435_100007980 | 3300007076 | Bacteria | 7576 |
| 288 | Ga0075435_100010661 | 3300007076 | Bacteria | 6730 |
| 289 | Ga0075435_100026170 | 3300007076 | Bacteria | 4548 |
| 290 | Ga0075435_100064885 | 3300007076 | Bacteria | 2968 |
| 291 | Ga0075435_100091585 | 3300007076 | Unclassified | 2509 |
| 292 | Ga0075435_100146874 | 3300007076 | Bacteria | 1981 |
| 293 | Ga0075435_100178615 | 3300007076 | Bacteria | 1793 |
| 294 | Ga0075435_100288924 | 3300007076 | Unclassified | 1401 |
| 295 | Ga0075435_100304205 | 3300007076 | Bacteria | 1364 |
| 296 | Ga0075435_100373828 | 3300007076 | Unclassified | 1224 |
| 297 | Ga0075435_100510882 | 3300007076 | Unclassified | 1039 |
| 298 | Ga0075435_100865300 | 3300007076 | Bacteria | 788 |
| 299 | Ga0105240_10001318 | 3300009093 | Bacteria | 42836 |
| 300 | Ga0105240_10278411 | 3300009093 | Unclassified | 1923 |
| 301 | Ga0111539_10002805 | 3300009094 | Bacteria | 23141 |
| 302 | Ga0111539_10002994 | 3300009094 | Bacteria | 22414 |
| 303 | Ga0111539_10005783 | 3300009094 | Bacteria | 15983 |
| 304 | Ga0111539_10063090 | 3300009094 | Unclassified | 4385 |
| 305 | Ga0111539_10213579 | 3300009094 | Bacteria | 2248 |
| 306 | Ga0111539_10428338 | 3300009094 | Bacteria | 1541 |
| 307 | Ga0111539_11093878 | 3300009094 | Bacteria | 926 |
| 308 | Ga0111539_11130576 | 3300009094 | Bacteria | 910 |
| 309 | Ga0111539_12142249 | 3300009094 | Unclassified | 649 |
| 310 | Ga0105245_10111429 | 3300009098 | Unclassified | 2545 |
| 311 | Ga0105245_10245499 | 3300009098 | Bacteria | 1738 |
| 312 | Ga0114129_10013590 | 3300009147 | Bacteria | 11600 |
| 313 | Ga0114129_10014069 | 3300009147 | Bacteria | 11399 |
| 314 | Ga0114129_10050832 | 3300009147 | Bacteria | 5820 |
| 315 | Ga0114129_10065608 | 3300009147 | Bacteria | 5066 |
| 316 | Ga0114129_10079937 | 3300009147 | Bacteria | 4545 |
| 317 | Ga0114129_10081486 | 3300009147 | Bacteria | 4498 |
| 318 | Ga0114129_10171754 | 3300009147 | Bacteria | 2955 |
| 319 | Ga0114129_10188138 | 3300009147 | Bacteria | 2805 |
| 320 | Ga0114129_10189782 | 3300009147 | Bacteria | 2791 |
| 321 | Ga0114129_10200942 | 3300009147 | Unclassified | 2699 |
| 322 | Ga0114129_10209251 | 3300009147 | Unclassified | 2638 |
| 323 | Ga0114129_10214541 | 3300009147 | Bacteria | 2600 |
| 324 | Ga0114129_10235446 | 3300009147 | Bacteria | 2464 |
| 325 | Ga0114129_10305090 | 3300009147 | Bacteria | 2121 |
| 326 | Ga0114129_10369593 | 3300009147 | Unclassified | 1896 |
| 327 | Ga0114129_10527597 | 3300009147 | Bacteria | 1539 |
| 328 | Ga0114129_10840077 | 3300009147 | Bacteria | 1168 |
| 329 | Ga0114129_11301444 | 3300009147 | Unclassified | 901 |
| 330 | Ga0114129_11510307 | 3300009147 | Unclassified | 825 |
| 331 | Ga0114129_13274665 | 3300009147 | Unclassified | 524 |
| 332 | Ga0105243_10058820 | 3300009148 | Bacteria | 3065 |
| 333 | Ga0105243_10751932 | 3300009148 | Bacteria | 956 |
| 334 | Ga0105241_10005902 | 3300009174 | Bacteria | 9036 |
| 335 | Ga0105242_10046389 | 3300009176 | Unclassified | 3525 |
| 336 | Ga0105242_10229054 | 3300009176 | Bacteria | 1665 |
| 337 | Ga0105248_11706543 | 3300009177 | Bacteria | 714 |
| 338 | Ga0105237_10018912 | 3300009545 | Bacteria | 7122 |
| 339 | Ga0105237_10088023 | 3300009545 | Bacteria | 3095 |
| 340 | Ga0105238_10085564 | 3300009551 | Bacteria | 3140 |
| 341 | Ga0105238_13082406 | 3300009551 | Unclassified | 500 |
| 342 | Ga0105249_10109252 | 3300009553 | Bacteria | 2612 |
| 343 | Ga0105249_10344442 | 3300009553 | Unclassified | 1508 |
| 344 | Ga0105030_104565 | 3300009987 | Bacteria | 1171 |
| 345 | Ga0105239_10059595 | 3300010375 | Unclassified | 4189 |
| 346 | Ga0105239_11309653 | 3300010375 | Bacteria | 836 |
| 347 | Ga0157326_1035605 | 3300012513 | Bacteria | 678 |
| 348 | Ga0157338_1058064 | 3300012515 | Bacteria | 574 |
| 349 | Ga0157373_10050366 | 3300013100 | Bacteria | 2966 |
| 350 | Ga0157371_10079616 | 3300013102 | Unclassified | 2321 |
| 351 | Ga0157374_10330142 | 3300013296 | Bacteria | 1513 |
| 352 | Ga0157378_10163906 | 3300013297 | Bacteria | 2081 |
| 353 | Ga0157378_10172107 | 3300013297 | Bacteria | 2031 |
| 354 | Ga0157378_10495747 | 3300013297 | Unclassified | 1219 |
| 355 | Ga0157378_10608446 | 3300013297 | Unclassified | 1105 |
| 356 | Ga0163162_10130481 | 3300013306 | Bacteria | 2622 |
| 357 | Ga0163162_10139211 | 3300013306 | Bacteria | 2539 |
| 358 | Ga0163162_12253508 | 3300013306 | Bacteria | 626 |
| 359 | Ga0157372_10014000 | 3300013307 | Bacteria | 8569 |
| 360 | Ga0157375_10224655 | 3300013308 | Bacteria | 2037 |
| 361 | Ga0157375_10620401 | 3300013308 | Bacteria | 1239 |
| 362 | Ga0157514_127414 | 3300013874 | Bacteria | 796 |
| 363 | Ga0163163_10044528 | 3300014325 | Unclassified | 4354 |
| 364 | Ga0157380_10000345 | 3300014326 | Bacteria | 27857 |
| 365 | Ga0157380_10003796 | 3300014326 | Bacteria | 10391 |
| 366 | Ga0157380_10025863 | 3300014326 | Bacteria | 4454 |
| 367 | Ga0157380_10653989 | 3300014326 | Bacteria | 1049 |
| 368 | Ga0157380_11770708 | 3300014326 | Bacteria | 676 |
| 369 | Ga0157380_12043916 | 3300014326 | Unclassified | 635 |
| 370 | Ga0157377_10203328 | 3300014745 | Unclassified | 1259 |
| 371 | Ga0157377_10387470 | 3300014745 | Bacteria | 948 |
| 372 | Ga0157376_10054527 | 3300014969 | Unclassified | 3333 |
| 373 | Ga0157376_11720352 | 3300014969 | Bacteria | 663 |
| 374 | Ga0209233_1002219 | 3300025261 | Bacteria | 7285 |
| 375 | Ga0207697_10005530 | 3300025315 | Bacteria | 5862 |
| 376 | Ga0207697_10022887 | 3300025315 | Unclassified | 2559 |
| 377 | Ga0207682_10038346 | 3300025893 | Bacteria | 1944 |
| 378 | Ga0207642_10072835 | 3300025899 | Bacteria | 1641 |
| 379 | Ga0207688_10022626 | 3300025901 | Bacteria | 3440 |
| 380 | Ga0207688_10412437 | 3300025901 | Bacteria | 839 |
| 381 | Ga0207647_10164766 | 3300025904 | Unclassified | 1292 |
| 382 | Ga0207699_10424842 | 3300025906 | Bacteria | 950 |
| 383 | Ga0207645_10000592 | 3300025907 | Bacteria | 30028 |
| 384 | Ga0207705_10039681 | 3300025909 | Bacteria | 3374 |
| 385 | Ga0207684_10002342 | 3300025910 | Bacteria | 19200 |
| 386 | Ga0207654_10059075 | 3300025911 | Unclassified | 2235 |
| 387 | Ga0207707_10001455 | 3300025912 | Bacteria | 21874 |
| 388 | Ga0207707_10020996 | 3300025912 | Bacteria | 5704 |
| 389 | Ga0207707_10343534 | 3300025912 | Unclassified | 1287 |
| 390 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 391 | Ga0207695_10485823 | 3300025913 | Bacteria | 1117 |
| 392 | Ga0207671_10227162 | 3300025914 | Bacteria | 1464 |
| 393 | Ga0207663_10065334 | 3300025916 | Bacteria | 2325 |
| 394 | Ga0207660_10070695 | 3300025917 | Bacteria | 2537 |
| 395 | Ga0207660_10439742 | 3300025917 | Bacteria | 1054 |
| 396 | Ga0207662_10129666 | 3300025918 | Unclassified | 1589 |
| 397 | Ga0207662_10367989 | 3300025918 | Bacteria | 969 |
| 398 | Ga0207662_10944642 | 3300025918 | Bacteria | 611 |
| 399 | Ga0207657_10014472 | 3300025919 | Bacteria | 7701 |
| 400 | Ga0207649_10439842 | 3300025920 | Unclassified | 982 |
| 401 | Ga0207652_10095034 | 3300025921 | Bacteria | 2625 |
| 402 | Ga0207652_10316377 | 3300025921 | Unclassified | 1409 |
| 403 | Ga0207646_10003474 | 3300025922 | Bacteria | 17795 |
| 404 | Ga0207646_10053880 | 3300025922 | Bacteria | 3598 |
| 405 | Ga0207646_10307460 | 3300025922 | Bacteria | 1432 |
| 406 | Ga0207646_10956919 | 3300025922 | Unclassified | 758 |
| 407 | Ga0207646_11061964 | 3300025922 | Unclassified | 714 |
| 408 | Ga0207681_10075779 | 3300025923 | Bacteria | 2360 |
| 409 | Ga0207681_10089024 | 3300025923 | Bacteria | 2200 |
| 410 | Ga0207681_10216031 | 3300025923 | Bacteria | 1481 |
| 411 | Ga0207681_10415994 | 3300025923 | Bacteria | 1088 |
| 412 | Ga0207694_10126861 | 3300025924 | Bacteria | 2042 |
| 413 | Ga0207650_10001050 | 3300025925 | Bacteria | 20534 |
| 414 | Ga0207650_10723147 | 3300025925 | Bacteria | 842 |
| 415 | Ga0207659_10041943 | 3300025926 | Bacteria | 3206 |
| 416 | Ga0207659_10258788 | 3300025926 | Bacteria | 1415 |
| 417 | Ga0207644_10030054 | 3300025931 | Unclassified | 3773 |
| 418 | Ga0207690_10258916 | 3300025932 | Unclassified | 1347 |
| 419 | Ga0207706_10010887 | 3300025933 | Bacteria | 8299 |
| 420 | Ga0207706_10118756 | 3300025933 | Bacteria | 2325 |
| 421 | Ga0207706_10301011 | 3300025933 | Bacteria | 1397 |
| 422 | Ga0207706_10454818 | 3300025933 | Bacteria | 1107 |
| 423 | Ga0207706_10640204 | 3300025933 | Bacteria | 911 |
| 424 | Ga0207706_11005218 | 3300025933 | Unclassified | 700 |
| 425 | Ga0207686_10321223 | 3300025934 | Unclassified | 1157 |
| 426 | Ga0207709_10569083 | 3300025935 | Bacteria | 893 |
| 427 | Ga0207670_10007615 | 3300025936 | Bacteria | 6056 |
| 428 | Ga0207670_10323522 | 3300025936 | Unclassified | 1214 |
| 429 | Ga0207669_10033542 | 3300025937 | Bacteria | 2899 |
| 430 | Ga0207669_10381811 | 3300025937 | Unclassified | 1098 |
| 431 | Ga0207704_10304662 | 3300025938 | Bacteria | 1222 |
| 432 | Ga0207704_10326854 | 3300025938 | Bacteria | 1185 |
| 433 | Ga0207704_11247182 | 3300025938 | Bacteria | 635 |
| 434 | Ga0207665_10054208 | 3300025939 | Bacteria | 2704 |
| 435 | Ga0207665_10291896 | 3300025939 | Bacteria | 1216 |
| 436 | Ga0207691_10006363 | 3300025940 | Bacteria | 11410 |
| 437 | Ga0207691_10852787 | 3300025940 | Bacteria | 764 |
| 438 | Ga0207689_10049335 | 3300025942 | Bacteria | 3472 |
| 439 | Ga0207689_10408037 | 3300025942 | Bacteria | 1133 |
| 440 | Ga0207679_10003644 | 3300025945 | Bacteria | 9544 |
| 441 | Ga0207667_10872609 | 3300025949 | Bacteria | 893 |
| 442 | Ga0207667_11244943 | 3300025949 | Unclassified | 722 |
| 443 | Ga0207651_10212481 | 3300025960 | Bacteria | 1558 |
| 444 | Ga0207651_10227286 | 3300025960 | Unclassified | 1512 |
| 445 | Ga0207712_10372144 | 3300025961 | Unclassified | 1193 |
| 446 | Ga0207712_10813997 | 3300025961 | Unclassified | 822 |
| 447 | Ga0207640_10309018 | 3300025981 | Bacteria | 1254 |
| 448 | Ga0207640_10815475 | 3300025981 | Bacteria | 809 |
| 449 | Ga0207658_12133922 | 3300025986 | Unclassified | 509 |
| 450 | Ga0207703_10527512 | 3300026035 | Unclassified | 1111 |
| 451 | Ga0207639_10574626 | 3300026041 | Bacteria | 1037 |
| 452 | Ga0207678_10023583 | 3300026067 | Bacteria | 5381 |
| 453 | Ga0207678_10254315 | 3300026067 | Bacteria | 1505 |
| 454 | Ga0207708_10032000 | 3300026075 | Unclassified | 3994 |
| 455 | Ga0207708_10415143 | 3300026075 | Bacteria | 1115 |
| 456 | Ga0207708_11871844 | 3300026075 | Bacteria | 526 |
| 457 | Ga0207702_10089539 | 3300026078 | Bacteria | 2691 |
| 458 | Ga0207641_10783696 | 3300026088 | Unclassified | 942 |
| 459 | Ga0207641_11569761 | 3300026088 | Bacteria | 660 |
| 460 | Ga0207648_10187358 | 3300026089 | Bacteria | 1833 |
| 461 | Ga0207648_11166525 | 3300026089 | Unclassified | 723 |
| 462 | Ga0207676_10199027 | 3300026095 | Bacteria | 1769 |
| 463 | Ga0207676_10464716 | 3300026095 | Bacteria | 1195 |
| 464 | Ga0207674_10086162 | 3300026116 | Bacteria | 3136 |
| 465 | Ga0207674_10115924 | 3300026116 | Bacteria | 2650 |
| 466 | Ga0207674_10216610 | 3300026116 | Bacteria | 1863 |
| 467 | Ga0207674_10808022 | 3300026116 | Bacteria | 905 |
| 468 | Ga0207674_11215618 | 3300026116 | Bacteria | 723 |
| 469 | Ga0207675_100175600 | 3300026118 | Bacteria | 2049 |
| 470 | Ga0207675_100242401 | 3300026118 | Bacteria | 1742 |
| 471 | Ga0207675_100538179 | 3300026118 | Unclassified | 1166 |
| 472 | Ga0207675_100629389 | 3300026118 | Bacteria | 1078 |
| 473 | Ga0207675_100672756 | 3300026118 | Bacteria | 1042 |
| 474 | Ga0207675_100884715 | 3300026118 | Bacteria | 909 |
| 475 | Ga0207683_10019216 | 3300026121 | Bacteria | 5833 |
| 476 | Ga0207698_10814766 | 3300026142 | Bacteria | 937 |
| 477 | Ga0209973_1046802 | 3300027252 | Unclassified | 645 |
| 478 | Ga0209967_1065444 | 3300027364 | Bacteria | 565 |
| 479 | Ga0209981_1052994 | 3300027378 | Unclassified | 616 |
| 480 | Ga0209984_1002716 | 3300027424 | Bacteria | 1989 |
| 481 | Ga0210000_1065529 | 3300027462 | Unclassified | 590 |
| 482 | Ga0209982_1042920 | 3300027552 | Unclassified | 723 |
| 483 | Ga0209970_1003676 | 3300027614 | Bacteria | 2570 |
| 484 | Ga0209970_1061889 | 3300027614 | Unclassified | 687 |
| 485 | Ga0209970_1068062 | 3300027614 | Bacteria | 660 |
| 486 | Ga0210002_1036544 | 3300027617 | Bacteria | 827 |
| 487 | Ga0209983_1007745 | 3300027665 | Bacteria | 2199 |
| 488 | Ga0209971_1003655 | 3300027682 | Bacteria | 3643 |
| 489 | Ga0209966_1046331 | 3300027695 | Unclassified | 917 |
| 490 | Ga0209998_10144612 | 3300027717 | Bacteria | 609 |
| 491 | Ga0209998_10197636 | 3300027717 | Bacteria | 525 |
| 492 | Ga0209974_10000812 | 3300027876 | Bacteria | 10699 |
| 493 | Ga0209974_10005290 | 3300027876 | Bacteria | 4553 |
| 494 | Ga0207428_10029894 | 3300027907 | Bacteria | 4507 |
| 495 | Ga0207428_10098398 | 3300027907 | Unclassified | 2264 |
| 496 | Ga0207428_10133763 | 3300027907 | Bacteria | 1897 |
| 497 | Ga0207428_10288858 | 3300027907 | Bacteria | 1216 |
| 498 | Ga0207428_10300797 | 3300027907 | Bacteria | 1187 |
| 499 | Ga0268266_11211368 | 3300028379 | Unclassified | 730 |
| 500 | Ga0268265_10092376 | 3300028380 | Bacteria | 2422 |
| 501 | Ga0268265_10282736 | 3300028380 | Bacteria | 1485 |
| 502 | Ga0268265_10337835 | 3300028380 | Bacteria | 1370 |
| 503 | Ga0268265_11402766 | 3300028380 | Bacteria | 701 |
| 504 | Ga0268265_11795737 | 3300028380 | Unclassified | 620 |
| 505 | Ga0268264_11066622 | 3300028381 | Bacteria | 816 |
| 506 | Ga0307515_10000005 | 3300028794 | Bacteria | 758563 |
| 507 | Ga0265760_10144607 | 3300031090 | Bacteria | 776 |
| 508 | Ga0307408_100055613 | 3300031548 | Archaea | 2866 |
| 509 | Ga0307408_100057239 | 3300031548 | Bacteria | 2829 |
| 510 | Ga0307408_100061859 | 3300031548 | Bacteria | 2734 |
| 511 | Ga0307408_100216838 | 3300031548 | Bacteria | 1559 |
| 512 | Ga0316575_10187384 | 3300031665 | Bacteria | 860 |
| 513 | Ga0316575_10480600 | 3300031665 | Bacteria | 538 |
| 514 | Ga0316576_10131305 | 3300031727 | Bacteria | 1884 |
| 515 | Ga0316578_10176869 | 3300031728 | Bacteria | 1286 |
| 516 | Ga0307405_10001828 | 3300031731 | Bacteria | 9125 |
| 517 | Ga0307405_10173807 | 3300031731 | Unclassified | 1539 |
| 518 | Ga0307405_10428643 | 3300031731 | Unclassified | 1043 |
| 519 | Ga0316577_10001492 | 3300031733 | Bacteria | 11089 |
| 520 | Ga0316577_10113086 | 3300031733 | Bacteria | 1524 |
| 521 | Ga0316577_10609810 | 3300031733 | Bacteria | 621 |
| 522 | Ga0307413_10050614 | 3300031824 | Bacteria | 2497 |
| 523 | Ga0307413_10106361 | 3300031824 | Unclassified | 1867 |
| 524 | Ga0307413_11114037 | 3300031824 | Bacteria | 682 |
| 525 | Ga0307413_11639450 | 3300031824 | Unclassified | 572 |
| 526 | Ga0307413_11688129 | 3300031824 | Unclassified | 564 |
| 527 | Ga0307410_10018291 | 3300031852 | Unclassified | 4232 |
| 528 | Ga0307410_10071739 | 3300031852 | Bacteria | 2403 |
| 529 | Ga0307410_10121841 | 3300031852 | Bacteria | 1903 |
| 530 | Ga0307410_10153004 | 3300031852 | Bacteria | 1719 |
| 531 | Ga0307410_10280269 | 3300031852 | Unclassified | 1308 |
| 532 | Ga0307410_10789378 | 3300031852 | Bacteria | 807 |
| 533 | Ga0307406_10013857 | 3300031901 | Bacteria | 4628 |
| 534 | Ga0307406_10067687 | 3300031901 | Bacteria | 2329 |
| 535 | Ga0307406_10075308 | 3300031901 | Bacteria | 2226 |
| 536 | Ga0307406_10087995 | 3300031901 | Bacteria | 2083 |
| 537 | Ga0307406_10115151 | 3300031901 | Unclassified | 1858 |
| 538 | Ga0307407_10033925 | 3300031903 | Bacteria | 2789 |
| 539 | Ga0307407_10224053 | 3300031903 | Bacteria | 1273 |
| 540 | Ga0307407_10431336 | 3300031903 | Bacteria | 952 |
| 541 | Ga0307412_10012347 | 3300031911 | Bacteria | 4976 |
| 542 | Ga0307412_10032667 | 3300031911 | Unclassified | 3301 |
| 543 | Ga0307412_10455038 | 3300031911 | Bacteria | 1055 |
| 544 | Ga0307409_100197333 | 3300031995 | Bacteria | 1797 |
| 545 | Ga0307409_100318563 | 3300031995 | Bacteria | 1454 |
| 546 | Ga0307409_100843253 | 3300031995 | Unclassified | 927 |
| 547 | Ga0307416_100000870 | 3300032002 | Bacteria | 15903 |
| 548 | Ga0307416_100002835 | 3300032002 | Bacteria | 10088 |
| 549 | Ga0307416_100022394 | 3300032002 | Bacteria | 4560 |
| 550 | Ga0307416_100522170 | 3300032002 | Unclassified | 1256 |
| 551 | Ga0307414_10015663 | 3300032004 | Unclassified | 4583 |
| 552 | Ga0307414_10141205 | 3300032004 | Bacteria | 1886 |
| 553 | Ga0307414_10219390 | 3300032004 | Unclassified | 1560 |
| 554 | Ga0307414_12071670 | 3300032004 | Bacteria | 531 |
| 555 | Ga0307411_10012783 | 3300032005 | Bacteria | 4600 |
| 556 | Ga0307411_10035882 | 3300032005 | Bacteria | 3101 |
| 557 | Ga0307411_10038805 | 3300032005 | Bacteria | 3008 |
| 558 | Ga0307411_10124439 | 3300032005 | Bacteria | 1872 |
| 559 | Ga0307411_10732481 | 3300032005 | Unclassified | 864 |
| 560 | Ga0307411_11038631 | 3300032005 | Bacteria | 735 |
| 561 | Ga0307415_100008578 | 3300032126 | Bacteria | 5673 |
| 562 | Ga0307415_100176437 | 3300032126 | Bacteria | 1672 |
| 563 | Ga0307415_100528368 | 3300032126 | Unclassified | 1037 |
| 564 | Ga0316585_10007701 | 3300032137 | Bacteria | 3111 |
| 565 | Ga0316585_10197044 | 3300032137 | Bacteria | 666 |
| 566 | Ga0373926_0273974 | 3300035083 | Bacteria | 656 |
| 567 | Ga0373928_0023454 | 3300035084 | Bacteria | 1316 |
| 568 | Ga0373940_0113852 | 3300035088 | Bacteria | 833 |
| 569 | Ga0373952_0151592 | 3300035092 | Unclassified | 651 |
| 570 | Ga0373932_0033741 | 3300035112 | Bacteria | 1439 |
| 571 | Ga0373932_0200699 | 3300035112 | Unclassified | 709 |
| 572 | Ga0373932_0359884 | 3300035112 | Unclassified | 555 |
| 573 | Ga0373939_0199681 | 3300035114 | Bacteria | 756 |
| 574 | Ga0373939_0383867 | 3300035114 | Unclassified | 579 |
| 575 | Ga0373941_0257082 | 3300035115 | Unclassified | 684 |
| 576 | Ga0373943_0636497 | 3300035170 | Bacteria | 630 |
| 577 | Ga0373946_0597124 | 3300035171 | Bacteria | 572 |
| 578 | Ga0373955_0294038 | 3300035172 | Unclassified | 979 |
| 579 | Ga0373942_0016919 | 3300035207 | Bacteria | 1793 |
| 580 | Ga0373942_0156579 | 3300035207 | Bacteria | 735 |
| 581 | Ga0373961_0226044 | 3300035241 | Unclassified | 669 |
| 582 | Ga0316574_0019000 | 3300035398 | Bacteria | 4049 |
| 583 | Ga0316574_0074165 | 3300035398 | Bacteria | 2153 |
| 584 | Ga0316574_0203524 | 3300035398 | Unclassified | 1271 |
| 585 | Ga0316574_0219846 | 3300035398 | Bacteria | 1217 |
| 586 | Ga0316574_0405148 | 3300035398 | Bacteria | 858 |
| 587 | Ga0373931_0231038 | 3300035691 | Unclassified | 1117 |
| 588 | Ga0373931_0400519 | 3300035691 | Bacteria | 869 |
| 589 | Ga0373931_0554362 | 3300035691 | Bacteria | 747 |
| 590 | Ga0373935_0473823 | 3300035692 | Bacteria | 906 |
| 591 | Ga0373947_0828518 | 3300035725 | Unclassified | 632 |
| 592 | Ga0373937_0141992 | 3300036401 | Bacteria | 2247 |
| 593 | Ga0316582_0204597 | 3300036647 | Bacteria | 1347 |
| 594 | Ga0316582_0336742 | 3300036647 | Bacteria | 1038 |
| 595 | Ga0316584_0006481 | 3300036712 | Bacteria | 7925 |
| 596 | Ga0316584_0092710 | 3300036712 | Bacteria | 2261 |
| 597 | Ga0373925_0673532 | 3300037068 | Bacteria | 853 |
| 598 | Ga0439453_0070827 | 3300041408 | Bacteria | 737 |
| 599 | Ga0439465_0169200 | 3300041413 | Unclassified | 787 |
| 600 | Ga0439431_0266577 | 3300041997 | Bacteria | 511 |
| 601 | Ga0439433_0056228 | 3300041999 | Unclassified | 933 |
| 602 | Ga0439441_015525 | 3300042001 | Bacteria | 1348 |
| 603 | Ga0439442_141863 | 3300042002 | Unclassified | 532 |
| 604 | Ga0439445_0230797 | 3300042004 | Unclassified | 551 |
| 605 | Ga0439432_085125 | 3300042006 | Unclassified | 955 |
| 606 | Ga0439450_144857 | 3300042008 | Unclassified | 621 |
| 607 | Ga0439454_025209 | 3300042011 | Bacteria | 903 |
| 608 | Ga0439455_0178146 | 3300042012 | Unclassified | 612 |
| 609 | Ga0439456_063877 | 3300042013 | Unclassified | 811 |
| 610 | Ga0450911_019573 | 3300042115 | Bacteria | 887 |
| 611 | Ga0450919_035315 | 3300042121 | Bacteria | 577 |
| 612 | Ga0450920_010976 | 3300042122 | Bacteria | 1683 |
| 613 | Ga0450923_001196 | 3300042125 | Bacteria | 3333 |
| 614 | Ga0450894_022089 | 3300042131 | Bacteria | 861 |
| 615 | Ga0450895_000249 | 3300042132 | Bacteria | 2749 |
| 616 | Ga0450895_002562 | 3300042132 | Bacteria | 1358 |
| 617 | Ga0450896_000566 | 3300042133 | Bacteria | 3951 |
| 618 | Ga0450896_001535 | 3300042133 | Bacteria | 2867 |
| 619 | Ga0450899_027048 | 3300042135 | Bacteria | 688 |
| 620 | Ga0450900_045104 | 3300042136 | Unclassified | 666 |
| 621 | Ga0450889_028602 | 3300042144 | Unclassified | 644 |
| 622 | Ga0450907_021726 | 3300042146 | Bacteria | 1080 |
| 623 | Ga0450907_081545 | 3300042146 | Bacteria | 561 |
| 624 | Ga0439446_0001736 | 3300042156 | Bacteria | 5066 |
| 625 | Ga0439446_0032718 | 3300042156 | Bacteria | 1509 |
| 626 | Ga0439446_0269567 | 3300042156 | Unclassified | 591 |
| 627 | Ga0450908_000339 | 3300042184 | Bacteria | 9121 |
| 628 | Ga0450908_011944 | 3300042184 | Bacteria | 1582 |
| 629 | Ga0439434_0006745 | 3300042435 | Bacteria | 3354 |
| 630 | Ga0439434_0016223 | 3300042435 | Bacteria | 2225 |
| 631 | Ga0439434_0054403 | 3300042435 | Bacteria | 1245 |
| 632 | Ga0439435_0001211 | 3300042436 | Bacteria | 4663 |
| 633 | Ga0439435_0098045 | 3300042436 | Bacteria | 898 |
| 634 | Ga0439444_0039794 | 3300042437 | Bacteria | 918 |
| 635 | Ga0439444_0154120 | 3300042437 | Unclassified | 557 |
| 636 | Ga0439459_0188939 | 3300042438 | Bacteria | 557 |
| 637 | Ga0439460_0006044 | 3300042461 | Bacteria | 2988 |
| 638 | Ga0450918_002807 | 3300042531 | Bacteria | 3272 |
| 639 | Ga0450918_012882 | 3300042531 | Bacteria | 1455 |
| 640 | Ga0451577_0143791 | 3300042876 | Bacteria | 2144 |
| 641 | Ga0451577_0335820 | 3300042876 | Unclassified | 1370 |
| 642 | Ga0451577_0466377 | 3300042876 | Unclassified | 1147 |
| 643 | Ga0451577_0553250 | 3300042876 | Bacteria | 1045 |
| 644 | Ga0451577_1219785 | 3300042876 | Bacteria | 671 |
| 645 | Ga0453683_0000838 | 3300044673 | Bacteria | 29835 |
| 646 | Ga0453684_1436321 | 3300044712 | Unclassified | 714 |
| 647 | Ga0453684_2077082 | 3300044712 | Unclassified | 570 |
| 648 | Ga0453684_2508921 | 3300044712 | Bacteria | 508 |
| 649 | Ga0451576_0400502 | 3300045051 | Unclassified | 1439 |
| 650 | Ga0451576_0889366 | 3300045051 | Bacteria | 934 |
| 651 | Ga0451576_1162381 | 3300045051 | Bacteria | 806 |
| 652 | Ga0451576_1806973 | 3300045051 | Bacteria | 632 |
| 653 | Ga0451576_2460874 | 3300045051 | Unclassified | 532 |
| 654 | Ga0495591_130220 | 3300046458 | Bacteria | 611 |
| 655 | Ga0495651_0918897 | 3300046462 | Bacteria | 534 |
| 656 | Ga0495580_0001653 | 3300046472 | Bacteria | 19619 |
| 657 | Ga0495666_0258679 | 3300046526 | Bacteria | 792 |
| 658 | Ga0495586_0276890 | 3300046535 | Unclassified | 960 |
| 659 | Ga0495598_0047318 | 3300046537 | Bacteria | 1282 |
| 660 | Ga0495621_0366297 | 3300046539 | Bacteria | 607 |
| 661 | Ga0495633_0550804 | 3300046558 | Unclassified | 519 |
| 662 | Ga0495647_0506333 | 3300046681 | Bacteria | 562 |
| 663 | Ga0495658_0219582 | 3300046683 | Bacteria | 1190 |
| 664 | Ga0495658_0746864 | 3300046683 | Bacteria | 627 |
| 665 | Ga0495669_0238927 | 3300046684 | Unclassified | 872 |
| 666 | Ga0495669_0628287 | 3300046684 | Unclassified | 522 |
| 667 | Ga0495670_0808672 | 3300046691 | Bacteria | 512 |
| 668 | Ga0495674_0609793 | 3300047319 | Bacteria | 864 |
| 669 | Ga0495614_0575806 | 3300048089 | Bacteria | 540 |
| 670 | Ga0496102_0515298 | 3300048905 | Unclassified | 1118 |
| 671 | Ga0496102_1544840 | 3300048905 | Bacteria | 582 |
| 672 | Ga0496104_0419058 | 3300048907 | Unclassified | 1251 |
| 673 | Ga0496105_0491188 | 3300048908 | Bacteria | 965 |
| 674 | Ga0496106_0255995 | 3300048909 | Unclassified | 1400 |
| 675 | Ga0496108_0442295 | 3300048911 | Unclassified | 1136 |
| 676 | Ga0496109_1267791 | 3300048912 | Bacteria | 673 |
| 677 | Ga0496109_1755201 | 3300048912 | Unclassified | 554 |
| 678 | Ga0496110_0312477 | 3300048913 | Unclassified | 1431 |
| 679 | Ga0496112_0158808 | 3300048915 | Unclassified | 2227 |
| 680 | Ga0496112_0231942 | 3300048915 | Bacteria | 1800 |
| 681 | Ga0496113_0037131 | 3300048916 | Bacteria | 3573 |
| 682 | Ga0496113_0282630 | 3300048916 | Bacteria | 1327 |
| 683 | Ga0496113_0405855 | 3300048916 | Bacteria | 1094 |
| 684 | Ga0496117_0079841 | 3300048920 | Bacteria | 2154 |
| 685 | Ga0496118_0018596 | 3300048921 | Bacteria | 6257 |
| 686 | Ga0501294_032497 | 3300049517 | Unclassified | 615 |
| 687 | Ga0501295_124214 | 3300049518 | Unclassified | 622 |
| 688 | Ga0501031_0029456 | 3300049568 | Unclassified | 3581 |
| 689 | Ga0501031_0033561 | 3300049568 | Bacteria | 3348 |
| 690 | Ga0501031_1002243 | 3300049568 | Bacteria | 534 |
| 691 | Ga0501032_0018093 | 3300049569 | Bacteria | 4941 |
| 692 | Ga0501032_0021090 | 3300049569 | Bacteria | 4531 |
| 693 | Ga0501032_0475352 | 3300049569 | Bacteria | 800 |
| 694 | Ga0501032_0480162 | 3300049569 | Bacteria | 795 |
| 695 | Ga0501032_0604241 | 3300049569 | Unclassified | 698 |
| 696 | Ga0501033_0153984 | 3300049570 | Bacteria | 1657 |
| 697 | Ga0501033_0225704 | 3300049570 | Bacteria | 1332 |
| 698 | Ga0501033_0528138 | 3300049570 | Bacteria | 815 |
| 699 | Ga0501034_0526527 | 3300049571 | Bacteria | 1093 |
| 700 | Ga0501034_1522222 | 3300049571 | Bacteria | 543 |
| 701 | Ga0501036_0003802 | 3300049572 | Bacteria | 12106 |
| 702 | Ga0501036_0049293 | 3300049572 | Unclassified | 3566 |
| 703 | Ga0501036_0070999 | 3300049572 | Bacteria | 2944 |
| 704 | Ga0501036_0574655 | 3300049572 | Bacteria | 936 |
| 705 | Ga0501036_0616944 | 3300049572 | Bacteria | 899 |
| 706 | Ga0501036_0716741 | 3300049572 | Bacteria | 826 |
| 707 | Ga0501036_1314484 | 3300049572 | Bacteria | 587 |
| 708 | Ga0501037_0011638 | 3300049573 | Bacteria | 6478 |
| 709 | Ga0501037_0087438 | 3300049573 | Bacteria | 2256 |
| 710 | Ga0501037_0162525 | 3300049573 | Bacteria | 1591 |
| 711 | Ga0501037_0191565 | 3300049573 | Unclassified | 1447 |
| 712 | Ga0501037_0943757 | 3300049573 | Bacteria | 564 |
| 713 | Ga0501038_0024543 | 3300049574 | Bacteria | 5378 |
| 714 | Ga0501038_0099268 | 3300049574 | Bacteria | 2427 |
| 715 | Ga0501038_0191655 | 3300049574 | Unclassified | 1644 |
| 716 | Ga0501038_0627815 | 3300049574 | Unclassified | 811 |
| 717 | Ga0501039_0001587 | 3300049575 | Bacteria | 16735 |
| 718 | Ga0501039_0046639 | 3300049575 | Bacteria | 3348 |
| 719 | Ga0501039_0284594 | 3300049575 | Unclassified | 1299 |
| 720 | Ga0501039_1395971 | 3300049575 | Bacteria | 539 |
| 721 | Ga0501039_1601285 | 3300049575 | Unclassified | 500 |
| 722 | Ga0501040_0001849 | 3300049576 | Bacteria | 13579 |
| 723 | Ga0501040_0006605 | 3300049576 | Bacteria | 7530 |
| 724 | Ga0501040_0007050 | 3300049576 | Bacteria | 7283 |
| 725 | Ga0501040_0201596 | 3300049576 | Bacteria | 1413 |
| 726 | Ga0501040_0255459 | 3300049576 | Bacteria | 1250 |
| 727 | Ga0501040_0274463 | 3300049576 | Bacteria | 1204 |
| 728 | Ga0501040_0490460 | 3300049576 | Unclassified | 885 |
| 729 | Ga0501040_0575427 | 3300049576 | Bacteria | 813 |
| 730 | Ga0501040_1389354 | 3300049576 | Unclassified | 510 |
| 731 | Ga0501040_1423190 | 3300049576 | Bacteria | 503 |
| 732 | Ga0501041_0000126 | 3300049577 | Bacteria | 32480 |
| 733 | Ga0501041_0001670 | 3300049577 | Bacteria | 12422 |
| 734 | Ga0501041_0017973 | 3300049577 | Bacteria | 4208 |
| 735 | Ga0501041_0040945 | 3300049577 | Bacteria | 2813 |
| 736 | Ga0501041_0139253 | 3300049577 | Bacteria | 1513 |
| 737 | Ga0501041_0311314 | 3300049577 | Bacteria | 993 |
| 738 | Ga0501041_0639683 | 3300049577 | Bacteria | 680 |
| 739 | Ga0501041_0674159 | 3300049577 | Unclassified | 661 |
| 740 | Ga0501041_1062212 | 3300049577 | Unclassified | 521 |
| 741 | Ga0501042_0001273 | 3300049578 | Bacteria | 14687 |
| 742 | Ga0501042_0019064 | 3300049578 | Bacteria | 4761 |
| 743 | Ga0501042_0194033 | 3300049578 | Bacteria | 1465 |
| 744 | Ga0501042_0465461 | 3300049578 | Bacteria | 917 |
| 745 | Ga0501042_0835866 | 3300049578 | Bacteria | 670 |
| 746 | Ga0501042_1252792 | 3300049578 | Bacteria | 541 |
| 747 | Ga0501043_0057159 | 3300049579 | Bacteria | 3064 |
| 748 | Ga0501043_0129544 | 3300049579 | Bacteria | 1977 |
| 749 | Ga0501043_0374372 | 3300049579 | Unclassified | 1079 |
| 750 | Ga0501043_0428343 | 3300049579 | Bacteria | 997 |
| 751 | Ga0501043_0975736 | 3300049579 | Bacteria | 604 |
| 752 | Ga0501046_0007595 | 3300049580 | Bacteria | 9509 |
| 753 | Ga0501046_0020390 | 3300049580 | Bacteria | 5483 |
| 754 | Ga0501046_0165187 | 3300049580 | Bacteria | 1663 |
| 755 | Ga0501046_0185543 | 3300049580 | Bacteria | 1553 |
| 756 | Ga0501046_0321118 | 3300049580 | Bacteria | 1128 |
| 757 | Ga0501046_0491318 | 3300049580 | Unclassified | 880 |
| 758 | Ga0501046_0501039 | 3300049580 | Bacteria | 870 |
| 759 | Ga0501046_0569622 | 3300049580 | Unclassified | 806 |
| 760 | Ga0501046_0694509 | 3300049580 | Bacteria | 717 |
| 761 | Ga0501048_0003443 | 3300049582 | Bacteria | 12024 |
| 762 | Ga0501048_0005073 | 3300049582 | Bacteria | 10033 |
| 763 | Ga0501048_0196471 | 3300049582 | Bacteria | 1430 |
| 764 | Ga0501048_0498899 | 3300049582 | Bacteria | 873 |
| 765 | Ga0501048_0733131 | 3300049582 | Bacteria | 710 |
| 766 | Ga0501048_0995298 | 3300049582 | Bacteria | 603 |
| 767 | Ga0501067_0048810 | 3300049583 | Bacteria | 2347 |
| 768 | Ga0501067_0226838 | 3300049583 | Bacteria | 1040 |
| 769 | Ga0501067_0313762 | 3300049583 | Bacteria | 873 |
| 770 | Ga0501068_0032984 | 3300049584 | Bacteria | 3082 |
| 771 | Ga0501068_0036095 | 3300049584 | Unclassified | 2954 |
| 772 | Ga0501068_0257606 | 3300049584 | Unclassified | 1112 |
| 773 | Ga0501068_0422328 | 3300049584 | Bacteria | 861 |
| 774 | Ga0501068_0721357 | 3300049584 | Bacteria | 652 |
| 775 | Ga0501068_1102038 | 3300049584 | Bacteria | 525 |
| 776 | Ga0501069_0097436 | 3300049585 | Unclassified | 1667 |
| 777 | Ga0501069_0242128 | 3300049585 | Bacteria | 1051 |
| 778 | Ga0501070_0045021 | 3300049586 | Unclassified | 3671 |
| 779 | Ga0501070_0403331 | 3300049586 | Unclassified | 1105 |
| 780 | Ga0501071_0000363 | 3300049587 | Bacteria | 22256 |
| 781 | Ga0501071_0000968 | 3300049587 | Bacteria | 15682 |
| 782 | Ga0501071_0079153 | 3300049587 | Unclassified | 2402 |
| 783 | Ga0501071_0094637 | 3300049587 | Bacteria | 2198 |
| 784 | Ga0501071_0104036 | 3300049587 | Bacteria | 2095 |
| 785 | Ga0501071_0132272 | 3300049587 | Bacteria | 1854 |
| 786 | Ga0501071_0135447 | 3300049587 | Bacteria | 1832 |
| 787 | Ga0501071_0262608 | 3300049587 | Bacteria | 1304 |
| 788 | Ga0501071_0264791 | 3300049587 | Bacteria | 1299 |
| 789 | Ga0501071_0623921 | 3300049587 | Bacteria | 829 |
| 790 | Ga0501071_0793355 | 3300049587 | Unclassified | 730 |
| 791 | Ga0501072_0000264 | 3300049588 | Bacteria | 38361 |
| 792 | Ga0501072_0007973 | 3300049588 | Bacteria | 8038 |
| 793 | Ga0501072_0009199 | 3300049588 | Bacteria | 7505 |
| 794 | Ga0501072_0328060 | 3300049588 | Bacteria | 1216 |
| 795 | Ga0501072_0566591 | 3300049588 | Bacteria | 896 |
| 796 | Ga0501072_0761326 | 3300049588 | Bacteria | 759 |
| 797 | Ga0501072_0761398 | 3300049588 | Unclassified | 759 |
| 798 | Ga0501072_0867143 | 3300049588 | Bacteria | 706 |
| 799 | Ga0501072_0891641 | 3300049588 | Unclassified | 695 |
| 800 | Ga0501072_0983822 | 3300049588 | Bacteria | 658 |
| 801 | Ga0501072_1098646 | 3300049588 | Unclassified | 619 |
| 802 | Ga0501073_0016547 | 3300049589 | Bacteria | 5345 |
| 803 | Ga0501073_0023845 | 3300049589 | Unclassified | 4394 |
| 804 | Ga0501073_0027511 | 3300049589 | Bacteria | 4066 |
| 805 | Ga0501073_0045503 | 3300049589 | Bacteria | 3091 |
| 806 | Ga0501073_0158603 | 3300049589 | Bacteria | 1568 |
| 807 | Ga0501074_0007641 | 3300049590 | Bacteria | 7824 |
| 808 | Ga0501074_0020471 | 3300049590 | Bacteria | 4807 |
| 809 | Ga0501074_0223323 | 3300049590 | Bacteria | 1341 |
| 810 | Ga0501074_0247359 | 3300049590 | Bacteria | 1268 |
| 811 | Ga0501075_0001885 | 3300049591 | Bacteria | 13835 |
| 812 | Ga0501075_0003063 | 3300049591 | Bacteria | 11174 |
| 813 | Ga0501075_0006023 | 3300049591 | Bacteria | 8313 |
| 814 | Ga0501075_0029253 | 3300049591 | Bacteria | 4073 |
| 815 | Ga0501075_0107800 | 3300049591 | Bacteria | 2117 |
| 816 | Ga0501075_0186776 | 3300049591 | Bacteria | 1581 |
| 817 | Ga0501075_0202725 | 3300049591 | Bacteria | 1513 |
| 818 | Ga0501075_0212130 | 3300049591 | Bacteria | 1477 |
| 819 | Ga0501075_0316164 | 3300049591 | Bacteria | 1190 |
| 820 | Ga0501075_0360006 | 3300049591 | Unclassified | 1109 |
| 821 | Ga0501075_0445226 | 3300049591 | Bacteria | 988 |
| 822 | Ga0501076_0000207 | 3300049592 | Bacteria | 35345 |
| 823 | Ga0501076_0005590 | 3300049592 | Bacteria | 9054 |
| 824 | Ga0501076_0016790 | 3300049592 | Bacteria | 5555 |
| 825 | Ga0501076_0082556 | 3300049592 | Bacteria | 2580 |
| 826 | Ga0501076_0236436 | 3300049592 | Bacteria | 1494 |
| 827 | Ga0501076_0240290 | 3300049592 | Bacteria | 1482 |
| 828 | Ga0501076_0254733 | 3300049592 | Unclassified | 1436 |
| 829 | Ga0501076_0264563 | 3300049592 | Bacteria | 1408 |
| 830 | Ga0501076_0265992 | 3300049592 | Bacteria | 1404 |
| 831 | Ga0501076_0496162 | 3300049592 | Bacteria | 1006 |
| 832 | Ga0501077_0000314 | 3300049593 | Bacteria | 28892 |
| 833 | Ga0501077_0021486 | 3300049593 | Bacteria | 4084 |
| 834 | Ga0501077_0419256 | 3300049593 | Bacteria | 856 |
| 835 | Ga0501077_0472377 | 3300049593 | Bacteria | 803 |
| 836 | Ga0501077_0792909 | 3300049593 | Unclassified | 609 |
| 837 | Ga0501209_088652 | 3300049656 | Unclassified | 898 |
| 838 | Ga0501216_055050 | 3300049660 | Unclassified | 790 |
| 839 | Ga0501217_069065 | 3300049661 | Unclassified | 959 |
| 840 | Ga0501233_073530 | 3300049668 | Unclassified | 870 |
| 841 | Ga0501233_138458 | 3300049668 | Unclassified | 670 |
| 842 | Ga0501249_013124 | 3300049679 | Bacteria | 1758 |
| 843 | Ga0501261_039152 | 3300049690 | Unclassified | 742 |
| 844 | Ga0501079_0001235 | 3300049741 | Bacteria | 17904 |
| 845 | Ga0501079_0026809 | 3300049741 | Unclassified | 4418 |
| 846 | Ga0501079_0044171 | 3300049741 | Bacteria | 3439 |
| 847 | Ga0501079_0058803 | 3300049741 | Bacteria | 2967 |
| 848 | Ga0501079_0120529 | 3300049741 | Bacteria | 2040 |
| 849 | Ga0501079_0124336 | 3300049741 | Unclassified | 2006 |
| 850 | Ga0501079_0154684 | 3300049741 | Bacteria | 1787 |
| 851 | Ga0501079_0435595 | 3300049741 | Bacteria | 1029 |
| 852 | Ga0501079_0928699 | 3300049741 | Bacteria | 685 |
| 853 | Ga0501080_0002643 | 3300049742 | Bacteria | 15670 |
| 854 | Ga0501080_0032378 | 3300049742 | Bacteria | 4876 |
| 855 | Ga0501080_0181094 | 3300049742 | Bacteria | 1939 |
| 856 | Ga0501080_0187602 | 3300049742 | Bacteria | 1901 |
| 857 | Ga0501080_0196114 | 3300049742 | Unclassified | 1854 |
| 858 | Ga0501080_0535560 | 3300049742 | Bacteria | 1044 |
| 859 | Ga0501080_0915466 | 3300049742 | Bacteria | 764 |
| 860 | Ga0501080_1481701 | 3300049742 | Bacteria | 577 |
| 861 | Ga0501080_1815333 | 3300049742 | Bacteria | 512 |
| 862 | Ga0501081_0000221 | 3300049743 | Bacteria | 28481 |
| 863 | Ga0501081_0010798 | 3300049743 | Bacteria | 5965 |
| 864 | Ga0501081_0013142 | 3300049743 | Bacteria | 5445 |
| 865 | Ga0501081_0022079 | 3300049743 | Bacteria | 4256 |
| 866 | Ga0501081_0030347 | 3300049743 | Bacteria | 3659 |
| 867 | Ga0501081_0038958 | 3300049743 | Bacteria | 3250 |
| 868 | Ga0501081_0049080 | 3300049743 | Bacteria | 2905 |
| 869 | Ga0501081_0153958 | 3300049743 | Bacteria | 1653 |
| 870 | Ga0501081_0360712 | 3300049743 | Bacteria | 1072 |
| 871 | Ga0501081_0532152 | 3300049743 | Unclassified | 877 |
| 872 | Ga0501081_0786200 | 3300049743 | Bacteria | 716 |
| 873 | Ga0501081_0876941 | 3300049743 | Bacteria | 676 |
| 874 | Ga0501081_1160178 | 3300049743 | Unclassified | 585 |
| 875 | Ga0501081_1523126 | 3300049743 | Unclassified | 508 |
| 876 | Ga0501081_1558536 | 3300049743 | Unclassified | 502 |
| 877 | Ga0501083_0109973 | 3300049744 | Bacteria | 1812 |
| 878 | Ga0501083_0164251 | 3300049744 | Bacteria | 1452 |
| 879 | Ga0501083_0410369 | 3300049744 | Bacteria | 881 |
| 880 | Ga0501083_0839294 | 3300049744 | Bacteria | 598 |
| 881 | Ga0501083_0990812 | 3300049744 | Bacteria | 547 |
| 882 | Ga0501270_002032 | 3300049767 | Bacteria | 2028 |
| 883 | Ga0501035_0006599 | 3300049822 | Bacteria | 10868 |
| 884 | Ga0501035_0029674 | 3300049822 | Bacteria | 4987 |
| 885 | Ga0501035_0113433 | 3300049822 | Bacteria | 2374 |
| 886 | Ga0501035_0283773 | 3300049822 | Bacteria | 1399 |
| 887 | Ga0501035_0556673 | 3300049822 | Bacteria | 939 |
| 888 | Ga0501035_1510824 | 3300049822 | Bacteria | 512 |
| 889 | Ga0501044_0154134 | 3300049823 | Bacteria | 2278 |
| 890 | Ga0501045_0006059 | 3300049824 | Bacteria | 8376 |
| 891 | Ga0501045_0071855 | 3300049824 | Bacteria | 2547 |
| 892 | Ga0501045_0108389 | 3300049824 | Bacteria | 2058 |
| 893 | Ga0501045_1071445 | 3300049824 | Unclassified | 590 |
| 894 | Ga0501204_041404 | 3300049850 | Unclassified | 676 |
| 895 | Ga0501204_053276 | 3300049850 | Unclassified | 625 |
| 896 | nmdc:mga03n38_167716_c1 | 3300050490 | Bacteria | 1116 |
| 897 | nmdc:mga0k408_347570_c1 | 3300050493 | Bacteria | 884 |
| 898 | nmdc:mga0k408_362634_c1 | 3300050493 | Unclassified | 863 |
| 899 | nmdc:mga0k408_771762_c1 | 3300050493 | Unclassified | 561 |
| 900 | nmdc:mga06z11_40382_c1 | 3300050494 | Bacteria | 2328 |
| 901 | nmdc:mga06z11_800670_c1 | 3300050494 | Bacteria | 574 |
| 902 | nmdc:mga05p37_100452_c1 | 3300050507 | Bacteria | 3563 |
| 903 | nmdc:mga05p37_128118_c1 | 3300050507 | Bacteria | 3116 |
| 904 | nmdc:mga05p37_136802_c1 | 3300050507 | Bacteria | 3003 |
| 905 | nmdc:mga05p37_13856_c1 | 3300050507 | Bacteria | 9660 |
| 906 | nmdc:mga05p37_1404637_c1 | 3300050507 | Unclassified | 703 |
| 907 | nmdc:mga05p37_1634005_c1 | 3300050507 | Unclassified | 633 |
| 908 | nmdc:mga05p37_1640144_c1 | 3300050507 | Bacteria | 631 |
| 909 | nmdc:mga05p37_209730_c1 | 3300050507 | Bacteria | 2355 |
| 910 | nmdc:mga05p37_398851_c1 | 3300050507 | Bacteria | 1607 |
| 911 | nmdc:mga05p37_45626_c1 | 3300050507 | Bacteria | 5389 |
| 912 | nmdc:mga05p37_481911_c1 | 3300050507 | Bacteria | 1428 |
| 913 | nmdc:mga05p37_60337_c1 | 3300050507 | Bacteria | 1895 |
| 914 | nmdc:mga05p37_680247_c1 | 3300050507 | Bacteria | 1147 |
| 915 | nmdc:mga05p37_70161_c1 | 3300050507 | Bacteria | 4310 |
| 916 | nmdc:mga05p37_91026_c1 | 3300050507 | Bacteria | 3759 |
| 917 | nmdc:mga05p37_95797_c1 | 3300050507 | Bacteria | 3656 |
| 918 | nmdc:mga05p37_97082_c1 | 3300050507 | Bacteria | 3630 |
| 919 | nmdc:mga09592_11064_c1 | 3300050508 | Bacteria | 7344 |
| 920 | nmdc:mga09592_1377121_c1 | 3300050508 | Unclassified | 578 |
| 921 | nmdc:mga09592_1660461_c1 | 3300050508 | Bacteria | 516 |
| 922 | nmdc:mga09592_70001_c1 | 3300050508 | Unclassified | 2611 |
| 923 | nmdc:mga09592_763734_c1 | 3300050508 | Unclassified | 820 |
| 924 | nmdc:mga0qj67_13514_c1 | 3300050509 | Bacteria | 6158 |
| 925 | nmdc:mga0qj67_279683_c1 | 3300050509 | Unclassified | 1353 |
| 926 | nmdc:mga0qj67_45181_c1 | 3300050509 | Unclassified | 3475 |
| 927 | nmdc:mga0qj67_903026_c1 | 3300050509 | Bacteria | 696 |
| 928 | nmdc:mga06r32_104565_c1 | 3300050510 | Bacteria | 2781 |
| 929 | nmdc:mga06r32_1652755_c1 | 3300050510 | Unclassified | 578 |
| 930 | nmdc:mga06r32_1799353_c1 | 3300050510 | Bacteria | 548 |
| 931 | nmdc:mga06r32_239318_c1 | 3300050510 | Bacteria | 1803 |
| 932 | nmdc:mga06r32_388396_c1 | 3300050510 | Bacteria | 1378 |
| 933 | nmdc:mga06r32_41331_c1 | 3300050510 | Bacteria | 4381 |
| 934 | nmdc:mga06r32_415068_c1 | 3300050510 | Bacteria | 1327 |
| 935 | nmdc:mga06r32_45349_c1 | 3300050510 | Unclassified | 4190 |
| 936 | nmdc:mga06r32_765383_c1 | 3300050510 | Bacteria | 928 |
| 937 | nmdc:mga06r32_777421_c1 | 3300050510 | Bacteria | 919 |
| 938 | nmdc:mga06r32_831646_c1 | 3300050510 | Unclassified | 883 |
| 939 | nmdc:mga08y16_1182762_c1 | 3300050511 | Bacteria | 736 |
| 940 | nmdc:mga08y16_177248_c1 | 3300050511 | Bacteria | 2213 |
| 941 | nmdc:mga08y16_268647_c1 | 3300050511 | Bacteria | 1761 |
| 942 | nmdc:mga08y16_35585_c1 | 3300050511 | Bacteria | 5229 |
| 943 | nmdc:mga08y16_36816_c1 | 3300050511 | Bacteria | 5139 |
| 944 | nmdc:mga08y16_368365_c1 | 3300050511 | Bacteria | 1474 |
| 945 | nmdc:mga08y16_48088_c1 | 3300050511 | Bacteria | 4463 |
| 946 | nmdc:mga0n895_1102_c1 | 3300050512 | Bacteria | 19755 |
| 947 | nmdc:mga0n895_117509_c1 | 3300050512 | Bacteria | 2679 |
| 948 | nmdc:mga0n895_15879_c1 | 3300050512 | Bacteria | 6887 |
| 949 | nmdc:mga0n895_162337_c1 | 3300050512 | Bacteria | 2266 |
| 950 | nmdc:mga0n895_19342_c1 | 3300050512 | Bacteria | 6328 |
| 951 | nmdc:mga0n895_240070_c1 | 3300050512 | Bacteria | 1839 |
| 952 | nmdc:mga0n895_260923_c1 | 3300050512 | Bacteria | 1758 |
| 953 | nmdc:mga0n895_262754_c1 | 3300050512 | Bacteria | 1752 |
| 954 | nmdc:mga0n895_35688_c1 | 3300050512 | Bacteria | 4796 |
| 955 | nmdc:mga0n895_39199_c1 | 3300050512 | Bacteria | 4595 |
| 956 | nmdc:mga0n895_44372_c1 | 3300050512 | Bacteria | 4335 |
| 957 | nmdc:mga0n895_808509_c1 | 3300050512 | Unclassified | 927 |
| 958 | nmdc:mga0n895_933780_c1 | 3300050512 | Unclassified | 852 |
| 959 | nmdc:mga0n895_97559_c1 | 3300050512 | Bacteria | 2945 |
| 960 | nmdc:mga0rr50_113414_c1 | 3300050513 | Bacteria | 2148 |
| 961 | nmdc:mga0rr50_1203614_c1 | 3300050513 | Unclassified | 644 |
| 962 | nmdc:mga0rr50_12062_c1 | 3300050513 | Bacteria | 5565 |
| 963 | nmdc:mga0rr50_1342765_c1 | 3300050513 | Bacteria | 606 |
| 964 | nmdc:mga0rr50_1567263_c1 | 3300050513 | Unclassified | 556 |
| 965 | nmdc:mga0rr50_348123_c1 | 3300050513 | Bacteria | 1246 |
| 966 | nmdc:mga0rr50_45429_c1 | 3300050513 | Bacteria | 3228 |
| 967 | nmdc:mga0rr50_479880_c1 | 3300050513 | Unclassified | 1056 |
| 968 | nmdc:mga0rr50_551665_c1 | 3300050513 | Bacteria | 981 |
| 969 | nmdc:mga0rr50_55166_c1 | 3300050513 | Bacteria | 2964 |
| 970 | nmdc:mga0rr50_624836_c1 | 3300050513 | Unclassified | 919 |
| 971 | nmdc:mga0rr50_65422_c1 | 3300050513 | Unclassified | 2754 |
| 972 | nmdc:mga0rr50_931260_c1 | 3300050513 | Bacteria | 741 |
| 973 | nmdc:mga08x19_122853_c1 | 3300050514 | Bacteria | 1742 |
| 974 | nmdc:mga08x19_2304_c1 | 3300050514 | Bacteria | 11604 |
| 975 | nmdc:mga08x19_282957_c1 | 3300050514 | Unclassified | 1149 |
| 976 | nmdc:mga08x19_462181_c1 | 3300050514 | Bacteria | 894 |
| 977 | nmdc:mga08x19_563692_c1 | 3300050514 | Bacteria | 806 |
| 978 | nmdc:mga08x19_653359_c1 | 3300050514 | Bacteria | 746 |
| 979 | nmdc:mga08x19_7202_c1 | 3300050514 | Bacteria | 6265 |
| 980 | nmdc:mga0a205_115102_c1 | 3300050515 | Bacteria | 2588 |
| 981 | nmdc:mga0a205_1168693_c1 | 3300050515 | Bacteria | 617 |
| 982 | nmdc:mga0a205_134401_c1 | 3300050515 | Bacteria | 2374 |
| 983 | nmdc:mga0a205_1357103_c1 | 3300050515 | Unclassified | 559 |
| 984 | nmdc:mga0a205_1560379_c1 | 3300050515 | Bacteria | 508 |
| 985 | nmdc:mga0a205_190862_c2 | 3300050515 | Unclassified | 1112 |
| 986 | nmdc:mga0a205_2541_c1 | 3300050515 | Bacteria | 16075 |
| 987 | nmdc:mga0a205_25671_c1 | 3300050515 | Bacteria | 5615 |
| 988 | nmdc:mga0a205_453779_c1 | 3300050515 | Bacteria | 1142 |
| 989 | nmdc:mga0a205_5886_c1 | 3300050515 | Bacteria | 11045 |
| 990 | nmdc:mga0a205_619_c1 | 3300050515 | Bacteria | 28239 |
| 991 | nmdc:mga0a205_632852_c1 | 3300050515 | Unclassified | 922 |
| 992 | nmdc:mga0a205_800022_c1 | 3300050515 | Bacteria | 791 |
| 993 | Ga0500555_095205 | 3300053103 | Bacteria | 761 |
| 994 | Ga0501084_0000423 | 3300054114 | Bacteria | 32674 |
| 995 | Ga0501084_0031669 | 3300054114 | Bacteria | 4421 |
| 996 | Ga0501084_0132103 | 3300054114 | Bacteria | 2102 |
| 997 | Ga0501084_0176141 | 3300054114 | Bacteria | 1805 |
| 998 | Ga0501084_0231795 | 3300054114 | Bacteria | 1559 |
| 999 | Ga0501084_0403357 | 3300054114 | Bacteria | 1155 |
| 1000 | Ga0501084_0469119 | 3300054114 | Bacteria | 1064 |
| 1001 | Ga0501084_0653993 | 3300054114 | Bacteria | 887 |
| 1002 | Ga0501084_0962485 | 3300054114 | Unclassified | 718 |
| 1003 | Ga0501084_1443719 | 3300054114 | Bacteria | 576 |
| 1004 | Ga0501084_1606690 | 3300054114 | Unclassified | 543 |
| 1005 | Ga0590071_036073 | 3300059421 | Bacteria | 1185 |
| 1006 | Ga0590074_014850 | 3300059423 | Bacteria | 1319 |
| 1007 | Ga0590075_101977 | 3300059424 | Unclassified | 748 |
| 1008 | Ga0501082_0000318 | 3300060353 | Bacteria | 42881 |
| 1009 | Ga0501082_0064814 | 3300060353 | Bacteria | 3146 |
| 1010 | Ga0501082_0090453 | 3300060353 | Bacteria | 2642 |
| 1011 | Ga0501082_0152016 | 3300060353 | Bacteria | 2011 |
| 1012 | Ga0501082_0238855 | 3300060353 | Bacteria | 1581 |
| 1013 | Ga0501082_0347131 | 3300060353 | Unclassified | 1293 |
| 1014 | Ga0501082_0654545 | 3300060353 | Bacteria | 919 |
| 1015 | Ga0501082_0820289 | 3300060353 | Bacteria | 814 |
| 1016 | Ga0501082_0890111 | 3300060353 | Unclassified | 779 |
| 1017 | Ga0501082_0936805 | 3300060353 | Unclassified | 757 |
| 1018 | Ga0501082_1318613 | 3300060353 | Unclassified | 630 |
| 1019 | Ga0501082_1324508 | 3300060353 | Unclassified | 629 |
| 1020 | Ga0501082_1547064 | 3300060353 | Unclassified | 579 |
| 1021 | Ga0530510_0000344 | 3300061734 | Bacteria | 29971 |
| 1022 | Ga0530510_0005891 | 3300061734 | Bacteria | 8498 |
| 1023 | Ga0530510_0121852 | 3300061734 | Bacteria | 1915 |
| 1024 | Ga0530510_0149282 | 3300061734 | Bacteria | 1725 |
| 1025 | Ga0530510_0291122 | 3300061734 | Bacteria | 1221 |
| 1026 | Ga0530510_0415732 | 3300061734 | Bacteria | 1015 |
| 1027 | Ga0530510_0627277 | 3300061734 | Bacteria | 818 |
| 1028 | Ga0530510_0728111 | 3300061734 | Bacteria | 756 |
| 1029 | Ga0530510_0745952 | 3300061734 | Bacteria | 746 |
| 1030 | Ga0530510_1155188 | 3300061734 | Bacteria | 593 |
| 1031 | Ga0530510_1326045 | 3300061734 | Unclassified | 552 |
| 1032 | Ga0070708_100376866 | |||
| 1033 | MRS1b_contig_727244 | |||
| 1034 | MBSR1b_contig_6780580 | |||
| 1035 | JGI25165J46597_1009672 | |||
| 1036 | JGI25405J52794_10001416 | |||
| 1037 | Ga0058860_11767753 | |||
| 1038 | Ga0065704_10686811 | |||
| 1039 | Ga0065712_10002257 | |||
| 1040 | Ga0065712_10002777 | |||
| 1041 | Ga0065715_10013103 | |||
| 1042 | Ga0065715_10301656 | |||
| 1043 | Ga0065715_10394114 | |||
| 1044 | Ga0065707_10001335 | |||
| 1045 | Ga0065707_10171174 | |||
| 1046 | Ga0065707_10360981 | |||
| 1047 | Ga0065707_10467478 | |||
| 1048 | Ga0065707_10580217 | |||
| 1049 | Ga0065707_10816276 | |||
| 1050 | Ga0070676_10303923 | |||
| 1051 | Ga0070676_10654905 | |||
| 1052 | Ga0070683_100650272 | |||
| 1053 | Ga0070690_100152307 | |||
| 1054 | Ga0070690_100280859 | |||
| 1055 | Ga0070690_100684629 | |||
| 1056 | Ga0070670_100000785 | |||
| 1057 | Ga0070677_10060769 | |||
| 1058 | Ga0068869_100030357 | |||
| 1059 | Ga0068869_100833432 | |||
| 1060 | Ga0068869_101326445 | |||
| 1061 | Ga0070666_10018952 | |||
| 1062 | Ga0070666_10565365 | |||
| 1063 | Ga0070680_100131696 | |||
| 1064 | Ga0070680_100644686 | |||
| 1065 | Ga0070682_100801986 | |||
| 1066 | Ga0068868_100032349 | |||
| 1067 | Ga0070689_100153375 | |||
| 1068 | Ga0070691_10056032 | |||
| 1069 | Ga0070691_10317104 | |||
| 1070 | Ga0070687_100555063 | |||
| 1071 | Ga0070661_100019298 | |||
| 1072 | Ga0070692_10126232 | |||
| 1073 | Ga0070692_11373994 | |||
| 1074 | Ga0070668_100157871 | |||
| 1075 | Ga0070669_100007755 | |||
| 1076 | Ga0070669_100254834 | |||
| 1077 | Ga0070669_100395856 | |||
| 1078 | Ga0070675_100205291 | |||
| 1079 | Ga0070675_100233584 | |||
| 1080 | Ga0070675_100479106 | |||
| 1081 | Ga0070671_100045667 | |||
| 1082 | Ga0070674_101799423 | |||
| 1083 | Ga0070673_100200946 | |||
| 1084 | Ga0070673_100281993 | |||
| 1085 | Ga0070688_100134226 | |||
| 1086 | Ga0070688_100453548 | |||
| 1087 | Ga0070659_100311591 | |||
| 1088 | Ga0070659_101580129 | |||
| 1089 | Ga0070667_100394665 | |||
| 1090 | Ga0070703_10138432 | |||
| 1091 | Ga0070703_10155327 | |||
| 1092 | Ga0070701_10963137 | |||
| 1093 | Ga0070701_11204575 | |||
| 1094 | Ga0070711_100037165 | |||
| 1095 | Ga0070711_100773403 | |||
| 1096 | Ga0070705_100055050 | |||
| 1097 | Ga0070705_100127054 | |||
| 1098 | Ga0070705_100680316 | |||
| 1099 | Ga0070705_100735474 | |||
| 1100 | Ga0070705_101066761 | |||
| 1101 | Ga0070705_101365913 | |||
| 1102 | Ga0070700_100196244 | |||
| 1103 | Ga0070700_100930747 | |||
| 1104 | Ga0070694_100044413 | |||
| 1105 | Ga0070694_100082135 | |||
| 1106 | Ga0070694_100146635 | |||
| 1107 | Ga0070694_100437801 | |||
| 1108 | Ga0070694_100457020 | |||
| 1109 | Ga0070694_100911231 | |||
| 1110 | Ga0070694_100932455 | |||
| 1111 | Ga0070708_100353126 | |||
| 1112 | Ga0070663_100227161 | |||
| 1113 | Ga0070663_100236773 | |||
| 1114 | Ga0070678_100114653 | |||
| 1115 | Ga0070662_100185064 | |||
| 1116 | Ga0070662_100229496 | |||
| 1117 | Ga0070662_100374604 | |||
| 1118 | Ga0070662_100391635 | |||
| 1119 | Ga0070662_100408767 | |||
| 1120 | Ga0070681_10010565 | |||
| 1121 | Ga0070681_10018600 | |||
| 1122 | Ga0070681_10044729 | |||
| 1123 | Ga0068867_100087998 | |||
| 1124 | Ga0068867_100388382 | |||
| 1125 | Ga0070685_10225040 | |||
| 1126 | Ga0070685_11426346 | |||
| 1127 | Ga0070706_100029329 | |||
| 1128 | Ga0070706_100061378 | |||
| 1129 | Ga0070706_100630820 | |||
| 1130 | Ga0070706_101651460 | |||
| 1131 | Ga0070707_100052951 | |||
| 1132 | Ga0070707_100056072 | |||
| 1133 | Ga0070707_100202837 | |||
| 1134 | Ga0070707_100698813 | |||
| 1135 | Ga0070698_100005467 | |||
| 1136 | Ga0070698_100375879 | |||
| 1137 | Ga0070698_100451015 | |||
| 1138 | Ga0070698_101177949 | |||
| 1139 | Ga0070699_100021770 | |||
| 1140 | Ga0070699_100347870 | |||
| 1141 | Ga0070699_100735113 | |||
| 1142 | Ga0070699_101830126 | |||
| 1143 | Ga0070679_100120303 | |||
| 1144 | Ga0070679_100159762 | |||
| 1145 | Ga0070684_100404023 | |||
| 1146 | Ga0070697_100012867 | |||
| 1147 | Ga0070697_100046361 | |||
| 1148 | Ga0070697_100111880 | |||
| 1149 | Ga0070697_100445016 | |||
| 1150 | Ga0070697_100455359 | |||
| 1151 | Ga0070697_100558728 | |||
| 1152 | Ga0070697_100622238 | |||
| 1153 | Ga0068853_100141923 | |||
| 1154 | Ga0070672_100056574 | |||
| 1155 | Ga0070672_100113353 | |||
| 1156 | Ga0070672_100860854 | |||
| 1157 | Ga0070672_101967065 | |||
| 1158 | Ga0070686_100029154 | |||
| 1159 | Ga0070695_100378764 | |||
| 1160 | Ga0070695_101275944 | |||
| 1161 | Ga0070696_100036308 | |||
| 1162 | Ga0070696_100111904 | |||
| 1163 | Ga0070696_100187425 | |||
| 1164 | Ga0070696_100296656 | |||
| 1165 | Ga0070696_101553673 | |||
| 1166 | Ga0070696_101576576 | |||
| 1167 | Ga0070696_102016638 | |||
| 1168 | Ga0070693_100094760 | |||
| 1169 | Ga0070665_100138414 | |||
| 1170 | Ga0070704_100036390 | |||
| 1171 | Ga0070704_100301640 | |||
| 1172 | Ga0070704_100672411 | |||
| 1173 | Ga0070704_100869366 | |||
| 1174 | Ga0070704_100897300 | |||
| 1175 | Ga0070704_101264110 | |||
| 1176 | Ga0070704_101459498 | |||
| 1177 | Ga0068855_100376152 | |||
| 1178 | Ga0070664_100001110 | |||
| 1179 | Ga0068857_100084476 | |||
| 1180 | Ga0068857_100717932 | |||
| 1181 | Ga0068857_101223252 | |||
| 1182 | Ga0068854_100072033 | |||
| 1183 | Ga0068854_100290230 | |||
| 1184 | Ga0068856_100022118 | |||
| 1185 | Ga0070702_100152063 | |||
| 1186 | Ga0070702_101225150 | |||
| 1187 | Ga0068852_100411171 | |||
| 1188 | Ga0068852_100587844 | |||
| 1189 | Ga0068859_100017152 | |||
| 1190 | Ga0068859_100025958 | |||
| 1191 | Ga0068859_100238962 | |||
| 1192 | Ga0068859_100406663 | |||
| 1193 | Ga0068859_102416130 | |||
| 1194 | Ga0068864_100427279 | |||
| 1195 | Ga0068864_100501235 | |||
| 1196 | Ga0068866_10161108 | |||
| 1197 | Ga0068866_10279666 | |||
| 1198 | Ga0068861_100150506 | |||
| 1199 | Ga0068861_100477746 | |||
| 1200 | Ga0068861_100538451 | |||
| 1201 | Ga0068861_100607985 | |||
| 1202 | Ga0068861_100669492 | |||
| 1203 | Ga0068861_101843833 | |||
| 1204 | Ga0068861_101923847 | |||
| 1205 | Ga0068870_10176720 | |||
| 1206 | Ga0068870_10206418 | |||
| 1207 | Ga0068870_10355712 | |||
| 1208 | Ga0068863_100232906 | |||
| 1209 | Ga0068863_101637737 | |||
| 1210 | Ga0068858_101426373 | |||
| 1211 | Ga0068858_101557842 | |||
| 1212 | Ga0068860_100221681 | |||
| 1213 | Ga0068860_101059566 | |||
| 1214 | Ga0068860_101095395 | |||
| 1215 | Ga0068860_101673070 | |||
| 1216 | Ga0068862_100023106 | |||
| 1217 | Ga0068862_100506416 | |||
| 1218 | Ga0068862_100567574 | |||
| 1219 | Ga0068862_102131660 | |||
| 1220 | Ga0081455_10002416 | |||
| 1221 | Ga0081455_10147538 | |||
| 1222 | Ga0081538_10009092 | |||
| 1223 | Ga0081538_10253644 | |||
| 1224 | Ga0075368_10150330 | |||
| 1225 | Ga0075363_100123778 | |||
| 1226 | Ga0075363_100391096 | |||
| 1227 | Ga0075432_10035052 | |||
| 1228 | Ga0075432_10175920 | |||
| 1229 | Ga0070716_100035913 | |||
| 1230 | Ga0070716_100336482 | |||
| 1231 | Ga0070712_100069890 | |||
| 1232 | Ga0070712_101859585 | |||
| 1233 | Ga0075367_10024419 | |||
| 1234 | Ga0075367_10094596 | |||
| 1235 | Ga0075366_10190961 | |||
| 1236 | Ga0097621_100444707 | |||
| 1237 | Ga0097621_100792877 | |||
| 1238 | Ga0097621_100801949 | |||
| 1239 | Ga0075370_10318196 | |||
| 1240 | Ga0068871_100687879 | |||
| 1241 | Ga0075428_100001519 | |||
| 1242 | Ga0075428_100006976 | |||
| 1243 | Ga0075428_100014051 | |||
| 1244 | Ga0075428_100022801 | |||
| 1245 | Ga0075428_100101440 | |||
| 1246 | Ga0075428_100107468 | |||
| 1247 | Ga0075428_100181801 | |||
| 1248 | Ga0075428_100451161 | |||
| 1249 | Ga0075428_100453839 | |||
| 1250 | Ga0075428_101434893 | |||
| 1251 | Ga0075430_100005925 | |||
| 1252 | Ga0075430_100157637 | |||
| 1253 | Ga0075430_100259778 | |||
| 1254 | Ga0075430_100294370 | |||
| 1255 | Ga0075431_100001686 | |||
| 1256 | Ga0075431_100016515 | |||
| 1257 | Ga0075431_100044729 | |||
| 1258 | Ga0075431_100096527 | |||
| 1259 | Ga0075431_100107887 | |||
| 1260 | Ga0075431_100335174 | |||
| 1261 | Ga0075431_100375883 | |||
| 1262 | Ga0075431_100504541 | |||
| 1263 | Ga0075431_100676384 | |||
| 1264 | Ga0075431_101072018 | |||
| 1265 | Ga0075431_101072501 | |||
| 1266 | Ga0075431_101757340 | |||
| 1267 | Ga0075433_10000446 | |||
| 1268 | Ga0075433_10007564 | |||
| 1269 | Ga0075433_10023127 | |||
| 1270 | Ga0075433_10036578 | |||
| 1271 | Ga0075433_10083007 | |||
| 1272 | Ga0075433_10099686 | |||
| 1273 | Ga0075433_10421278 | |||
| 1274 | Ga0075433_10476322 | |||
| 1275 | Ga0075433_10897157 | |||
| 1276 | Ga0075433_11024829 | |||
| 1277 | Ga0075433_11026516 | |||
| 1278 | Ga0075433_11250910 | |||
| 1279 | Ga0075433_11612052 | |||
| 1280 | Ga0075433_11721521 | |||
| 1281 | Ga0075434_100001490 | |||
| 1282 | Ga0075434_100012190 | |||
| 1283 | Ga0075434_100016451 | |||
| 1284 | Ga0075434_100029643 | |||
| 1285 | Ga0075434_100043984 | |||
| 1286 | Ga0075434_100059577 | |||
| 1287 | Ga0075434_100064015 | |||
| 1288 | Ga0075434_100090000 | |||
| 1289 | Ga0075434_100107500 | |||
| 1290 | Ga0075434_100121773 | |||
| 1291 | Ga0075434_100327168 | |||
| 1292 | Ga0075434_100427500 | |||
| 1293 | Ga0075434_101406567 | |||
| 1294 | Ga0075429_100002919 | |||
| 1295 | Ga0075429_100038449 | |||
| 1296 | Ga0075429_100042378 | |||
| 1297 | Ga0075429_100128482 | |||
| 1298 | Ga0075429_100192990 | |||
| 1299 | Ga0075429_100705130 | |||
| 1300 | Ga0075429_100723437 | |||
| 1301 | Ga0068865_100409513 | |||
| 1302 | Ga0068865_100455993 | |||
| 1303 | Ga0068865_100547597 | |||
| 1304 | Ga0068865_101389722 | |||
| 1305 | Ga0075436_100010183 | |||
| 1306 | Ga0075436_100023881 | |||
| 1307 | Ga0075436_100033659 | |||
| 1308 | Ga0075436_100147557 | |||
| 1309 | Ga0075436_100210906 | |||
| 1310 | Ga0075436_100407122 | |||
| 1311 | Ga0075436_100443399 | |||
| 1312 | Ga0075436_101157539 | |||
| 1313 | Ga0097620_100017152 | |||
| 1314 | Ga0097620_100025962 | |||
| 1315 | Ga0097620_100238957 | |||
| 1316 | Ga0097620_100406675 | |||
| 1317 | Ga0097620_102415366 | |||
| 1318 | Ga0075435_100007980 | |||
| 1319 | Ga0075435_100010661 | |||
| 1320 | Ga0075435_100026170 | |||
| 1321 | Ga0075435_100064885 | |||
| 1322 | Ga0075435_100091585 | |||
| 1323 | Ga0075435_100146874 | |||
| 1324 | Ga0075435_100178615 | |||
| 1325 | Ga0075435_100288924 | |||
| 1326 | Ga0075435_100304205 | |||
| 1327 | Ga0075435_100373828 | |||
| 1328 | Ga0075435_100510882 | |||
| 1329 | Ga0075435_100865300 | |||
| 1330 | Ga0105240_10001318 | |||
| 1331 | Ga0105240_10278411 | |||
| 1332 | Ga0111539_10002805 | |||
| 1333 | Ga0111539_10002994 | |||
| 1334 | Ga0111539_10005783 | |||
| 1335 | Ga0111539_10063090 | |||
| 1336 | Ga0111539_10213579 | |||
| 1337 | Ga0111539_10428338 | |||
| 1338 | Ga0111539_11093878 | |||
| 1339 | Ga0111539_11130576 | |||
| 1340 | Ga0111539_12142249 | |||
| 1341 | Ga0105245_10111429 | |||
| 1342 | Ga0105245_10245499 | |||
| 1343 | Ga0114129_10013590 | |||
| 1344 | Ga0114129_10014069 | |||
| 1345 | Ga0114129_10050832 | |||
| 1346 | Ga0114129_10065608 | |||
| 1347 | Ga0114129_10079937 | |||
| 1348 | Ga0114129_10081486 | |||
| 1349 | Ga0114129_10171754 | |||
| 1350 | Ga0114129_10188138 | |||
| 1351 | Ga0114129_10189782 | |||
| 1352 | Ga0114129_10200942 | |||
| 1353 | Ga0114129_10209251 | |||
| 1354 | Ga0114129_10214541 | |||
| 1355 | Ga0114129_10235446 | |||
| 1356 | Ga0114129_10305090 | |||
| 1357 | Ga0114129_10369593 | |||
| 1358 | Ga0114129_10527597 | |||
| 1359 | Ga0114129_10840077 | |||
| 1360 | Ga0114129_11301444 | |||
| 1361 | Ga0114129_11510307 | |||
| 1362 | Ga0114129_13274665 | |||
| 1363 | Ga0105243_10058820 | |||
| 1364 | Ga0105243_10751932 | |||
| 1365 | Ga0105241_10005902 | |||
| 1366 | Ga0105242_10046389 | |||
| 1367 | Ga0105242_10229054 | |||
| 1368 | Ga0105248_11706543 | |||
| 1369 | Ga0105237_10018912 | |||
| 1370 | Ga0105237_10088023 | |||
| 1371 | Ga0105238_10085564 | |||
| 1372 | Ga0105238_13082406 | |||
| 1373 | Ga0105249_10109252 | |||
| 1374 | Ga0105249_10344442 | |||
| 1375 | Ga0105030_104565 | |||
| 1376 | Ga0105239_10059595 | |||
| 1377 | Ga0105239_11309653 | |||
| 1378 | Ga0157326_1035605 | |||
| 1379 | Ga0157338_1058064 | |||
| 1380 | Ga0157373_10050366 | |||
| 1381 | Ga0157371_10079616 | |||
| 1382 | Ga0157374_10330142 | |||
| 1383 | Ga0157378_10163906 | |||
| 1384 | Ga0157378_10172107 | |||
| 1385 | Ga0157378_10495747 | |||
| 1386 | Ga0157378_10608446 | |||
| 1387 | Ga0163162_10130481 | |||
| 1388 | Ga0163162_10139211 | |||
| 1389 | Ga0163162_12253508 | |||
| 1390 | Ga0157372_10014000 | |||
| 1391 | Ga0157375_10224655 | |||
| 1392 | Ga0157375_10620401 | |||
| 1393 | Ga0157514_127414 | |||
| 1394 | Ga0163163_10044528 | |||
| 1395 | Ga0157380_10000345 | |||
| 1396 | Ga0157380_10003796 | |||
| 1397 | Ga0157380_10025863 | |||
| 1398 | Ga0157380_10653989 | |||
| 1399 | Ga0157380_11770708 | |||
| 1400 | Ga0157380_12043916 | |||
| 1401 | Ga0157377_10203328 | |||
| 1402 | Ga0157377_10387470 | |||
| 1403 | Ga0157376_10054527 | |||
| 1404 | Ga0157376_11720352 | |||
| 1405 | Ga0209233_1002219 | |||
| 1406 | Ga0207697_10005530 | |||
| 1407 | Ga0207697_10022887 | |||
| 1408 | Ga0207682_10038346 | |||
| 1409 | Ga0207642_10072835 | |||
| 1410 | Ga0207688_10022626 | |||
| 1411 | Ga0207688_10412437 | |||
| 1412 | Ga0207647_10164766 | |||
| 1413 | Ga0207699_10424842 | |||
| 1414 | Ga0207645_10000592 | |||
| 1415 | Ga0207705_10039681 | |||
| 1416 | Ga0207684_10002342 | |||
| 1417 | Ga0207654_10059075 | |||
| 1418 | Ga0207707_10001455 | |||
| 1419 | Ga0207707_10020996 | |||
| 1420 | Ga0207707_10343534 | |||
| 1421 | Ga0207695_10000007 | |||
| 1422 | Ga0207695_10485823 | |||
| 1423 | Ga0207671_10227162 | |||
| 1424 | Ga0207663_10065334 | |||
| 1425 | Ga0207660_10070695 | |||
| 1426 | Ga0207660_10439742 | |||
| 1427 | Ga0207662_10129666 | |||
| 1428 | Ga0207662_10367989 | |||
| 1429 | Ga0207662_10944642 | |||
| 1430 | Ga0207657_10014472 | |||
| 1431 | Ga0207649_10439842 | |||
| 1432 | Ga0207652_10095034 | |||
| 1433 | Ga0207652_10316377 | |||
| 1434 | Ga0207646_10003474 | |||
| 1435 | Ga0207646_10053880 | |||
| 1436 | Ga0207646_10307460 | |||
| 1437 | Ga0207646_10956919 | |||
| 1438 | Ga0207646_11061964 | |||
| 1439 | Ga0207681_10075779 | |||
| 1440 | Ga0207681_10089024 | |||
| 1441 | Ga0207681_10216031 | |||
| 1442 | Ga0207681_10415994 | |||
| 1443 | Ga0207694_10126861 | |||
| 1444 | Ga0207650_10001050 | |||
| 1445 | Ga0207650_10723147 | |||
| 1446 | Ga0207659_10041943 | |||
| 1447 | Ga0207659_10258788 | |||
| 1448 | Ga0207644_10030054 | |||
| 1449 | Ga0207690_10258916 | |||
| 1450 | Ga0207706_10010887 | |||
| 1451 | Ga0207706_10118756 | |||
| 1452 | Ga0207706_10301011 | |||
| 1453 | Ga0207706_10454818 | |||
| 1454 | Ga0207706_10640204 | |||
| 1455 | Ga0207706_11005218 | |||
| 1456 | Ga0207686_10321223 | |||
| 1457 | Ga0207709_10569083 | |||
| 1458 | Ga0207670_10007615 | |||
| 1459 | Ga0207670_10323522 | |||
| 1460 | Ga0207669_10033542 | |||
| 1461 | Ga0207669_10381811 | |||
| 1462 | Ga0207704_10304662 | |||
| 1463 | Ga0207704_10326854 | |||
| 1464 | Ga0207704_11247182 | |||
| 1465 | Ga0207665_10054208 | |||
| 1466 | Ga0207665_10291896 | |||
| 1467 | Ga0207691_10006363 | |||
| 1468 | Ga0207691_10852787 | |||
| 1469 | Ga0207689_10049335 | |||
| 1470 | Ga0207689_10408037 | |||
| 1471 | Ga0207679_10003644 | |||
| 1472 | Ga0207667_10872609 | |||
| 1473 | Ga0207667_11244943 | |||
| 1474 | Ga0207651_10212481 | |||
| 1475 | Ga0207651_10227286 | |||
| 1476 | Ga0207712_10372144 | |||
| 1477 | Ga0207712_10813997 | |||
| 1478 | Ga0207640_10309018 | |||
| 1479 | Ga0207640_10815475 | |||
| 1480 | Ga0207658_12133922 | |||
| 1481 | Ga0207703_10527512 | |||
| 1482 | Ga0207639_10574626 | |||
| 1483 | Ga0207678_10023583 | |||
| 1484 | Ga0207678_10254315 | |||
| 1485 | Ga0207708_10032000 | |||
| 1486 | Ga0207708_10415143 | |||
| 1487 | Ga0207708_11871844 | |||
| 1488 | Ga0207702_10089539 | |||
| 1489 | Ga0207641_10783696 | |||
| 1490 | Ga0207641_11569761 | |||
| 1491 | Ga0207648_10187358 | |||
| 1492 | Ga0207648_11166525 | |||
| 1493 | Ga0207676_10199027 | |||
| 1494 | Ga0207676_10464716 | |||
| 1495 | Ga0207674_10086162 | |||
| 1496 | Ga0207674_10115924 | |||
| 1497 | Ga0207674_10216610 | |||
| 1498 | Ga0207674_10808022 | |||
| 1499 | Ga0207674_11215618 | |||
| 1500 | Ga0207675_100175600 | |||
| 1501 | Ga0207675_100242401 | |||
| 1502 | Ga0207675_100538179 | |||
| 1503 | Ga0207675_100629389 | |||
| 1504 | Ga0207675_100672756 | |||
| 1505 | Ga0207675_100884715 | |||
| 1506 | Ga0207683_10019216 | |||
| 1507 | Ga0207698_10814766 | |||
| 1508 | Ga0209973_1046802 | |||
| 1509 | Ga0209967_1065444 | |||
| 1510 | Ga0209981_1052994 | |||
| 1511 | Ga0209984_1002716 | |||
| 1512 | Ga0210000_1065529 | |||
| 1513 | Ga0209982_1042920 | |||
| 1514 | Ga0209970_1003676 | |||
| 1515 | Ga0209970_1061889 | |||
| 1516 | Ga0209970_1068062 | |||
| 1517 | Ga0210002_1036544 | |||
| 1518 | Ga0209983_1007745 | |||
| 1519 | Ga0209971_1003655 | |||
| 1520 | Ga0209966_1046331 | |||
| 1521 | Ga0209998_10144612 | |||
| 1522 | Ga0209998_10197636 | |||
| 1523 | Ga0209974_10000812 | |||
| 1524 | Ga0209974_10005290 | |||
| 1525 | Ga0207428_10029894 | |||
| 1526 | Ga0207428_10098398 | |||
| 1527 | Ga0207428_10133763 | |||
| 1528 | Ga0207428_10288858 | |||
| 1529 | Ga0207428_10300797 | |||
| 1530 | Ga0268266_11211368 | |||
| 1531 | Ga0268265_10092376 | |||
| 1532 | Ga0268265_10282736 | |||
| 1533 | Ga0268265_10337835 | |||
| 1534 | Ga0268265_11402766 | |||
| 1535 | Ga0268265_11795737 | |||
| 1536 | Ga0268264_11066622 | |||
| 1537 | Ga0307515_10000005 | |||
| 1538 | Ga0265760_10144607 | |||
| 1539 | Ga0307408_100055613 | |||
| 1540 | Ga0307408_100057239 | |||
| 1541 | Ga0307408_100061859 | |||
| 1542 | Ga0307408_100216838 | |||
| 1543 | Ga0316575_10187384 | |||
| 1544 | Ga0316575_10480600 | |||
| 1545 | Ga0316576_10131305 | |||
| 1546 | Ga0316578_10176869 | |||
| 1547 | Ga0307405_10001828 | |||
| 1548 | Ga0307405_10173807 | |||
| 1549 | Ga0307405_10428643 | |||
| 1550 | Ga0316577_10001492 | |||
| 1551 | Ga0316577_10113086 | |||
| 1552 | Ga0316577_10609810 | |||
| 1553 | Ga0307413_10050614 | |||
| 1554 | Ga0307413_10106361 | |||
| 1555 | Ga0307413_11114037 | |||
| 1556 | Ga0307413_11639450 | |||
| 1557 | Ga0307413_11688129 | |||
| 1558 | Ga0307410_10018291 | |||
| 1559 | Ga0307410_10071739 | |||
| 1560 | Ga0307410_10121841 | |||
| 1561 | Ga0307410_10153004 | |||
| 1562 | Ga0307410_10280269 | |||
| 1563 | Ga0307410_10789378 | |||
| 1564 | Ga0307406_10013857 | |||
| 1565 | Ga0307406_10067687 | |||
| 1566 | Ga0307406_10075308 | |||
| 1567 | Ga0307406_10087995 | |||
| 1568 | Ga0307406_10115151 | |||
| 1569 | Ga0307407_10033925 | |||
| 1570 | Ga0307407_10224053 | |||
| 1571 | Ga0307407_10431336 | |||
| 1572 | Ga0307412_10012347 | |||
| 1573 | Ga0307412_10032667 | |||
| 1574 | Ga0307412_10455038 | |||
| 1575 | Ga0307409_100197333 | |||
| 1576 | Ga0307409_100318563 | |||
| 1577 | Ga0307409_100843253 | |||
| 1578 | Ga0307416_100000870 | |||
| 1579 | Ga0307416_100002835 | |||
| 1580 | Ga0307416_100022394 | |||
| 1581 | Ga0307416_100522170 | |||
| 1582 | Ga0307414_10015663 | |||
| 1583 | Ga0307414_10141205 | |||
| 1584 | Ga0307414_10219390 | |||
| 1585 | Ga0307414_12071670 | |||
| 1586 | Ga0307411_10012783 | |||
| 1587 | Ga0307411_10035882 | |||
| 1588 | Ga0307411_10038805 | |||
| 1589 | Ga0307411_10124439 | |||
| 1590 | Ga0307411_10732481 | |||
| 1591 | Ga0307411_11038631 | |||
| 1592 | Ga0307415_100008578 | |||
| 1593 | Ga0307415_100176437 | |||
| 1594 | Ga0307415_100528368 | |||
| 1595 | Ga0316585_10007701 | |||
| 1596 | Ga0316585_10197044 | |||
| 1597 | Ga0373926_0273974 | |||
| 1598 | Ga0373928_0023454 | |||
| 1599 | Ga0373940_0113852 | |||
| 1600 | Ga0373952_0151592 | |||
| 1601 | Ga0373932_0033741 | |||
| 1602 | Ga0373932_0200699 | |||
| 1603 | Ga0373932_0359884 | |||
| 1604 | Ga0373939_0199681 | |||
| 1605 | Ga0373939_0383867 | |||
| 1606 | Ga0373941_0257082 | |||
| 1607 | Ga0373943_0636497 | |||
| 1608 | Ga0373946_0597124 | |||
| 1609 | Ga0373955_0294038 | |||
| 1610 | Ga0373942_0016919 | |||
| 1611 | Ga0373942_0156579 | |||
| 1612 | Ga0373961_0226044 | |||
| 1613 | Ga0316574_0019000 | |||
| 1614 | Ga0316574_0074165 | |||
| 1615 | Ga0316574_0203524 | |||
| 1616 | Ga0316574_0219846 | |||
| 1617 | Ga0316574_0405148 | |||
| 1618 | Ga0373931_0231038 | |||
| 1619 | Ga0373931_0400519 | |||
| 1620 | Ga0373931_0554362 | |||
| 1621 | Ga0373935_0473823 | |||
| 1622 | Ga0373947_0828518 | |||
| 1623 | Ga0373937_0141992 | |||
| 1624 | Ga0316582_0204597 | |||
| 1625 | Ga0316582_0336742 | |||
| 1626 | Ga0316584_0006481 | |||
| 1627 | Ga0316584_0092710 | |||
| 1628 | Ga0373925_0673532 | |||
| 1629 | Ga0439453_0070827 | |||
| 1630 | Ga0439465_0169200 | |||
| 1631 | Ga0439431_0266577 | |||
| 1632 | Ga0439433_0056228 | |||
| 1633 | Ga0439441_015525 | |||
| 1634 | Ga0439442_141863 | |||
| 1635 | Ga0439445_0230797 | |||
| 1636 | Ga0439432_085125 | |||
| 1637 | Ga0439450_144857 | |||
| 1638 | Ga0439454_025209 | |||
| 1639 | Ga0439455_0178146 | |||
| 1640 | Ga0439456_063877 | |||
| 1641 | Ga0450911_019573 | |||
| 1642 | Ga0450919_035315 | |||
| 1643 | Ga0450920_010976 | |||
| 1644 | Ga0450923_001196 | |||
| 1645 | Ga0450894_022089 | |||
| 1646 | Ga0450895_000249 | |||
| 1647 | Ga0450895_002562 | |||
| 1648 | Ga0450896_000566 | |||
| 1649 | Ga0450896_001535 | |||
| 1650 | Ga0450899_027048 | |||
| 1651 | Ga0450900_045104 | |||
| 1652 | Ga0450889_028602 | |||
| 1653 | Ga0450907_021726 | |||
| 1654 | Ga0450907_081545 | |||
| 1655 | Ga0439446_0001736 | |||
| 1656 | Ga0439446_0032718 | |||
| 1657 | Ga0439446_0269567 | |||
| 1658 | Ga0450908_000339 | |||
| 1659 | Ga0450908_011944 | |||
| 1660 | Ga0439434_0006745 | |||
| 1661 | Ga0439434_0016223 | |||
| 1662 | Ga0439434_0054403 | |||
| 1663 | Ga0439435_0001211 | |||
| 1664 | Ga0439435_0098045 | |||
| 1665 | Ga0439444_0039794 | |||
| 1666 | Ga0439444_0154120 | |||
| 1667 | Ga0439459_0188939 | |||
| 1668 | Ga0439460_0006044 | |||
| 1669 | Ga0450918_002807 | |||
| 1670 | Ga0450918_012882 | |||
| 1671 | Ga0451577_0143791 | |||
| 1672 | Ga0451577_0335820 | |||
| 1673 | Ga0451577_0466377 | |||
| 1674 | Ga0451577_0553250 | |||
| 1675 | Ga0451577_1219785 | |||
| 1676 | Ga0453683_0000838 | |||
| 1677 | Ga0453684_1436321 | |||
| 1678 | Ga0453684_2077082 | |||
| 1679 | Ga0453684_2508921 | |||
| 1680 | Ga0451576_0400502 | |||
| 1681 | Ga0451576_0889366 | |||
| 1682 | Ga0451576_1162381 | |||
| 1683 | Ga0451576_1806973 | |||
| 1684 | Ga0451576_2460874 | |||
| 1685 | Ga0495591_130220 | |||
| 1686 | Ga0495651_0918897 | |||
| 1687 | Ga0495580_0001653 | |||
| 1688 | Ga0495666_0258679 | |||
| 1689 | Ga0495586_0276890 | |||
| 1690 | Ga0495598_0047318 | |||
| 1691 | Ga0495621_0366297 | |||
| 1692 | Ga0495633_0550804 | |||
| 1693 | Ga0495647_0506333 | |||
| 1694 | Ga0495658_0219582 | |||
| 1695 | Ga0495658_0746864 | |||
| 1696 | Ga0495669_0238927 | |||
| 1697 | Ga0495669_0628287 | |||
| 1698 | Ga0495670_0808672 | |||
| 1699 | Ga0495674_0609793 | |||
| 1700 | Ga0495614_0575806 | |||
| 1701 | Ga0496102_0515298 | |||
| 1702 | Ga0496102_1544840 | |||
| 1703 | Ga0496104_0419058 | |||
| 1704 | Ga0496105_0491188 | |||
| 1705 | Ga0496106_0255995 | |||
| 1706 | Ga0496108_0442295 | |||
| 1707 | Ga0496109_1267791 | |||
| 1708 | Ga0496109_1755201 | |||
| 1709 | Ga0496110_0312477 | |||
| 1710 | Ga0496112_0158808 | |||
| 1711 | Ga0496112_0231942 | |||
| 1712 | Ga0496113_0037131 | |||
| 1713 | Ga0496113_0282630 | |||
| 1714 | Ga0496113_0405855 | |||
| 1715 | Ga0496117_0079841 | |||
| 1716 | Ga0496118_0018596 | |||
| 1717 | Ga0501294_032497 | |||
| 1718 | Ga0501295_124214 | |||
| 1719 | Ga0501031_0029456 | |||
| 1720 | Ga0501031_0033561 | |||
| 1721 | Ga0501031_1002243 | |||
| 1722 | Ga0501032_0018093 | |||
| 1723 | Ga0501032_0021090 | |||
| 1724 | Ga0501032_0475352 | |||
| 1725 | Ga0501032_0480162 | |||
| 1726 | Ga0501032_0604241 | |||
| 1727 | Ga0501033_0153984 | |||
| 1728 | Ga0501033_0225704 | |||
| 1729 | Ga0501033_0528138 | |||
| 1730 | Ga0501034_0526527 | |||
| 1731 | Ga0501034_1522222 | |||
| 1732 | Ga0501036_0003802 | |||
| 1733 | Ga0501036_0049293 | |||
| 1734 | Ga0501036_0070999 | |||
| 1735 | Ga0501036_0574655 | |||
| 1736 | Ga0501036_0616944 | |||
| 1737 | Ga0501036_0716741 | |||
| 1738 | Ga0501036_1314484 | |||
| 1739 | Ga0501037_0011638 | |||
| 1740 | Ga0501037_0087438 | |||
| 1741 | Ga0501037_0162525 | |||
| 1742 | Ga0501037_0191565 | |||
| 1743 | Ga0501037_0943757 | |||
| 1744 | Ga0501038_0024543 | |||
| 1745 | Ga0501038_0099268 | |||
| 1746 | Ga0501038_0191655 | |||
| 1747 | Ga0501038_0627815 | |||
| 1748 | Ga0501039_0001587 | |||
| 1749 | Ga0501039_0046639 | |||
| 1750 | Ga0501039_0284594 | |||
| 1751 | Ga0501039_1395971 | |||
| 1752 | Ga0501039_1601285 | |||
| 1753 | Ga0501040_0001849 | |||
| 1754 | Ga0501040_0006605 | |||
| 1755 | Ga0501040_0007050 | |||
| 1756 | Ga0501040_0201596 | |||
| 1757 | Ga0501040_0255459 | |||
| 1758 | Ga0501040_0274463 | |||
| 1759 | Ga0501040_0490460 | |||
| 1760 | Ga0501040_0575427 | |||
| 1761 | Ga0501040_1389354 | |||
| 1762 | Ga0501040_1423190 | |||
| 1763 | Ga0501041_0000126 | |||
| 1764 | Ga0501041_0001670 | |||
| 1765 | Ga0501041_0017973 | |||
| 1766 | Ga0501041_0040945 | |||
| 1767 | Ga0501041_0139253 | |||
| 1768 | Ga0501041_0311314 | |||
| 1769 | Ga0501041_0639683 | |||
| 1770 | Ga0501041_0674159 | |||
| 1771 | Ga0501041_1062212 | |||
| 1772 | Ga0501042_0001273 | |||
| 1773 | Ga0501042_0019064 | |||
| 1774 | Ga0501042_0194033 | |||
| 1775 | Ga0501042_0465461 | |||
| 1776 | Ga0501042_0835866 | |||
| 1777 | Ga0501042_1252792 | |||
| 1778 | Ga0501043_0057159 | |||
| 1779 | Ga0501043_0129544 | |||
| 1780 | Ga0501043_0374372 | |||
| 1781 | Ga0501043_0428343 | |||
| 1782 | Ga0501043_0975736 | |||
| 1783 | Ga0501046_0007595 | |||
| 1784 | Ga0501046_0020390 | |||
| 1785 | Ga0501046_0165187 | |||
| 1786 | Ga0501046_0185543 | |||
| 1787 | Ga0501046_0321118 | |||
| 1788 | Ga0501046_0491318 | |||
| 1789 | Ga0501046_0501039 | |||
| 1790 | Ga0501046_0569622 | |||
| 1791 | Ga0501046_0694509 | |||
| 1792 | Ga0501048_0003443 | |||
| 1793 | Ga0501048_0005073 | |||
| 1794 | Ga0501048_0196471 | |||
| 1795 | Ga0501048_0498899 | |||
| 1796 | Ga0501048_0733131 | |||
| 1797 | Ga0501048_0995298 | |||
| 1798 | Ga0501067_0048810 | |||
| 1799 | Ga0501067_0226838 | |||
| 1800 | Ga0501067_0313762 | |||
| 1801 | Ga0501068_0032984 | |||
| 1802 | Ga0501068_0036095 | |||
| 1803 | Ga0501068_0257606 | |||
| 1804 | Ga0501068_0422328 | |||
| 1805 | Ga0501068_0721357 | |||
| 1806 | Ga0501068_1102038 | |||
| 1807 | Ga0501069_0097436 | |||
| 1808 | Ga0501069_0242128 | |||
| 1809 | Ga0501070_0045021 | |||
| 1810 | Ga0501070_0403331 | |||
| 1811 | Ga0501071_0000363 | |||
| 1812 | Ga0501071_0000968 | |||
| 1813 | Ga0501071_0079153 | |||
| 1814 | Ga0501071_0094637 | |||
| 1815 | Ga0501071_0104036 | |||
| 1816 | Ga0501071_0132272 | |||
| 1817 | Ga0501071_0135447 | |||
| 1818 | Ga0501071_0262608 | |||
| 1819 | Ga0501071_0264791 | |||
| 1820 | Ga0501071_0623921 | |||
| 1821 | Ga0501071_0793355 | |||
| 1822 | Ga0501072_0000264 | |||
| 1823 | Ga0501072_0007973 | |||
| 1824 | Ga0501072_0009199 | |||
| 1825 | Ga0501072_0328060 | |||
| 1826 | Ga0501072_0566591 | |||
| 1827 | Ga0501072_0761326 | |||
| 1828 | Ga0501072_0761398 | |||
| 1829 | Ga0501072_0867143 | |||
| 1830 | Ga0501072_0891641 | |||
| 1831 | Ga0501072_0983822 | |||
| 1832 | Ga0501072_1098646 | |||
| 1833 | Ga0501073_0016547 | |||
| 1834 | Ga0501073_0023845 | |||
| 1835 | Ga0501073_0027511 | |||
| 1836 | Ga0501073_0045503 | |||
| 1837 | Ga0501073_0158603 | |||
| 1838 | Ga0501074_0007641 | |||
| 1839 | Ga0501074_0020471 | |||
| 1840 | Ga0501074_0223323 | |||
| 1841 | Ga0501074_0247359 | |||
| 1842 | Ga0501075_0001885 | |||
| 1843 | Ga0501075_0003063 | |||
| 1844 | Ga0501075_0006023 | |||
| 1845 | Ga0501075_0029253 | |||
| 1846 | Ga0501075_0107800 | |||
| 1847 | Ga0501075_0186776 | |||
| 1848 | Ga0501075_0202725 | |||
| 1849 | Ga0501075_0212130 | |||
| 1850 | Ga0501075_0316164 | |||
| 1851 | Ga0501075_0360006 | |||
| 1852 | Ga0501075_0445226 | |||
| 1853 | Ga0501076_0000207 | |||
| 1854 | Ga0501076_0005590 | |||
| 1855 | Ga0501076_0016790 | |||
| 1856 | Ga0501076_0082556 | |||
| 1857 | Ga0501076_0236436 | |||
| 1858 | Ga0501076_0240290 | |||
| 1859 | Ga0501076_0254733 | |||
| 1860 | Ga0501076_0264563 | |||
| 1861 | Ga0501076_0265992 | |||
| 1862 | Ga0501076_0496162 | |||
| 1863 | Ga0501077_0000314 | |||
| 1864 | Ga0501077_0021486 | |||
| 1865 | Ga0501077_0419256 | |||
| 1866 | Ga0501077_0472377 | |||
| 1867 | Ga0501077_0792909 | |||
| 1868 | Ga0501209_088652 | |||
| 1869 | Ga0501216_055050 | |||
| 1870 | Ga0501217_069065 | |||
| 1871 | Ga0501233_073530 | |||
| 1872 | Ga0501233_138458 | |||
| 1873 | Ga0501249_013124 | |||
| 1874 | Ga0501261_039152 | |||
| 1875 | Ga0501079_0001235 | |||
| 1876 | Ga0501079_0026809 | |||
| 1877 | Ga0501079_0044171 | |||
| 1878 | Ga0501079_0058803 | |||
| 1879 | Ga0501079_0120529 | |||
| 1880 | Ga0501079_0124336 | |||
| 1881 | Ga0501079_0154684 | |||
| 1882 | Ga0501079_0435595 | |||
| 1883 | Ga0501079_0928699 | |||
| 1884 | Ga0501080_0002643 | |||
| 1885 | Ga0501080_0032378 | |||
| 1886 | Ga0501080_0181094 | |||
| 1887 | Ga0501080_0187602 | |||
| 1888 | Ga0501080_0196114 | |||
| 1889 | Ga0501080_0535560 | |||
| 1890 | Ga0501080_0915466 | |||
| 1891 | Ga0501080_1481701 | |||
| 1892 | Ga0501080_1815333 | |||
| 1893 | Ga0501081_0000221 | |||
| 1894 | Ga0501081_0010798 | |||
| 1895 | Ga0501081_0013142 | |||
| 1896 | Ga0501081_0022079 | |||
| 1897 | Ga0501081_0030347 | |||
| 1898 | Ga0501081_0038958 | |||
| 1899 | Ga0501081_0049080 | |||
| 1900 | Ga0501081_0153958 | |||
| 1901 | Ga0501081_0360712 | |||
| 1902 | Ga0501081_0532152 | |||
| 1903 | Ga0501081_0786200 | |||
| 1904 | Ga0501081_0876941 | |||
| 1905 | Ga0501081_1160178 | |||
| 1906 | Ga0501081_1523126 | |||
| 1907 | Ga0501081_1558536 | |||
| 1908 | Ga0501083_0109973 | |||
| 1909 | Ga0501083_0164251 | |||
| 1910 | Ga0501083_0410369 | |||
| 1911 | Ga0501083_0839294 | |||
| 1912 | Ga0501083_0990812 | |||
| 1913 | Ga0501270_002032 | |||
| 1914 | Ga0501035_0006599 | |||
| 1915 | Ga0501035_0029674 | |||
| 1916 | Ga0501035_0113433 | |||
| 1917 | Ga0501035_0283773 | |||
| 1918 | Ga0501035_0556673 | |||
| 1919 | Ga0501035_1510824 | |||
| 1920 | Ga0501044_0154134 | |||
| 1921 | Ga0501045_0006059 | |||
| 1922 | Ga0501045_0071855 | |||
| 1923 | Ga0501045_0108389 | |||
| 1924 | Ga0501045_1071445 | |||
| 1925 | Ga0501204_041404 | |||
| 1926 | Ga0501204_053276 | |||
| 1927 | nmdc:mga03n38_167716_c1 | |||
| 1928 | nmdc:mga0k408_347570_c1 | |||
| 1929 | nmdc:mga0k408_362634_c1 | |||
| 1930 | nmdc:mga0k408_771762_c1 | |||
| 1931 | nmdc:mga06z11_40382_c1 | |||
| 1932 | nmdc:mga06z11_800670_c1 | |||
| 1933 | nmdc:mga05p37_100452_c1 | |||
| 1934 | nmdc:mga05p37_128118_c1 | |||
| 1935 | nmdc:mga05p37_136802_c1 | |||
| 1936 | nmdc:mga05p37_13856_c1 | |||
| 1937 | nmdc:mga05p37_1404637_c1 | |||
| 1938 | nmdc:mga05p37_1634005_c1 | |||
| 1939 | nmdc:mga05p37_1640144_c1 | |||
| 1940 | nmdc:mga05p37_209730_c1 | |||
| 1941 | nmdc:mga05p37_398851_c1 | |||
| 1942 | nmdc:mga05p37_45626_c1 | |||
| 1943 | nmdc:mga05p37_481911_c1 | |||
| 1944 | nmdc:mga05p37_60337_c1 | |||
| 1945 | nmdc:mga05p37_680247_c1 | |||
| 1946 | nmdc:mga05p37_70161_c1 | |||
| 1947 | nmdc:mga05p37_91026_c1 | |||
| 1948 | nmdc:mga05p37_95797_c1 | |||
| 1949 | nmdc:mga05p37_97082_c1 | |||
| 1950 | nmdc:mga09592_11064_c1 | |||
| 1951 | nmdc:mga09592_1377121_c1 | |||
| 1952 | nmdc:mga09592_1660461_c1 | |||
| 1953 | nmdc:mga09592_70001_c1 | |||
| 1954 | nmdc:mga09592_763734_c1 | |||
| 1955 | nmdc:mga0qj67_13514_c1 | |||
| 1956 | nmdc:mga0qj67_279683_c1 | |||
| 1957 | nmdc:mga0qj67_45181_c1 | |||
| 1958 | nmdc:mga0qj67_903026_c1 | |||
| 1959 | nmdc:mga06r32_104565_c1 | |||
| 1960 | nmdc:mga06r32_1652755_c1 | |||
| 1961 | nmdc:mga06r32_1799353_c1 | |||
| 1962 | nmdc:mga06r32_239318_c1 | |||
| 1963 | nmdc:mga06r32_388396_c1 | |||
| 1964 | nmdc:mga06r32_41331_c1 | |||
| 1965 | nmdc:mga06r32_415068_c1 | |||
| 1966 | nmdc:mga06r32_45349_c1 | |||
| 1967 | nmdc:mga06r32_765383_c1 | |||
| 1968 | nmdc:mga06r32_777421_c1 | |||
| 1969 | nmdc:mga06r32_831646_c1 | |||
| 1970 | nmdc:mga08y16_1182762_c1 | |||
| 1971 | nmdc:mga08y16_177248_c1 | |||
| 1972 | nmdc:mga08y16_268647_c1 | |||
| 1973 | nmdc:mga08y16_35585_c1 | |||
| 1974 | nmdc:mga08y16_36816_c1 | |||
| 1975 | nmdc:mga08y16_368365_c1 | |||
| 1976 | nmdc:mga08y16_48088_c1 | |||
| 1977 | nmdc:mga0n895_1102_c1 | |||
| 1978 | nmdc:mga0n895_117509_c1 | |||
| 1979 | nmdc:mga0n895_15879_c1 | |||
| 1980 | nmdc:mga0n895_162337_c1 | |||
| 1981 | nmdc:mga0n895_19342_c1 | |||
| 1982 | nmdc:mga0n895_240070_c1 | |||
| 1983 | nmdc:mga0n895_260923_c1 | |||
| 1984 | nmdc:mga0n895_262754_c1 | |||
| 1985 | nmdc:mga0n895_35688_c1 | |||
| 1986 | nmdc:mga0n895_39199_c1 | |||
| 1987 | nmdc:mga0n895_44372_c1 | |||
| 1988 | nmdc:mga0n895_808509_c1 | |||
| 1989 | nmdc:mga0n895_933780_c1 | |||
| 1990 | nmdc:mga0n895_97559_c1 | |||
| 1991 | nmdc:mga0rr50_113414_c1 | |||
| 1992 | nmdc:mga0rr50_1203614_c1 | |||
| 1993 | nmdc:mga0rr50_12062_c1 | |||
| 1994 | nmdc:mga0rr50_1342765_c1 | |||
| 1995 | nmdc:mga0rr50_1567263_c1 | |||
| 1996 | nmdc:mga0rr50_348123_c1 | |||
| 1997 | nmdc:mga0rr50_45429_c1 | |||
| 1998 | nmdc:mga0rr50_479880_c1 | |||
| 1999 | nmdc:mga0rr50_551665_c1 | |||
| 2000 | nmdc:mga0rr50_55166_c1 | |||
| 2001 | nmdc:mga0rr50_624836_c1 | |||
| 2002 | nmdc:mga0rr50_65422_c1 | |||
| 2003 | nmdc:mga0rr50_931260_c1 | |||
| 2004 | nmdc:mga08x19_122853_c1 | |||
| 2005 | nmdc:mga08x19_2304_c1 | |||
| 2006 | nmdc:mga08x19_282957_c1 | |||
| 2007 | nmdc:mga08x19_462181_c1 | |||
| 2008 | nmdc:mga08x19_563692_c1 | |||
| 2009 | nmdc:mga08x19_653359_c1 | |||
| 2010 | nmdc:mga08x19_7202_c1 | |||
| 2011 | nmdc:mga0a205_115102_c1 | |||
| 2012 | nmdc:mga0a205_1168693_c1 | |||
| 2013 | nmdc:mga0a205_134401_c1 | |||
| 2014 | nmdc:mga0a205_1357103_c1 | |||
| 2015 | nmdc:mga0a205_1560379_c1 | |||
| 2016 | nmdc:mga0a205_190862_c2 | |||
| 2017 | nmdc:mga0a205_2541_c1 | |||
| 2018 | nmdc:mga0a205_25671_c1 | |||
| 2019 | nmdc:mga0a205_453779_c1 | |||
| 2020 | nmdc:mga0a205_5886_c1 | |||
| 2021 | nmdc:mga0a205_619_c1 | |||
| 2022 | nmdc:mga0a205_632852_c1 | |||
| 2023 | nmdc:mga0a205_800022_c1 | |||
| 2024 | Ga0500555_095205 | |||
| 2025 | Ga0501084_0000423 | |||
| 2026 | Ga0501084_0031669 | |||
| 2027 | Ga0501084_0132103 | |||
| 2028 | Ga0501084_0176141 | |||
| 2029 | Ga0501084_0231795 | |||
| 2030 | Ga0501084_0403357 | |||
| 2031 | Ga0501084_0469119 | |||
| 2032 | Ga0501084_0653993 | |||
| 2033 | Ga0501084_0962485 | |||
| 2034 | Ga0501084_1443719 | |||
| 2035 | Ga0501084_1606690 | |||
| 2036 | Ga0590071_036073 | |||
| 2037 | Ga0590074_014850 | |||
| 2038 | Ga0590075_101977 | |||
| 2039 | Ga0501082_0000318 | |||
| 2040 | Ga0501082_0064814 | |||
| 2041 | Ga0501082_0090453 | |||
| 2042 | Ga0501082_0152016 | |||
| 2043 | Ga0501082_0238855 | |||
| 2044 | Ga0501082_0347131 | |||
| 2045 | Ga0501082_0654545 | |||
| 2046 | Ga0501082_0820289 | |||
| 2047 | Ga0501082_0890111 | |||
| 2048 | Ga0501082_0936805 | |||
| 2049 | Ga0501082_1318613 | |||
| 2050 | Ga0501082_1324508 | |||
| 2051 | Ga0501082_1547064 | |||
| 2052 | Ga0530510_0000344 | |||
| 2053 | Ga0530510_0005891 | |||
| 2054 | Ga0530510_0121852 | |||
| 2055 | Ga0530510_0149282 | |||
| 2056 | Ga0530510_0291122 | |||
| 2057 | Ga0530510_0415732 | |||
| 2058 | Ga0530510_0627277 | |||
| 2059 | Ga0530510_0728111 | |||
| 2060 | Ga0530510_0745952 | |||
| 2061 | Ga0530510_1155188 | |||
| 2062 | Ga0530510_1326045 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.9111 | 1 | 81 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.9028 | 1 | 81 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.9007 | 1 | 81 |
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8943 | 2 | 78 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8925 | 1 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9437 | 4 | 78 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9376 | 1 | 81 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9201 | 4 | 78 | 3.10.20.30 |
| af_I6XWG2_11_92_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8989 | 1 | 81 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8944 | 2 | 78 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534V2P4-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 1.003 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A7C3JJG2-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9964 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A2V7VPH6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9672 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A7C2Y5L6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9662 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A7C4IJF8-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9657 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |