F488606

General Info

Members Datasets Scaffolds Average Seq Length
1031 357 2062 81

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100376866|Ga0070708_1003768662
Length 96
Sequence MRIGVRLFASLREAAGTELVELDLPDGSTAEEAWRRLAEAHPSLAGRRRSLAVAVNRRYARFDEPLAPGDEVVFVPPVSGGSQSMPSSRRRLRNVG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
217 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
218 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
219 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
238 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
239 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
240 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
241 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
242 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
243 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
244 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
245 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
246 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
247 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
248 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
249 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
250 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
251 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
252 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
253 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
254 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
255 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
256 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
257 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
258 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
259 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
264 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
265 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
298 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
325 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
326 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
327 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
328 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
329 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 1.36
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 26.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100376866 3300005445 Bacteria 1338
2 MRS1b_contig_727244 2162886011 Unclassified 1012
3 MBSR1b_contig_6780580 2162886012 Bacteria 824
4 JGI25165J46597_1009672 3300003214 Bacteria 1439
5 JGI25405J52794_10001416 3300003911 Bacteria 3938
6 Ga0058860_11767753 3300004801 Unclassified 895
7 Ga0065704_10686811 3300005289 Unclassified 566
8 Ga0065712_10002257 3300005290 Bacteria 4870
9 Ga0065712_10002777 3300005290 Bacteria 5095
10 Ga0065715_10013103 3300005293 Bacteria 2158
11 Ga0065715_10301656 3300005293 Unclassified 1039
12 Ga0065715_10394114 3300005293 Bacteria 890
13 Ga0065707_10001335 3300005295 Bacteria 11321
14 Ga0065707_10171174 3300005295 Unclassified 1478
15 Ga0065707_10360981 3300005295 Unclassified 904
16 Ga0065707_10467478 3300005295 Unclassified 785
17 Ga0065707_10580217 3300005295 Bacteria 693
18 Ga0065707_10816276 3300005295 Unclassified 594
19 Ga0070676_10303923 3300005328 Unclassified 1082
20 Ga0070676_10654905 3300005328 Bacteria 763
21 Ga0070683_100650272 3300005329 Unclassified 1009
22 Ga0070690_100152307 3300005330 Unclassified 1579
23 Ga0070690_100280859 3300005330 Unclassified 1188
24 Ga0070690_100684629 3300005330 Bacteria 786
25 Ga0070670_100000785 3300005331 Bacteria 24698
26 Ga0070677_10060769 3300005333 Bacteria 1558
27 Ga0068869_100030357 3300005334 Bacteria 3794
28 Ga0068869_100833432 3300005334 Bacteria 795
29 Ga0068869_101326445 3300005334 Unclassified 635
30 Ga0070666_10018952 3300005335 Unclassified 4434
31 Ga0070666_10565365 3300005335 Bacteria 828
32 Ga0070680_100131696 3300005336 Bacteria 2093
33 Ga0070680_100644686 3300005336 Unclassified 910
34 Ga0070682_100801986 3300005337 Unclassified 765
35 Ga0068868_100032349 3300005338 Bacteria 4023
36 Ga0070689_100153375 3300005340 Bacteria 1859
37 Ga0070691_10056032 3300005341 Bacteria 1889
38 Ga0070691_10317104 3300005341 Bacteria 856
39 Ga0070687_100555063 3300005343 Unclassified 782
40 Ga0070661_100019298 3300005344 Bacteria 4859
41 Ga0070692_10126232 3300005345 Unclassified 1433
42 Ga0070692_11373994 3300005345 Bacteria 509
43 Ga0070668_100157871 3300005347 Bacteria 1838
44 Ga0070669_100007755 3300005353 Bacteria 7673
45 Ga0070669_100254834 3300005353 Bacteria 1398
46 Ga0070669_100395856 3300005353 Bacteria 1129
47 Ga0070675_100205291 3300005354 Bacteria 1711
48 Ga0070675_100233584 3300005354 Bacteria 1605
49 Ga0070675_100479106 3300005354 Bacteria 1119
50 Ga0070671_100045667 3300005355 Bacteria 3642
51 Ga0070674_101799423 3300005356 Unclassified 555
52 Ga0070673_100200946 3300005364 Bacteria 1716
53 Ga0070673_100281993 3300005364 Bacteria 1457
54 Ga0070688_100134226 3300005365 Bacteria 1674
55 Ga0070688_100453548 3300005365 Bacteria 959
56 Ga0070659_100311591 3300005366 Unclassified 1314
57 Ga0070659_101580129 3300005366 Unclassified 585
58 Ga0070667_100394665 3300005367 Unclassified 1258
59 Ga0070703_10138432 3300005406 Bacteria 902
60 Ga0070703_10155327 3300005406 Unclassified 863
61 Ga0070701_10963137 3300005438 Bacteria 593
62 Ga0070701_11204575 3300005438 Bacteria 537
63 Ga0070711_100037165 3300005439 Bacteria 3266
64 Ga0070711_100773403 3300005439 Unclassified 813
65 Ga0070705_100055050 3300005440 Bacteria 2336
66 Ga0070705_100127054 3300005440 Unclassified 1657
67 Ga0070705_100680316 3300005440 Bacteria 806
68 Ga0070705_100735474 3300005440 Unclassified 778
69 Ga0070705_101066761 3300005440 Bacteria 659
70 Ga0070705_101365913 3300005440 Bacteria 589
71 Ga0070700_100196244 3300005441 Unclassified 1415
72 Ga0070700_100930747 3300005441 Bacteria 710
73 Ga0070694_100044413 3300005444 Bacteria 2974
74 Ga0070694_100082135 3300005444 Bacteria 2243
75 Ga0070694_100146635 3300005444 Bacteria 1720
76 Ga0070694_100437801 3300005444 Bacteria 1030
77 Ga0070694_100457020 3300005444 Bacteria 1009
78 Ga0070694_100911231 3300005444 Bacteria 726
79 Ga0070694_100932455 3300005444 Unclassified 718
80 Ga0070708_100353126 3300005445 Unclassified 1386
81 Ga0070663_100227161 3300005455 Bacteria 1468
82 Ga0070663_100236773 3300005455 Bacteria 1440
83 Ga0070678_100114653 3300005456 Bacteria 2114
84 Ga0070662_100185064 3300005457 Bacteria 1644
85 Ga0070662_100229496 3300005457 Unclassified 1484
86 Ga0070662_100374604 3300005457 Bacteria 1171
87 Ga0070662_100391635 3300005457 Bacteria 1145
88 Ga0070662_100408767 3300005457 Bacteria 1121
89 Ga0070681_10010565 3300005458 Bacteria 9119
90 Ga0070681_10018600 3300005458 Bacteria 6947
91 Ga0070681_10044729 3300005458 Unclassified 4432
92 Ga0068867_100087998 3300005459 Bacteria 2353
93 Ga0068867_100388382 3300005459 Bacteria 1174
94 Ga0070685_10225040 3300005466 Unclassified 1231
95 Ga0070685_11426346 3300005466 Bacteria 532
96 Ga0070706_100029329 3300005467 Bacteria 5070
97 Ga0070706_100061378 3300005467 Bacteria 3471
98 Ga0070706_100630820 3300005467 Bacteria 995
99 Ga0070706_101651460 3300005467 Unclassified 584
100 Ga0070707_100052951 3300005468 Bacteria 3891
101 Ga0070707_100056072 3300005468 Unclassified 3778
102 Ga0070707_100202837 3300005468 Bacteria 1933
103 Ga0070707_100698813 3300005468 Bacteria 977
104 Ga0070698_100005467 3300005471 Bacteria 13869
105 Ga0070698_100375879 3300005471 Unclassified 1353
106 Ga0070698_100451015 3300005471 Bacteria 1222
107 Ga0070698_101177949 3300005471 Unclassified 715
108 Ga0070699_100021770 3300005518 Bacteria 5526
109 Ga0070699_100347870 3300005518 Unclassified 1335
110 Ga0070699_100735113 3300005518 Unclassified 902
111 Ga0070699_101830126 3300005518 Bacteria 556
112 Ga0070679_100120303 3300005530 Bacteria 2611
113 Ga0070679_100159762 3300005530 Bacteria 2228
114 Ga0070684_100404023 3300005535 Unclassified 1259
115 Ga0070697_100012867 3300005536 Bacteria 6555
116 Ga0070697_100046361 3300005536 Bacteria 3523
117 Ga0070697_100111880 3300005536 Bacteria 2276
118 Ga0070697_100445016 3300005536 Bacteria 1128
119 Ga0070697_100455359 3300005536 Unclassified 1115
120 Ga0070697_100558728 3300005536 Bacteria 1004
121 Ga0070697_100622238 3300005536 Bacteria 950
122 Ga0068853_100141923 3300005539 Bacteria 2156
123 Ga0070672_100056574 3300005543 Bacteria 3077
124 Ga0070672_100113353 3300005543 Bacteria 2213
125 Ga0070672_100860854 3300005543 Unclassified 799
126 Ga0070672_101967065 3300005543 Bacteria 526
127 Ga0070686_100029154 3300005544 Unclassified 3354
128 Ga0070695_100378764 3300005545 Bacteria 1067
129 Ga0070695_101275944 3300005545 Bacteria 606
130 Ga0070696_100036308 3300005546 Bacteria 3397
131 Ga0070696_100111904 3300005546 Bacteria 1967
132 Ga0070696_100187425 3300005546 Bacteria 1538
133 Ga0070696_100296656 3300005546 Bacteria 1237
134 Ga0070696_101553673 3300005546 Bacteria 568
135 Ga0070696_101576576 3300005546 Bacteria 564
136 Ga0070696_102016638 3300005546 Bacteria 501
137 Ga0070693_100094760 3300005547 Bacteria 1807
138 Ga0070665_100138414 3300005548 Bacteria 2438
139 Ga0070704_100036390 3300005549 Bacteria 3355
140 Ga0070704_100301640 3300005549 Bacteria 1335
141 Ga0070704_100672411 3300005549 Bacteria 916
142 Ga0070704_100869366 3300005549 Bacteria 809
143 Ga0070704_100897300 3300005549 Unclassified 797
144 Ga0070704_101264110 3300005549 Bacteria 675
145 Ga0070704_101459498 3300005549 Bacteria 628
146 Ga0068855_100376152 3300005563 Bacteria 1560
147 Ga0070664_100001110 3300005564 Bacteria 21299
148 Ga0068857_100084476 3300005577 Bacteria 2837
149 Ga0068857_100717932 3300005577 Bacteria 950
150 Ga0068857_101223252 3300005577 Bacteria 728
151 Ga0068854_100072033 3300005578 Bacteria 2530
152 Ga0068854_100290230 3300005578 Bacteria 1320
153 Ga0068856_100022118 3300005614 Bacteria 6183
154 Ga0070702_100152063 3300005615 Unclassified 1487
155 Ga0070702_101225150 3300005615 Bacteria 606
156 Ga0068852_100411171 3300005616 Unclassified 1333
157 Ga0068852_100587844 3300005616 Bacteria 1117
158 Ga0068859_100017152 3300005617 Bacteria 7272
159 Ga0068859_100025958 3300005617 Bacteria 5877
160 Ga0068859_100238962 3300005617 Bacteria 1905
161 Ga0068859_100406663 3300005617 Unclassified 1457
162 Ga0068859_102416130 3300005617 Unclassified 579
163 Ga0068864_100427279 3300005618 Bacteria 1263
164 Ga0068864_100501235 3300005618 Bacteria 1168
165 Ga0068866_10161108 3300005718 Bacteria 1308
166 Ga0068866_10279666 3300005718 Bacteria 1033
167 Ga0068861_100150506 3300005719 Bacteria 1909
168 Ga0068861_100477746 3300005719 Unclassified 1122
169 Ga0068861_100538451 3300005719 Bacteria 1062
170 Ga0068861_100607985 3300005719 Bacteria 1004
171 Ga0068861_100669492 3300005719 Unclassified 961
172 Ga0068861_101843833 3300005719 Bacteria 601
173 Ga0068861_101923847 3300005719 Bacteria 589
174 Ga0068870_10176720 3300005840 Bacteria 1278
175 Ga0068870_10206418 3300005840 Unclassified 1194
176 Ga0068870_10355712 3300005840 Bacteria 941
177 Ga0068863_100232906 3300005841 Bacteria 1777
178 Ga0068863_101637737 3300005841 Bacteria 653
179 Ga0068858_101426373 3300005842 Bacteria 682
180 Ga0068858_101557842 3300005842 Unclassified 652
181 Ga0068860_100221681 3300005843 Bacteria 1837
182 Ga0068860_101059566 3300005843 Unclassified 830
183 Ga0068860_101095395 3300005843 Bacteria 816
184 Ga0068860_101673070 3300005843 Bacteria 658
185 Ga0068862_100023106 3300005844 Bacteria 5207
186 Ga0068862_100506416 3300005844 Bacteria 1147
187 Ga0068862_100567574 3300005844 Unclassified 1085
188 Ga0068862_102131660 3300005844 Bacteria 572
189 Ga0081455_10002416 3300005937 Bacteria 22277
190 Ga0081455_10147538 3300005937 Bacteria 1817
191 Ga0081538_10009092 3300005981 Bacteria 8336
192 Ga0081538_10253644 3300005981 Unclassified 669
193 Ga0075368_10150330 3300006042 Bacteria 973
194 Ga0075363_100123778 3300006048 Bacteria 1446
195 Ga0075363_100391096 3300006048 Bacteria 816
196 Ga0075432_10035052 3300006058 Bacteria 1744
197 Ga0075432_10175920 3300006058 Unclassified 835
198 Ga0070716_100035913 3300006173 Bacteria 2728
199 Ga0070716_100336482 3300006173 Bacteria 1063
200 Ga0070712_100069890 3300006175 Bacteria 2506
201 Ga0070712_101859585 3300006175 Unclassified 527
202 Ga0075367_10024419 3300006178 Bacteria 3408
203 Ga0075367_10094596 3300006178 Bacteria 1822
204 Ga0075366_10190961 3300006195 Bacteria 1245
205 Ga0097621_100444707 3300006237 Unclassified 1167
206 Ga0097621_100792877 3300006237 Bacteria 877
207 Ga0097621_100801949 3300006237 Unclassified 872
208 Ga0075370_10318196 3300006353 Unclassified 927
209 Ga0068871_100687879 3300006358 Bacteria 936
210 Ga0075428_100001519 3300006844 Bacteria 24799
211 Ga0075428_100006976 3300006844 Bacteria 12531
212 Ga0075428_100014051 3300006844 Bacteria 8911
213 Ga0075428_100022801 3300006844 Bacteria 6928
214 Ga0075428_100101440 3300006844 Unclassified 3137
215 Ga0075428_100107468 3300006844 Bacteria 3041
216 Ga0075428_100181801 3300006844 Bacteria 2276
217 Ga0075428_100451161 3300006844 Unclassified 1377
218 Ga0075428_100453839 3300006844 Bacteria 1373
219 Ga0075428_101434893 3300006844 Bacteria 724
220 Ga0075430_100005925 3300006846 Bacteria 10322
221 Ga0075430_100157637 3300006846 Bacteria 1889
222 Ga0075430_100259778 3300006846 Bacteria 1438
223 Ga0075430_100294370 3300006846 Bacteria 1343
224 Ga0075431_100001686 3300006847 Bacteria 20728
225 Ga0075431_100016515 3300006847 Bacteria 7492
226 Ga0075431_100044729 3300006847 Bacteria 4565
227 Ga0075431_100096527 3300006847 Bacteria 3051
228 Ga0075431_100107887 3300006847 Bacteria 2873
229 Ga0075431_100335174 3300006847 Bacteria 1523
230 Ga0075431_100375883 3300006847 Unclassified 1426
231 Ga0075431_100504541 3300006847 Bacteria 1201
232 Ga0075431_100676384 3300006847 Bacteria 1011
233 Ga0075431_101072018 3300006847 Unclassified 771
234 Ga0075431_101072501 3300006847 Bacteria 771
235 Ga0075431_101757340 3300006847 Bacteria 577
236 Ga0075433_10000446 3300006852 Bacteria 26719
237 Ga0075433_10007564 3300006852 Bacteria 8618
238 Ga0075433_10023127 3300006852 Bacteria 5227
239 Ga0075433_10036578 3300006852 Unclassified 4230
240 Ga0075433_10083007 3300006852 Bacteria 2827
241 Ga0075433_10099686 3300006852 Bacteria 2572
242 Ga0075433_10421278 3300006852 Bacteria 1177
243 Ga0075433_10476322 3300006852 Unclassified 1100
244 Ga0075433_10897157 3300006852 Unclassified 773
245 Ga0075433_11024829 3300006852 Bacteria 719
246 Ga0075433_11026516 3300006852 Bacteria 718
247 Ga0075433_11250910 3300006852 Unclassified 644
248 Ga0075433_11612052 3300006852 Unclassified 560
249 Ga0075433_11721521 3300006852 Bacteria 540
250 Ga0075434_100001490 3300006871 Bacteria 19748
251 Ga0075434_100012190 3300006871 Bacteria 8145
252 Ga0075434_100016451 3300006871 Bacteria 7110
253 Ga0075434_100029643 3300006871 Bacteria 5385
254 Ga0075434_100043984 3300006871 Bacteria 4430
255 Ga0075434_100059577 3300006871 Bacteria 3796
256 Ga0075434_100064015 3300006871 Bacteria 3661
257 Ga0075434_100090000 3300006871 Bacteria 3070
258 Ga0075434_100107500 3300006871 Bacteria 2800
259 Ga0075434_100121773 3300006871 Bacteria 2625
260 Ga0075434_100327168 3300006871 Bacteria 1553
261 Ga0075434_100427500 3300006871 Unclassified 1346
262 Ga0075434_101406567 3300006871 Unclassified 707
263 Ga0075429_100002919 3300006880 Bacteria 14502
264 Ga0075429_100038449 3300006880 Bacteria 4165
265 Ga0075429_100042378 3300006880 Unclassified 3962
266 Ga0075429_100128482 3300006880 Bacteria 2217
267 Ga0075429_100192990 3300006880 Bacteria 1784
268 Ga0075429_100705130 3300006880 Unclassified 884
269 Ga0075429_100723437 3300006880 Unclassified 872
270 Ga0068865_100409513 3300006881 Bacteria 1112
271 Ga0068865_100455993 3300006881 Bacteria 1058
272 Ga0068865_100547597 3300006881 Bacteria 971
273 Ga0068865_101389722 3300006881 Bacteria 626
274 Ga0075436_100010183 3300006914 Bacteria 6439
275 Ga0075436_100023881 3300006914 Bacteria 4202
276 Ga0075436_100033659 3300006914 Bacteria 3533
277 Ga0075436_100147557 3300006914 Unclassified 1654
278 Ga0075436_100210906 3300006914 Unclassified 1377
279 Ga0075436_100407122 3300006914 Bacteria 986
280 Ga0075436_100443399 3300006914 Unclassified 945
281 Ga0075436_101157539 3300006914 Unclassified 583
282 Ga0097620_100017152 3300006931 Bacteria 7272
283 Ga0097620_100025962 3300006931 Bacteria 5877
284 Ga0097620_100238957 3300006931 Bacteria 1905
285 Ga0097620_100406675 3300006931 Unclassified 1457
286 Ga0097620_102415366 3300006931 Unclassified 579
287 Ga0075435_100007980 3300007076 Bacteria 7576
288 Ga0075435_100010661 3300007076 Bacteria 6730
289 Ga0075435_100026170 3300007076 Bacteria 4548
290 Ga0075435_100064885 3300007076 Bacteria 2968
291 Ga0075435_100091585 3300007076 Unclassified 2509
292 Ga0075435_100146874 3300007076 Bacteria 1981
293 Ga0075435_100178615 3300007076 Bacteria 1793
294 Ga0075435_100288924 3300007076 Unclassified 1401
295 Ga0075435_100304205 3300007076 Bacteria 1364
296 Ga0075435_100373828 3300007076 Unclassified 1224
297 Ga0075435_100510882 3300007076 Unclassified 1039
298 Ga0075435_100865300 3300007076 Bacteria 788
299 Ga0105240_10001318 3300009093 Bacteria 42836
300 Ga0105240_10278411 3300009093 Unclassified 1923
301 Ga0111539_10002805 3300009094 Bacteria 23141
302 Ga0111539_10002994 3300009094 Bacteria 22414
303 Ga0111539_10005783 3300009094 Bacteria 15983
304 Ga0111539_10063090 3300009094 Unclassified 4385
305 Ga0111539_10213579 3300009094 Bacteria 2248
306 Ga0111539_10428338 3300009094 Bacteria 1541
307 Ga0111539_11093878 3300009094 Bacteria 926
308 Ga0111539_11130576 3300009094 Bacteria 910
309 Ga0111539_12142249 3300009094 Unclassified 649
310 Ga0105245_10111429 3300009098 Unclassified 2545
311 Ga0105245_10245499 3300009098 Bacteria 1738
312 Ga0114129_10013590 3300009147 Bacteria 11600
313 Ga0114129_10014069 3300009147 Bacteria 11399
314 Ga0114129_10050832 3300009147 Bacteria 5820
315 Ga0114129_10065608 3300009147 Bacteria 5066
316 Ga0114129_10079937 3300009147 Bacteria 4545
317 Ga0114129_10081486 3300009147 Bacteria 4498
318 Ga0114129_10171754 3300009147 Bacteria 2955
319 Ga0114129_10188138 3300009147 Bacteria 2805
320 Ga0114129_10189782 3300009147 Bacteria 2791
321 Ga0114129_10200942 3300009147 Unclassified 2699
322 Ga0114129_10209251 3300009147 Unclassified 2638
323 Ga0114129_10214541 3300009147 Bacteria 2600
324 Ga0114129_10235446 3300009147 Bacteria 2464
325 Ga0114129_10305090 3300009147 Bacteria 2121
326 Ga0114129_10369593 3300009147 Unclassified 1896
327 Ga0114129_10527597 3300009147 Bacteria 1539
328 Ga0114129_10840077 3300009147 Bacteria 1168
329 Ga0114129_11301444 3300009147 Unclassified 901
330 Ga0114129_11510307 3300009147 Unclassified 825
331 Ga0114129_13274665 3300009147 Unclassified 524
332 Ga0105243_10058820 3300009148 Bacteria 3065
333 Ga0105243_10751932 3300009148 Bacteria 956
334 Ga0105241_10005902 3300009174 Bacteria 9036
335 Ga0105242_10046389 3300009176 Unclassified 3525
336 Ga0105242_10229054 3300009176 Bacteria 1665
337 Ga0105248_11706543 3300009177 Bacteria 714
338 Ga0105237_10018912 3300009545 Bacteria 7122
339 Ga0105237_10088023 3300009545 Bacteria 3095
340 Ga0105238_10085564 3300009551 Bacteria 3140
341 Ga0105238_13082406 3300009551 Unclassified 500
342 Ga0105249_10109252 3300009553 Bacteria 2612
343 Ga0105249_10344442 3300009553 Unclassified 1508
344 Ga0105030_104565 3300009987 Bacteria 1171
345 Ga0105239_10059595 3300010375 Unclassified 4189
346 Ga0105239_11309653 3300010375 Bacteria 836
347 Ga0157326_1035605 3300012513 Bacteria 678
348 Ga0157338_1058064 3300012515 Bacteria 574
349 Ga0157373_10050366 3300013100 Bacteria 2966
350 Ga0157371_10079616 3300013102 Unclassified 2321
351 Ga0157374_10330142 3300013296 Bacteria 1513
352 Ga0157378_10163906 3300013297 Bacteria 2081
353 Ga0157378_10172107 3300013297 Bacteria 2031
354 Ga0157378_10495747 3300013297 Unclassified 1219
355 Ga0157378_10608446 3300013297 Unclassified 1105
356 Ga0163162_10130481 3300013306 Bacteria 2622
357 Ga0163162_10139211 3300013306 Bacteria 2539
358 Ga0163162_12253508 3300013306 Bacteria 626
359 Ga0157372_10014000 3300013307 Bacteria 8569
360 Ga0157375_10224655 3300013308 Bacteria 2037
361 Ga0157375_10620401 3300013308 Bacteria 1239
362 Ga0157514_127414 3300013874 Bacteria 796
363 Ga0163163_10044528 3300014325 Unclassified 4354
364 Ga0157380_10000345 3300014326 Bacteria 27857
365 Ga0157380_10003796 3300014326 Bacteria 10391
366 Ga0157380_10025863 3300014326 Bacteria 4454
367 Ga0157380_10653989 3300014326 Bacteria 1049
368 Ga0157380_11770708 3300014326 Bacteria 676
369 Ga0157380_12043916 3300014326 Unclassified 635
370 Ga0157377_10203328 3300014745 Unclassified 1259
371 Ga0157377_10387470 3300014745 Bacteria 948
372 Ga0157376_10054527 3300014969 Unclassified 3333
373 Ga0157376_11720352 3300014969 Bacteria 663
374 Ga0209233_1002219 3300025261 Bacteria 7285
375 Ga0207697_10005530 3300025315 Bacteria 5862
376 Ga0207697_10022887 3300025315 Unclassified 2559
377 Ga0207682_10038346 3300025893 Bacteria 1944
378 Ga0207642_10072835 3300025899 Bacteria 1641
379 Ga0207688_10022626 3300025901 Bacteria 3440
380 Ga0207688_10412437 3300025901 Bacteria 839
381 Ga0207647_10164766 3300025904 Unclassified 1292
382 Ga0207699_10424842 3300025906 Bacteria 950
383 Ga0207645_10000592 3300025907 Bacteria 30028
384 Ga0207705_10039681 3300025909 Bacteria 3374
385 Ga0207684_10002342 3300025910 Bacteria 19200
386 Ga0207654_10059075 3300025911 Unclassified 2235
387 Ga0207707_10001455 3300025912 Bacteria 21874
388 Ga0207707_10020996 3300025912 Bacteria 5704
389 Ga0207707_10343534 3300025912 Unclassified 1287
390 Ga0207695_10000007 3300025913 Bacteria 1092551
391 Ga0207695_10485823 3300025913 Bacteria 1117
392 Ga0207671_10227162 3300025914 Bacteria 1464
393 Ga0207663_10065334 3300025916 Bacteria 2325
394 Ga0207660_10070695 3300025917 Bacteria 2537
395 Ga0207660_10439742 3300025917 Bacteria 1054
396 Ga0207662_10129666 3300025918 Unclassified 1589
397 Ga0207662_10367989 3300025918 Bacteria 969
398 Ga0207662_10944642 3300025918 Bacteria 611
399 Ga0207657_10014472 3300025919 Bacteria 7701
400 Ga0207649_10439842 3300025920 Unclassified 982
401 Ga0207652_10095034 3300025921 Bacteria 2625
402 Ga0207652_10316377 3300025921 Unclassified 1409
403 Ga0207646_10003474 3300025922 Bacteria 17795
404 Ga0207646_10053880 3300025922 Bacteria 3598
405 Ga0207646_10307460 3300025922 Bacteria 1432
406 Ga0207646_10956919 3300025922 Unclassified 758
407 Ga0207646_11061964 3300025922 Unclassified 714
408 Ga0207681_10075779 3300025923 Bacteria 2360
409 Ga0207681_10089024 3300025923 Bacteria 2200
410 Ga0207681_10216031 3300025923 Bacteria 1481
411 Ga0207681_10415994 3300025923 Bacteria 1088
412 Ga0207694_10126861 3300025924 Bacteria 2042
413 Ga0207650_10001050 3300025925 Bacteria 20534
414 Ga0207650_10723147 3300025925 Bacteria 842
415 Ga0207659_10041943 3300025926 Bacteria 3206
416 Ga0207659_10258788 3300025926 Bacteria 1415
417 Ga0207644_10030054 3300025931 Unclassified 3773
418 Ga0207690_10258916 3300025932 Unclassified 1347
419 Ga0207706_10010887 3300025933 Bacteria 8299
420 Ga0207706_10118756 3300025933 Bacteria 2325
421 Ga0207706_10301011 3300025933 Bacteria 1397
422 Ga0207706_10454818 3300025933 Bacteria 1107
423 Ga0207706_10640204 3300025933 Bacteria 911
424 Ga0207706_11005218 3300025933 Unclassified 700
425 Ga0207686_10321223 3300025934 Unclassified 1157
426 Ga0207709_10569083 3300025935 Bacteria 893
427 Ga0207670_10007615 3300025936 Bacteria 6056
428 Ga0207670_10323522 3300025936 Unclassified 1214
429 Ga0207669_10033542 3300025937 Bacteria 2899
430 Ga0207669_10381811 3300025937 Unclassified 1098
431 Ga0207704_10304662 3300025938 Bacteria 1222
432 Ga0207704_10326854 3300025938 Bacteria 1185
433 Ga0207704_11247182 3300025938 Bacteria 635
434 Ga0207665_10054208 3300025939 Bacteria 2704
435 Ga0207665_10291896 3300025939 Bacteria 1216
436 Ga0207691_10006363 3300025940 Bacteria 11410
437 Ga0207691_10852787 3300025940 Bacteria 764
438 Ga0207689_10049335 3300025942 Bacteria 3472
439 Ga0207689_10408037 3300025942 Bacteria 1133
440 Ga0207679_10003644 3300025945 Bacteria 9544
441 Ga0207667_10872609 3300025949 Bacteria 893
442 Ga0207667_11244943 3300025949 Unclassified 722
443 Ga0207651_10212481 3300025960 Bacteria 1558
444 Ga0207651_10227286 3300025960 Unclassified 1512
445 Ga0207712_10372144 3300025961 Unclassified 1193
446 Ga0207712_10813997 3300025961 Unclassified 822
447 Ga0207640_10309018 3300025981 Bacteria 1254
448 Ga0207640_10815475 3300025981 Bacteria 809
449 Ga0207658_12133922 3300025986 Unclassified 509
450 Ga0207703_10527512 3300026035 Unclassified 1111
451 Ga0207639_10574626 3300026041 Bacteria 1037
452 Ga0207678_10023583 3300026067 Bacteria 5381
453 Ga0207678_10254315 3300026067 Bacteria 1505
454 Ga0207708_10032000 3300026075 Unclassified 3994
455 Ga0207708_10415143 3300026075 Bacteria 1115
456 Ga0207708_11871844 3300026075 Bacteria 526
457 Ga0207702_10089539 3300026078 Bacteria 2691
458 Ga0207641_10783696 3300026088 Unclassified 942
459 Ga0207641_11569761 3300026088 Bacteria 660
460 Ga0207648_10187358 3300026089 Bacteria 1833
461 Ga0207648_11166525 3300026089 Unclassified 723
462 Ga0207676_10199027 3300026095 Bacteria 1769
463 Ga0207676_10464716 3300026095 Bacteria 1195
464 Ga0207674_10086162 3300026116 Bacteria 3136
465 Ga0207674_10115924 3300026116 Bacteria 2650
466 Ga0207674_10216610 3300026116 Bacteria 1863
467 Ga0207674_10808022 3300026116 Bacteria 905
468 Ga0207674_11215618 3300026116 Bacteria 723
469 Ga0207675_100175600 3300026118 Bacteria 2049
470 Ga0207675_100242401 3300026118 Bacteria 1742
471 Ga0207675_100538179 3300026118 Unclassified 1166
472 Ga0207675_100629389 3300026118 Bacteria 1078
473 Ga0207675_100672756 3300026118 Bacteria 1042
474 Ga0207675_100884715 3300026118 Bacteria 909
475 Ga0207683_10019216 3300026121 Bacteria 5833
476 Ga0207698_10814766 3300026142 Bacteria 937
477 Ga0209973_1046802 3300027252 Unclassified 645
478 Ga0209967_1065444 3300027364 Bacteria 565
479 Ga0209981_1052994 3300027378 Unclassified 616
480 Ga0209984_1002716 3300027424 Bacteria 1989
481 Ga0210000_1065529 3300027462 Unclassified 590
482 Ga0209982_1042920 3300027552 Unclassified 723
483 Ga0209970_1003676 3300027614 Bacteria 2570
484 Ga0209970_1061889 3300027614 Unclassified 687
485 Ga0209970_1068062 3300027614 Bacteria 660
486 Ga0210002_1036544 3300027617 Bacteria 827
487 Ga0209983_1007745 3300027665 Bacteria 2199
488 Ga0209971_1003655 3300027682 Bacteria 3643
489 Ga0209966_1046331 3300027695 Unclassified 917
490 Ga0209998_10144612 3300027717 Bacteria 609
491 Ga0209998_10197636 3300027717 Bacteria 525
492 Ga0209974_10000812 3300027876 Bacteria 10699
493 Ga0209974_10005290 3300027876 Bacteria 4553
494 Ga0207428_10029894 3300027907 Bacteria 4507
495 Ga0207428_10098398 3300027907 Unclassified 2264
496 Ga0207428_10133763 3300027907 Bacteria 1897
497 Ga0207428_10288858 3300027907 Bacteria 1216
498 Ga0207428_10300797 3300027907 Bacteria 1187
499 Ga0268266_11211368 3300028379 Unclassified 730
500 Ga0268265_10092376 3300028380 Bacteria 2422
501 Ga0268265_10282736 3300028380 Bacteria 1485
502 Ga0268265_10337835 3300028380 Bacteria 1370
503 Ga0268265_11402766 3300028380 Bacteria 701
504 Ga0268265_11795737 3300028380 Unclassified 620
505 Ga0268264_11066622 3300028381 Bacteria 816
506 Ga0307515_10000005 3300028794 Bacteria 758563
507 Ga0265760_10144607 3300031090 Bacteria 776
508 Ga0307408_100055613 3300031548 Archaea 2866
509 Ga0307408_100057239 3300031548 Bacteria 2829
510 Ga0307408_100061859 3300031548 Bacteria 2734
511 Ga0307408_100216838 3300031548 Bacteria 1559
512 Ga0316575_10187384 3300031665 Bacteria 860
513 Ga0316575_10480600 3300031665 Bacteria 538
514 Ga0316576_10131305 3300031727 Bacteria 1884
515 Ga0316578_10176869 3300031728 Bacteria 1286
516 Ga0307405_10001828 3300031731 Bacteria 9125
517 Ga0307405_10173807 3300031731 Unclassified 1539
518 Ga0307405_10428643 3300031731 Unclassified 1043
519 Ga0316577_10001492 3300031733 Bacteria 11089
520 Ga0316577_10113086 3300031733 Bacteria 1524
521 Ga0316577_10609810 3300031733 Bacteria 621
522 Ga0307413_10050614 3300031824 Bacteria 2497
523 Ga0307413_10106361 3300031824 Unclassified 1867
524 Ga0307413_11114037 3300031824 Bacteria 682
525 Ga0307413_11639450 3300031824 Unclassified 572
526 Ga0307413_11688129 3300031824 Unclassified 564
527 Ga0307410_10018291 3300031852 Unclassified 4232
528 Ga0307410_10071739 3300031852 Bacteria 2403
529 Ga0307410_10121841 3300031852 Bacteria 1903
530 Ga0307410_10153004 3300031852 Bacteria 1719
531 Ga0307410_10280269 3300031852 Unclassified 1308
532 Ga0307410_10789378 3300031852 Bacteria 807
533 Ga0307406_10013857 3300031901 Bacteria 4628
534 Ga0307406_10067687 3300031901 Bacteria 2329
535 Ga0307406_10075308 3300031901 Bacteria 2226
536 Ga0307406_10087995 3300031901 Bacteria 2083
537 Ga0307406_10115151 3300031901 Unclassified 1858
538 Ga0307407_10033925 3300031903 Bacteria 2789
539 Ga0307407_10224053 3300031903 Bacteria 1273
540 Ga0307407_10431336 3300031903 Bacteria 952
541 Ga0307412_10012347 3300031911 Bacteria 4976
542 Ga0307412_10032667 3300031911 Unclassified 3301
543 Ga0307412_10455038 3300031911 Bacteria 1055
544 Ga0307409_100197333 3300031995 Bacteria 1797
545 Ga0307409_100318563 3300031995 Bacteria 1454
546 Ga0307409_100843253 3300031995 Unclassified 927
547 Ga0307416_100000870 3300032002 Bacteria 15903
548 Ga0307416_100002835 3300032002 Bacteria 10088
549 Ga0307416_100022394 3300032002 Bacteria 4560
550 Ga0307416_100522170 3300032002 Unclassified 1256
551 Ga0307414_10015663 3300032004 Unclassified 4583
552 Ga0307414_10141205 3300032004 Bacteria 1886
553 Ga0307414_10219390 3300032004 Unclassified 1560
554 Ga0307414_12071670 3300032004 Bacteria 531
555 Ga0307411_10012783 3300032005 Bacteria 4600
556 Ga0307411_10035882 3300032005 Bacteria 3101
557 Ga0307411_10038805 3300032005 Bacteria 3008
558 Ga0307411_10124439 3300032005 Bacteria 1872
559 Ga0307411_10732481 3300032005 Unclassified 864
560 Ga0307411_11038631 3300032005 Bacteria 735
561 Ga0307415_100008578 3300032126 Bacteria 5673
562 Ga0307415_100176437 3300032126 Bacteria 1672
563 Ga0307415_100528368 3300032126 Unclassified 1037
564 Ga0316585_10007701 3300032137 Bacteria 3111
565 Ga0316585_10197044 3300032137 Bacteria 666
566 Ga0373926_0273974 3300035083 Bacteria 656
567 Ga0373928_0023454 3300035084 Bacteria 1316
568 Ga0373940_0113852 3300035088 Bacteria 833
569 Ga0373952_0151592 3300035092 Unclassified 651
570 Ga0373932_0033741 3300035112 Bacteria 1439
571 Ga0373932_0200699 3300035112 Unclassified 709
572 Ga0373932_0359884 3300035112 Unclassified 555
573 Ga0373939_0199681 3300035114 Bacteria 756
574 Ga0373939_0383867 3300035114 Unclassified 579
575 Ga0373941_0257082 3300035115 Unclassified 684
576 Ga0373943_0636497 3300035170 Bacteria 630
577 Ga0373946_0597124 3300035171 Bacteria 572
578 Ga0373955_0294038 3300035172 Unclassified 979
579 Ga0373942_0016919 3300035207 Bacteria 1793
580 Ga0373942_0156579 3300035207 Bacteria 735
581 Ga0373961_0226044 3300035241 Unclassified 669
582 Ga0316574_0019000 3300035398 Bacteria 4049
583 Ga0316574_0074165 3300035398 Bacteria 2153
584 Ga0316574_0203524 3300035398 Unclassified 1271
585 Ga0316574_0219846 3300035398 Bacteria 1217
586 Ga0316574_0405148 3300035398 Bacteria 858
587 Ga0373931_0231038 3300035691 Unclassified 1117
588 Ga0373931_0400519 3300035691 Bacteria 869
589 Ga0373931_0554362 3300035691 Bacteria 747
590 Ga0373935_0473823 3300035692 Bacteria 906
591 Ga0373947_0828518 3300035725 Unclassified 632
592 Ga0373937_0141992 3300036401 Bacteria 2247
593 Ga0316582_0204597 3300036647 Bacteria 1347
594 Ga0316582_0336742 3300036647 Bacteria 1038
595 Ga0316584_0006481 3300036712 Bacteria 7925
596 Ga0316584_0092710 3300036712 Bacteria 2261
597 Ga0373925_0673532 3300037068 Bacteria 853
598 Ga0439453_0070827 3300041408 Bacteria 737
599 Ga0439465_0169200 3300041413 Unclassified 787
600 Ga0439431_0266577 3300041997 Bacteria 511
601 Ga0439433_0056228 3300041999 Unclassified 933
602 Ga0439441_015525 3300042001 Bacteria 1348
603 Ga0439442_141863 3300042002 Unclassified 532
604 Ga0439445_0230797 3300042004 Unclassified 551
605 Ga0439432_085125 3300042006 Unclassified 955
606 Ga0439450_144857 3300042008 Unclassified 621
607 Ga0439454_025209 3300042011 Bacteria 903
608 Ga0439455_0178146 3300042012 Unclassified 612
609 Ga0439456_063877 3300042013 Unclassified 811
610 Ga0450911_019573 3300042115 Bacteria 887
611 Ga0450919_035315 3300042121 Bacteria 577
612 Ga0450920_010976 3300042122 Bacteria 1683
613 Ga0450923_001196 3300042125 Bacteria 3333
614 Ga0450894_022089 3300042131 Bacteria 861
615 Ga0450895_000249 3300042132 Bacteria 2749
616 Ga0450895_002562 3300042132 Bacteria 1358
617 Ga0450896_000566 3300042133 Bacteria 3951
618 Ga0450896_001535 3300042133 Bacteria 2867
619 Ga0450899_027048 3300042135 Bacteria 688
620 Ga0450900_045104 3300042136 Unclassified 666
621 Ga0450889_028602 3300042144 Unclassified 644
622 Ga0450907_021726 3300042146 Bacteria 1080
623 Ga0450907_081545 3300042146 Bacteria 561
624 Ga0439446_0001736 3300042156 Bacteria 5066
625 Ga0439446_0032718 3300042156 Bacteria 1509
626 Ga0439446_0269567 3300042156 Unclassified 591
627 Ga0450908_000339 3300042184 Bacteria 9121
628 Ga0450908_011944 3300042184 Bacteria 1582
629 Ga0439434_0006745 3300042435 Bacteria 3354
630 Ga0439434_0016223 3300042435 Bacteria 2225
631 Ga0439434_0054403 3300042435 Bacteria 1245
632 Ga0439435_0001211 3300042436 Bacteria 4663
633 Ga0439435_0098045 3300042436 Bacteria 898
634 Ga0439444_0039794 3300042437 Bacteria 918
635 Ga0439444_0154120 3300042437 Unclassified 557
636 Ga0439459_0188939 3300042438 Bacteria 557
637 Ga0439460_0006044 3300042461 Bacteria 2988
638 Ga0450918_002807 3300042531 Bacteria 3272
639 Ga0450918_012882 3300042531 Bacteria 1455
640 Ga0451577_0143791 3300042876 Bacteria 2144
641 Ga0451577_0335820 3300042876 Unclassified 1370
642 Ga0451577_0466377 3300042876 Unclassified 1147
643 Ga0451577_0553250 3300042876 Bacteria 1045
644 Ga0451577_1219785 3300042876 Bacteria 671
645 Ga0453683_0000838 3300044673 Bacteria 29835
646 Ga0453684_1436321 3300044712 Unclassified 714
647 Ga0453684_2077082 3300044712 Unclassified 570
648 Ga0453684_2508921 3300044712 Bacteria 508
649 Ga0451576_0400502 3300045051 Unclassified 1439
650 Ga0451576_0889366 3300045051 Bacteria 934
651 Ga0451576_1162381 3300045051 Bacteria 806
652 Ga0451576_1806973 3300045051 Bacteria 632
653 Ga0451576_2460874 3300045051 Unclassified 532
654 Ga0495591_130220 3300046458 Bacteria 611
655 Ga0495651_0918897 3300046462 Bacteria 534
656 Ga0495580_0001653 3300046472 Bacteria 19619
657 Ga0495666_0258679 3300046526 Bacteria 792
658 Ga0495586_0276890 3300046535 Unclassified 960
659 Ga0495598_0047318 3300046537 Bacteria 1282
660 Ga0495621_0366297 3300046539 Bacteria 607
661 Ga0495633_0550804 3300046558 Unclassified 519
662 Ga0495647_0506333 3300046681 Bacteria 562
663 Ga0495658_0219582 3300046683 Bacteria 1190
664 Ga0495658_0746864 3300046683 Bacteria 627
665 Ga0495669_0238927 3300046684 Unclassified 872
666 Ga0495669_0628287 3300046684 Unclassified 522
667 Ga0495670_0808672 3300046691 Bacteria 512
668 Ga0495674_0609793 3300047319 Bacteria 864
669 Ga0495614_0575806 3300048089 Bacteria 540
670 Ga0496102_0515298 3300048905 Unclassified 1118
671 Ga0496102_1544840 3300048905 Bacteria 582
672 Ga0496104_0419058 3300048907 Unclassified 1251
673 Ga0496105_0491188 3300048908 Bacteria 965
674 Ga0496106_0255995 3300048909 Unclassified 1400
675 Ga0496108_0442295 3300048911 Unclassified 1136
676 Ga0496109_1267791 3300048912 Bacteria 673
677 Ga0496109_1755201 3300048912 Unclassified 554
678 Ga0496110_0312477 3300048913 Unclassified 1431
679 Ga0496112_0158808 3300048915 Unclassified 2227
680 Ga0496112_0231942 3300048915 Bacteria 1800
681 Ga0496113_0037131 3300048916 Bacteria 3573
682 Ga0496113_0282630 3300048916 Bacteria 1327
683 Ga0496113_0405855 3300048916 Bacteria 1094
684 Ga0496117_0079841 3300048920 Bacteria 2154
685 Ga0496118_0018596 3300048921 Bacteria 6257
686 Ga0501294_032497 3300049517 Unclassified 615
687 Ga0501295_124214 3300049518 Unclassified 622
688 Ga0501031_0029456 3300049568 Unclassified 3581
689 Ga0501031_0033561 3300049568 Bacteria 3348
690 Ga0501031_1002243 3300049568 Bacteria 534
691 Ga0501032_0018093 3300049569 Bacteria 4941
692 Ga0501032_0021090 3300049569 Bacteria 4531
693 Ga0501032_0475352 3300049569 Bacteria 800
694 Ga0501032_0480162 3300049569 Bacteria 795
695 Ga0501032_0604241 3300049569 Unclassified 698
696 Ga0501033_0153984 3300049570 Bacteria 1657
697 Ga0501033_0225704 3300049570 Bacteria 1332
698 Ga0501033_0528138 3300049570 Bacteria 815
699 Ga0501034_0526527 3300049571 Bacteria 1093
700 Ga0501034_1522222 3300049571 Bacteria 543
701 Ga0501036_0003802 3300049572 Bacteria 12106
702 Ga0501036_0049293 3300049572 Unclassified 3566
703 Ga0501036_0070999 3300049572 Bacteria 2944
704 Ga0501036_0574655 3300049572 Bacteria 936
705 Ga0501036_0616944 3300049572 Bacteria 899
706 Ga0501036_0716741 3300049572 Bacteria 826
707 Ga0501036_1314484 3300049572 Bacteria 587
708 Ga0501037_0011638 3300049573 Bacteria 6478
709 Ga0501037_0087438 3300049573 Bacteria 2256
710 Ga0501037_0162525 3300049573 Bacteria 1591
711 Ga0501037_0191565 3300049573 Unclassified 1447
712 Ga0501037_0943757 3300049573 Bacteria 564
713 Ga0501038_0024543 3300049574 Bacteria 5378
714 Ga0501038_0099268 3300049574 Bacteria 2427
715 Ga0501038_0191655 3300049574 Unclassified 1644
716 Ga0501038_0627815 3300049574 Unclassified 811
717 Ga0501039_0001587 3300049575 Bacteria 16735
718 Ga0501039_0046639 3300049575 Bacteria 3348
719 Ga0501039_0284594 3300049575 Unclassified 1299
720 Ga0501039_1395971 3300049575 Bacteria 539
721 Ga0501039_1601285 3300049575 Unclassified 500
722 Ga0501040_0001849 3300049576 Bacteria 13579
723 Ga0501040_0006605 3300049576 Bacteria 7530
724 Ga0501040_0007050 3300049576 Bacteria 7283
725 Ga0501040_0201596 3300049576 Bacteria 1413
726 Ga0501040_0255459 3300049576 Bacteria 1250
727 Ga0501040_0274463 3300049576 Bacteria 1204
728 Ga0501040_0490460 3300049576 Unclassified 885
729 Ga0501040_0575427 3300049576 Bacteria 813
730 Ga0501040_1389354 3300049576 Unclassified 510
731 Ga0501040_1423190 3300049576 Bacteria 503
732 Ga0501041_0000126 3300049577 Bacteria 32480
733 Ga0501041_0001670 3300049577 Bacteria 12422
734 Ga0501041_0017973 3300049577 Bacteria 4208
735 Ga0501041_0040945 3300049577 Bacteria 2813
736 Ga0501041_0139253 3300049577 Bacteria 1513
737 Ga0501041_0311314 3300049577 Bacteria 993
738 Ga0501041_0639683 3300049577 Bacteria 680
739 Ga0501041_0674159 3300049577 Unclassified 661
740 Ga0501041_1062212 3300049577 Unclassified 521
741 Ga0501042_0001273 3300049578 Bacteria 14687
742 Ga0501042_0019064 3300049578 Bacteria 4761
743 Ga0501042_0194033 3300049578 Bacteria 1465
744 Ga0501042_0465461 3300049578 Bacteria 917
745 Ga0501042_0835866 3300049578 Bacteria 670
746 Ga0501042_1252792 3300049578 Bacteria 541
747 Ga0501043_0057159 3300049579 Bacteria 3064
748 Ga0501043_0129544 3300049579 Bacteria 1977
749 Ga0501043_0374372 3300049579 Unclassified 1079
750 Ga0501043_0428343 3300049579 Bacteria 997
751 Ga0501043_0975736 3300049579 Bacteria 604
752 Ga0501046_0007595 3300049580 Bacteria 9509
753 Ga0501046_0020390 3300049580 Bacteria 5483
754 Ga0501046_0165187 3300049580 Bacteria 1663
755 Ga0501046_0185543 3300049580 Bacteria 1553
756 Ga0501046_0321118 3300049580 Bacteria 1128
757 Ga0501046_0491318 3300049580 Unclassified 880
758 Ga0501046_0501039 3300049580 Bacteria 870
759 Ga0501046_0569622 3300049580 Unclassified 806
760 Ga0501046_0694509 3300049580 Bacteria 717
761 Ga0501048_0003443 3300049582 Bacteria 12024
762 Ga0501048_0005073 3300049582 Bacteria 10033
763 Ga0501048_0196471 3300049582 Bacteria 1430
764 Ga0501048_0498899 3300049582 Bacteria 873
765 Ga0501048_0733131 3300049582 Bacteria 710
766 Ga0501048_0995298 3300049582 Bacteria 603
767 Ga0501067_0048810 3300049583 Bacteria 2347
768 Ga0501067_0226838 3300049583 Bacteria 1040
769 Ga0501067_0313762 3300049583 Bacteria 873
770 Ga0501068_0032984 3300049584 Bacteria 3082
771 Ga0501068_0036095 3300049584 Unclassified 2954
772 Ga0501068_0257606 3300049584 Unclassified 1112
773 Ga0501068_0422328 3300049584 Bacteria 861
774 Ga0501068_0721357 3300049584 Bacteria 652
775 Ga0501068_1102038 3300049584 Bacteria 525
776 Ga0501069_0097436 3300049585 Unclassified 1667
777 Ga0501069_0242128 3300049585 Bacteria 1051
778 Ga0501070_0045021 3300049586 Unclassified 3671
779 Ga0501070_0403331 3300049586 Unclassified 1105
780 Ga0501071_0000363 3300049587 Bacteria 22256
781 Ga0501071_0000968 3300049587 Bacteria 15682
782 Ga0501071_0079153 3300049587 Unclassified 2402
783 Ga0501071_0094637 3300049587 Bacteria 2198
784 Ga0501071_0104036 3300049587 Bacteria 2095
785 Ga0501071_0132272 3300049587 Bacteria 1854
786 Ga0501071_0135447 3300049587 Bacteria 1832
787 Ga0501071_0262608 3300049587 Bacteria 1304
788 Ga0501071_0264791 3300049587 Bacteria 1299
789 Ga0501071_0623921 3300049587 Bacteria 829
790 Ga0501071_0793355 3300049587 Unclassified 730
791 Ga0501072_0000264 3300049588 Bacteria 38361
792 Ga0501072_0007973 3300049588 Bacteria 8038
793 Ga0501072_0009199 3300049588 Bacteria 7505
794 Ga0501072_0328060 3300049588 Bacteria 1216
795 Ga0501072_0566591 3300049588 Bacteria 896
796 Ga0501072_0761326 3300049588 Bacteria 759
797 Ga0501072_0761398 3300049588 Unclassified 759
798 Ga0501072_0867143 3300049588 Bacteria 706
799 Ga0501072_0891641 3300049588 Unclassified 695
800 Ga0501072_0983822 3300049588 Bacteria 658
801 Ga0501072_1098646 3300049588 Unclassified 619
802 Ga0501073_0016547 3300049589 Bacteria 5345
803 Ga0501073_0023845 3300049589 Unclassified 4394
804 Ga0501073_0027511 3300049589 Bacteria 4066
805 Ga0501073_0045503 3300049589 Bacteria 3091
806 Ga0501073_0158603 3300049589 Bacteria 1568
807 Ga0501074_0007641 3300049590 Bacteria 7824
808 Ga0501074_0020471 3300049590 Bacteria 4807
809 Ga0501074_0223323 3300049590 Bacteria 1341
810 Ga0501074_0247359 3300049590 Bacteria 1268
811 Ga0501075_0001885 3300049591 Bacteria 13835
812 Ga0501075_0003063 3300049591 Bacteria 11174
813 Ga0501075_0006023 3300049591 Bacteria 8313
814 Ga0501075_0029253 3300049591 Bacteria 4073
815 Ga0501075_0107800 3300049591 Bacteria 2117
816 Ga0501075_0186776 3300049591 Bacteria 1581
817 Ga0501075_0202725 3300049591 Bacteria 1513
818 Ga0501075_0212130 3300049591 Bacteria 1477
819 Ga0501075_0316164 3300049591 Bacteria 1190
820 Ga0501075_0360006 3300049591 Unclassified 1109
821 Ga0501075_0445226 3300049591 Bacteria 988
822 Ga0501076_0000207 3300049592 Bacteria 35345
823 Ga0501076_0005590 3300049592 Bacteria 9054
824 Ga0501076_0016790 3300049592 Bacteria 5555
825 Ga0501076_0082556 3300049592 Bacteria 2580
826 Ga0501076_0236436 3300049592 Bacteria 1494
827 Ga0501076_0240290 3300049592 Bacteria 1482
828 Ga0501076_0254733 3300049592 Unclassified 1436
829 Ga0501076_0264563 3300049592 Bacteria 1408
830 Ga0501076_0265992 3300049592 Bacteria 1404
831 Ga0501076_0496162 3300049592 Bacteria 1006
832 Ga0501077_0000314 3300049593 Bacteria 28892
833 Ga0501077_0021486 3300049593 Bacteria 4084
834 Ga0501077_0419256 3300049593 Bacteria 856
835 Ga0501077_0472377 3300049593 Bacteria 803
836 Ga0501077_0792909 3300049593 Unclassified 609
837 Ga0501209_088652 3300049656 Unclassified 898
838 Ga0501216_055050 3300049660 Unclassified 790
839 Ga0501217_069065 3300049661 Unclassified 959
840 Ga0501233_073530 3300049668 Unclassified 870
841 Ga0501233_138458 3300049668 Unclassified 670
842 Ga0501249_013124 3300049679 Bacteria 1758
843 Ga0501261_039152 3300049690 Unclassified 742
844 Ga0501079_0001235 3300049741 Bacteria 17904
845 Ga0501079_0026809 3300049741 Unclassified 4418
846 Ga0501079_0044171 3300049741 Bacteria 3439
847 Ga0501079_0058803 3300049741 Bacteria 2967
848 Ga0501079_0120529 3300049741 Bacteria 2040
849 Ga0501079_0124336 3300049741 Unclassified 2006
850 Ga0501079_0154684 3300049741 Bacteria 1787
851 Ga0501079_0435595 3300049741 Bacteria 1029
852 Ga0501079_0928699 3300049741 Bacteria 685
853 Ga0501080_0002643 3300049742 Bacteria 15670
854 Ga0501080_0032378 3300049742 Bacteria 4876
855 Ga0501080_0181094 3300049742 Bacteria 1939
856 Ga0501080_0187602 3300049742 Bacteria 1901
857 Ga0501080_0196114 3300049742 Unclassified 1854
858 Ga0501080_0535560 3300049742 Bacteria 1044
859 Ga0501080_0915466 3300049742 Bacteria 764
860 Ga0501080_1481701 3300049742 Bacteria 577
861 Ga0501080_1815333 3300049742 Bacteria 512
862 Ga0501081_0000221 3300049743 Bacteria 28481
863 Ga0501081_0010798 3300049743 Bacteria 5965
864 Ga0501081_0013142 3300049743 Bacteria 5445
865 Ga0501081_0022079 3300049743 Bacteria 4256
866 Ga0501081_0030347 3300049743 Bacteria 3659
867 Ga0501081_0038958 3300049743 Bacteria 3250
868 Ga0501081_0049080 3300049743 Bacteria 2905
869 Ga0501081_0153958 3300049743 Bacteria 1653
870 Ga0501081_0360712 3300049743 Bacteria 1072
871 Ga0501081_0532152 3300049743 Unclassified 877
872 Ga0501081_0786200 3300049743 Bacteria 716
873 Ga0501081_0876941 3300049743 Bacteria 676
874 Ga0501081_1160178 3300049743 Unclassified 585
875 Ga0501081_1523126 3300049743 Unclassified 508
876 Ga0501081_1558536 3300049743 Unclassified 502
877 Ga0501083_0109973 3300049744 Bacteria 1812
878 Ga0501083_0164251 3300049744 Bacteria 1452
879 Ga0501083_0410369 3300049744 Bacteria 881
880 Ga0501083_0839294 3300049744 Bacteria 598
881 Ga0501083_0990812 3300049744 Bacteria 547
882 Ga0501270_002032 3300049767 Bacteria 2028
883 Ga0501035_0006599 3300049822 Bacteria 10868
884 Ga0501035_0029674 3300049822 Bacteria 4987
885 Ga0501035_0113433 3300049822 Bacteria 2374
886 Ga0501035_0283773 3300049822 Bacteria 1399
887 Ga0501035_0556673 3300049822 Bacteria 939
888 Ga0501035_1510824 3300049822 Bacteria 512
889 Ga0501044_0154134 3300049823 Bacteria 2278
890 Ga0501045_0006059 3300049824 Bacteria 8376
891 Ga0501045_0071855 3300049824 Bacteria 2547
892 Ga0501045_0108389 3300049824 Bacteria 2058
893 Ga0501045_1071445 3300049824 Unclassified 590
894 Ga0501204_041404 3300049850 Unclassified 676
895 Ga0501204_053276 3300049850 Unclassified 625
896 nmdc:mga03n38_167716_c1 3300050490 Bacteria 1116
897 nmdc:mga0k408_347570_c1 3300050493 Bacteria 884
898 nmdc:mga0k408_362634_c1 3300050493 Unclassified 863
899 nmdc:mga0k408_771762_c1 3300050493 Unclassified 561
900 nmdc:mga06z11_40382_c1 3300050494 Bacteria 2328
901 nmdc:mga06z11_800670_c1 3300050494 Bacteria 574
902 nmdc:mga05p37_100452_c1 3300050507 Bacteria 3563
903 nmdc:mga05p37_128118_c1 3300050507 Bacteria 3116
904 nmdc:mga05p37_136802_c1 3300050507 Bacteria 3003
905 nmdc:mga05p37_13856_c1 3300050507 Bacteria 9660
906 nmdc:mga05p37_1404637_c1 3300050507 Unclassified 703
907 nmdc:mga05p37_1634005_c1 3300050507 Unclassified 633
908 nmdc:mga05p37_1640144_c1 3300050507 Bacteria 631
909 nmdc:mga05p37_209730_c1 3300050507 Bacteria 2355
910 nmdc:mga05p37_398851_c1 3300050507 Bacteria 1607
911 nmdc:mga05p37_45626_c1 3300050507 Bacteria 5389
912 nmdc:mga05p37_481911_c1 3300050507 Bacteria 1428
913 nmdc:mga05p37_60337_c1 3300050507 Bacteria 1895
914 nmdc:mga05p37_680247_c1 3300050507 Bacteria 1147
915 nmdc:mga05p37_70161_c1 3300050507 Bacteria 4310
916 nmdc:mga05p37_91026_c1 3300050507 Bacteria 3759
917 nmdc:mga05p37_95797_c1 3300050507 Bacteria 3656
918 nmdc:mga05p37_97082_c1 3300050507 Bacteria 3630
919 nmdc:mga09592_11064_c1 3300050508 Bacteria 7344
920 nmdc:mga09592_1377121_c1 3300050508 Unclassified 578
921 nmdc:mga09592_1660461_c1 3300050508 Bacteria 516
922 nmdc:mga09592_70001_c1 3300050508 Unclassified 2611
923 nmdc:mga09592_763734_c1 3300050508 Unclassified 820
924 nmdc:mga0qj67_13514_c1 3300050509 Bacteria 6158
925 nmdc:mga0qj67_279683_c1 3300050509 Unclassified 1353
926 nmdc:mga0qj67_45181_c1 3300050509 Unclassified 3475
927 nmdc:mga0qj67_903026_c1 3300050509 Bacteria 696
928 nmdc:mga06r32_104565_c1 3300050510 Bacteria 2781
929 nmdc:mga06r32_1652755_c1 3300050510 Unclassified 578
930 nmdc:mga06r32_1799353_c1 3300050510 Bacteria 548
931 nmdc:mga06r32_239318_c1 3300050510 Bacteria 1803
932 nmdc:mga06r32_388396_c1 3300050510 Bacteria 1378
933 nmdc:mga06r32_41331_c1 3300050510 Bacteria 4381
934 nmdc:mga06r32_415068_c1 3300050510 Bacteria 1327
935 nmdc:mga06r32_45349_c1 3300050510 Unclassified 4190
936 nmdc:mga06r32_765383_c1 3300050510 Bacteria 928
937 nmdc:mga06r32_777421_c1 3300050510 Bacteria 919
938 nmdc:mga06r32_831646_c1 3300050510 Unclassified 883
939 nmdc:mga08y16_1182762_c1 3300050511 Bacteria 736
940 nmdc:mga08y16_177248_c1 3300050511 Bacteria 2213
941 nmdc:mga08y16_268647_c1 3300050511 Bacteria 1761
942 nmdc:mga08y16_35585_c1 3300050511 Bacteria 5229
943 nmdc:mga08y16_36816_c1 3300050511 Bacteria 5139
944 nmdc:mga08y16_368365_c1 3300050511 Bacteria 1474
945 nmdc:mga08y16_48088_c1 3300050511 Bacteria 4463
946 nmdc:mga0n895_1102_c1 3300050512 Bacteria 19755
947 nmdc:mga0n895_117509_c1 3300050512 Bacteria 2679
948 nmdc:mga0n895_15879_c1 3300050512 Bacteria 6887
949 nmdc:mga0n895_162337_c1 3300050512 Bacteria 2266
950 nmdc:mga0n895_19342_c1 3300050512 Bacteria 6328
951 nmdc:mga0n895_240070_c1 3300050512 Bacteria 1839
952 nmdc:mga0n895_260923_c1 3300050512 Bacteria 1758
953 nmdc:mga0n895_262754_c1 3300050512 Bacteria 1752
954 nmdc:mga0n895_35688_c1 3300050512 Bacteria 4796
955 nmdc:mga0n895_39199_c1 3300050512 Bacteria 4595
956 nmdc:mga0n895_44372_c1 3300050512 Bacteria 4335
957 nmdc:mga0n895_808509_c1 3300050512 Unclassified 927
958 nmdc:mga0n895_933780_c1 3300050512 Unclassified 852
959 nmdc:mga0n895_97559_c1 3300050512 Bacteria 2945
960 nmdc:mga0rr50_113414_c1 3300050513 Bacteria 2148
961 nmdc:mga0rr50_1203614_c1 3300050513 Unclassified 644
962 nmdc:mga0rr50_12062_c1 3300050513 Bacteria 5565
963 nmdc:mga0rr50_1342765_c1 3300050513 Bacteria 606
964 nmdc:mga0rr50_1567263_c1 3300050513 Unclassified 556
965 nmdc:mga0rr50_348123_c1 3300050513 Bacteria 1246
966 nmdc:mga0rr50_45429_c1 3300050513 Bacteria 3228
967 nmdc:mga0rr50_479880_c1 3300050513 Unclassified 1056
968 nmdc:mga0rr50_551665_c1 3300050513 Bacteria 981
969 nmdc:mga0rr50_55166_c1 3300050513 Bacteria 2964
970 nmdc:mga0rr50_624836_c1 3300050513 Unclassified 919
971 nmdc:mga0rr50_65422_c1 3300050513 Unclassified 2754
972 nmdc:mga0rr50_931260_c1 3300050513 Bacteria 741
973 nmdc:mga08x19_122853_c1 3300050514 Bacteria 1742
974 nmdc:mga08x19_2304_c1 3300050514 Bacteria 11604
975 nmdc:mga08x19_282957_c1 3300050514 Unclassified 1149
976 nmdc:mga08x19_462181_c1 3300050514 Bacteria 894
977 nmdc:mga08x19_563692_c1 3300050514 Bacteria 806
978 nmdc:mga08x19_653359_c1 3300050514 Bacteria 746
979 nmdc:mga08x19_7202_c1 3300050514 Bacteria 6265
980 nmdc:mga0a205_115102_c1 3300050515 Bacteria 2588
981 nmdc:mga0a205_1168693_c1 3300050515 Bacteria 617
982 nmdc:mga0a205_134401_c1 3300050515 Bacteria 2374
983 nmdc:mga0a205_1357103_c1 3300050515 Unclassified 559
984 nmdc:mga0a205_1560379_c1 3300050515 Bacteria 508
985 nmdc:mga0a205_190862_c2 3300050515 Unclassified 1112
986 nmdc:mga0a205_2541_c1 3300050515 Bacteria 16075
987 nmdc:mga0a205_25671_c1 3300050515 Bacteria 5615
988 nmdc:mga0a205_453779_c1 3300050515 Bacteria 1142
989 nmdc:mga0a205_5886_c1 3300050515 Bacteria 11045
990 nmdc:mga0a205_619_c1 3300050515 Bacteria 28239
991 nmdc:mga0a205_632852_c1 3300050515 Unclassified 922
992 nmdc:mga0a205_800022_c1 3300050515 Bacteria 791
993 Ga0500555_095205 3300053103 Bacteria 761
994 Ga0501084_0000423 3300054114 Bacteria 32674
995 Ga0501084_0031669 3300054114 Bacteria 4421
996 Ga0501084_0132103 3300054114 Bacteria 2102
997 Ga0501084_0176141 3300054114 Bacteria 1805
998 Ga0501084_0231795 3300054114 Bacteria 1559
999 Ga0501084_0403357 3300054114 Bacteria 1155
1000 Ga0501084_0469119 3300054114 Bacteria 1064
1001 Ga0501084_0653993 3300054114 Bacteria 887
1002 Ga0501084_0962485 3300054114 Unclassified 718
1003 Ga0501084_1443719 3300054114 Bacteria 576
1004 Ga0501084_1606690 3300054114 Unclassified 543
1005 Ga0590071_036073 3300059421 Bacteria 1185
1006 Ga0590074_014850 3300059423 Bacteria 1319
1007 Ga0590075_101977 3300059424 Unclassified 748
1008 Ga0501082_0000318 3300060353 Bacteria 42881
1009 Ga0501082_0064814 3300060353 Bacteria 3146
1010 Ga0501082_0090453 3300060353 Bacteria 2642
1011 Ga0501082_0152016 3300060353 Bacteria 2011
1012 Ga0501082_0238855 3300060353 Bacteria 1581
1013 Ga0501082_0347131 3300060353 Unclassified 1293
1014 Ga0501082_0654545 3300060353 Bacteria 919
1015 Ga0501082_0820289 3300060353 Bacteria 814
1016 Ga0501082_0890111 3300060353 Unclassified 779
1017 Ga0501082_0936805 3300060353 Unclassified 757
1018 Ga0501082_1318613 3300060353 Unclassified 630
1019 Ga0501082_1324508 3300060353 Unclassified 629
1020 Ga0501082_1547064 3300060353 Unclassified 579
1021 Ga0530510_0000344 3300061734 Bacteria 29971
1022 Ga0530510_0005891 3300061734 Bacteria 8498
1023 Ga0530510_0121852 3300061734 Bacteria 1915
1024 Ga0530510_0149282 3300061734 Bacteria 1725
1025 Ga0530510_0291122 3300061734 Bacteria 1221
1026 Ga0530510_0415732 3300061734 Bacteria 1015
1027 Ga0530510_0627277 3300061734 Bacteria 818
1028 Ga0530510_0728111 3300061734 Bacteria 756
1029 Ga0530510_0745952 3300061734 Bacteria 746
1030 Ga0530510_1155188 3300061734 Bacteria 593
1031 Ga0530510_1326045 3300061734 Unclassified 552
1032 Ga0070708_100376866
1033 MRS1b_contig_727244
1034 MBSR1b_contig_6780580
1035 JGI25165J46597_1009672
1036 JGI25405J52794_10001416
1037 Ga0058860_11767753
1038 Ga0065704_10686811
1039 Ga0065712_10002257
1040 Ga0065712_10002777
1041 Ga0065715_10013103
1042 Ga0065715_10301656
1043 Ga0065715_10394114
1044 Ga0065707_10001335
1045 Ga0065707_10171174
1046 Ga0065707_10360981
1047 Ga0065707_10467478
1048 Ga0065707_10580217
1049 Ga0065707_10816276
1050 Ga0070676_10303923
1051 Ga0070676_10654905
1052 Ga0070683_100650272
1053 Ga0070690_100152307
1054 Ga0070690_100280859
1055 Ga0070690_100684629
1056 Ga0070670_100000785
1057 Ga0070677_10060769
1058 Ga0068869_100030357
1059 Ga0068869_100833432
1060 Ga0068869_101326445
1061 Ga0070666_10018952
1062 Ga0070666_10565365
1063 Ga0070680_100131696
1064 Ga0070680_100644686
1065 Ga0070682_100801986
1066 Ga0068868_100032349
1067 Ga0070689_100153375
1068 Ga0070691_10056032
1069 Ga0070691_10317104
1070 Ga0070687_100555063
1071 Ga0070661_100019298
1072 Ga0070692_10126232
1073 Ga0070692_11373994
1074 Ga0070668_100157871
1075 Ga0070669_100007755
1076 Ga0070669_100254834
1077 Ga0070669_100395856
1078 Ga0070675_100205291
1079 Ga0070675_100233584
1080 Ga0070675_100479106
1081 Ga0070671_100045667
1082 Ga0070674_101799423
1083 Ga0070673_100200946
1084 Ga0070673_100281993
1085 Ga0070688_100134226
1086 Ga0070688_100453548
1087 Ga0070659_100311591
1088 Ga0070659_101580129
1089 Ga0070667_100394665
1090 Ga0070703_10138432
1091 Ga0070703_10155327
1092 Ga0070701_10963137
1093 Ga0070701_11204575
1094 Ga0070711_100037165
1095 Ga0070711_100773403
1096 Ga0070705_100055050
1097 Ga0070705_100127054
1098 Ga0070705_100680316
1099 Ga0070705_100735474
1100 Ga0070705_101066761
1101 Ga0070705_101365913
1102 Ga0070700_100196244
1103 Ga0070700_100930747
1104 Ga0070694_100044413
1105 Ga0070694_100082135
1106 Ga0070694_100146635
1107 Ga0070694_100437801
1108 Ga0070694_100457020
1109 Ga0070694_100911231
1110 Ga0070694_100932455
1111 Ga0070708_100353126
1112 Ga0070663_100227161
1113 Ga0070663_100236773
1114 Ga0070678_100114653
1115 Ga0070662_100185064
1116 Ga0070662_100229496
1117 Ga0070662_100374604
1118 Ga0070662_100391635
1119 Ga0070662_100408767
1120 Ga0070681_10010565
1121 Ga0070681_10018600
1122 Ga0070681_10044729
1123 Ga0068867_100087998
1124 Ga0068867_100388382
1125 Ga0070685_10225040
1126 Ga0070685_11426346
1127 Ga0070706_100029329
1128 Ga0070706_100061378
1129 Ga0070706_100630820
1130 Ga0070706_101651460
1131 Ga0070707_100052951
1132 Ga0070707_100056072
1133 Ga0070707_100202837
1134 Ga0070707_100698813
1135 Ga0070698_100005467
1136 Ga0070698_100375879
1137 Ga0070698_100451015
1138 Ga0070698_101177949
1139 Ga0070699_100021770
1140 Ga0070699_100347870
1141 Ga0070699_100735113
1142 Ga0070699_101830126
1143 Ga0070679_100120303
1144 Ga0070679_100159762
1145 Ga0070684_100404023
1146 Ga0070697_100012867
1147 Ga0070697_100046361
1148 Ga0070697_100111880
1149 Ga0070697_100445016
1150 Ga0070697_100455359
1151 Ga0070697_100558728
1152 Ga0070697_100622238
1153 Ga0068853_100141923
1154 Ga0070672_100056574
1155 Ga0070672_100113353
1156 Ga0070672_100860854
1157 Ga0070672_101967065
1158 Ga0070686_100029154
1159 Ga0070695_100378764
1160 Ga0070695_101275944
1161 Ga0070696_100036308
1162 Ga0070696_100111904
1163 Ga0070696_100187425
1164 Ga0070696_100296656
1165 Ga0070696_101553673
1166 Ga0070696_101576576
1167 Ga0070696_102016638
1168 Ga0070693_100094760
1169 Ga0070665_100138414
1170 Ga0070704_100036390
1171 Ga0070704_100301640
1172 Ga0070704_100672411
1173 Ga0070704_100869366
1174 Ga0070704_100897300
1175 Ga0070704_101264110
1176 Ga0070704_101459498
1177 Ga0068855_100376152
1178 Ga0070664_100001110
1179 Ga0068857_100084476
1180 Ga0068857_100717932
1181 Ga0068857_101223252
1182 Ga0068854_100072033
1183 Ga0068854_100290230
1184 Ga0068856_100022118
1185 Ga0070702_100152063
1186 Ga0070702_101225150
1187 Ga0068852_100411171
1188 Ga0068852_100587844
1189 Ga0068859_100017152
1190 Ga0068859_100025958
1191 Ga0068859_100238962
1192 Ga0068859_100406663
1193 Ga0068859_102416130
1194 Ga0068864_100427279
1195 Ga0068864_100501235
1196 Ga0068866_10161108
1197 Ga0068866_10279666
1198 Ga0068861_100150506
1199 Ga0068861_100477746
1200 Ga0068861_100538451
1201 Ga0068861_100607985
1202 Ga0068861_100669492
1203 Ga0068861_101843833
1204 Ga0068861_101923847
1205 Ga0068870_10176720
1206 Ga0068870_10206418
1207 Ga0068870_10355712
1208 Ga0068863_100232906
1209 Ga0068863_101637737
1210 Ga0068858_101426373
1211 Ga0068858_101557842
1212 Ga0068860_100221681
1213 Ga0068860_101059566
1214 Ga0068860_101095395
1215 Ga0068860_101673070
1216 Ga0068862_100023106
1217 Ga0068862_100506416
1218 Ga0068862_100567574
1219 Ga0068862_102131660
1220 Ga0081455_10002416
1221 Ga0081455_10147538
1222 Ga0081538_10009092
1223 Ga0081538_10253644
1224 Ga0075368_10150330
1225 Ga0075363_100123778
1226 Ga0075363_100391096
1227 Ga0075432_10035052
1228 Ga0075432_10175920
1229 Ga0070716_100035913
1230 Ga0070716_100336482
1231 Ga0070712_100069890
1232 Ga0070712_101859585
1233 Ga0075367_10024419
1234 Ga0075367_10094596
1235 Ga0075366_10190961
1236 Ga0097621_100444707
1237 Ga0097621_100792877
1238 Ga0097621_100801949
1239 Ga0075370_10318196
1240 Ga0068871_100687879
1241 Ga0075428_100001519
1242 Ga0075428_100006976
1243 Ga0075428_100014051
1244 Ga0075428_100022801
1245 Ga0075428_100101440
1246 Ga0075428_100107468
1247 Ga0075428_100181801
1248 Ga0075428_100451161
1249 Ga0075428_100453839
1250 Ga0075428_101434893
1251 Ga0075430_100005925
1252 Ga0075430_100157637
1253 Ga0075430_100259778
1254 Ga0075430_100294370
1255 Ga0075431_100001686
1256 Ga0075431_100016515
1257 Ga0075431_100044729
1258 Ga0075431_100096527
1259 Ga0075431_100107887
1260 Ga0075431_100335174
1261 Ga0075431_100375883
1262 Ga0075431_100504541
1263 Ga0075431_100676384
1264 Ga0075431_101072018
1265 Ga0075431_101072501
1266 Ga0075431_101757340
1267 Ga0075433_10000446
1268 Ga0075433_10007564
1269 Ga0075433_10023127
1270 Ga0075433_10036578
1271 Ga0075433_10083007
1272 Ga0075433_10099686
1273 Ga0075433_10421278
1274 Ga0075433_10476322
1275 Ga0075433_10897157
1276 Ga0075433_11024829
1277 Ga0075433_11026516
1278 Ga0075433_11250910
1279 Ga0075433_11612052
1280 Ga0075433_11721521
1281 Ga0075434_100001490
1282 Ga0075434_100012190
1283 Ga0075434_100016451
1284 Ga0075434_100029643
1285 Ga0075434_100043984
1286 Ga0075434_100059577
1287 Ga0075434_100064015
1288 Ga0075434_100090000
1289 Ga0075434_100107500
1290 Ga0075434_100121773
1291 Ga0075434_100327168
1292 Ga0075434_100427500
1293 Ga0075434_101406567
1294 Ga0075429_100002919
1295 Ga0075429_100038449
1296 Ga0075429_100042378
1297 Ga0075429_100128482
1298 Ga0075429_100192990
1299 Ga0075429_100705130
1300 Ga0075429_100723437
1301 Ga0068865_100409513
1302 Ga0068865_100455993
1303 Ga0068865_100547597
1304 Ga0068865_101389722
1305 Ga0075436_100010183
1306 Ga0075436_100023881
1307 Ga0075436_100033659
1308 Ga0075436_100147557
1309 Ga0075436_100210906
1310 Ga0075436_100407122
1311 Ga0075436_100443399
1312 Ga0075436_101157539
1313 Ga0097620_100017152
1314 Ga0097620_100025962
1315 Ga0097620_100238957
1316 Ga0097620_100406675
1317 Ga0097620_102415366
1318 Ga0075435_100007980
1319 Ga0075435_100010661
1320 Ga0075435_100026170
1321 Ga0075435_100064885
1322 Ga0075435_100091585
1323 Ga0075435_100146874
1324 Ga0075435_100178615
1325 Ga0075435_100288924
1326 Ga0075435_100304205
1327 Ga0075435_100373828
1328 Ga0075435_100510882
1329 Ga0075435_100865300
1330 Ga0105240_10001318
1331 Ga0105240_10278411
1332 Ga0111539_10002805
1333 Ga0111539_10002994
1334 Ga0111539_10005783
1335 Ga0111539_10063090
1336 Ga0111539_10213579
1337 Ga0111539_10428338
1338 Ga0111539_11093878
1339 Ga0111539_11130576
1340 Ga0111539_12142249
1341 Ga0105245_10111429
1342 Ga0105245_10245499
1343 Ga0114129_10013590
1344 Ga0114129_10014069
1345 Ga0114129_10050832
1346 Ga0114129_10065608
1347 Ga0114129_10079937
1348 Ga0114129_10081486
1349 Ga0114129_10171754
1350 Ga0114129_10188138
1351 Ga0114129_10189782
1352 Ga0114129_10200942
1353 Ga0114129_10209251
1354 Ga0114129_10214541
1355 Ga0114129_10235446
1356 Ga0114129_10305090
1357 Ga0114129_10369593
1358 Ga0114129_10527597
1359 Ga0114129_10840077
1360 Ga0114129_11301444
1361 Ga0114129_11510307
1362 Ga0114129_13274665
1363 Ga0105243_10058820
1364 Ga0105243_10751932
1365 Ga0105241_10005902
1366 Ga0105242_10046389
1367 Ga0105242_10229054
1368 Ga0105248_11706543
1369 Ga0105237_10018912
1370 Ga0105237_10088023
1371 Ga0105238_10085564
1372 Ga0105238_13082406
1373 Ga0105249_10109252
1374 Ga0105249_10344442
1375 Ga0105030_104565
1376 Ga0105239_10059595
1377 Ga0105239_11309653
1378 Ga0157326_1035605
1379 Ga0157338_1058064
1380 Ga0157373_10050366
1381 Ga0157371_10079616
1382 Ga0157374_10330142
1383 Ga0157378_10163906
1384 Ga0157378_10172107
1385 Ga0157378_10495747
1386 Ga0157378_10608446
1387 Ga0163162_10130481
1388 Ga0163162_10139211
1389 Ga0163162_12253508
1390 Ga0157372_10014000
1391 Ga0157375_10224655
1392 Ga0157375_10620401
1393 Ga0157514_127414
1394 Ga0163163_10044528
1395 Ga0157380_10000345
1396 Ga0157380_10003796
1397 Ga0157380_10025863
1398 Ga0157380_10653989
1399 Ga0157380_11770708
1400 Ga0157380_12043916
1401 Ga0157377_10203328
1402 Ga0157377_10387470
1403 Ga0157376_10054527
1404 Ga0157376_11720352
1405 Ga0209233_1002219
1406 Ga0207697_10005530
1407 Ga0207697_10022887
1408 Ga0207682_10038346
1409 Ga0207642_10072835
1410 Ga0207688_10022626
1411 Ga0207688_10412437
1412 Ga0207647_10164766
1413 Ga0207699_10424842
1414 Ga0207645_10000592
1415 Ga0207705_10039681
1416 Ga0207684_10002342
1417 Ga0207654_10059075
1418 Ga0207707_10001455
1419 Ga0207707_10020996
1420 Ga0207707_10343534
1421 Ga0207695_10000007
1422 Ga0207695_10485823
1423 Ga0207671_10227162
1424 Ga0207663_10065334
1425 Ga0207660_10070695
1426 Ga0207660_10439742
1427 Ga0207662_10129666
1428 Ga0207662_10367989
1429 Ga0207662_10944642
1430 Ga0207657_10014472
1431 Ga0207649_10439842
1432 Ga0207652_10095034
1433 Ga0207652_10316377
1434 Ga0207646_10003474
1435 Ga0207646_10053880
1436 Ga0207646_10307460
1437 Ga0207646_10956919
1438 Ga0207646_11061964
1439 Ga0207681_10075779
1440 Ga0207681_10089024
1441 Ga0207681_10216031
1442 Ga0207681_10415994
1443 Ga0207694_10126861
1444 Ga0207650_10001050
1445 Ga0207650_10723147
1446 Ga0207659_10041943
1447 Ga0207659_10258788
1448 Ga0207644_10030054
1449 Ga0207690_10258916
1450 Ga0207706_10010887
1451 Ga0207706_10118756
1452 Ga0207706_10301011
1453 Ga0207706_10454818
1454 Ga0207706_10640204
1455 Ga0207706_11005218
1456 Ga0207686_10321223
1457 Ga0207709_10569083
1458 Ga0207670_10007615
1459 Ga0207670_10323522
1460 Ga0207669_10033542
1461 Ga0207669_10381811
1462 Ga0207704_10304662
1463 Ga0207704_10326854
1464 Ga0207704_11247182
1465 Ga0207665_10054208
1466 Ga0207665_10291896
1467 Ga0207691_10006363
1468 Ga0207691_10852787
1469 Ga0207689_10049335
1470 Ga0207689_10408037
1471 Ga0207679_10003644
1472 Ga0207667_10872609
1473 Ga0207667_11244943
1474 Ga0207651_10212481
1475 Ga0207651_10227286
1476 Ga0207712_10372144
1477 Ga0207712_10813997
1478 Ga0207640_10309018
1479 Ga0207640_10815475
1480 Ga0207658_12133922
1481 Ga0207703_10527512
1482 Ga0207639_10574626
1483 Ga0207678_10023583
1484 Ga0207678_10254315
1485 Ga0207708_10032000
1486 Ga0207708_10415143
1487 Ga0207708_11871844
1488 Ga0207702_10089539
1489 Ga0207641_10783696
1490 Ga0207641_11569761
1491 Ga0207648_10187358
1492 Ga0207648_11166525
1493 Ga0207676_10199027
1494 Ga0207676_10464716
1495 Ga0207674_10086162
1496 Ga0207674_10115924
1497 Ga0207674_10216610
1498 Ga0207674_10808022
1499 Ga0207674_11215618
1500 Ga0207675_100175600
1501 Ga0207675_100242401
1502 Ga0207675_100538179
1503 Ga0207675_100629389
1504 Ga0207675_100672756
1505 Ga0207675_100884715
1506 Ga0207683_10019216
1507 Ga0207698_10814766
1508 Ga0209973_1046802
1509 Ga0209967_1065444
1510 Ga0209981_1052994
1511 Ga0209984_1002716
1512 Ga0210000_1065529
1513 Ga0209982_1042920
1514 Ga0209970_1003676
1515 Ga0209970_1061889
1516 Ga0209970_1068062
1517 Ga0210002_1036544
1518 Ga0209983_1007745
1519 Ga0209971_1003655
1520 Ga0209966_1046331
1521 Ga0209998_10144612
1522 Ga0209998_10197636
1523 Ga0209974_10000812
1524 Ga0209974_10005290
1525 Ga0207428_10029894
1526 Ga0207428_10098398
1527 Ga0207428_10133763
1528 Ga0207428_10288858
1529 Ga0207428_10300797
1530 Ga0268266_11211368
1531 Ga0268265_10092376
1532 Ga0268265_10282736
1533 Ga0268265_10337835
1534 Ga0268265_11402766
1535 Ga0268265_11795737
1536 Ga0268264_11066622
1537 Ga0307515_10000005
1538 Ga0265760_10144607
1539 Ga0307408_100055613
1540 Ga0307408_100057239
1541 Ga0307408_100061859
1542 Ga0307408_100216838
1543 Ga0316575_10187384
1544 Ga0316575_10480600
1545 Ga0316576_10131305
1546 Ga0316578_10176869
1547 Ga0307405_10001828
1548 Ga0307405_10173807
1549 Ga0307405_10428643
1550 Ga0316577_10001492
1551 Ga0316577_10113086
1552 Ga0316577_10609810
1553 Ga0307413_10050614
1554 Ga0307413_10106361
1555 Ga0307413_11114037
1556 Ga0307413_11639450
1557 Ga0307413_11688129
1558 Ga0307410_10018291
1559 Ga0307410_10071739
1560 Ga0307410_10121841
1561 Ga0307410_10153004
1562 Ga0307410_10280269
1563 Ga0307410_10789378
1564 Ga0307406_10013857
1565 Ga0307406_10067687
1566 Ga0307406_10075308
1567 Ga0307406_10087995
1568 Ga0307406_10115151
1569 Ga0307407_10033925
1570 Ga0307407_10224053
1571 Ga0307407_10431336
1572 Ga0307412_10012347
1573 Ga0307412_10032667
1574 Ga0307412_10455038
1575 Ga0307409_100197333
1576 Ga0307409_100318563
1577 Ga0307409_100843253
1578 Ga0307416_100000870
1579 Ga0307416_100002835
1580 Ga0307416_100022394
1581 Ga0307416_100522170
1582 Ga0307414_10015663
1583 Ga0307414_10141205
1584 Ga0307414_10219390
1585 Ga0307414_12071670
1586 Ga0307411_10012783
1587 Ga0307411_10035882
1588 Ga0307411_10038805
1589 Ga0307411_10124439
1590 Ga0307411_10732481
1591 Ga0307411_11038631
1592 Ga0307415_100008578
1593 Ga0307415_100176437
1594 Ga0307415_100528368
1595 Ga0316585_10007701
1596 Ga0316585_10197044
1597 Ga0373926_0273974
1598 Ga0373928_0023454
1599 Ga0373940_0113852
1600 Ga0373952_0151592
1601 Ga0373932_0033741
1602 Ga0373932_0200699
1603 Ga0373932_0359884
1604 Ga0373939_0199681
1605 Ga0373939_0383867
1606 Ga0373941_0257082
1607 Ga0373943_0636497
1608 Ga0373946_0597124
1609 Ga0373955_0294038
1610 Ga0373942_0016919
1611 Ga0373942_0156579
1612 Ga0373961_0226044
1613 Ga0316574_0019000
1614 Ga0316574_0074165
1615 Ga0316574_0203524
1616 Ga0316574_0219846
1617 Ga0316574_0405148
1618 Ga0373931_0231038
1619 Ga0373931_0400519
1620 Ga0373931_0554362
1621 Ga0373935_0473823
1622 Ga0373947_0828518
1623 Ga0373937_0141992
1624 Ga0316582_0204597
1625 Ga0316582_0336742
1626 Ga0316584_0006481
1627 Ga0316584_0092710
1628 Ga0373925_0673532
1629 Ga0439453_0070827
1630 Ga0439465_0169200
1631 Ga0439431_0266577
1632 Ga0439433_0056228
1633 Ga0439441_015525
1634 Ga0439442_141863
1635 Ga0439445_0230797
1636 Ga0439432_085125
1637 Ga0439450_144857
1638 Ga0439454_025209
1639 Ga0439455_0178146
1640 Ga0439456_063877
1641 Ga0450911_019573
1642 Ga0450919_035315
1643 Ga0450920_010976
1644 Ga0450923_001196
1645 Ga0450894_022089
1646 Ga0450895_000249
1647 Ga0450895_002562
1648 Ga0450896_000566
1649 Ga0450896_001535
1650 Ga0450899_027048
1651 Ga0450900_045104
1652 Ga0450889_028602
1653 Ga0450907_021726
1654 Ga0450907_081545
1655 Ga0439446_0001736
1656 Ga0439446_0032718
1657 Ga0439446_0269567
1658 Ga0450908_000339
1659 Ga0450908_011944
1660 Ga0439434_0006745
1661 Ga0439434_0016223
1662 Ga0439434_0054403
1663 Ga0439435_0001211
1664 Ga0439435_0098045
1665 Ga0439444_0039794
1666 Ga0439444_0154120
1667 Ga0439459_0188939
1668 Ga0439460_0006044
1669 Ga0450918_002807
1670 Ga0450918_012882
1671 Ga0451577_0143791
1672 Ga0451577_0335820
1673 Ga0451577_0466377
1674 Ga0451577_0553250
1675 Ga0451577_1219785
1676 Ga0453683_0000838
1677 Ga0453684_1436321
1678 Ga0453684_2077082
1679 Ga0453684_2508921
1680 Ga0451576_0400502
1681 Ga0451576_0889366
1682 Ga0451576_1162381
1683 Ga0451576_1806973
1684 Ga0451576_2460874
1685 Ga0495591_130220
1686 Ga0495651_0918897
1687 Ga0495580_0001653
1688 Ga0495666_0258679
1689 Ga0495586_0276890
1690 Ga0495598_0047318
1691 Ga0495621_0366297
1692 Ga0495633_0550804
1693 Ga0495647_0506333
1694 Ga0495658_0219582
1695 Ga0495658_0746864
1696 Ga0495669_0238927
1697 Ga0495669_0628287
1698 Ga0495670_0808672
1699 Ga0495674_0609793
1700 Ga0495614_0575806
1701 Ga0496102_0515298
1702 Ga0496102_1544840
1703 Ga0496104_0419058
1704 Ga0496105_0491188
1705 Ga0496106_0255995
1706 Ga0496108_0442295
1707 Ga0496109_1267791
1708 Ga0496109_1755201
1709 Ga0496110_0312477
1710 Ga0496112_0158808
1711 Ga0496112_0231942
1712 Ga0496113_0037131
1713 Ga0496113_0282630
1714 Ga0496113_0405855
1715 Ga0496117_0079841
1716 Ga0496118_0018596
1717 Ga0501294_032497
1718 Ga0501295_124214
1719 Ga0501031_0029456
1720 Ga0501031_0033561
1721 Ga0501031_1002243
1722 Ga0501032_0018093
1723 Ga0501032_0021090
1724 Ga0501032_0475352
1725 Ga0501032_0480162
1726 Ga0501032_0604241
1727 Ga0501033_0153984
1728 Ga0501033_0225704
1729 Ga0501033_0528138
1730 Ga0501034_0526527
1731 Ga0501034_1522222
1732 Ga0501036_0003802
1733 Ga0501036_0049293
1734 Ga0501036_0070999
1735 Ga0501036_0574655
1736 Ga0501036_0616944
1737 Ga0501036_0716741
1738 Ga0501036_1314484
1739 Ga0501037_0011638
1740 Ga0501037_0087438
1741 Ga0501037_0162525
1742 Ga0501037_0191565
1743 Ga0501037_0943757
1744 Ga0501038_0024543
1745 Ga0501038_0099268
1746 Ga0501038_0191655
1747 Ga0501038_0627815
1748 Ga0501039_0001587
1749 Ga0501039_0046639
1750 Ga0501039_0284594
1751 Ga0501039_1395971
1752 Ga0501039_1601285
1753 Ga0501040_0001849
1754 Ga0501040_0006605
1755 Ga0501040_0007050
1756 Ga0501040_0201596
1757 Ga0501040_0255459
1758 Ga0501040_0274463
1759 Ga0501040_0490460
1760 Ga0501040_0575427
1761 Ga0501040_1389354
1762 Ga0501040_1423190
1763 Ga0501041_0000126
1764 Ga0501041_0001670
1765 Ga0501041_0017973
1766 Ga0501041_0040945
1767 Ga0501041_0139253
1768 Ga0501041_0311314
1769 Ga0501041_0639683
1770 Ga0501041_0674159
1771 Ga0501041_1062212
1772 Ga0501042_0001273
1773 Ga0501042_0019064
1774 Ga0501042_0194033
1775 Ga0501042_0465461
1776 Ga0501042_0835866
1777 Ga0501042_1252792
1778 Ga0501043_0057159
1779 Ga0501043_0129544
1780 Ga0501043_0374372
1781 Ga0501043_0428343
1782 Ga0501043_0975736
1783 Ga0501046_0007595
1784 Ga0501046_0020390
1785 Ga0501046_0165187
1786 Ga0501046_0185543
1787 Ga0501046_0321118
1788 Ga0501046_0491318
1789 Ga0501046_0501039
1790 Ga0501046_0569622
1791 Ga0501046_0694509
1792 Ga0501048_0003443
1793 Ga0501048_0005073
1794 Ga0501048_0196471
1795 Ga0501048_0498899
1796 Ga0501048_0733131
1797 Ga0501048_0995298
1798 Ga0501067_0048810
1799 Ga0501067_0226838
1800 Ga0501067_0313762
1801 Ga0501068_0032984
1802 Ga0501068_0036095
1803 Ga0501068_0257606
1804 Ga0501068_0422328
1805 Ga0501068_0721357
1806 Ga0501068_1102038
1807 Ga0501069_0097436
1808 Ga0501069_0242128
1809 Ga0501070_0045021
1810 Ga0501070_0403331
1811 Ga0501071_0000363
1812 Ga0501071_0000968
1813 Ga0501071_0079153
1814 Ga0501071_0094637
1815 Ga0501071_0104036
1816 Ga0501071_0132272
1817 Ga0501071_0135447
1818 Ga0501071_0262608
1819 Ga0501071_0264791
1820 Ga0501071_0623921
1821 Ga0501071_0793355
1822 Ga0501072_0000264
1823 Ga0501072_0007973
1824 Ga0501072_0009199
1825 Ga0501072_0328060
1826 Ga0501072_0566591
1827 Ga0501072_0761326
1828 Ga0501072_0761398
1829 Ga0501072_0867143
1830 Ga0501072_0891641
1831 Ga0501072_0983822
1832 Ga0501072_1098646
1833 Ga0501073_0016547
1834 Ga0501073_0023845
1835 Ga0501073_0027511
1836 Ga0501073_0045503
1837 Ga0501073_0158603
1838 Ga0501074_0007641
1839 Ga0501074_0020471
1840 Ga0501074_0223323
1841 Ga0501074_0247359
1842 Ga0501075_0001885
1843 Ga0501075_0003063
1844 Ga0501075_0006023
1845 Ga0501075_0029253
1846 Ga0501075_0107800
1847 Ga0501075_0186776
1848 Ga0501075_0202725
1849 Ga0501075_0212130
1850 Ga0501075_0316164
1851 Ga0501075_0360006
1852 Ga0501075_0445226
1853 Ga0501076_0000207
1854 Ga0501076_0005590
1855 Ga0501076_0016790
1856 Ga0501076_0082556
1857 Ga0501076_0236436
1858 Ga0501076_0240290
1859 Ga0501076_0254733
1860 Ga0501076_0264563
1861 Ga0501076_0265992
1862 Ga0501076_0496162
1863 Ga0501077_0000314
1864 Ga0501077_0021486
1865 Ga0501077_0419256
1866 Ga0501077_0472377
1867 Ga0501077_0792909
1868 Ga0501209_088652
1869 Ga0501216_055050
1870 Ga0501217_069065
1871 Ga0501233_073530
1872 Ga0501233_138458
1873 Ga0501249_013124
1874 Ga0501261_039152
1875 Ga0501079_0001235
1876 Ga0501079_0026809
1877 Ga0501079_0044171
1878 Ga0501079_0058803
1879 Ga0501079_0120529
1880 Ga0501079_0124336
1881 Ga0501079_0154684
1882 Ga0501079_0435595
1883 Ga0501079_0928699
1884 Ga0501080_0002643
1885 Ga0501080_0032378
1886 Ga0501080_0181094
1887 Ga0501080_0187602
1888 Ga0501080_0196114
1889 Ga0501080_0535560
1890 Ga0501080_0915466
1891 Ga0501080_1481701
1892 Ga0501080_1815333
1893 Ga0501081_0000221
1894 Ga0501081_0010798
1895 Ga0501081_0013142
1896 Ga0501081_0022079
1897 Ga0501081_0030347
1898 Ga0501081_0038958
1899 Ga0501081_0049080
1900 Ga0501081_0153958
1901 Ga0501081_0360712
1902 Ga0501081_0532152
1903 Ga0501081_0786200
1904 Ga0501081_0876941
1905 Ga0501081_1160178
1906 Ga0501081_1523126
1907 Ga0501081_1558536
1908 Ga0501083_0109973
1909 Ga0501083_0164251
1910 Ga0501083_0410369
1911 Ga0501083_0839294
1912 Ga0501083_0990812
1913 Ga0501270_002032
1914 Ga0501035_0006599
1915 Ga0501035_0029674
1916 Ga0501035_0113433
1917 Ga0501035_0283773
1918 Ga0501035_0556673
1919 Ga0501035_1510824
1920 Ga0501044_0154134
1921 Ga0501045_0006059
1922 Ga0501045_0071855
1923 Ga0501045_0108389
1924 Ga0501045_1071445
1925 Ga0501204_041404
1926 Ga0501204_053276
1927 nmdc:mga03n38_167716_c1
1928 nmdc:mga0k408_347570_c1
1929 nmdc:mga0k408_362634_c1
1930 nmdc:mga0k408_771762_c1
1931 nmdc:mga06z11_40382_c1
1932 nmdc:mga06z11_800670_c1
1933 nmdc:mga05p37_100452_c1
1934 nmdc:mga05p37_128118_c1
1935 nmdc:mga05p37_136802_c1
1936 nmdc:mga05p37_13856_c1
1937 nmdc:mga05p37_1404637_c1
1938 nmdc:mga05p37_1634005_c1
1939 nmdc:mga05p37_1640144_c1
1940 nmdc:mga05p37_209730_c1
1941 nmdc:mga05p37_398851_c1
1942 nmdc:mga05p37_45626_c1
1943 nmdc:mga05p37_481911_c1
1944 nmdc:mga05p37_60337_c1
1945 nmdc:mga05p37_680247_c1
1946 nmdc:mga05p37_70161_c1
1947 nmdc:mga05p37_91026_c1
1948 nmdc:mga05p37_95797_c1
1949 nmdc:mga05p37_97082_c1
1950 nmdc:mga09592_11064_c1
1951 nmdc:mga09592_1377121_c1
1952 nmdc:mga09592_1660461_c1
1953 nmdc:mga09592_70001_c1
1954 nmdc:mga09592_763734_c1
1955 nmdc:mga0qj67_13514_c1
1956 nmdc:mga0qj67_279683_c1
1957 nmdc:mga0qj67_45181_c1
1958 nmdc:mga0qj67_903026_c1
1959 nmdc:mga06r32_104565_c1
1960 nmdc:mga06r32_1652755_c1
1961 nmdc:mga06r32_1799353_c1
1962 nmdc:mga06r32_239318_c1
1963 nmdc:mga06r32_388396_c1
1964 nmdc:mga06r32_41331_c1
1965 nmdc:mga06r32_415068_c1
1966 nmdc:mga06r32_45349_c1
1967 nmdc:mga06r32_765383_c1
1968 nmdc:mga06r32_777421_c1
1969 nmdc:mga06r32_831646_c1
1970 nmdc:mga08y16_1182762_c1
1971 nmdc:mga08y16_177248_c1
1972 nmdc:mga08y16_268647_c1
1973 nmdc:mga08y16_35585_c1
1974 nmdc:mga08y16_36816_c1
1975 nmdc:mga08y16_368365_c1
1976 nmdc:mga08y16_48088_c1
1977 nmdc:mga0n895_1102_c1
1978 nmdc:mga0n895_117509_c1
1979 nmdc:mga0n895_15879_c1
1980 nmdc:mga0n895_162337_c1
1981 nmdc:mga0n895_19342_c1
1982 nmdc:mga0n895_240070_c1
1983 nmdc:mga0n895_260923_c1
1984 nmdc:mga0n895_262754_c1
1985 nmdc:mga0n895_35688_c1
1986 nmdc:mga0n895_39199_c1
1987 nmdc:mga0n895_44372_c1
1988 nmdc:mga0n895_808509_c1
1989 nmdc:mga0n895_933780_c1
1990 nmdc:mga0n895_97559_c1
1991 nmdc:mga0rr50_113414_c1
1992 nmdc:mga0rr50_1203614_c1
1993 nmdc:mga0rr50_12062_c1
1994 nmdc:mga0rr50_1342765_c1
1995 nmdc:mga0rr50_1567263_c1
1996 nmdc:mga0rr50_348123_c1
1997 nmdc:mga0rr50_45429_c1
1998 nmdc:mga0rr50_479880_c1
1999 nmdc:mga0rr50_551665_c1
2000 nmdc:mga0rr50_55166_c1
2001 nmdc:mga0rr50_624836_c1
2002 nmdc:mga0rr50_65422_c1
2003 nmdc:mga0rr50_931260_c1
2004 nmdc:mga08x19_122853_c1
2005 nmdc:mga08x19_2304_c1
2006 nmdc:mga08x19_282957_c1
2007 nmdc:mga08x19_462181_c1
2008 nmdc:mga08x19_563692_c1
2009 nmdc:mga08x19_653359_c1
2010 nmdc:mga08x19_7202_c1
2011 nmdc:mga0a205_115102_c1
2012 nmdc:mga0a205_1168693_c1
2013 nmdc:mga0a205_134401_c1
2014 nmdc:mga0a205_1357103_c1
2015 nmdc:mga0a205_1560379_c1
2016 nmdc:mga0a205_190862_c2
2017 nmdc:mga0a205_2541_c1
2018 nmdc:mga0a205_25671_c1
2019 nmdc:mga0a205_453779_c1
2020 nmdc:mga0a205_5886_c1
2021 nmdc:mga0a205_619_c1
2022 nmdc:mga0a205_632852_c1
2023 nmdc:mga0a205_800022_c1
2024 Ga0500555_095205
2025 Ga0501084_0000423
2026 Ga0501084_0031669
2027 Ga0501084_0132103
2028 Ga0501084_0176141
2029 Ga0501084_0231795
2030 Ga0501084_0403357
2031 Ga0501084_0469119
2032 Ga0501084_0653993
2033 Ga0501084_0962485
2034 Ga0501084_1443719
2035 Ga0501084_1606690
2036 Ga0590071_036073
2037 Ga0590074_014850
2038 Ga0590075_101977
2039 Ga0501082_0000318
2040 Ga0501082_0064814
2041 Ga0501082_0090453
2042 Ga0501082_0152016
2043 Ga0501082_0238855
2044 Ga0501082_0347131
2045 Ga0501082_0654545
2046 Ga0501082_0820289
2047 Ga0501082_0890111
2048 Ga0501082_0936805
2049 Ga0501082_1318613
2050 Ga0501082_1324508
2051 Ga0501082_1547064
2052 Ga0530510_0000344
2053 Ga0530510_0005891
2054 Ga0530510_0121852
2055 Ga0530510_0149282
2056 Ga0530510_0291122
2057 Ga0530510_0415732
2058 Ga0530510_0627277
2059 Ga0530510_0728111
2060 Ga0530510_0745952
2061 Ga0530510_1155188
2062 Ga0530510_1326045

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

5

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.9111 1 81
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9028 1 81
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.9007 1 81
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8943 2 78
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8925 1 81
ID Description Score Start End Superfamily
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9437 4 78 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9376 1 81 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9201 4 78 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8989 1 81 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8944 2 78 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A534V2P4-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 1.003 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A7C3JJG2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9964 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A2V7VPH6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9672 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A7C2Y5L6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9662 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A7C4IJF8-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9657 1 81 GO:0000166
GO:0006777
GO:1990133

Map