F488580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 430 | 1028 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0067146|Ga0395898_0067146_2042_2581 |
| Length | 179 |
| Sequence | MAKTSKPKKKKAPAKTAVKKPRGAKRAGKATPLFTIGYEQAKPAAVMKELEAAKIDLVVDTRAVAASRRPGFSKRQLSASLVEAGIGYVHLQKLGTPAEGRQAARAGDRDTLMRVYDAHINKPEPQAELGKLVSLIKSGKRIALLCYCRDPKTCHRSQIVKRVKARLPLEVENLIPPLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 139 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 140 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 141 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 142 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 143 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 161 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 245 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 248 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 249 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 271 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 290 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 293 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 298 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 299 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 305 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 374 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 382 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 383 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 384 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 385 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 386 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 387 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 388 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 412 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 430 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0 |
| Rhizoplane | 6.41 |
| Rhizosphere | 91.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_7410661 | 2162886011 | Bacteria | 821 |
| 2 | 2214756332 | 2209111006 | Bacteria | 3109 |
| 3 | ARSoilYngRDRAFT_c00187 | 3300000042 | Bacteria | 10438 |
| 4 | ARcpr5yngRDRAFT_c000626 | 3300000043 | Bacteria | 4432 |
| 5 | ARSoilOldRDRAFT_c000105 | 3300000044 | Bacteria | 15779 |
| 6 | ARCol0oldRDRAFT_c00945 | 3300000045 | Bacteria | 2244 |
| 7 | ARCol0yngRDRAFT_1000034 | 3300000652 | Bacteria | 23733 |
| 8 | JGI24736J21556_1020600 | 3300001904 | Bacteria | 1035 |
| 9 | JGI24741J21665_1018201 | 3300001915 | Bacteria | 1125 |
| 10 | JGI24746J21847_1001098 | 3300001977 | Bacteria | 4254 |
| 11 | JGI24739J22299_10000164 | 3300001989 | Bacteria | 21825 |
| 12 | JGI24737J22298_10001508 | 3300001990 | Bacteria | 8287 |
| 13 | JGI24737J22298_10001579 | 3300001990 | Bacteria | 8106 |
| 14 | JGI24743J22301_10012313 | 3300001991 | Bacteria | 1554 |
| 15 | JGI24750J21931_1000344 | 3300002070 | Bacteria | 7887 |
| 16 | JGI24745J21846_1001611 | 3300002073 | Bacteria | 2215 |
| 17 | JGI24738J21930_10000112 | 3300002075 | Bacteria | 19038 |
| 18 | JGI24749J21850_1000411 | 3300002076 | Bacteria | 6398 |
| 19 | JGI24744J21845_10024671 | 3300002077 | Bacteria | 1175 |
| 20 | JGI24035J26624_1000107 | 3300002126 | Bacteria | 7155 |
| 21 | JGI24034J26672_10001485 | 3300002239 | Bacteria | 3118 |
| 22 | JGI24742J22300_10000359 | 3300002244 | Bacteria | 6705 |
| 23 | JGI24751J29686_10062096 | 3300002459 | Bacteria | 769 |
| 24 | JGI24751J29686_10092099 | 3300002459 | Unclassified | 631 |
| 25 | JGI25406J46586_10033300 | 3300003203 | Bacteria | 1904 |
| 26 | JGI26128J50194_1007301 | 3300003347 | Unclassified | 712 |
| 27 | Ga0065712_10071820 | 3300005290 | Bacteria | 5036 |
| 28 | Ga0065712_10098339 | 3300005290 | Bacteria | 2122 |
| 29 | Ga0065712_10615400 | 3300005290 | Bacteria | 569 |
| 30 | Ga0065715_10001049 | 3300005293 | Bacteria | 8311 |
| 31 | Ga0065715_10001550 | 3300005293 | Bacteria | 6014 |
| 32 | Ga0065715_10208859 | 3300005293 | Bacteria | 1317 |
| 33 | Ga0065707_10123077 | 3300005295 | Bacteria | 2073 |
| 34 | Ga0070658_10115505 | 3300005327 | Bacteria | 2227 |
| 35 | Ga0070676_10000755 | 3300005328 | Bacteria | 15911 |
| 36 | Ga0070676_10236745 | 3300005328 | Bacteria | 1212 |
| 37 | Ga0070683_100000376 | 3300005329 | Bacteria | 31004 |
| 38 | Ga0070683_100105366 | 3300005329 | Bacteria | 2658 |
| 39 | Ga0070683_100617469 | 3300005329 | Unclassified | 1038 |
| 40 | Ga0070690_100001711 | 3300005330 | Bacteria | 11573 |
| 41 | Ga0070690_100006546 | 3300005330 | Bacteria | 6613 |
| 42 | Ga0070690_100221375 | 3300005330 | Bacteria | 1326 |
| 43 | Ga0070670_100235031 | 3300005331 | Bacteria | 1595 |
| 44 | Ga0070670_100577328 | 3300005331 | Bacteria | 1005 |
| 45 | Ga0070670_100665518 | 3300005331 | Bacteria | 935 |
| 46 | Ga0070677_10001502 | 3300005333 | Bacteria | 7381 |
| 47 | Ga0068869_100000523 | 3300005334 | Bacteria | 21387 |
| 48 | Ga0068869_100661514 | 3300005334 | Bacteria | 888 |
| 49 | Ga0070666_10001839 | 3300005335 | Bacteria | 12930 |
| 50 | Ga0070666_10006461 | 3300005335 | Bacteria | 7206 |
| 51 | Ga0070680_100007212 | 3300005336 | Bacteria | 8473 |
| 52 | Ga0070680_100102774 | 3300005336 | Bacteria | 2374 |
| 53 | Ga0070680_100124334 | 3300005336 | Bacteria | 2155 |
| 54 | Ga0070680_101282681 | 3300005336 | Bacteria | 634 |
| 55 | Ga0070682_100000141 | 3300005337 | Bacteria | 57251 |
| 56 | Ga0070682_100010911 | 3300005337 | Bacteria | 5176 |
| 57 | Ga0070682_100308753 | 3300005337 | Bacteria | 1164 |
| 58 | Ga0070682_100466906 | 3300005337 | Bacteria | 970 |
| 59 | Ga0068868_100037520 | 3300005338 | Bacteria | 3757 |
| 60 | Ga0068868_100259259 | 3300005338 | Bacteria | 1465 |
| 61 | Ga0068868_100717048 | 3300005338 | Unclassified | 896 |
| 62 | Ga0070660_100002574 | 3300005339 | Bacteria | 12436 |
| 63 | Ga0070660_100430741 | 3300005339 | Unclassified | 1093 |
| 64 | Ga0070689_100038887 | 3300005340 | Bacteria | 3641 |
| 65 | Ga0070689_100049550 | 3300005340 | Bacteria | 3243 |
| 66 | Ga0070689_100084736 | 3300005340 | Bacteria | 2491 |
| 67 | Ga0070689_100224298 | 3300005340 | Bacteria | 1543 |
| 68 | Ga0070691_10000190 | 3300005341 | Bacteria | 20511 |
| 69 | Ga0070691_10060821 | 3300005341 | Bacteria | 1816 |
| 70 | Ga0070687_100000212 | 3300005343 | Bacteria | 20234 |
| 71 | Ga0070687_100030889 | 3300005343 | Bacteria | 2622 |
| 72 | Ga0070661_100000242 | 3300005344 | Bacteria | 44945 |
| 73 | Ga0070661_100092283 | 3300005344 | Bacteria | 2243 |
| 74 | Ga0070661_100686622 | 3300005344 | Bacteria | 833 |
| 75 | Ga0070661_101125174 | 3300005344 | Bacteria | 655 |
| 76 | Ga0070661_101250019 | 3300005344 | Bacteria | 622 |
| 77 | Ga0070692_10007147 | 3300005345 | Bacteria | 4901 |
| 78 | Ga0070669_100000593 | 3300005353 | Bacteria | 26849 |
| 79 | Ga0070675_100000165 | 3300005354 | Bacteria | 40656 |
| 80 | Ga0070671_100010995 | 3300005355 | Bacteria | 7262 |
| 81 | Ga0070671_100091245 | 3300005355 | Bacteria | 2551 |
| 82 | Ga0070671_100250203 | 3300005355 | Unclassified | 1505 |
| 83 | Ga0070671_100397850 | 3300005355 | Bacteria | 1178 |
| 84 | Ga0070674_100000450 | 3300005356 | Bacteria | 20737 |
| 85 | Ga0070673_100781188 | 3300005364 | Bacteria | 881 |
| 86 | Ga0070688_100028095 | 3300005365 | Bacteria | 3355 |
| 87 | Ga0070688_100036300 | 3300005365 | Bacteria | 2997 |
| 88 | Ga0070688_100064025 | 3300005365 | Bacteria | 2332 |
| 89 | Ga0070659_100000988 | 3300005366 | Bacteria | 20880 |
| 90 | Ga0070659_100016224 | 3300005366 | Bacteria | 5590 |
| 91 | Ga0070659_100965221 | 3300005366 | Unclassified | 747 |
| 92 | Ga0070667_100000759 | 3300005367 | Bacteria | 30677 |
| 93 | Ga0070667_100084445 | 3300005367 | Bacteria | 2721 |
| 94 | Ga0070703_10006259 | 3300005406 | Bacteria | 3335 |
| 95 | Ga0070709_10003620 | 3300005434 | Bacteria | 8296 |
| 96 | Ga0070709_10066394 | 3300005434 | Bacteria | 2314 |
| 97 | Ga0070714_100023744 | 3300005435 | Bacteria | 5041 |
| 98 | Ga0070714_100024265 | 3300005435 | Bacteria | 4989 |
| 99 | Ga0070714_100040478 | 3300005435 | Bacteria | 3928 |
| 100 | Ga0070714_100207666 | 3300005435 | Bacteria | 1794 |
| 101 | Ga0070713_100156668 | 3300005436 | Bacteria | 2030 |
| 102 | Ga0070713_100190763 | 3300005436 | Bacteria | 1846 |
| 103 | Ga0070713_100681284 | 3300005436 | Bacteria | 981 |
| 104 | Ga0070713_101606664 | 3300005436 | Unclassified | 631 |
| 105 | Ga0070710_10008897 | 3300005437 | Bacteria | 4900 |
| 106 | Ga0070710_10010783 | 3300005437 | Bacteria | 4495 |
| 107 | Ga0070710_10304996 | 3300005437 | Bacteria | 1040 |
| 108 | Ga0070710_10360499 | 3300005437 | Bacteria | 965 |
| 109 | Ga0070701_10000103 | 3300005438 | Bacteria | 24021 |
| 110 | Ga0070711_100122379 | 3300005439 | Bacteria | 1926 |
| 111 | Ga0070711_100231133 | 3300005439 | Bacteria | 1442 |
| 112 | Ga0070711_100277590 | 3300005439 | Bacteria | 1324 |
| 113 | Ga0070711_100357520 | 3300005439 | Unclassified | 1175 |
| 114 | Ga0070705_100029576 | 3300005440 | Bacteria | 3015 |
| 115 | Ga0070705_100072916 | 3300005440 | Bacteria | 2082 |
| 116 | Ga0070705_100136287 | 3300005440 | Bacteria | 1609 |
| 117 | Ga0070700_100000364 | 3300005441 | Bacteria | 23195 |
| 118 | Ga0070694_100000880 | 3300005444 | Bacteria | 16931 |
| 119 | Ga0070694_100334790 | 3300005444 | Bacteria | 1169 |
| 120 | Ga0070708_100103778 | 3300005445 | Bacteria | 2607 |
| 121 | Ga0070663_100000417 | 3300005455 | Bacteria | 22399 |
| 122 | Ga0070663_100095890 | 3300005455 | Bacteria | 2206 |
| 123 | Ga0070663_100331488 | 3300005455 | Bacteria | 1227 |
| 124 | Ga0070678_100001012 | 3300005456 | Bacteria | 14620 |
| 125 | Ga0070678_100020403 | 3300005456 | Bacteria | 4347 |
| 126 | Ga0070678_100135201 | 3300005456 | Bacteria | 1965 |
| 127 | Ga0070678_100266982 | 3300005456 | Bacteria | 1442 |
| 128 | Ga0070662_100000796 | 3300005457 | Bacteria | 19367 |
| 129 | Ga0070662_100834181 | 3300005457 | Bacteria | 785 |
| 130 | Ga0070681_10002475 | 3300005458 | Bacteria | 16918 |
| 131 | Ga0070681_10016649 | 3300005458 | Bacteria | 7339 |
| 132 | Ga0070681_10076422 | 3300005458 | Bacteria | 3307 |
| 133 | Ga0070681_10139375 | 3300005458 | Bacteria | 2355 |
| 134 | Ga0070681_10160379 | 3300005458 | Bacteria | 2173 |
| 135 | Ga0070681_10824898 | 3300005458 | Bacteria | 845 |
| 136 | Ga0068867_100009775 | 3300005459 | Bacteria | 6759 |
| 137 | Ga0068867_100330952 | 3300005459 | Bacteria | 1265 |
| 138 | Ga0070685_10000547 | 3300005466 | Bacteria | 21062 |
| 139 | Ga0070685_10051382 | 3300005466 | Bacteria | 2383 |
| 140 | Ga0070699_100602141 | 3300005518 | Bacteria | 1002 |
| 141 | Ga0070679_100010894 | 3300005530 | Bacteria | 8638 |
| 142 | Ga0070679_100131590 | 3300005530 | Bacteria | 2483 |
| 143 | Ga0070679_100358833 | 3300005530 | Bacteria | 1405 |
| 144 | Ga0070684_100000755 | 3300005535 | Bacteria | 22399 |
| 145 | Ga0070684_100060283 | 3300005535 | Bacteria | 3318 |
| 146 | Ga0070684_100065596 | 3300005535 | Bacteria | 3186 |
| 147 | Ga0070684_100601370 | 3300005535 | Bacteria | 1022 |
| 148 | Ga0070697_100044337 | 3300005536 | Bacteria | 3602 |
| 149 | Ga0068853_100000483 | 3300005539 | Bacteria | 27159 |
| 150 | Ga0068853_100245345 | 3300005539 | Bacteria | 1642 |
| 151 | Ga0070672_100000527 | 3300005543 | Bacteria | 22399 |
| 152 | Ga0070686_100002014 | 3300005544 | Bacteria | 11269 |
| 153 | Ga0070686_100062310 | 3300005544 | Bacteria | 2413 |
| 154 | Ga0070686_100164667 | 3300005544 | Unclassified | 1564 |
| 155 | Ga0070695_100003705 | 3300005545 | Bacteria | 8902 |
| 156 | Ga0070696_100006474 | 3300005546 | Bacteria | 7828 |
| 157 | Ga0070696_100007364 | 3300005546 | Bacteria | 7349 |
| 158 | Ga0070696_100340163 | 3300005546 | Unclassified | 1159 |
| 159 | Ga0070696_100692801 | 3300005546 | Unclassified | 830 |
| 160 | Ga0070693_100000199 | 3300005547 | Bacteria | 28265 |
| 161 | Ga0070693_100030479 | 3300005547 | Bacteria | 2949 |
| 162 | Ga0070693_100103745 | 3300005547 | Bacteria | 1737 |
| 163 | Ga0070693_100295687 | 3300005547 | Bacteria | 1089 |
| 164 | Ga0070665_100207388 | 3300005548 | Bacteria | 1960 |
| 165 | Ga0070665_100278950 | 3300005548 | Bacteria | 1673 |
| 166 | Ga0070704_100022794 | 3300005549 | Bacteria | 4078 |
| 167 | Ga0068855_100004444 | 3300005563 | Bacteria | 17127 |
| 168 | Ga0068855_100020137 | 3300005563 | Bacteria | 8011 |
| 169 | Ga0068855_100031660 | 3300005563 | Bacteria | 6315 |
| 170 | Ga0068855_100235987 | 3300005563 | Bacteria | 2045 |
| 171 | Ga0068855_100284778 | 3300005563 | Bacteria | 1834 |
| 172 | Ga0070664_100000895 | 3300005564 | Bacteria | 23168 |
| 173 | Ga0070664_100124321 | 3300005564 | Bacteria | 2262 |
| 174 | Ga0070664_100285222 | 3300005564 | Bacteria | 1490 |
| 175 | Ga0070664_100739967 | 3300005564 | Bacteria | 917 |
| 176 | Ga0068857_100001816 | 3300005577 | Bacteria | 17161 |
| 177 | Ga0068857_100363630 | 3300005577 | Bacteria | 1341 |
| 178 | Ga0068857_100618475 | 3300005577 | Bacteria | 1025 |
| 179 | Ga0068854_100001666 | 3300005578 | Bacteria | 13522 |
| 180 | Ga0068856_100001538 | 3300005614 | Bacteria | 24179 |
| 181 | Ga0068856_100164360 | 3300005614 | Bacteria | 2230 |
| 182 | Ga0068856_100449012 | 3300005614 | Bacteria | 1310 |
| 183 | Ga0070702_100001415 | 3300005615 | Bacteria | 9801 |
| 184 | Ga0068852_100002972 | 3300005616 | Bacteria | 11773 |
| 185 | Ga0068852_100079588 | 3300005616 | Bacteria | 2903 |
| 186 | Ga0068852_100110846 | 3300005616 | Bacteria | 2494 |
| 187 | Ga0068852_100514371 | 3300005616 | Bacteria | 1194 |
| 188 | Ga0068859_100013486 | 3300005617 | Bacteria | 8195 |
| 189 | Ga0068859_100173949 | 3300005617 | Bacteria | 2235 |
| 190 | Ga0068859_100310289 | 3300005617 | Unclassified | 1671 |
| 191 | Ga0068859_101007969 | 3300005617 | Bacteria | 915 |
| 192 | Ga0068864_100001172 | 3300005618 | Bacteria | 21814 |
| 193 | Ga0068864_100018526 | 3300005618 | Bacteria | 5818 |
| 194 | Ga0068864_100210126 | 3300005618 | Bacteria | 1791 |
| 195 | Ga0068864_100276215 | 3300005618 | Bacteria | 1567 |
| 196 | Ga0068866_10003190 | 3300005718 | Bacteria | 6752 |
| 197 | Ga0068861_100005060 | 3300005719 | Bacteria | 8895 |
| 198 | Ga0068851_10108129 | 3300005834 | Bacteria | 1482 |
| 199 | Ga0068870_10000155 | 3300005840 | Bacteria | 23940 |
| 200 | Ga0068863_100000495 | 3300005841 | Bacteria | 39957 |
| 201 | Ga0068858_100000783 | 3300005842 | Bacteria | 33229 |
| 202 | Ga0068858_100049192 | 3300005842 | Bacteria | 3904 |
| 203 | Ga0068858_100112198 | 3300005842 | Bacteria | 2546 |
| 204 | Ga0068860_100024037 | 3300005843 | Bacteria | 5891 |
| 205 | Ga0068860_100745695 | 3300005843 | Bacteria | 991 |
| 206 | Ga0068862_100020432 | 3300005844 | Bacteria | 5532 |
| 207 | Ga0068862_100445539 | 3300005844 | Bacteria | 1220 |
| 208 | Ga0068862_101152857 | 3300005844 | Bacteria | 772 |
| 209 | Ga0081455_10000204 | 3300005937 | Bacteria | 75793 |
| 210 | Ga0081455_10242172 | 3300005937 | Bacteria | 1325 |
| 211 | Ga0081539_10004321 | 3300005985 | Bacteria | 15860 |
| 212 | Ga0070717_10006465 | 3300006028 | Bacteria | 8622 |
| 213 | Ga0070717_10423517 | 3300006028 | Bacteria | 1198 |
| 214 | Ga0075432_10147364 | 3300006058 | Unclassified | 902 |
| 215 | Ga0070715_10029891 | 3300006163 | Bacteria | 2198 |
| 216 | Ga0070716_100003033 | 3300006173 | Bacteria | 7836 |
| 217 | Ga0070716_100548250 | 3300006173 | Bacteria | 862 |
| 218 | Ga0070716_100706632 | 3300006173 | Unclassified | 771 |
| 219 | Ga0070712_100254997 | 3300006175 | Bacteria | 1403 |
| 220 | Ga0070712_100269137 | 3300006175 | Bacteria | 1368 |
| 221 | Ga0070712_100562458 | 3300006175 | Bacteria | 962 |
| 222 | Ga0070712_101002837 | 3300006175 | Unclassified | 723 |
| 223 | Ga0075367_10216870 | 3300006178 | Bacteria | 1197 |
| 224 | Ga0075366_10008368 | 3300006195 | Bacteria | 5747 |
| 225 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 226 | Ga0097621_100021075 | 3300006237 | Bacteria | 5034 |
| 227 | Ga0097621_100048453 | 3300006237 | Bacteria | 3447 |
| 228 | Ga0068871_100000034 | 3300006358 | Bacteria | 71462 |
| 229 | Ga0068871_100030893 | 3300006358 | Bacteria | 4221 |
| 230 | Ga0068871_100059648 | 3300006358 | Bacteria | 3109 |
| 231 | Ga0075428_100381795 | 3300006844 | Bacteria | 1510 |
| 232 | Ga0075428_101007026 | 3300006844 | Bacteria | 882 |
| 233 | Ga0075430_100005590 | 3300006846 | Bacteria | 10623 |
| 234 | Ga0075431_100004052 | 3300006847 | Bacteria | 14278 |
| 235 | Ga0075433_10000774 | 3300006852 | Bacteria | 21997 |
| 236 | Ga0075433_10009145 | 3300006852 | Bacteria | 7912 |
| 237 | Ga0075433_10267078 | 3300006852 | Bacteria | 1516 |
| 238 | Ga0075434_100001700 | 3300006871 | Bacteria | 18837 |
| 239 | Ga0075434_100005910 | 3300006871 | Bacteria | 11193 |
| 240 | Ga0075434_100061647 | 3300006871 | Bacteria | 3732 |
| 241 | Ga0075434_100234596 | 3300006871 | Bacteria | 1854 |
| 242 | Ga0075434_100944090 | 3300006871 | Bacteria | 877 |
| 243 | Ga0075429_100007130 | 3300006880 | Bacteria | 9709 |
| 244 | Ga0068865_100000230 | 3300006881 | Bacteria | 31147 |
| 245 | Ga0068865_100162809 | 3300006881 | Bacteria | 1703 |
| 246 | Ga0068865_100951326 | 3300006881 | Bacteria | 750 |
| 247 | Ga0075436_100085251 | 3300006914 | Bacteria | 2193 |
| 248 | Ga0075436_100093945 | 3300006914 | Bacteria | 2086 |
| 249 | Ga0075436_100264830 | 3300006914 | Bacteria | 1226 |
| 250 | Ga0097620_100013487 | 3300006931 | Bacteria | 8195 |
| 251 | Ga0097620_100173947 | 3300006931 | Bacteria | 2235 |
| 252 | Ga0097620_100310281 | 3300006931 | Unclassified | 1671 |
| 253 | Ga0097620_101007933 | 3300006931 | Bacteria | 915 |
| 254 | Ga0075435_100054003 | 3300007076 | Bacteria | 3242 |
| 255 | Ga0075435_100300755 | 3300007076 | Bacteria | 1372 |
| 256 | Ga0105251_10009243 | 3300009011 | Bacteria | 5842 |
| 257 | Ga0105250_10055797 | 3300009092 | Bacteria | 1585 |
| 258 | Ga0105240_10101227 | 3300009093 | Bacteria | 3505 |
| 259 | Ga0105240_10398388 | 3300009093 | Bacteria | 1551 |
| 260 | Ga0111539_10000932 | 3300009094 | Bacteria | 38323 |
| 261 | Ga0111539_10002162 | 3300009094 | Bacteria | 26296 |
| 262 | Ga0111539_10010377 | 3300009094 | Bacteria | 11726 |
| 263 | Ga0111539_11341449 | 3300009094 | Bacteria | 830 |
| 264 | Ga0105245_10000258 | 3300009098 | Bacteria | 50464 |
| 265 | Ga0105245_10152565 | 3300009098 | Bacteria | 2186 |
| 266 | Ga0105245_11023069 | 3300009098 | Bacteria | 871 |
| 267 | Ga0105245_11211651 | 3300009098 | Bacteria | 803 |
| 268 | Ga0105245_11634296 | 3300009098 | Unclassified | 696 |
| 269 | Ga0105247_10002128 | 3300009101 | Bacteria | 13684 |
| 270 | Ga0105247_10038860 | 3300009101 | Bacteria | 2907 |
| 271 | Ga0114129_10207007 | 3300009147 | Bacteria | 2654 |
| 272 | Ga0114129_10234184 | 3300009147 | Bacteria | 2472 |
| 273 | Ga0105243_10000846 | 3300009148 | Bacteria | 29054 |
| 274 | Ga0105243_10065468 | 3300009148 | Bacteria | 2919 |
| 275 | Ga0105243_10247884 | 3300009148 | Bacteria | 1589 |
| 276 | Ga0105243_10612432 | 3300009148 | Unclassified | 1050 |
| 277 | Ga0105241_10002261 | 3300009174 | Bacteria | 14471 |
| 278 | Ga0105241_10125441 | 3300009174 | Bacteria | 2072 |
| 279 | Ga0105241_10165873 | 3300009174 | Bacteria | 1820 |
| 280 | Ga0105241_10282491 | 3300009174 | Bacteria | 1418 |
| 281 | Ga0105241_10751454 | 3300009174 | Bacteria | 894 |
| 282 | Ga0105242_10000037 | 3300009176 | Bacteria | 91293 |
| 283 | Ga0105242_10009393 | 3300009176 | Bacteria | 7503 |
| 284 | Ga0105242_10178096 | 3300009176 | Bacteria | 1874 |
| 285 | Ga0105248_10000744 | 3300009177 | Bacteria | 36599 |
| 286 | Ga0105248_10056701 | 3300009177 | Bacteria | 4395 |
| 287 | Ga0105248_10149553 | 3300009177 | Bacteria | 2635 |
| 288 | Ga0105248_10185800 | 3300009177 | Bacteria | 2342 |
| 289 | Ga0105248_10857143 | 3300009177 | Unclassified | 1025 |
| 290 | Ga0105237_10037795 | 3300009545 | Bacteria | 4878 |
| 291 | Ga0105237_10053692 | 3300009545 | Bacteria | 4041 |
| 292 | Ga0105237_10142292 | 3300009545 | Bacteria | 2393 |
| 293 | Ga0105238_10012092 | 3300009551 | Bacteria | 8698 |
| 294 | Ga0105238_10070510 | 3300009551 | Bacteria | 3494 |
| 295 | Ga0105238_10236325 | 3300009551 | Bacteria | 1805 |
| 296 | Ga0105249_10000209 | 3300009553 | Bacteria | 67037 |
| 297 | Ga0105249_10117280 | 3300009553 | Bacteria | 2525 |
| 298 | Ga0105249_10295751 | 3300009553 | Bacteria | 1622 |
| 299 | Ga0105249_11075648 | 3300009553 | Unclassified | 874 |
| 300 | Ga0099796_10003664 | 3300010159 | Bacteria | 3601 |
| 301 | Ga0105239_10001464 | 3300010375 | Bacteria | 31391 |
| 302 | Ga0105239_10012186 | 3300010375 | Bacteria | 9585 |
| 303 | Ga0105239_10488895 | 3300010375 | Bacteria | 1399 |
| 304 | Ga0105239_10710429 | 3300010375 | Unclassified | 1149 |
| 305 | Ga0105239_10835107 | 3300010375 | Bacteria | 1056 |
| 306 | Ga0105246_10002021 | 3300011119 | Bacteria | 12259 |
| 307 | Ga0105246_10062610 | 3300011119 | Bacteria | 2592 |
| 308 | Ga0105246_10482729 | 3300011119 | Bacteria | 1049 |
| 309 | Ga0105246_11317413 | 3300011119 | Bacteria | 670 |
| 310 | Ga0157320_1021615 | 3300012481 | Unclassified | 591 |
| 311 | Ga0157337_1002622 | 3300012483 | Bacteria | 1032 |
| 312 | Ga0157335_1004003 | 3300012492 | Unclassified | 972 |
| 313 | Ga0157339_1002627 | 3300012505 | Bacteria | 1231 |
| 314 | Ga0157342_1004833 | 3300012507 | Bacteria | 1215 |
| 315 | Ga0157338_1008326 | 3300012515 | Unclassified | 1003 |
| 316 | Ga0157373_10014658 | 3300013100 | Bacteria | 5748 |
| 317 | Ga0157373_10196765 | 3300013100 | Bacteria | 1421 |
| 318 | Ga0157371_10008348 | 3300013102 | Bacteria | 8263 |
| 319 | Ga0157371_10060753 | 3300013102 | Bacteria | 2679 |
| 320 | Ga0157370_10510019 | 3300013104 | Bacteria | 1104 |
| 321 | Ga0157370_11080666 | 3300013104 | Unclassified | 725 |
| 322 | Ga0157369_10532119 | 3300013105 | Bacteria | 1215 |
| 323 | Ga0157369_11142614 | 3300013105 | Bacteria | 796 |
| 324 | Ga0157374_10137924 | 3300013296 | Bacteria | 2366 |
| 325 | Ga0157374_10282802 | 3300013296 | Bacteria | 1638 |
| 326 | Ga0157374_10299961 | 3300013296 | Bacteria | 1589 |
| 327 | Ga0157378_10015202 | 3300013297 | Bacteria | 6740 |
| 328 | Ga0157378_10133927 | 3300013297 | Bacteria | 2296 |
| 329 | Ga0157378_10297844 | 3300013297 | Bacteria | 1560 |
| 330 | Ga0157378_11414961 | 3300013297 | Unclassified | 738 |
| 331 | Ga0163162_10001677 | 3300013306 | Bacteria | 20764 |
| 332 | Ga0163162_10017229 | 3300013306 | Bacteria | 7069 |
| 333 | Ga0163162_10044150 | 3300013306 | Bacteria | 4463 |
| 334 | Ga0163162_10163610 | 3300013306 | Bacteria | 2348 |
| 335 | Ga0163162_10895406 | 3300013306 | Bacteria | 1001 |
| 336 | Ga0157372_10006418 | 3300013307 | Bacteria | 12516 |
| 337 | Ga0157372_10052004 | 3300013307 | Bacteria | 4560 |
| 338 | Ga0157372_10117836 | 3300013307 | Bacteria | 3046 |
| 339 | Ga0157372_10886625 | 3300013307 | Bacteria | 1035 |
| 340 | Ga0157372_11720725 | 3300013307 | Unclassified | 721 |
| 341 | Ga0157375_10000263 | 3300013308 | Bacteria | 47730 |
| 342 | Ga0157375_10135976 | 3300013308 | Bacteria | 2582 |
| 343 | Ga0157375_10192704 | 3300013308 | Bacteria | 2193 |
| 344 | Ga0157375_11439516 | 3300013308 | Bacteria | 812 |
| 345 | Ga0163163_10037332 | 3300014325 | Bacteria | 4726 |
| 346 | Ga0163163_10074510 | 3300014325 | Bacteria | 3386 |
| 347 | Ga0163163_10316586 | 3300014325 | Bacteria | 1614 |
| 348 | Ga0163163_10317763 | 3300014325 | Bacteria | 1611 |
| 349 | Ga0163163_12934105 | 3300014325 | Bacteria | 532 |
| 350 | Ga0157380_10000294 | 3300014326 | Bacteria | 30013 |
| 351 | Ga0157380_10122182 | 3300014326 | Bacteria | 2207 |
| 352 | Ga0157380_13237656 | 3300014326 | Bacteria | 520 |
| 353 | Ga0182008_10408393 | 3300014497 | Unclassified | 731 |
| 354 | Ga0157377_10001223 | 3300014745 | Bacteria | 10958 |
| 355 | Ga0157377_10143335 | 3300014745 | Bacteria | 1470 |
| 356 | Ga0157379_10002453 | 3300014968 | Bacteria | 15540 |
| 357 | Ga0157379_10025614 | 3300014968 | Bacteria | 5242 |
| 358 | Ga0157379_10115199 | 3300014968 | Bacteria | 2417 |
| 359 | Ga0157379_10185057 | 3300014968 | Bacteria | 1882 |
| 360 | Ga0157379_10196082 | 3300014968 | Bacteria | 1825 |
| 361 | Ga0157379_10329815 | 3300014968 | Bacteria | 1394 |
| 362 | Ga0157376_10000342 | 3300014969 | Bacteria | 31043 |
| 363 | Ga0157376_10134633 | 3300014969 | Bacteria | 2210 |
| 364 | Ga0157376_10151167 | 3300014969 | Bacteria | 2094 |
| 365 | Ga0163161_10000523 | 3300017792 | Bacteria | 31363 |
| 366 | Ga0163161_10381004 | 3300017792 | Bacteria | 1127 |
| 367 | Ga0213875_10001962 | 3300021388 | Bacteria | 12731 |
| 368 | Ga0207666_1000010 | 3300025271 | Bacteria | 46973 |
| 369 | Ga0207666_1000667 | 3300025271 | Bacteria | 4112 |
| 370 | Ga0207673_1000505 | 3300025290 | Bacteria | 4125 |
| 371 | Ga0207697_10000186 | 3300025315 | Bacteria | 32405 |
| 372 | Ga0207697_10003939 | 3300025315 | Bacteria | 7220 |
| 373 | Ga0207713_1044991 | 3300025735 | Bacteria | 1807 |
| 374 | Ga0207653_10012427 | 3300025885 | Bacteria | 2658 |
| 375 | Ga0207682_10000123 | 3300025893 | Bacteria | 34953 |
| 376 | Ga0207692_10032812 | 3300025898 | Bacteria | 2498 |
| 377 | Ga0207692_10284192 | 3300025898 | Bacteria | 1002 |
| 378 | Ga0207692_11009394 | 3300025898 | Bacteria | 550 |
| 379 | Ga0207642_10005605 | 3300025899 | Bacteria | 4110 |
| 380 | Ga0207710_10002765 | 3300025900 | Bacteria | 8022 |
| 381 | Ga0207710_10006531 | 3300025900 | Bacteria | 4972 |
| 382 | Ga0207710_10257605 | 3300025900 | Bacteria | 874 |
| 383 | Ga0207688_10000340 | 3300025901 | Bacteria | 21590 |
| 384 | Ga0207688_10000889 | 3300025901 | Bacteria | 15094 |
| 385 | Ga0207688_10203185 | 3300025901 | Bacteria | 1189 |
| 386 | Ga0207680_10116477 | 3300025903 | Bacteria | 1741 |
| 387 | Ga0207647_10011455 | 3300025904 | Bacteria | 6219 |
| 388 | Ga0207647_10040398 | 3300025904 | Bacteria | 2938 |
| 389 | Ga0207685_10028132 | 3300025905 | Bacteria | 1976 |
| 390 | Ga0207685_10045413 | 3300025905 | Bacteria | 1666 |
| 391 | Ga0207699_10004580 | 3300025906 | Bacteria | 6605 |
| 392 | Ga0207645_10000023 | 3300025907 | Bacteria | 98724 |
| 393 | Ga0207645_10049222 | 3300025907 | Bacteria | 2691 |
| 394 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 395 | Ga0207684_10527420 | 3300025910 | Bacteria | 1011 |
| 396 | Ga0207654_10003445 | 3300025911 | Bacteria | 8001 |
| 397 | Ga0207654_10050507 | 3300025911 | Bacteria | 2390 |
| 398 | Ga0207707_10111063 | 3300025912 | Bacteria | 2396 |
| 399 | Ga0207707_10275817 | 3300025912 | Bacteria | 1457 |
| 400 | Ga0207707_10287031 | 3300025912 | Bacteria | 1424 |
| 401 | Ga0207695_10194754 | 3300025913 | Bacteria | 1943 |
| 402 | Ga0207695_10264455 | 3300025913 | Bacteria | 1617 |
| 403 | Ga0207695_10965032 | 3300025913 | Unclassified | 732 |
| 404 | Ga0207695_11052260 | 3300025913 | Bacteria | 693 |
| 405 | Ga0207671_10024741 | 3300025914 | Bacteria | 4510 |
| 406 | Ga0207671_10039604 | 3300025914 | Bacteria | 3489 |
| 407 | Ga0207693_10185639 | 3300025915 | Bacteria | 1637 |
| 408 | Ga0207693_10580563 | 3300025915 | Bacteria | 873 |
| 409 | Ga0207663_10128103 | 3300025916 | Bacteria | 1749 |
| 410 | Ga0207663_10514025 | 3300025916 | Unclassified | 932 |
| 411 | Ga0207663_10543919 | 3300025916 | Bacteria | 907 |
| 412 | Ga0207660_10000393 | 3300025917 | Bacteria | 28822 |
| 413 | Ga0207660_10076398 | 3300025917 | Bacteria | 2449 |
| 414 | Ga0207660_10163077 | 3300025917 | Bacteria | 1721 |
| 415 | Ga0207660_10186507 | 3300025917 | Bacteria | 1613 |
| 416 | Ga0207662_10000136 | 3300025918 | Bacteria | 35258 |
| 417 | Ga0207662_10063446 | 3300025918 | Bacteria | 2222 |
| 418 | Ga0207662_10652402 | 3300025918 | Bacteria | 735 |
| 419 | Ga0207662_10789516 | 3300025918 | Bacteria | 669 |
| 420 | Ga0207657_10002615 | 3300025919 | Bacteria | 19455 |
| 421 | Ga0207657_10320497 | 3300025919 | Bacteria | 1226 |
| 422 | Ga0207649_10000434 | 3300025920 | Bacteria | 30314 |
| 423 | Ga0207649_10306640 | 3300025920 | Bacteria | 1162 |
| 424 | Ga0207652_10001720 | 3300025921 | Bacteria | 19098 |
| 425 | Ga0207652_10076720 | 3300025921 | Bacteria | 2915 |
| 426 | Ga0207652_10127620 | 3300025921 | Bacteria | 2266 |
| 427 | Ga0207652_10272766 | 3300025921 | Bacteria | 1526 |
| 428 | Ga0207652_10569695 | 3300025921 | Bacteria | 1017 |
| 429 | Ga0207652_10824789 | 3300025921 | Bacteria | 822 |
| 430 | Ga0207681_10000273 | 3300025923 | Bacteria | 38704 |
| 431 | Ga0207681_10295327 | 3300025923 | Bacteria | 1280 |
| 432 | Ga0207694_10103091 | 3300025924 | Bacteria | 2262 |
| 433 | Ga0207650_10020018 | 3300025925 | Bacteria | 4712 |
| 434 | Ga0207650_10169465 | 3300025925 | Bacteria | 1735 |
| 435 | Ga0207650_10944291 | 3300025925 | Bacteria | 733 |
| 436 | Ga0207659_10000097 | 3300025926 | Bacteria | 51545 |
| 437 | Ga0207659_10007932 | 3300025926 | Bacteria | 6566 |
| 438 | Ga0207659_10670072 | 3300025926 | Bacteria | 887 |
| 439 | Ga0207687_10120117 | 3300025927 | Bacteria | 1964 |
| 440 | Ga0207687_10223689 | 3300025927 | Unclassified | 1483 |
| 441 | Ga0207687_10449343 | 3300025927 | Bacteria | 1069 |
| 442 | Ga0207700_10003518 | 3300025928 | Bacteria | 9127 |
| 443 | Ga0207700_10097601 | 3300025928 | Bacteria | 2335 |
| 444 | Ga0207700_10334032 | 3300025928 | Bacteria | 1316 |
| 445 | Ga0207664_10048472 | 3300025929 | Bacteria | 3341 |
| 446 | Ga0207664_10198976 | 3300025929 | Bacteria | 1728 |
| 447 | Ga0207664_10209836 | 3300025929 | Bacteria | 1685 |
| 448 | Ga0207664_10469011 | 3300025929 | Bacteria | 1125 |
| 449 | Ga0207664_11007045 | 3300025929 | Unclassified | 747 |
| 450 | Ga0207644_10003263 | 3300025931 | Bacteria | 10474 |
| 451 | Ga0207644_10005450 | 3300025931 | Bacteria | 8289 |
| 452 | Ga0207644_10557139 | 3300025931 | Unclassified | 949 |
| 453 | Ga0207690_10000962 | 3300025932 | Bacteria | 18398 |
| 454 | Ga0207690_10139249 | 3300025932 | Bacteria | 1786 |
| 455 | Ga0207706_10000867 | 3300025933 | Bacteria | 31142 |
| 456 | Ga0207706_10059941 | 3300025933 | Bacteria | 3352 |
| 457 | Ga0207706_10098568 | 3300025933 | Bacteria | 2571 |
| 458 | Ga0207686_10002591 | 3300025934 | Bacteria | 9812 |
| 459 | Ga0207686_10032046 | 3300025934 | Bacteria | 3125 |
| 460 | Ga0207686_10037852 | 3300025934 | Bacteria | 2914 |
| 461 | Ga0207709_11316769 | 3300025935 | Unclassified | 597 |
| 462 | Ga0207670_10000536 | 3300025936 | Bacteria | 20898 |
| 463 | Ga0207670_10082190 | 3300025936 | Bacteria | 2257 |
| 464 | Ga0207670_10610018 | 3300025936 | Bacteria | 897 |
| 465 | Ga0207669_10001135 | 3300025937 | Bacteria | 11370 |
| 466 | Ga0207669_10165681 | 3300025937 | Bacteria | 1567 |
| 467 | Ga0207704_10000119 | 3300025938 | Bacteria | 43208 |
| 468 | Ga0207704_10003914 | 3300025938 | Bacteria | 6770 |
| 469 | Ga0207704_10939779 | 3300025938 | Bacteria | 729 |
| 470 | Ga0207665_10000417 | 3300025939 | Bacteria | 29333 |
| 471 | Ga0207665_10015059 | 3300025939 | Bacteria | 5079 |
| 472 | Ga0207665_10144157 | 3300025939 | Bacteria | 1701 |
| 473 | Ga0207665_11128519 | 3300025939 | Bacteria | 625 |
| 474 | Ga0207691_10000544 | 3300025940 | Bacteria | 37754 |
| 475 | Ga0207691_10217984 | 3300025940 | Bacteria | 1655 |
| 476 | Ga0207711_10002468 | 3300025941 | Bacteria | 16502 |
| 477 | Ga0207711_10099011 | 3300025941 | Bacteria | 2577 |
| 478 | Ga0207711_10125801 | 3300025941 | Bacteria | 2293 |
| 479 | Ga0207711_10289961 | 3300025941 | Bacteria | 1508 |
| 480 | Ga0207711_10572557 | 3300025941 | Unclassified | 1053 |
| 481 | Ga0207689_10001743 | 3300025942 | Bacteria | 20521 |
| 482 | Ga0207689_10117899 | 3300025942 | Bacteria | 2183 |
| 483 | Ga0207689_10296686 | 3300025942 | Bacteria | 1339 |
| 484 | Ga0207661_10000785 | 3300025944 | Bacteria | 20682 |
| 485 | Ga0207661_10223394 | 3300025944 | Bacteria | 1665 |
| 486 | Ga0207661_10455646 | 3300025944 | Bacteria | 1165 |
| 487 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 488 | Ga0207679_10128429 | 3300025945 | Bacteria | 2030 |
| 489 | Ga0207679_10128984 | 3300025945 | Bacteria | 2026 |
| 490 | Ga0207679_10468933 | 3300025945 | Bacteria | 1119 |
| 491 | Ga0207679_10799771 | 3300025945 | Bacteria | 860 |
| 492 | Ga0207679_10822530 | 3300025945 | Bacteria | 847 |
| 493 | Ga0207667_10016422 | 3300025949 | Bacteria | 8368 |
| 494 | Ga0207667_10044449 | 3300025949 | Bacteria | 4706 |
| 495 | Ga0207667_10068650 | 3300025949 | Bacteria | 3690 |
| 496 | Ga0207667_10863785 | 3300025949 | Unclassified | 898 |
| 497 | Ga0207667_10955605 | 3300025949 | Bacteria | 846 |
| 498 | Ga0207651_10000083 | 3300025960 | Bacteria | 42310 |
| 499 | Ga0207651_10139913 | 3300025960 | Bacteria | 1868 |
| 500 | Ga0207712_10000471 | 3300025961 | Bacteria | 33929 |
| 501 | Ga0207712_10084342 | 3300025961 | Bacteria | 2321 |
| 502 | Ga0207712_10281977 | 3300025961 | Bacteria | 1356 |
| 503 | Ga0207712_10586101 | 3300025961 | Bacteria | 963 |
| 504 | Ga0207668_10000862 | 3300025972 | Bacteria | 18292 |
| 505 | Ga0207640_10003185 | 3300025981 | Bacteria | 8831 |
| 506 | Ga0207658_10002203 | 3300025986 | Bacteria | 14473 |
| 507 | Ga0207658_10198152 | 3300025986 | Bacteria | 1674 |
| 508 | Ga0207677_10000992 | 3300026023 | Bacteria | 15647 |
| 509 | Ga0207677_10264725 | 3300026023 | Bacteria | 1403 |
| 510 | Ga0207703_10014801 | 3300026035 | Bacteria | 6087 |
| 511 | Ga0207703_10098576 | 3300026035 | Bacteria | 2472 |
| 512 | Ga0207703_10104241 | 3300026035 | Bacteria | 2409 |
| 513 | Ga0207703_10122397 | 3300026035 | Bacteria | 2235 |
| 514 | Ga0207703_10148000 | 3300026035 | Bacteria | 2045 |
| 515 | Ga0207639_10004451 | 3300026041 | Bacteria | 9457 |
| 516 | Ga0207639_10177779 | 3300026041 | Bacteria | 1808 |
| 517 | Ga0207678_10001568 | 3300026067 | Bacteria | 21015 |
| 518 | Ga0207678_10030143 | 3300026067 | Bacteria | 4735 |
| 519 | Ga0207678_10048617 | 3300026067 | Bacteria | 3666 |
| 520 | Ga0207678_10241654 | 3300026067 | Bacteria | 1546 |
| 521 | Ga0207708_10004251 | 3300026075 | Bacteria | 10546 |
| 522 | Ga0207708_10023945 | 3300026075 | Bacteria | 4617 |
| 523 | Ga0207708_10137355 | 3300026075 | Bacteria | 1915 |
| 524 | Ga0207708_10203604 | 3300026075 | Bacteria | 1580 |
| 525 | Ga0207702_10003639 | 3300026078 | Bacteria | 13965 |
| 526 | Ga0207702_10092756 | 3300026078 | Bacteria | 2647 |
| 527 | Ga0207702_10920268 | 3300026078 | Bacteria | 867 |
| 528 | Ga0207641_10000510 | 3300026088 | Bacteria | 43699 |
| 529 | Ga0207641_10917150 | 3300026088 | Unclassified | 870 |
| 530 | Ga0207641_10959794 | 3300026088 | Unclassified | 851 |
| 531 | Ga0207648_10002351 | 3300026089 | Bacteria | 20407 |
| 532 | Ga0207648_10185015 | 3300026089 | Bacteria | 1845 |
| 533 | Ga0207648_10200614 | 3300026089 | Bacteria | 1769 |
| 534 | Ga0207676_10001371 | 3300026095 | Bacteria | 18133 |
| 535 | Ga0207676_10014152 | 3300026095 | Bacteria | 5730 |
| 536 | Ga0207676_10029204 | 3300026095 | Bacteria | 4126 |
| 537 | Ga0207676_10219149 | 3300026095 | Bacteria | 1693 |
| 538 | Ga0207676_10445788 | 3300026095 | Unclassified | 1219 |
| 539 | Ga0207674_10000608 | 3300026116 | Bacteria | 46971 |
| 540 | Ga0207674_10185416 | 3300026116 | Bacteria | 2031 |
| 541 | Ga0207674_10250096 | 3300026116 | Bacteria | 1720 |
| 542 | Ga0207674_10384519 | 3300026116 | Bacteria | 1357 |
| 543 | Ga0207675_100000805 | 3300026118 | Bacteria | 31142 |
| 544 | Ga0207683_10000082 | 3300026121 | Bacteria | 74842 |
| 545 | Ga0207683_10007216 | 3300026121 | Bacteria | 9529 |
| 546 | Ga0207683_10037275 | 3300026121 | Bacteria | 4233 |
| 547 | Ga0207683_10316409 | 3300026121 | Bacteria | 1429 |
| 548 | Ga0207683_10675933 | 3300026121 | Unclassified | 957 |
| 549 | Ga0207698_10000377 | 3300026142 | Bacteria | 25983 |
| 550 | Ga0207698_10257260 | 3300026142 | Bacteria | 1602 |
| 551 | Ga0207698_10504867 | 3300026142 | Bacteria | 1177 |
| 552 | Ga0207698_11345622 | 3300026142 | Bacteria | 729 |
| 553 | Ga0209973_1011005 | 3300027252 | Bacteria | 1079 |
| 554 | Ga0209984_1008995 | 3300027424 | Bacteria | 1263 |
| 555 | Ga0209179_1056121 | 3300027512 | Bacteria | 850 |
| 556 | Ga0210002_1001321 | 3300027617 | Bacteria | 3462 |
| 557 | Ga0209971_1054660 | 3300027682 | Bacteria | 965 |
| 558 | Ga0209966_1005107 | 3300027695 | Bacteria | 2244 |
| 559 | Ga0209998_10002579 | 3300027717 | Bacteria | 4118 |
| 560 | Ga0209813_10209987 | 3300027866 | Bacteria | 724 |
| 561 | Ga0209974_10005874 | 3300027876 | Bacteria | 4304 |
| 562 | Ga0209974_10020181 | 3300027876 | Bacteria | 2209 |
| 563 | Ga0207428_10000124 | 3300027907 | Bacteria | 105795 |
| 564 | Ga0207428_10000420 | 3300027907 | Bacteria | 52679 |
| 565 | Ga0207428_10000703 | 3300027907 | Bacteria | 38851 |
| 566 | Ga0207428_10905284 | 3300027907 | Unclassified | 623 |
| 567 | Ga0268266_10138505 | 3300028379 | Bacteria | 2182 |
| 568 | Ga0268266_10381955 | 3300028379 | Bacteria | 1329 |
| 569 | Ga0268266_10818748 | 3300028379 | Bacteria | 899 |
| 570 | Ga0268266_11644153 | 3300028379 | Bacteria | 618 |
| 571 | Ga0268265_10001170 | 3300028380 | Bacteria | 22993 |
| 572 | Ga0268265_10352587 | 3300028380 | Bacteria | 1344 |
| 573 | Ga0268264_10001878 | 3300028381 | Bacteria | 19073 |
| 574 | Ga0268264_10203260 | 3300028381 | Bacteria | 1814 |
| 575 | Ga0268264_10217943 | 3300028381 | Bacteria | 1755 |
| 576 | Ga0268264_10394554 | 3300028381 | Bacteria | 1328 |
| 577 | Ga0268264_10590759 | 3300028381 | Unclassified | 1093 |
| 578 | Ga0265337_1004750 | 3300028556 | Bacteria | 5571 |
| 579 | Ga0265338_10081076 | 3300028800 | Bacteria | 2723 |
| 580 | Ga0265338_10534682 | 3300028800 | Bacteria | 822 |
| 581 | Ga0265325_10055164 | 3300031241 | Bacteria | 2032 |
| 582 | Ga0265325_10285780 | 3300031241 | Bacteria | 739 |
| 583 | Ga0265339_10110080 | 3300031249 | Bacteria | 1425 |
| 584 | Ga0265316_10498186 | 3300031344 | Bacteria | 870 |
| 585 | Ga0316575_10055001 | 3300031665 | Bacteria | 1585 |
| 586 | Ga0316575_10068406 | 3300031665 | Bacteria | 1425 |
| 587 | Ga0316583_10000771 | 3300032133 | Bacteria | 10056 |
| 588 | Ga0373930_0001168 | 3300034816 | Bacteria | 3838 |
| 589 | Ga0373948_0000160 | 3300034817 | Bacteria | 7409 |
| 590 | Ga0373948_0010635 | 3300034817 | Unclassified | 1611 |
| 591 | Ga0373958_0001209 | 3300034819 | Bacteria | 3443 |
| 592 | Ga0373958_0003548 | 3300034819 | Bacteria | 2256 |
| 593 | Ga0373958_0004355 | 3300034819 | Bacteria | 2094 |
| 594 | Ga0373959_0002987 | 3300034820 | Bacteria | 2687 |
| 595 | Ga0373959_0008682 | 3300034820 | Bacteria | 1735 |
| 596 | Ga0373959_0012691 | 3300034820 | Unclassified | 1509 |
| 597 | Ga0373938_0000574 | 3300034957 | Bacteria | 5948 |
| 598 | Ga0373938_0030785 | 3300034957 | Bacteria | 1147 |
| 599 | Ga0373928_0002434 | 3300035084 | Bacteria | 3607 |
| 600 | Ga0373928_0005079 | 3300035084 | Bacteria | 2509 |
| 601 | Ga0373928_0019947 | 3300035084 | Unclassified | 1402 |
| 602 | Ga0373929_0005219 | 3300035085 | Bacteria | 2335 |
| 603 | Ga0373929_0024438 | 3300035085 | Bacteria | 1248 |
| 604 | Ga0373929_0036900 | 3300035085 | Unclassified | 1069 |
| 605 | Ga0373934_0088877 | 3300035086 | Bacteria | 1244 |
| 606 | Ga0373934_0145739 | 3300035086 | Bacteria | 969 |
| 607 | Ga0373940_0000069 | 3300035088 | Bacteria | 11756 |
| 608 | Ga0373940_0002640 | 3300035088 | Bacteria | 3524 |
| 609 | Ga0373940_0054586 | 3300035088 | Unclassified | 1130 |
| 610 | Ga0373949_0000870 | 3300035090 | Bacteria | 9531 |
| 611 | Ga0373949_0002073 | 3300035090 | Bacteria | 5292 |
| 612 | Ga0373951_0002636 | 3300035091 | Bacteria | 4499 |
| 613 | Ga0373951_0003101 | 3300035091 | Bacteria | 4100 |
| 614 | Ga0373951_0012104 | 3300035091 | Bacteria | 1940 |
| 615 | Ga0373952_0001400 | 3300035092 | Bacteria | 4411 |
| 616 | Ga0373952_0003512 | 3300035092 | Bacteria | 2827 |
| 617 | Ga0373952_0005360 | 3300035092 | Bacteria | 2343 |
| 618 | Ga0373923_0012915 | 3300035111 | Bacteria | 3101 |
| 619 | Ga0373923_0166864 | 3300035111 | Bacteria | 1007 |
| 620 | Ga0373923_0367730 | 3300035111 | Bacteria | 688 |
| 621 | Ga0373932_0002119 | 3300035112 | Bacteria | 5158 |
| 622 | Ga0373936_0001643 | 3300035113 | Bacteria | 8197 |
| 623 | Ga0373936_0297987 | 3300035113 | Unclassified | 727 |
| 624 | Ga0373939_0001165 | 3300035114 | Bacteria | 6436 |
| 625 | Ga0373939_0003141 | 3300035114 | Bacteria | 3883 |
| 626 | Ga0373939_0064153 | 3300035114 | Bacteria | 1178 |
| 627 | Ga0373941_0000185 | 3300035115 | Bacteria | 11732 |
| 628 | Ga0373941_0001158 | 3300035115 | Bacteria | 5499 |
| 629 | Ga0373945_0000687 | 3300035116 | Bacteria | 9768 |
| 630 | Ga0373945_0000695 | 3300035116 | Bacteria | 9737 |
| 631 | Ga0373945_0203214 | 3300035116 | Bacteria | 823 |
| 632 | Ga0373953_0001909 | 3300035117 | Bacteria | 6180 |
| 633 | Ga0373953_0006813 | 3300035117 | Bacteria | 3789 |
| 634 | Ga0373954_0004095 | 3300035118 | Bacteria | 6248 |
| 635 | Ga0373954_0004312 | 3300035118 | Bacteria | 6113 |
| 636 | Ga0373954_0008788 | 3300035118 | Bacteria | 4443 |
| 637 | Ga0373954_0016524 | 3300035118 | Bacteria | 3304 |
| 638 | Ga0373956_0004180 | 3300035119 | Bacteria | 5788 |
| 639 | Ga0373956_0031693 | 3300035119 | Bacteria | 2318 |
| 640 | Ga0373957_0004330 | 3300035120 | Bacteria | 4309 |
| 641 | Ga0373957_0006881 | 3300035120 | Bacteria | 3608 |
| 642 | Ga0373957_0139488 | 3300035120 | Bacteria | 990 |
| 643 | Ga0373960_0000288 | 3300035121 | Bacteria | 9618 |
| 644 | Ga0373960_0000314 | 3300035121 | Bacteria | 9220 |
| 645 | Ga0373960_0097115 | 3300035121 | Unclassified | 950 |
| 646 | Ga0373943_0003558 | 3300035170 | Bacteria | 7091 |
| 647 | Ga0373943_0025872 | 3300035170 | Bacteria | 2745 |
| 648 | Ga0373946_0011915 | 3300035171 | Bacteria | 3249 |
| 649 | Ga0373946_0057297 | 3300035171 | Bacteria | 1648 |
| 650 | Ga0373946_0451959 | 3300035171 | Bacteria | 654 |
| 651 | Ga0373946_0609450 | 3300035171 | Unclassified | 566 |
| 652 | Ga0373955_0000419 | 3300035172 | Bacteria | 17956 |
| 653 | Ga0373955_0014791 | 3300035172 | Bacteria | 3806 |
| 654 | Ga0373955_0126208 | 3300035172 | Bacteria | 1491 |
| 655 | Ga0373955_0244843 | 3300035172 | Bacteria | 1074 |
| 656 | Ga0373942_0007512 | 3300035207 | Bacteria | 2530 |
| 657 | Ga0373942_0189397 | 3300035207 | Unclassified | 677 |
| 658 | Ga0373961_0000636 | 3300035241 | Bacteria | 12674 |
| 659 | Ga0373961_0001288 | 3300035241 | Bacteria | 7639 |
| 660 | Ga0373961_0005944 | 3300035241 | Bacteria | 2932 |
| 661 | Ga0373961_0110901 | 3300035241 | Bacteria | 899 |
| 662 | Ga0373962_0000974 | 3300035242 | Bacteria | 6617 |
| 663 | Ga0373962_0013472 | 3300035242 | Bacteria | 2072 |
| 664 | Ga0373962_0014241 | 3300035242 | Bacteria | 2025 |
| 665 | Ga0373924_0000402 | 3300035410 | Bacteria | 13279 |
| 666 | Ga0373924_0049898 | 3300035410 | Bacteria | 1733 |
| 667 | Ga0373924_0100828 | 3300035410 | Bacteria | 1242 |
| 668 | Ga0373924_0211517 | 3300035410 | Unclassified | 856 |
| 669 | Ga0373931_0014198 | 3300035691 | Bacteria | 3889 |
| 670 | Ga0373935_0000012 | 3300035692 | Bacteria | 81961 |
| 671 | Ga0373935_0114880 | 3300035692 | Bacteria | 1791 |
| 672 | Ga0373935_0320575 | 3300035692 | Unclassified | 1099 |
| 673 | Ga0373927_0006963 | 3300035695 | Bacteria | 7676 |
| 674 | Ga0373927_0031200 | 3300035695 | Bacteria | 3475 |
| 675 | Ga0373927_0331158 | 3300035695 | Bacteria | 1003 |
| 676 | Ga0373933_0000893 | 3300035724 | Bacteria | 18249 |
| 677 | Ga0373933_0004197 | 3300035724 | Bacteria | 7942 |
| 678 | Ga0373933_0371840 | 3300035724 | Unclassified | 930 |
| 679 | Ga0373947_0002387 | 3300035725 | Bacteria | 11336 |
| 680 | Ga0373947_0013898 | 3300035725 | Bacteria | 4615 |
| 681 | Ga0373947_0106326 | 3300035725 | Bacteria | 1768 |
| 682 | Ga0373937_0000054 | 3300036401 | Bacteria | 102542 |
| 683 | Ga0373937_0036163 | 3300036401 | Bacteria | 4499 |
| 684 | Ga0373937_0084336 | 3300036401 | Bacteria | 2939 |
| 685 | Ga0373937_0260551 | 3300036401 | Bacteria | 1635 |
| 686 | Ga0373937_0334901 | 3300036401 | Unclassified | 1433 |
| 687 | Ga0373937_0626303 | 3300036401 | Bacteria | 1021 |
| 688 | Ga0373925_0000018 | 3300037068 | Bacteria | 174213 |
| 689 | Ga0373925_0149411 | 3300037068 | Bacteria | 1833 |
| 690 | Ga0373925_0374663 | 3300037068 | Bacteria | 1158 |
| 691 | Ga0373925_0532501 | 3300037068 | Bacteria | 965 |
| 692 | Ga0395899_0081389 | 3300037312 | Bacteria | 2356 |
| 693 | Ga0395900_0001369 | 3300037418 | Bacteria | 29330 |
| 694 | Ga0395900_0030158 | 3300037418 | Bacteria | 5567 |
| 695 | Ga0395898_0017006 | 3300037466 | Bacteria | 7427 |
| 696 | Ga0395898_0049455 | 3300037466 | Bacteria | 4119 |
| 697 | Ga0395898_0067146 | 3300037466 | Bacteria | 3473 |
| 698 | Ga0395905_0533525 | 3300037471 | Bacteria | 1074 |
| 699 | Ga0436364_0997377 | 3300037853 | Bacteria | 897 |
| 700 | Ga0436364_1325276 | 3300037853 | Bacteria | 58128 |
| 701 | Ga0395901_0006448 | 3300038443 | Bacteria | 11889 |
| 702 | Ga0395901_0369703 | 3300038443 | Bacteria | 1477 |
| 703 | Ga0242419_022220 | 3300038698 | Unclassified | 535 |
| 704 | Ga0242420_012183 | 3300038996 | Bacteria | 1452 |
| 705 | Ga0436365_1531855 | 3300039437 | Bacteria | 1400 |
| 706 | Ga0436365_1569518 | 3300039437 | Bacteria | 1003 |
| 707 | Ga0436363_0942778 | 3300039450 | Bacteria | 1289 |
| 708 | Ga0436362_0063504 | 3300039453 | Bacteria | 800 |
| 709 | Ga0439450_099769 | 3300042008 | Bacteria | 736 |
| 710 | Ga0439435_0002304 | 3300042436 | Bacteria | 3761 |
| 711 | Ga0439459_0060356 | 3300042438 | Bacteria | 855 |
| 712 | Ga0439464_0098059 | 3300042439 | Bacteria | 888 |
| 713 | Ga0439460_0012096 | 3300042461 | Bacteria | 2233 |
| 714 | Ga0466966_0046303 | 3300044684 | Bacteria | 2778 |
| 715 | Ga0466961_0034949 | 3300044693 | Bacteria | 3227 |
| 716 | Ga0466963_0220717 | 3300044694 | Unclassified | 1327 |
| 717 | Ga0466963_1084952 | 3300044694 | Bacteria | 563 |
| 718 | Ga0466959_0489922 | 3300045049 | Bacteria | 831 |
| 719 | Ga0451576_0309129 | 3300045051 | Unclassified | 1654 |
| 720 | Ga0466958_0038326 | 3300045836 | Bacteria | 2876 |
| 721 | Ga0466958_0191358 | 3300045836 | Bacteria | 1300 |
| 722 | Ga0466967_0732053 | 3300045976 | Bacteria | 980 |
| 723 | Ga0495617_072191 | 3300046452 | Bacteria | 1135 |
| 724 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 725 | Ga0495592_0031373 | 3300046454 | Bacteria | 4016 |
| 726 | Ga0495592_0379569 | 3300046454 | Bacteria | 900 |
| 727 | Ga0495592_0701821 | 3300046454 | Unclassified | 608 |
| 728 | Ga0495603_0025839 | 3300046455 | Bacteria | 3549 |
| 729 | Ga0495603_0041607 | 3300046455 | Bacteria | 2747 |
| 730 | Ga0495591_113022 | 3300046458 | Bacteria | 666 |
| 731 | Ga0495629_0002067 | 3300046459 | Bacteria | 15573 |
| 732 | Ga0495629_0006898 | 3300046459 | Bacteria | 8377 |
| 733 | Ga0495629_0041066 | 3300046459 | Bacteria | 3255 |
| 734 | Ga0495629_0076460 | 3300046459 | Bacteria | 2337 |
| 735 | Ga0495641_0017165 | 3300046461 | Bacteria | 3781 |
| 736 | Ga0495641_0089052 | 3300046461 | Unclassified | 1380 |
| 737 | Ga0495651_0003892 | 3300046462 | Bacteria | 11420 |
| 738 | Ga0495651_0003996 | 3300046462 | Bacteria | 11277 |
| 739 | Ga0495651_0013246 | 3300046462 | Bacteria | 6376 |
| 740 | Ga0495653_0000292 | 3300046463 | Bacteria | 40544 |
| 741 | Ga0495653_0010574 | 3300046463 | Bacteria | 7556 |
| 742 | Ga0495653_0038160 | 3300046463 | Bacteria | 3770 |
| 743 | Ga0495653_0196921 | 3300046463 | Bacteria | 1370 |
| 744 | Ga0495653_0245634 | 3300046463 | Bacteria | 1190 |
| 745 | Ga0495580_0035178 | 3300046472 | Bacteria | 3602 |
| 746 | Ga0495582_0059398 | 3300046473 | Bacteria | 2109 |
| 747 | Ga0495582_0110852 | 3300046473 | Bacteria | 1541 |
| 748 | Ga0495639_0030981 | 3300046475 | Bacteria | 2378 |
| 749 | Ga0495639_0051117 | 3300046475 | Bacteria | 1879 |
| 750 | Ga0495639_0064199 | 3300046475 | Bacteria | 1687 |
| 751 | Ga0495662_0002781 | 3300046476 | Bacteria | 8842 |
| 752 | Ga0495662_0028948 | 3300046476 | Bacteria | 2674 |
| 753 | Ga0495662_0278585 | 3300046476 | Bacteria | 823 |
| 754 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 755 | Ga0495664_0003348 | 3300046477 | Bacteria | 8717 |
| 756 | Ga0495664_0078730 | 3300046477 | Bacteria | 1974 |
| 757 | Ga0495584_0041089 | 3300046491 | Bacteria | 2335 |
| 758 | Ga0495594_0026532 | 3300046499 | Bacteria | 3117 |
| 759 | Ga0495594_0038501 | 3300046499 | Bacteria | 2611 |
| 760 | Ga0495594_0233935 | 3300046499 | Bacteria | 1047 |
| 761 | Ga0495607_0458264 | 3300046501 | Bacteria | 571 |
| 762 | Ga0495608_0000050 | 3300046511 | Bacteria | 96603 |
| 763 | Ga0495608_0009807 | 3300046511 | Bacteria | 6683 |
| 764 | Ga0495608_0071850 | 3300046511 | Bacteria | 2257 |
| 765 | Ga0495608_0092126 | 3300046511 | Bacteria | 1959 |
| 766 | Ga0495608_0715829 | 3300046511 | Bacteria | 595 |
| 767 | Ga0495618_0000045 | 3300046514 | Bacteria | 94654 |
| 768 | Ga0495618_0004751 | 3300046514 | Bacteria | 8305 |
| 769 | Ga0495618_0072201 | 3300046514 | Bacteria | 2196 |
| 770 | Ga0495618_0199829 | 3300046514 | Bacteria | 1265 |
| 771 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 772 | Ga0495628_0002046 | 3300046516 | Bacteria | 18273 |
| 773 | Ga0495628_0049119 | 3300046516 | Bacteria | 3341 |
| 774 | Ga0495628_0091598 | 3300046516 | Bacteria | 2353 |
| 775 | Ga0495630_0002190 | 3300046517 | Bacteria | 13605 |
| 776 | Ga0495630_0030402 | 3300046517 | Bacteria | 4017 |
| 777 | Ga0495630_0055331 | 3300046517 | Bacteria | 2973 |
| 778 | Ga0495631_0117810 | 3300046518 | Bacteria | 1142 |
| 779 | Ga0495637_0038624 | 3300046520 | Bacteria | 2066 |
| 780 | Ga0495644_0061346 | 3300046523 | Bacteria | 1413 |
| 781 | Ga0495663_0103796 | 3300046525 | Bacteria | 938 |
| 782 | Ga0495666_0007624 | 3300046526 | Bacteria | 5416 |
| 783 | Ga0495666_0021257 | 3300046526 | Bacteria | 3211 |
| 784 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 785 | Ga0495652_0020932 | 3300046529 | Bacteria | 5812 |
| 786 | Ga0495665_0261136 | 3300046531 | Bacteria | 890 |
| 787 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 788 | Ga0495640_0008637 | 3300046533 | Bacteria | 7984 |
| 789 | Ga0495640_0033258 | 3300046533 | Bacteria | 3665 |
| 790 | Ga0495640_0179741 | 3300046533 | Bacteria | 1348 |
| 791 | Ga0495586_0004089 | 3300046535 | Bacteria | 7817 |
| 792 | Ga0495586_0029120 | 3300046535 | Bacteria | 2956 |
| 793 | Ga0495586_0073218 | 3300046535 | Bacteria | 1874 |
| 794 | Ga0495587_0000028 | 3300046536 | Bacteria | 138663 |
| 795 | Ga0495587_0006079 | 3300046536 | Bacteria | 7876 |
| 796 | Ga0495587_0013640 | 3300046536 | Bacteria | 5105 |
| 797 | Ga0495598_0003603 | 3300046537 | Bacteria | 3303 |
| 798 | Ga0495609_0177304 | 3300046538 | Bacteria | 898 |
| 799 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 800 | Ga0495645_0343798 | 3300046543 | Bacteria | 963 |
| 801 | Ga0495622_0013106 | 3300046557 | Bacteria | 3847 |
| 802 | Ga0495622_0262309 | 3300046557 | Bacteria | 758 |
| 803 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 804 | Ga0495667_0002342 | 3300046559 | Bacteria | 12672 |
| 805 | Ga0495667_0141398 | 3300046559 | Bacteria | 1551 |
| 806 | Ga0495656_0009862 | 3300046615 | Bacteria | 3450 |
| 807 | Ga0495634_0000531 | 3300046642 | Bacteria | 37387 |
| 808 | Ga0495634_0019375 | 3300046642 | Bacteria | 4836 |
| 809 | Ga0495634_0025736 | 3300046642 | Bacteria | 4109 |
| 810 | Ga0495634_0185453 | 3300046642 | Bacteria | 1300 |
| 811 | Ga0495611_0051766 | 3300046648 | Bacteria | 1851 |
| 812 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 813 | Ga0495635_0000736 | 3300046663 | Bacteria | 21173 |
| 814 | Ga0495635_0025074 | 3300046663 | Bacteria | 4154 |
| 815 | Ga0495635_0340919 | 3300046663 | Bacteria | 1001 |
| 816 | Ga0495659_0317643 | 3300046664 | Bacteria | 661 |
| 817 | Ga0495588_0013638 | 3300046674 | Bacteria | 3873 |
| 818 | Ga0495657_0000136 | 3300046675 | Bacteria | 65707 |
| 819 | Ga0495657_0025115 | 3300046675 | Bacteria | 4234 |
| 820 | Ga0495657_0065329 | 3300046675 | Bacteria | 2393 |
| 821 | Ga0495657_0089251 | 3300046675 | Bacteria | 1981 |
| 822 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 823 | Ga0495599_0002064 | 3300046678 | Bacteria | 11642 |
| 824 | Ga0495599_0155610 | 3300046678 | Unclassified | 1414 |
| 825 | Ga0495623_0000052 | 3300046679 | Bacteria | 71268 |
| 826 | Ga0495623_0002286 | 3300046679 | Bacteria | 12776 |
| 827 | Ga0495646_0000036 | 3300046680 | Bacteria | 81182 |
| 828 | Ga0495646_0002741 | 3300046680 | Bacteria | 10885 |
| 829 | Ga0495646_0054470 | 3300046680 | Bacteria | 2405 |
| 830 | Ga0495646_0147666 | 3300046680 | Bacteria | 1310 |
| 831 | Ga0495647_0010583 | 3300046681 | Bacteria | 3143 |
| 832 | Ga0495647_0038031 | 3300046681 | Bacteria | 1818 |
| 833 | Ga0495647_0159922 | 3300046681 | Bacteria | 970 |
| 834 | Ga0495658_0001370 | 3300046683 | Bacteria | 12779 |
| 835 | Ga0495658_0018935 | 3300046683 | Bacteria | 3588 |
| 836 | Ga0495669_0020794 | 3300046684 | Bacteria | 2844 |
| 837 | Ga0495669_0359342 | 3300046684 | Unclassified | 704 |
| 838 | Ga0495613_0006674 | 3300046689 | Bacteria | 8621 |
| 839 | Ga0495613_0039955 | 3300046689 | Bacteria | 3476 |
| 840 | Ga0495613_0098623 | 3300046689 | Bacteria | 2111 |
| 841 | Ga0495624_0014439 | 3300046690 | Bacteria | 5358 |
| 842 | Ga0495624_0174582 | 3300046690 | Bacteria | 1310 |
| 843 | Ga0495670_0006726 | 3300046691 | Bacteria | 5655 |
| 844 | Ga0495600_0000037 | 3300046809 | Bacteria | 78434 |
| 845 | Ga0495600_0003589 | 3300046809 | Bacteria | 9137 |
| 846 | Ga0495600_0109398 | 3300046809 | Bacteria | 1799 |
| 847 | Ga0495581_0002869 | 3300047315 | Bacteria | 9849 |
| 848 | Ga0495581_0005348 | 3300047315 | Bacteria | 7424 |
| 849 | Ga0495581_0046501 | 3300047315 | Bacteria | 2508 |
| 850 | Ga0495581_0114681 | 3300047315 | Bacteria | 1567 |
| 851 | Ga0495581_0125649 | 3300047315 | Bacteria | 1493 |
| 852 | Ga0495604_0000602 | 3300047317 | Bacteria | 31009 |
| 853 | Ga0495604_0020434 | 3300047317 | Bacteria | 5288 |
| 854 | Ga0495604_0058771 | 3300047317 | Bacteria | 2952 |
| 855 | Ga0495604_0075847 | 3300047317 | Bacteria | 2530 |
| 856 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 857 | Ga0495674_0012879 | 3300047319 | Bacteria | 7875 |
| 858 | Ga0495674_0046522 | 3300047319 | Bacteria | 3850 |
| 859 | Ga0495674_0146363 | 3300047319 | Bacteria | 1983 |
| 860 | Ga0495676_0072815 | 3300047321 | Bacteria | 2637 |
| 861 | Ga0495676_0251189 | 3300047321 | Bacteria | 1206 |
| 862 | Ga0495680_0000705 | 3300047322 | Bacteria | 37488 |
| 863 | Ga0495680_0011290 | 3300047322 | Bacteria | 7916 |
| 864 | Ga0495680_0021145 | 3300047322 | Bacteria | 5453 |
| 865 | Ga0495680_0036428 | 3300047322 | Bacteria | 3949 |
| 866 | Ga0495680_0116258 | 3300047322 | Bacteria | 1978 |
| 867 | Ga0495675_0000049 | 3300047444 | Bacteria | 80913 |
| 868 | Ga0495675_0000480 | 3300047444 | Bacteria | 26138 |
| 869 | Ga0495684_0000046 | 3300047471 | Bacteria | 92658 |
| 870 | Ga0495684_0009067 | 3300047471 | Bacteria | 7683 |
| 871 | Ga0495684_0529609 | 3300047471 | Unclassified | 805 |
| 872 | Ga0495593_0009427 | 3300047673 | Bacteria | 5664 |
| 873 | Ga0495593_0013719 | 3300047673 | Bacteria | 4615 |
| 874 | Ga0495593_0070727 | 3300047673 | Bacteria | 1812 |
| 875 | Ga0495602_0000102 | 3300048088 | Bacteria | 81094 |
| 876 | Ga0495602_0178747 | 3300048088 | Bacteria | 1639 |
| 877 | Ga0495602_0352227 | 3300048088 | Bacteria | 1062 |
| 878 | Ga0495614_0022914 | 3300048089 | Bacteria | 2692 |
| 879 | Ga0496100_0000057 | 3300048903 | Bacteria | 67216 |
| 880 | Ga0496100_0008197 | 3300048903 | Bacteria | 5818 |
| 881 | Ga0496100_0068502 | 3300048903 | Bacteria | 2360 |
| 882 | Ga0496101_0065500 | 3300048904 | Bacteria | 2649 |
| 883 | Ga0496101_0167695 | 3300048904 | Bacteria | 1686 |
| 884 | Ga0496101_0253127 | 3300048904 | Unclassified | 1372 |
| 885 | Ga0496102_0001628 | 3300048905 | Bacteria | 19791 |
| 886 | Ga0496102_0023116 | 3300048905 | Bacteria | 5517 |
| 887 | Ga0496102_0232125 | 3300048905 | Bacteria | 1739 |
| 888 | Ga0496102_0241653 | 3300048905 | Unclassified | 1702 |
| 889 | Ga0496102_0257080 | 3300048905 | Bacteria | 1646 |
| 890 | Ga0496102_0398302 | 3300048905 | Bacteria | 1294 |
| 891 | Ga0496102_0441266 | 3300048905 | Bacteria | 1221 |
| 892 | Ga0496103_0039242 | 3300048906 | Bacteria | 2910 |
| 893 | Ga0496103_0306285 | 3300048906 | Unclassified | 1022 |
| 894 | Ga0496104_0059037 | 3300048907 | Bacteria | 3631 |
| 895 | Ga0496104_0062929 | 3300048907 | Bacteria | 3518 |
| 896 | Ga0496104_0072866 | 3300048907 | Bacteria | 3267 |
| 897 | Ga0496104_0120451 | 3300048907 | Bacteria | 2519 |
| 898 | Ga0496104_0156717 | 3300048907 | Bacteria | 2185 |
| 899 | Ga0496105_0071127 | 3300048908 | Bacteria | 2875 |
| 900 | Ga0496105_0116920 | 3300048908 | Bacteria | 2199 |
| 901 | Ga0496105_0523047 | 3300048908 | Unclassified | 929 |
| 902 | Ga0496106_0028707 | 3300048909 | Bacteria | 4144 |
| 903 | Ga0496106_0423263 | 3300048909 | Bacteria | 1070 |
| 904 | Ga0496107_0001129 | 3300048910 | Bacteria | 16115 |
| 905 | Ga0496107_0064606 | 3300048910 | Bacteria | 2653 |
| 906 | Ga0496107_0192756 | 3300048910 | Bacteria | 1514 |
| 907 | Ga0496107_0785625 | 3300048910 | Bacteria | 697 |
| 908 | Ga0496108_0003535 | 3300048911 | Bacteria | 12534 |
| 909 | Ga0496108_0043797 | 3300048911 | Bacteria | 3738 |
| 910 | Ga0496108_0086379 | 3300048911 | Bacteria | 2663 |
| 911 | Ga0496108_0160018 | 3300048911 | Bacteria | 1945 |
| 912 | Ga0496109_0002432 | 3300048912 | Bacteria | 15587 |
| 913 | Ga0496109_0033913 | 3300048912 | Bacteria | 4594 |
| 914 | Ga0496109_0061718 | 3300048912 | Bacteria | 3427 |
| 915 | Ga0496109_0074074 | 3300048912 | Bacteria | 3130 |
| 916 | Ga0496109_0093167 | 3300048912 | Bacteria | 2787 |
| 917 | Ga0496109_0144608 | 3300048912 | Bacteria | 2224 |
| 918 | Ga0496110_0077993 | 3300048913 | Bacteria | 2948 |
| 919 | Ga0496110_0083286 | 3300048913 | Bacteria | 2853 |
| 920 | Ga0496110_0143879 | 3300048913 | Bacteria | 2156 |
| 921 | Ga0496110_0691338 | 3300048913 | Unclassified | 921 |
| 922 | Ga0496111_0022875 | 3300048914 | Bacteria | 4381 |
| 923 | Ga0496111_0043097 | 3300048914 | Bacteria | 3243 |
| 924 | Ga0496111_0098747 | 3300048914 | Bacteria | 2144 |
| 925 | Ga0496111_0171211 | 3300048914 | Bacteria | 1613 |
| 926 | Ga0496111_0310351 | 3300048914 | Bacteria | 1169 |
| 927 | Ga0496112_0070793 | 3300048915 | Bacteria | 3446 |
| 928 | Ga0496112_0079005 | 3300048915 | Bacteria | 3254 |
| 929 | Ga0496112_0100086 | 3300048915 | Bacteria | 2868 |
| 930 | Ga0496112_0121818 | 3300048915 | Bacteria | 2578 |
| 931 | Ga0496112_0339166 | 3300048915 | Unclassified | 1446 |
| 932 | Ga0496112_0406554 | 3300048915 | Unclassified | 1301 |
| 933 | Ga0496112_1029737 | 3300048915 | Bacteria | 743 |
| 934 | Ga0496113_0049425 | 3300048916 | Bacteria | 3131 |
| 935 | Ga0496113_0057193 | 3300048916 | Bacteria | 2930 |
| 936 | Ga0496113_0076978 | 3300048916 | Bacteria | 2549 |
| 937 | Ga0496114_0002944 | 3300048917 | Bacteria | 13059 |
| 938 | Ga0496114_0010304 | 3300048917 | Bacteria | 7438 |
| 939 | Ga0496114_0757422 | 3300048917 | Bacteria | 848 |
| 940 | Ga0496115_0002786 | 3300048918 | Bacteria | 12565 |
| 941 | Ga0496115_0047377 | 3300048918 | Bacteria | 3437 |
| 942 | Ga0496115_0142243 | 3300048918 | Bacteria | 1979 |
| 943 | Ga0496115_0189633 | 3300048918 | Bacteria | 1698 |
| 944 | Ga0496115_0508287 | 3300048918 | Bacteria | 967 |
| 945 | Ga0496121_0601147 | 3300048924 | Bacteria | 679 |
| 946 | Ga0496125_0131914 | 3300048928 | Bacteria | 1757 |
| 947 | Ga0501031_0327693 | 3300049568 | Bacteria | 992 |
| 948 | Ga0501036_0652256 | 3300049572 | Bacteria | 871 |
| 949 | Ga0501037_0783430 | 3300049573 | Bacteria | 630 |
| 950 | Ga0501042_0127565 | 3300049578 | Bacteria | 1832 |
| 951 | Ga0501046_0776403 | 3300049580 | Bacteria | 672 |
| 952 | Ga0501047_0722528 | 3300049581 | Unclassified | 813 |
| 953 | Ga0501048_0152945 | 3300049582 | Bacteria | 1632 |
| 954 | Ga0501048_1282069 | 3300049582 | Unclassified | 527 |
| 955 | Ga0501067_0538171 | 3300049583 | Bacteria | 654 |
| 956 | Ga0501068_0271736 | 3300049584 | Bacteria | 1082 |
| 957 | Ga0501068_1095784 | 3300049584 | Bacteria | 527 |
| 958 | Ga0501070_0244160 | 3300049586 | Bacteria | 1470 |
| 959 | Ga0501071_0013555 | 3300049587 | Bacteria | 5558 |
| 960 | Ga0501072_0044486 | 3300049588 | Bacteria | 3491 |
| 961 | Ga0501073_0045999 | 3300049589 | Bacteria | 3072 |
| 962 | Ga0501075_0299893 | 3300049591 | Bacteria | 1224 |
| 963 | Ga0501076_0661325 | 3300049592 | Bacteria | 862 |
| 964 | Ga0501077_0123062 | 3300049593 | Unclassified | 1644 |
| 965 | Ga0501077_0460576 | 3300049593 | Bacteria | 814 |
| 966 | Ga0501079_0216088 | 3300049741 | Bacteria | 1498 |
| 967 | Ga0501079_0404254 | 3300049741 | Bacteria | 1071 |
| 968 | Ga0501081_0073391 | 3300049743 | Bacteria | 2386 |
| 969 | Ga0501083_0008454 | 3300049744 | Bacteria | 7274 |
| 970 | Ga0501083_0853241 | 3300049744 | Bacteria | 593 |
| 971 | Ga0501044_0555230 | 3300049823 | Bacteria | 1045 |
| 972 | Ga0501045_0576953 | 3300049824 | Bacteria | 833 |
| 973 | nmdc:mga03n38_606528_c1 | 3300050490 | Bacteria | 624 |
| 974 | nmdc:mga0k408_120181_c1 | 3300050493 | Bacteria | 1556 |
| 975 | nmdc:mga0k408_746501_c1 | 3300050493 | Unclassified | 572 |
| 976 | nmdc:mga06z11_211456_c1 | 3300050494 | Bacteria | 1130 |
| 977 | nmdc:mga05p37_45_c2 | 3300050507 | Bacteria | 24882 |
| 978 | nmdc:mga05p37_839451_c1 | 3300050507 | Bacteria | 999 |
| 979 | nmdc:mga05p37_92628_c1 | 3300050507 | Bacteria | 3724 |
| 980 | nmdc:mga09592_1055_c1 | 3300050508 | Bacteria | 21846 |
| 981 | nmdc:mga0qj67_1012_c1 | 3300050509 | Bacteria | 19405 |
| 982 | nmdc:mga0qj67_92436_c1 | 3300050509 | Bacteria | 2432 |
| 983 | nmdc:mga06r32_56570_c1 | 3300050510 | Bacteria | 3766 |
| 984 | nmdc:mga08y16_1134_c1 | 3300050511 | Bacteria | 26246 |
| 985 | nmdc:mga08y16_12172_c1 | 3300050511 | Bacteria | 9043 |
| 986 | nmdc:mga08y16_1989_c1 | 3300050511 | Bacteria | 20867 |
| 987 | nmdc:mga0n895_286420_c1 | 3300050512 | Bacteria | 1670 |
| 988 | nmdc:mga0n895_3165_c1 | 3300050512 | Bacteria | 13152 |
| 989 | nmdc:mga0n895_404960_c1 | 3300050512 | Bacteria | 1380 |
| 990 | nmdc:mga0n895_50_c1 | 3300050512 | Bacteria | 71634 |
| 991 | nmdc:mga0rr50_45762_c1 | 3300050513 | Bacteria | 3219 |
| 992 | nmdc:mga0rr50_77520_c1 | 3300050513 | Bacteria | 2554 |
| 993 | nmdc:mga0rr50_950190_c1 | 3300050513 | Unclassified | 733 |
| 994 | nmdc:mga08x19_536788_c1 | 3300050514 | Bacteria | 827 |
| 995 | nmdc:mga08x19_75835_c1 | 3300050514 | Bacteria | 2199 |
| 996 | nmdc:mga08x19_86249_c1 | 3300050514 | Bacteria | 2067 |
| 997 | nmdc:mga0a205_171569_c1 | 3300050515 | Unclassified | 2065 |
| 998 | nmdc:mga0a205_2228_c1 | 3300050515 | Bacteria | 17060 |
| 999 | nmdc:mga0a205_5479_c1 | 3300050515 | Bacteria | 11429 |
| 1000 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 1001 | Ga0495601_0004549 | 3300053077 | Bacteria | 8015 |
| 1002 | Ga0495601_0010204 | 3300053077 | Bacteria | 5583 |
| 1003 | Ga0495601_0011553 | 3300053077 | Bacteria | 5288 |
| 1004 | Ga0495601_0041259 | 3300053077 | Bacteria | 2892 |
| 1005 | Ga0495601_0189704 | 3300053077 | Bacteria | 1343 |
| 1006 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 1007 | Ga0495612_0004274 | 3300053078 | Bacteria | 5935 |
| 1008 | Ga0495612_0139684 | 3300053078 | Bacteria | 1050 |
| 1009 | Ga0495612_0210593 | 3300053078 | Bacteria | 859 |
| 1010 | Ga0495595_0000227 | 3300053084 | Bacteria | 22346 |
| 1011 | Ga0495595_0000420 | 3300053084 | Bacteria | 16034 |
| 1012 | Ga0495595_0002620 | 3300053084 | Bacteria | 7052 |
| 1013 | Ga0495595_0003875 | 3300053084 | Bacteria | 5969 |
| 1014 | Ga0495595_0109261 | 3300053084 | Bacteria | 1339 |
| 1015 | Ga0495619_0000027 | 3300053085 | Bacteria | 165001 |
| 1016 | Ga0495619_0000260 | 3300053085 | Bacteria | 38574 |
| 1017 | Ga0495619_0013843 | 3300053085 | Bacteria | 5090 |
| 1018 | Ga0495619_0016793 | 3300053085 | Bacteria | 4634 |
| 1019 | Ga0495619_0053926 | 3300053085 | Bacteria | 2661 |
| 1020 | Ga0495619_0057856 | 3300053085 | Bacteria | 2572 |
| 1021 | Ga0495619_0060868 | 3300053085 | Bacteria | 2510 |
| 1022 | Ga0500566_0193529 | 3300053094 | Bacteria | 1033 |
| 1023 | Ga0501084_0544356 | 3300054114 | Unclassified | 981 |
| 1024 | Ga0501082_0007806 | 3300060353 | Bacteria | 9234 |
| 1025 | Ga0501082_0222206 | 3300060353 | Bacteria | 1643 |
| 1026 | Ga0466962_0034260 | 3300061719 | Bacteria | 2431 |
| 1027 | Ga0530510_0219739 | 3300061734 | Bacteria | 1412 |
| 1028 | Ga0530510_0767135 | 3300061734 | Bacteria | 735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842694124 | 2842695400 | 146 |
| 2 | 3300028379 | Ga0268266_11644153 | Ga0268266_116441531 | 147 |
| 3 | 3300049584 | Ga0501068_1095784 | Ga0501068_1095784_43_489 | 147 |
| 4 | 3300002459 | JGI24751J29686_10062096 | JGI24751J29686_100620962 | 148 |
| 5 | 3300003203 | JGI25406J46586_10033300 | JGI25406J46586_100333001 | 148 |
| 6 | 3300005290 | Ga0065712_10615400 | Ga0065712_106154001 | 148 |
| 7 | 3300005331 | Ga0070670_100577328 | Ga0070670_1005773282 | 148 |
| 8 | 3300005331 | Ga0070670_100665518 | Ga0070670_1006655181 | 148 |
| 9 | 3300005340 | Ga0070689_100224298 | Ga0070689_1002242982 | 148 |
| 10 | 3300005365 | Ga0070688_100028095 | Ga0070688_1000280951 | 148 |
| 11 | 3300005539 | Ga0068853_100245345 | Ga0068853_1002453452 | 148 |
| 12 | 3300005577 | Ga0068857_100363630 | Ga0068857_1003636302 | 148 |
| 13 | 3300005617 | Ga0068859_100310289 | Ga0068859_1003102892 | 148 |
| 14 | 3300005617 | Ga0068859_101007969 | Ga0068859_1010079692 | 148 |
| 15 | 3300005618 | Ga0068864_100210126 | Ga0068864_1002101262 | 148 |
| 16 | 3300005844 | Ga0068862_100445539 | Ga0068862_1004455392 | 148 |
| 17 | 3300005844 | Ga0068862_101152857 | Ga0068862_1011528571 | 148 |
| 18 | 3300005985 | Ga0081539_10004321 | Ga0081539_100043214 | 148 |
| 19 | 3300006175 | Ga0070712_100562458 | Ga0070712_1005624581 | 148 |
| 20 | 3300006195 | Ga0075366_10008368 | Ga0075366_100083686 | 148 |
| 21 | 3300006931 | Ga0097620_100310281 | Ga0097620_1003102812 | 148 |
| 22 | 3300006931 | Ga0097620_101007933 | Ga0097620_1010079332 | 148 |
| 23 | 3300009094 | Ga0111539_11341449 | Ga0111539_113414491 | 148 |
| 24 | 3300014325 | Ga0163163_12934105 | Ga0163163_129341051 | 148 |
| 25 | 3300014326 | Ga0157380_13237656 | Ga0157380_132376561 | 148 |
| 26 | 3300017792 | Ga0163161_10381004 | Ga0163161_103810042 | 148 |
| 27 | 3300025923 | Ga0207681_10295327 | Ga0207681_102953272 | 148 |
| 28 | 3300025925 | Ga0207650_10169465 | Ga0207650_101694652 | 148 |
| 29 | 3300025925 | Ga0207650_10944291 | Ga0207650_109442912 | 148 |
| 30 | 3300025926 | Ga0207659_10670072 | Ga0207659_106700721 | 148 |
| 31 | 3300025927 | Ga0207687_10449343 | Ga0207687_104493432 | 148 |
| 32 | 3300025936 | Ga0207670_10610018 | Ga0207670_106100182 | 148 |
| 33 | 3300025942 | Ga0207689_10117899 | Ga0207689_101178992 | 148 |
| 34 | 3300025961 | Ga0207712_10586101 | Ga0207712_105861012 | 148 |
| 35 | 3300026035 | Ga0207703_10148000 | Ga0207703_101480002 | 148 |
| 36 | 3300026041 | Ga0207639_10177779 | Ga0207639_101777792 | 148 |
| 37 | 3300026095 | Ga0207676_10029204 | Ga0207676_100292042 | 148 |
| 38 | 3300026116 | Ga0207674_10185416 | Ga0207674_101854162 | 148 |
| 39 | 3300027866 | Ga0209813_10209987 | Ga0209813_102099872 | 148 |
| 40 | 3300028380 | Ga0268265_10352587 | Ga0268265_103525872 | 148 |
| 41 | 3300037853 | Ga0436364_0997377 | Ga0436364_0997377_261_710 | 148 |
| 42 | 3300039437 | Ga0436365_1569518 | Ga0436365_1569518_296_745 | 148 |
| 43 | 3300042436 | Ga0439435_0002304 | Ga0439435_0002304_2931_3380 | 148 |
| 44 | 3300044694 | Ga0466963_1084952 | Ga0466963_1084952_69_518 | 148 |
| 45 | 3300050493 | nmdc:mga0k408_120181_c1 | nmdc:mga0k408_120181_c1_286_735 | 148 |
| 46 | 3300050507 | nmdc:mga05p37_839451_c1 | nmdc:mga05p37_839451_c1_423_872 | 148 |
| 47 | 3300050509 | nmdc:mga0qj67_92436_c1 | nmdc:mga0qj67_92436_c1_1402_1848 | 148 |
| 48 | 3300039437 | Ga0436365_1531855 | Ga0436365_1531855_777_1229 | 149 |
| 49 | 3300039450 | Ga0436363_0942778 | Ga0436363_0942778_744_1196 | 149 |
| 50 | 3300039453 | Ga0436362_0063504 | Ga0436362_0063504_265_717 | 149 |
| 51 | 3300005329 | Ga0070683_100105366 | Ga0070683_1001053662 | 150 |
| 52 | 3300005336 | Ga0070680_100102774 | Ga0070680_1001027743 | 150 |
| 53 | 3300005434 | Ga0070709_10066394 | Ga0070709_100663943 | 150 |
| 54 | 3300005435 | Ga0070714_100023744 | Ga0070714_1000237446 | 150 |
| 55 | 3300005435 | Ga0070714_100024265 | Ga0070714_1000242656 | 150 |
| 56 | 3300005436 | Ga0070713_100681284 | Ga0070713_1006812841 | 150 |
| 57 | 3300005437 | Ga0070710_10360499 | Ga0070710_103604992 | 150 |
| 58 | 3300005439 | Ga0070711_100277590 | Ga0070711_1002775902 | 150 |
| 59 | 3300005458 | Ga0070681_10139375 | Ga0070681_101393751 | 150 |
| 60 | 3300005535 | Ga0070684_100065596 | Ga0070684_1000655961 | 150 |
| 61 | 3300005547 | Ga0070693_100295687 | Ga0070693_1002956872 | 150 |
| 62 | 3300005563 | Ga0068855_100235987 | Ga0068855_1002359871 | 150 |
| 63 | 3300006173 | Ga0070716_100706632 | Ga0070716_1007066322 | 150 |
| 64 | 3300006175 | Ga0070712_100254997 | Ga0070712_1002549973 | 150 |
| 65 | 3300009093 | Ga0105240_10398388 | Ga0105240_103983882 | 150 |
| 66 | 3300009174 | Ga0105241_10165873 | Ga0105241_101658732 | 150 |
| 67 | 3300009174 | Ga0105241_10751454 | Ga0105241_107514542 | 150 |
| 68 | 3300009551 | Ga0105238_10070510 | Ga0105238_100705104 | 150 |
| 69 | 3300010159 | Ga0099796_10003664 | Ga0099796_100036644 | 150 |
| 70 | 3300013100 | Ga0157373_10196765 | Ga0157373_101967651 | 150 |
| 71 | 3300013102 | Ga0157371_10060753 | Ga0157371_100607532 | 150 |
| 72 | 3300013104 | Ga0157370_10510019 | Ga0157370_105100192 | 150 |
| 73 | 3300013307 | Ga0157372_10052004 | Ga0157372_100520044 | 150 |
| 74 | 3300013307 | Ga0157372_11720725 | Ga0157372_117207252 | 150 |
| 75 | 3300021388 | Ga0213875_10001962 | Ga0213875_100019622 | 150 |
| 76 | 3300025898 | Ga0207692_11009394 | Ga0207692_110093941 | 150 |
| 77 | 3300025911 | Ga0207654_10050507 | Ga0207654_100505073 | 150 |
| 78 | 3300025913 | Ga0207695_10264455 | Ga0207695_102644552 | 150 |
| 79 | 3300025916 | Ga0207663_10543919 | Ga0207663_105439191 | 150 |
| 80 | 3300025917 | Ga0207660_10163077 | Ga0207660_101630772 | 150 |
| 81 | 3300025929 | Ga0207664_10198976 | Ga0207664_101989761 | 150 |
| 82 | 3300025929 | Ga0207664_10469011 | Ga0207664_104690112 | 150 |
| 83 | 3300025929 | Ga0207664_11007045 | Ga0207664_110070452 | 150 |
| 84 | 3300025939 | Ga0207665_11128519 | Ga0207665_111285191 | 150 |
| 85 | 3300025949 | Ga0207667_10955605 | Ga0207667_109556051 | 150 |
| 86 | 3300026078 | Ga0207702_10092756 | Ga0207702_100927562 | 150 |
| 87 | 3300027512 | Ga0209179_1056121 | Ga0209179_10561212 | 150 |
| 88 | 3300028556 | Ga0265337_1004750 | Ga0265337_10047502 | 150 |
| 89 | 3300028800 | Ga0265338_10081076 | Ga0265338_100810762 | 150 |
| 90 | 3300028800 | Ga0265338_10534682 | Ga0265338_105346821 | 150 |
| 91 | 3300031241 | Ga0265325_10055164 | Ga0265325_100551642 | 150 |
| 92 | 3300031241 | Ga0265325_10285780 | Ga0265325_102857801 | 150 |
| 93 | 3300031249 | Ga0265339_10110080 | Ga0265339_101100802 | 150 |
| 94 | 3300031344 | Ga0265316_10498186 | Ga0265316_104981862 | 150 |
| 95 | 3300031665 | Ga0316575_10055001 | Ga0316575_100550012 | 150 |
| 96 | 3300031665 | Ga0316575_10068406 | Ga0316575_100684062 | 150 |
| 97 | 3300032133 | Ga0316583_10000771 | Ga0316583_100007714 | 150 |
| 98 | 3300035086 | Ga0373934_0145739 | Ga0373934_0145739_202_654 | 150 |
| 99 | 3300035111 | Ga0373923_0166864 | Ga0373923_0166864_172_624 | 150 |
| 100 | 3300035113 | Ga0373936_0001643 | Ga0373936_0001643_4131_4583 | 150 |
| 101 | 3300035116 | Ga0373945_0000695 | Ga0373945_0000695_5584_6036 | 150 |
| 102 | 3300035117 | Ga0373953_0006813 | Ga0373953_0006813_2682_3134 | 150 |
| 103 | 3300035118 | Ga0373954_0004095 | Ga0373954_0004095_23_475 | 150 |
| 104 | 3300035118 | Ga0373954_0004312 | Ga0373954_0004312_4782_5234 | 150 |
| 105 | 3300035119 | Ga0373956_0031693 | Ga0373956_0031693_810_1262 | 150 |
| 106 | 3300035120 | Ga0373957_0006881 | Ga0373957_0006881_1597_2049 | 150 |
| 107 | 3300035170 | Ga0373943_0003558 | Ga0373943_0003558_4545_4997 | 150 |
| 108 | 3300035172 | Ga0373955_0000419 | Ga0373955_0000419_6060_6512 | 150 |
| 109 | 3300035172 | Ga0373955_0126208 | Ga0373955_0126208_171_623 | 150 |
| 110 | 3300035241 | Ga0373961_0110901 | Ga0373961_0110901_387_839 | 150 |
| 111 | 3300035410 | Ga0373924_0000402 | Ga0373924_0000402_9850_10302 | 150 |
| 112 | 3300035410 | Ga0373924_0211517 | Ga0373924_0211517_354_806 | 150 |
| 113 | 3300035692 | Ga0373935_0000012 | Ga0373935_0000012_53585_54037 | 150 |
| 114 | 3300035695 | Ga0373927_0006963 | Ga0373927_0006963_1217_1669 | 150 |
| 115 | 3300035724 | Ga0373933_0004197 | Ga0373933_0004197_4838_5290 | 150 |
| 116 | 3300035724 | Ga0373933_0371840 | Ga0373933_0371840_449_901 | 150 |
| 117 | 3300035725 | Ga0373947_0002387 | Ga0373947_0002387_9127_9579 | 150 |
| 118 | 3300036401 | Ga0373937_0000054 | Ga0373937_0000054_13616_14068 | 150 |
| 119 | 3300036401 | Ga0373937_0260551 | Ga0373937_0260551_254_706 | 150 |
| 120 | 3300037068 | Ga0373925_0000018 | Ga0373925_0000018_120150_120602 | 150 |
| 121 | 3300037853 | Ga0436364_1325276 | Ga0436364_1325276_33848_34324 | 150 |
| 122 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_87796_88248 | 150 |
| 123 | 3300046454 | Ga0495592_0379569 | Ga0495592_0379569_362_814 | 150 |
| 124 | 3300046459 | Ga0495629_0006898 | Ga0495629_0006898_7039_7491 | 150 |
| 125 | 3300046462 | Ga0495651_0003996 | Ga0495651_0003996_7799_8251 | 150 |
| 126 | 3300046463 | Ga0495653_0000292 | Ga0495653_0000292_21621_22073 | 150 |
| 127 | 3300046476 | Ga0495662_0002781 | Ga0495662_0002781_5017_5469 | 150 |
| 128 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_228113_228565 | 150 |
| 129 | 3300046511 | Ga0495608_0000050 | Ga0495608_0000050_46101_46553 | 150 |
| 130 | 3300046511 | Ga0495608_0092126 | Ga0495608_0092126_300_752 | 150 |
| 131 | 3300046514 | Ga0495618_0000045 | Ga0495618_0000045_66236_66688 | 150 |
| 132 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_59170_59622 | 150 |
| 133 | 3300046517 | Ga0495630_0002190 | Ga0495630_0002190_6392_6844 | 150 |
| 134 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_598600_599052 | 150 |
| 135 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_46236_46688 | 150 |
| 136 | 3300046535 | Ga0495586_0073218 | Ga0495586_0073218_584_1036 | 150 |
| 137 | 3300046536 | Ga0495587_0000028 | Ga0495587_0000028_105213_105665 | 150 |
| 138 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_121619_122071 | 150 |
| 139 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_438568_439020 | 150 |
| 140 | 3300046559 | Ga0495667_0141398 | Ga0495667_0141398_960_1412 | 150 |
| 141 | 3300046642 | Ga0495634_0000531 | Ga0495634_0000531_21371_21823 | 150 |
| 142 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_252647_253099 | 150 |
| 143 | 3300046675 | Ga0495657_0000136 | Ga0495657_0000136_59162_59614 | 150 |
| 144 | 3300046675 | Ga0495657_0065329 | Ga0495657_0065329_1553_2005 | 150 |
| 145 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_319699_320151 | 150 |
| 146 | 3300046679 | Ga0495623_0000052 | Ga0495623_0000052_21598_22050 | 150 |
| 147 | 3300046680 | Ga0495646_0000036 | Ga0495646_0000036_59285_59737 | 150 |
| 148 | 3300046681 | Ga0495647_0159922 | Ga0495647_0159922_347_799 | 150 |
| 149 | 3300046689 | Ga0495613_0039955 | Ga0495613_0039955_562_1014 | 150 |
| 150 | 3300046690 | Ga0495624_0174582 | Ga0495624_0174582_405_857 | 150 |
| 151 | 3300046809 | Ga0495600_0000037 | Ga0495600_0000037_21430_21882 | 150 |
| 152 | 3300047315 | Ga0495581_0002869 | Ga0495581_0002869_4902_5354 | 150 |
| 153 | 3300047317 | Ga0495604_0000602 | Ga0495604_0000602_27947_28399 | 150 |
| 154 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_428050_428502 | 150 |
| 155 | 3300047321 | Ga0495676_0251189 | Ga0495676_0251189_283_735 | 150 |
| 156 | 3300047322 | Ga0495680_0000705 | Ga0495680_0000705_30977_31429 | 150 |
| 157 | 3300047322 | Ga0495680_0116258 | Ga0495680_0116258_1324_1776 | 150 |
| 158 | 3300047444 | Ga0495675_0000049 | Ga0495675_0000049_59056_59508 | 150 |
| 159 | 3300047471 | Ga0495684_0000046 | Ga0495684_0000046_78213_78665 | 150 |
| 160 | 3300047673 | Ga0495593_0013719 | Ga0495593_0013719_1119_1571 | 150 |
| 161 | 3300048088 | Ga0495602_0000102 | Ga0495602_0000102_59207_59659 | 150 |
| 162 | 3300048088 | Ga0495602_0178747 | Ga0495602_0178747_123_575 | 150 |
| 163 | 3300048915 | Ga0496112_1029737 | Ga0496112_1029737_260_715 | 150 |
| 164 | 3300049581 | Ga0501047_0722528 | Ga0501047_0722528_72_524 | 150 |
| 165 | 3300049584 | Ga0501068_0271736 | Ga0501068_0271736_456_914 | 150 |
| 166 | 3300049741 | Ga0501079_0404254 | Ga0501079_0404254_547_1005 | 150 |
| 167 | 3300049743 | Ga0501081_0073391 | Ga0501081_0073391_980_1438 | 150 |
| 168 | 3300049744 | Ga0501083_0853241 | Ga0501083_0853241_57_515 | 150 |
| 169 | 3300049823 | Ga0501044_0555230 | Ga0501044_0555230_355_807 | 150 |
| 170 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_268100_268552 | 150 |
| 171 | 3300053077 | Ga0495601_0041259 | Ga0495601_0041259_506_958 | 150 |
| 172 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_46108_46560 | 150 |
| 173 | 3300053078 | Ga0495612_0210593 | Ga0495612_0210593_214_666 | 150 |
| 174 | 3300053084 | Ga0495595_0000227 | Ga0495595_0000227_6407_6859 | 150 |
| 175 | 3300053084 | Ga0495595_0109261 | Ga0495595_0109261_150_602 | 150 |
| 176 | 3300053085 | Ga0495619_0000027 | Ga0495619_0000027_59358_59810 | 150 |
| 177 | 3300053085 | Ga0495619_0053926 | Ga0495619_0053926_446_898 | 150 |
| 178 | 3300060353 | Ga0501082_0007806 | Ga0501082_0007806_7413_7871 | 150 |
| 179 | 3300061734 | Ga0530510_0767135 | Ga0530510_0767135_67_525 | 150 |
| 180 | 3300005344 | Ga0070661_101250019 | Ga0070661_1012500192 | 151 |
| 181 | 3300005458 | Ga0070681_10824898 | Ga0070681_108248982 | 151 |
| 182 | 3300013308 | Ga0157375_11439516 | Ga0157375_114395162 | 151 |
| 183 | 3300025912 | Ga0207707_10287031 | Ga0207707_102870311 | 151 |
| 184 | 3300049572 | Ga0501036_0652256 | Ga0501036_0652256_167_622 | 151 |
| 185 | 3300049573 | Ga0501037_0783430 | Ga0501037_0783430_163_618 | 151 |
| 186 | 3300049578 | Ga0501042_0127565 | Ga0501042_0127565_949_1404 | 151 |
| 187 | 3300049580 | Ga0501046_0776403 | Ga0501046_0776403_144_599 | 151 |
| 188 | 3300049582 | Ga0501048_0152945 | Ga0501048_0152945_317_772 | 151 |
| 189 | 3300049587 | Ga0501071_0013555 | Ga0501071_0013555_1706_2161 | 151 |
| 190 | 3300049588 | Ga0501072_0044486 | Ga0501072_0044486_2886_3341 | 151 |
| 191 | 3300049591 | Ga0501075_0299893 | Ga0501075_0299893_566_1021 | 151 |
| 192 | 3300049592 | Ga0501076_0661325 | Ga0501076_0661325_131_586 | 151 |
| 193 | 3300049593 | Ga0501077_0460576 | Ga0501077_0460576_327_782 | 151 |
| 194 | 3300049824 | Ga0501045_0576953 | Ga0501045_0576953_101_556 | 151 |
| 195 | 3300054114 | Ga0501084_0544356 | Ga0501084_0544356_264_719 | 151 |
| 196 | 3300061734 | Ga0530510_0219739 | Ga0530510_0219739_749_1204 | 151 |
| 197 | 3300042438 | Ga0439459_0060356 | Ga0439459_0060356_330_830 | 152 |
| 198 | 3300025915 | Ga0207693_10580563 | Ga0207693_105805632 | 153 |
| 199 | 3300035410 | Ga0373924_0100828 | Ga0373924_0100828_195_716 | 153 |
| 200 | 3300037068 | Ga0373925_0532501 | Ga0373925_0532501_157_690 | 153 |
| 201 | 3300037418 | Ga0395900_0001369 | Ga0395900_0001369_9485_9946 | 153 |
| 202 | 3300037466 | Ga0395898_0017006 | Ga0395898_0017006_2342_2803 | 153 |
| 203 | 3300037471 | Ga0395905_0533525 | Ga0395905_0533525_490_951 | 153 |
| 204 | 3300046473 | Ga0495582_0110852 | Ga0495582_0110852_804_1325 | 153 |
| 205 | 3300046476 | Ga0495662_0278585 | Ga0495662_0278585_106_627 | 153 |
| 206 | 3300046514 | Ga0495618_0072201 | Ga0495618_0072201_782_1315 | 153 |
| 207 | 3300046526 | Ga0495666_0007624 | Ga0495666_0007624_3678_4211 | 153 |
| 208 | 3300046543 | Ga0495645_0343798 | Ga0495645_0343798_245_778 | 153 |
| 209 | 3300046557 | Ga0495622_0262309 | Ga0495622_0262309_74_595 | 153 |
| 210 | 3300046642 | Ga0495634_0185453 | Ga0495634_0185453_89_610 | 153 |
| 211 | 3300046680 | Ga0495646_0147666 | Ga0495646_0147666_578_1111 | 153 |
| 212 | 3300046681 | Ga0495647_0038031 | Ga0495647_0038031_108_641 | 153 |
| 213 | 3300047315 | Ga0495581_0125649 | Ga0495581_0125649_476_1009 | 153 |
| 214 | 3300047319 | Ga0495674_0046522 | Ga0495674_0046522_1159_1692 | 153 |
| 215 | 3300049583 | Ga0501067_0538171 | Ga0501067_0538171_63_527 | 153 |
| 216 | 3300053077 | Ga0495601_0010204 | Ga0495601_0010204_1297_1830 | 153 |
| 217 | 3300053085 | Ga0495619_0013843 | Ga0495619_0013843_1349_1882 | 153 |
| 218 | 3300005327 | Ga0070658_10115505 | Ga0070658_101155052 | 154 |
| 219 | 3300005436 | Ga0070713_101606664 | Ga0070713_1016066641 | 154 |
| 220 | 3300005563 | Ga0068855_100020137 | Ga0068855_1000201377 | 154 |
| 221 | 3300005577 | Ga0068857_100618475 | Ga0068857_1006184752 | 154 |
| 222 | 3300009551 | Ga0105238_10012092 | Ga0105238_100120927 | 154 |
| 223 | 3300013307 | Ga0157372_10117836 | Ga0157372_101178362 | 154 |
| 224 | 3300014497 | Ga0182008_10408393 | Ga0182008_104083931 | 154 |
| 225 | 3300025913 | Ga0207695_11052260 | Ga0207695_110522602 | 154 |
| 226 | 3300025924 | Ga0207694_10103091 | Ga0207694_101030913 | 154 |
| 227 | 3300025949 | Ga0207667_10044449 | Ga0207667_100444493 | 154 |
| 228 | 3300026116 | Ga0207674_10250096 | Ga0207674_102500962 | 154 |
| 229 | 3300044684 | Ga0466966_0046303 | Ga0466966_0046303_1470_1934 | 154 |
| 230 | 3300044693 | Ga0466961_0034949 | Ga0466961_0034949_762_1226 | 154 |
| 231 | 3300044694 | Ga0466963_0220717 | Ga0466963_0220717_160_624 | 154 |
| 232 | 3300045049 | Ga0466959_0489922 | Ga0466959_0489922_246_710 | 154 |
| 233 | 3300045836 | Ga0466958_0038326 | Ga0466958_0038326_1371_1835 | 154 |
| 234 | 3300045836 | Ga0466958_0191358 | Ga0466958_0191358_369_833 | 154 |
| 235 | 3300050490 | nmdc:mga03n38_606528_c1 | nmdc:mga03n38_606528_c1_135_605 | 154 |
| 236 | 3300061719 | Ga0466962_0034260 | Ga0466962_0034260_1301_1765 | 154 |
| 237 | 3300009098 | Ga0105245_11211651 | Ga0105245_112116512 | 155 |
| 238 | 3300046475 | Ga0495639_0051117 | Ga0495639_0051117_1096_1629 | 155 |
| 239 | 3300049568 | Ga0501031_0327693 | Ga0501031_0327693_65_595 | 155 |
| 240 | 3300005337 | Ga0070682_100308753 | Ga0070682_1003087532 | 156 |
| 241 | 3300005344 | Ga0070661_101125174 | Ga0070661_1011251741 | 156 |
| 242 | 3300005364 | Ga0070673_100781188 | Ga0070673_1007811882 | 156 |
| 243 | 3300005436 | Ga0070713_100190763 | Ga0070713_1001907632 | 156 |
| 244 | 3300005437 | Ga0070710_10010783 | Ga0070710_100107832 | 156 |
| 245 | 3300005457 | Ga0070662_100834181 | Ga0070662_1008341812 | 156 |
| 246 | 3300005563 | Ga0068855_100284778 | Ga0068855_1002847782 | 156 |
| 247 | 3300005616 | Ga0068852_100514371 | Ga0068852_1005143712 | 156 |
| 248 | 3300009545 | Ga0105237_10142292 | Ga0105237_101422923 | 156 |
| 249 | 3300013297 | Ga0157378_11414961 | Ga0157378_114149612 | 156 |
| 250 | 3300013306 | Ga0163162_10044150 | Ga0163162_100441504 | 156 |
| 251 | 3300013307 | Ga0157372_10886625 | Ga0157372_108866252 | 156 |
| 252 | 3300014968 | Ga0157379_10329815 | Ga0157379_103298152 | 156 |
| 253 | 3300025898 | Ga0207692_10032812 | Ga0207692_100328123 | 156 |
| 254 | 3300025905 | Ga0207685_10045413 | Ga0207685_100454132 | 156 |
| 255 | 3300025921 | Ga0207652_10824789 | Ga0207652_108247891 | 156 |
| 256 | 3300025928 | Ga0207700_10334032 | Ga0207700_103340322 | 156 |
| 257 | 3300025933 | Ga0207706_10098568 | Ga0207706_100985683 | 156 |
| 258 | 3300025960 | Ga0207651_10139913 | Ga0207651_101399132 | 156 |
| 259 | 3300025961 | Ga0207712_10281977 | Ga0207712_102819772 | 156 |
| 260 | 3300037312 | Ga0395899_0081389 | Ga0395899_0081389_935_1474 | 156 |
| 261 | 3300037418 | Ga0395900_0030158 | Ga0395900_0030158_3719_4258 | 156 |
| 262 | 3300037466 | Ga0395898_0049455 | Ga0395898_0049455_344_883 | 156 |
| 263 | 3300038443 | Ga0395901_0006448 | Ga0395901_0006448_3787_4326 | 156 |
| 264 | 3300046455 | Ga0495603_0041607 | Ga0495603_0041607_106_633 | 156 |
| 265 | 3300046499 | Ga0495594_0233935 | Ga0495594_0233935_33_560 | 156 |
| 266 | 3300048904 | Ga0496101_0167695 | Ga0496101_0167695_359_892 | 156 |
| 267 | 3300048905 | Ga0496102_0023116 | Ga0496102_0023116_3155_3688 | 156 |
| 268 | 3300048907 | Ga0496104_0120451 | Ga0496104_0120451_1903_2436 | 156 |
| 269 | 3300048910 | Ga0496107_0192756 | Ga0496107_0192756_356_889 | 156 |
| 270 | 3300048912 | Ga0496109_0074074 | Ga0496109_0074074_656_1189 | 156 |
| 271 | 3300048915 | Ga0496112_0079005 | Ga0496112_0079005_281_808 | 156 |
| 272 | 3300048918 | Ga0496115_0508287 | Ga0496115_0508287_379_912 | 156 |
| 273 | 3300049586 | Ga0501070_0244160 | Ga0501070_0244160_295_825 | 156 |
| 274 | 3300049589 | Ga0501073_0045999 | Ga0501073_0045999_1129_1659 | 156 |
| 275 | 3300049744 | Ga0501083_0008454 | Ga0501083_0008454_6102_6632 | 156 |
| 276 | 3300060353 | Ga0501082_0222206 | Ga0501082_0222206_1067_1597 | 156 |
| 277 | 3300005444 | Ga0070694_100334790 | Ga0070694_1003347902 | 157 |
| 278 | 3300005456 | Ga0070678_100135201 | Ga0070678_1001352012 | 157 |
| 279 | 3300005563 | Ga0068855_100031660 | Ga0068855_1000316603 | 157 |
| 280 | 3300005564 | Ga0070664_100285222 | Ga0070664_1002852222 | 157 |
| 281 | 3300005614 | Ga0068856_100164360 | Ga0068856_1001643602 | 157 |
| 282 | 3300005616 | Ga0068852_100079588 | Ga0068852_1000795883 | 157 |
| 283 | 3300006028 | Ga0070717_10423517 | Ga0070717_104235172 | 157 |
| 284 | 3300006173 | Ga0070716_100548250 | Ga0070716_1005482502 | 157 |
| 285 | 3300006175 | Ga0070712_101002837 | Ga0070712_1010028371 | 157 |
| 286 | 3300006237 | Ga0097621_100021075 | Ga0097621_1000210754 | 157 |
| 287 | 3300006358 | Ga0068871_100030893 | Ga0068871_1000308932 | 157 |
| 288 | 3300009098 | Ga0105245_10152565 | Ga0105245_101525652 | 157 |
| 289 | 3300009174 | Ga0105241_10282491 | Ga0105241_102824912 | 157 |
| 290 | 3300009177 | Ga0105248_10056701 | Ga0105248_100567014 | 157 |
| 291 | 3300011119 | Ga0105246_10482729 | Ga0105246_104827292 | 157 |
| 292 | 3300012481 | Ga0157320_1021615 | Ga0157320_10216152 | 157 |
| 293 | 3300013104 | Ga0157370_11080666 | Ga0157370_110806661 | 157 |
| 294 | 3300013105 | Ga0157369_10532119 | Ga0157369_105321192 | 157 |
| 295 | 3300014325 | Ga0163163_10316586 | Ga0163163_103165862 | 157 |
| 296 | 3300025898 | Ga0207692_10284192 | Ga0207692_102841922 | 157 |
| 297 | 3300025934 | Ga0207686_10037852 | Ga0207686_100378523 | 157 |
| 298 | 3300025939 | Ga0207665_10015059 | Ga0207665_100150592 | 157 |
| 299 | 3300025941 | Ga0207711_10099011 | Ga0207711_100990112 | 157 |
| 300 | 3300025945 | Ga0207679_10128984 | Ga0207679_101289842 | 157 |
| 301 | 3300025949 | Ga0207667_10068650 | Ga0207667_100686502 | 157 |
| 302 | 3300026067 | Ga0207678_10030143 | Ga0207678_100301432 | 157 |
| 303 | 3300026088 | Ga0207641_10959794 | Ga0207641_109597942 | 157 |
| 304 | 3300026121 | Ga0207683_10007216 | Ga0207683_100072163 | 157 |
| 305 | 3300035086 | Ga0373934_0088877 | Ga0373934_0088877_615_1124 | 157 |
| 306 | 3300035111 | Ga0373923_0367730 | Ga0373923_0367730_90_599 | 157 |
| 307 | 3300035117 | Ga0373953_0001909 | Ga0373953_0001909_2462_2971 | 157 |
| 308 | 3300035118 | Ga0373954_0016524 | Ga0373954_0016524_926_1435 | 157 |
| 309 | 3300035119 | Ga0373956_0004180 | Ga0373956_0004180_1936_2445 | 157 |
| 310 | 3300035120 | Ga0373957_0004330 | Ga0373957_0004330_1915_2424 | 157 |
| 311 | 3300035171 | Ga0373946_0451959 | Ga0373946_0451959_13_522 | 157 |
| 312 | 3300035172 | Ga0373955_0014791 | Ga0373955_0014791_1774_2283 | 157 |
| 313 | 3300035692 | Ga0373935_0114880 | Ga0373935_0114880_225_734 | 157 |
| 314 | 3300035695 | Ga0373927_0331158 | Ga0373927_0331158_58_567 | 157 |
| 315 | 3300035724 | Ga0373933_0000893 | Ga0373933_0000893_16123_16632 | 157 |
| 316 | 3300037068 | Ga0373925_0374663 | Ga0373925_0374663_296_805 | 157 |
| 317 | 3300046454 | Ga0495592_0031373 | Ga0495592_0031373_297_806 | 157 |
| 318 | 3300046459 | Ga0495629_0041066 | Ga0495629_0041066_479_988 | 157 |
| 319 | 3300046462 | Ga0495651_0013246 | Ga0495651_0013246_2898_3407 | 157 |
| 320 | 3300046463 | Ga0495653_0038160 | Ga0495653_0038160_184_693 | 157 |
| 321 | 3300046477 | Ga0495664_0003348 | Ga0495664_0003348_2830_3339 | 157 |
| 322 | 3300046511 | Ga0495608_0009807 | Ga0495608_0009807_1214_1723 | 157 |
| 323 | 3300046514 | Ga0495618_0004751 | Ga0495618_0004751_4126_4635 | 157 |
| 324 | 3300046516 | Ga0495628_0002046 | Ga0495628_0002046_15879_16388 | 157 |
| 325 | 3300046517 | Ga0495630_0055331 | Ga0495630_0055331_82_591 | 157 |
| 326 | 3300046529 | Ga0495652_0020932 | Ga0495652_0020932_2771_3280 | 157 |
| 327 | 3300046533 | Ga0495640_0008637 | Ga0495640_0008637_2959_3468 | 157 |
| 328 | 3300046535 | Ga0495586_0004089 | Ga0495586_0004089_6941_7450 | 157 |
| 329 | 3300046536 | Ga0495587_0006079 | Ga0495587_0006079_5020_5529 | 157 |
| 330 | 3300046642 | Ga0495634_0019375 | Ga0495634_0019375_2628_3137 | 157 |
| 331 | 3300046663 | Ga0495635_0000736 | Ga0495635_0000736_16954_17463 | 157 |
| 332 | 3300046675 | Ga0495657_0025115 | Ga0495657_0025115_189_698 | 157 |
| 333 | 3300046678 | Ga0495599_0002064 | Ga0495599_0002064_10837_11346 | 157 |
| 334 | 3300046679 | Ga0495623_0002286 | Ga0495623_0002286_11302_11811 | 157 |
| 335 | 3300046680 | Ga0495646_0002741 | Ga0495646_0002741_7549_8058 | 157 |
| 336 | 3300046690 | Ga0495624_0014439 | Ga0495624_0014439_2742_3251 | 157 |
| 337 | 3300046809 | Ga0495600_0109398 | Ga0495600_0109398_347_856 | 157 |
| 338 | 3300047317 | Ga0495604_0020434 | Ga0495604_0020434_1619_2128 | 157 |
| 339 | 3300047319 | Ga0495674_0012879 | Ga0495674_0012879_4023_4532 | 157 |
| 340 | 3300047322 | Ga0495680_0021145 | Ga0495680_0021145_1799_2308 | 157 |
| 341 | 3300047444 | Ga0495675_0000480 | Ga0495675_0000480_2988_3497 | 157 |
| 342 | 3300048910 | Ga0496107_0785625 | Ga0496107_0785625_144_653 | 157 |
| 343 | 3300048913 | Ga0496110_0691338 | Ga0496110_0691338_297_806 | 157 |
| 344 | 3300048914 | Ga0496111_0310351 | Ga0496111_0310351_625_1134 | 157 |
| 345 | 3300048917 | Ga0496114_0757422 | Ga0496114_0757422_238_747 | 157 |
| 346 | 3300053077 | Ga0495601_0011553 | Ga0495601_0011553_1491_2000 | 157 |
| 347 | 3300053078 | Ga0495612_0004274 | Ga0495612_0004274_1048_1557 | 157 |
| 348 | 3300053084 | Ga0495595_0000420 | Ga0495595_0000420_12472_12981 | 157 |
| 349 | 3300053085 | Ga0495619_0016793 | Ga0495619_0016793_1663_2172 | 157 |
| 350 | 3300005530 | Ga0070679_100358833 | Ga0070679_1003588332 | 158 |
| 351 | 3300025921 | Ga0207652_10272766 | Ga0207652_102727662 | 158 |
| 352 | 3300045976 | Ga0466967_0732053 | Ga0466967_0732053_308_835 | 158 |
| 353 | 3300005328 | Ga0070676_10236745 | Ga0070676_102367452 | 159 |
| 354 | 3300005331 | Ga0070670_100235031 | Ga0070670_1002350312 | 159 |
| 355 | 3300005334 | Ga0068869_100661514 | Ga0068869_1006615142 | 159 |
| 356 | 3300005335 | Ga0070666_10001839 | Ga0070666_1000183915 | 159 |
| 357 | 3300005336 | Ga0070680_100124334 | Ga0070680_1001243342 | 159 |
| 358 | 3300005337 | Ga0070682_100010911 | Ga0070682_1000109112 | 159 |
| 359 | 3300005338 | Ga0068868_100259259 | Ga0068868_1002592591 | 159 |
| 360 | 3300005338 | Ga0068868_100717048 | Ga0068868_1007170481 | 159 |
| 361 | 3300005339 | Ga0070660_100430741 | Ga0070660_1004307412 | 159 |
| 362 | 3300005340 | Ga0070689_100049550 | Ga0070689_1000495502 | 159 |
| 363 | 3300005341 | Ga0070691_10060821 | Ga0070691_100608212 | 159 |
| 364 | 3300005344 | Ga0070661_100092283 | Ga0070661_1000922833 | 159 |
| 365 | 3300005355 | Ga0070671_100091245 | Ga0070671_1000912452 | 159 |
| 366 | 3300005355 | Ga0070671_100250203 | Ga0070671_1002502032 | 159 |
| 367 | 3300005365 | Ga0070688_100064025 | Ga0070688_1000640253 | 159 |
| 368 | 3300005366 | Ga0070659_100965221 | Ga0070659_1009652212 | 159 |
| 369 | 3300005367 | Ga0070667_100084445 | Ga0070667_1000844453 | 159 |
| 370 | 3300005434 | Ga0070709_10003620 | Ga0070709_100036203 | 159 |
| 371 | 3300005435 | Ga0070714_100040478 | Ga0070714_1000404781 | 159 |
| 372 | 3300005436 | Ga0070713_100156668 | Ga0070713_1001566682 | 159 |
| 373 | 3300005437 | Ga0070710_10008897 | Ga0070710_100088974 | 159 |
| 374 | 3300005439 | Ga0070711_100122379 | Ga0070711_1001223792 | 159 |
| 375 | 3300005439 | Ga0070711_100357520 | Ga0070711_1003575202 | 159 |
| 376 | 3300005440 | Ga0070705_100072916 | Ga0070705_1000729162 | 159 |
| 377 | 3300005455 | Ga0070663_100331488 | Ga0070663_1003314882 | 159 |
| 378 | 3300005456 | Ga0070678_100020403 | Ga0070678_1000204033 | 159 |
| 379 | 3300005456 | Ga0070678_100266982 | Ga0070678_1002669822 | 159 |
| 380 | 3300005458 | Ga0070681_10016649 | Ga0070681_100166493 | 159 |
| 381 | 3300005459 | Ga0068867_100330952 | Ga0068867_1003309522 | 159 |
| 382 | 3300005466 | Ga0070685_10051382 | Ga0070685_100513822 | 159 |
| 383 | 3300005530 | Ga0070679_100131590 | Ga0070679_1001315902 | 159 |
| 384 | 3300005535 | Ga0070684_100060283 | Ga0070684_1000602833 | 159 |
| 385 | 3300005535 | Ga0070684_100601370 | Ga0070684_1006013702 | 159 |
| 386 | 3300005544 | Ga0070686_100164667 | Ga0070686_1001646672 | 159 |
| 387 | 3300005546 | Ga0070696_100340163 | Ga0070696_1003401632 | 159 |
| 388 | 3300005547 | Ga0070693_100030479 | Ga0070693_1000304793 | 159 |
| 389 | 3300005547 | Ga0070693_100103745 | Ga0070693_1001037452 | 159 |
| 390 | 3300005548 | Ga0070665_100207388 | Ga0070665_1002073882 | 159 |
| 391 | 3300005564 | Ga0070664_100739967 | Ga0070664_1007399672 | 159 |
| 392 | 3300005614 | Ga0068856_100449012 | Ga0068856_1004490122 | 159 |
| 393 | 3300005618 | Ga0068864_100018526 | Ga0068864_1000185265 | 159 |
| 394 | 3300005834 | Ga0068851_10108129 | Ga0068851_101081292 | 159 |
| 395 | 3300005842 | Ga0068858_100112198 | Ga0068858_1001121982 | 159 |
| 396 | 3300005843 | Ga0068860_100745695 | Ga0068860_1007456951 | 159 |
| 397 | 3300006028 | Ga0070717_10006465 | Ga0070717_1000646510 | 159 |
| 398 | 3300006163 | Ga0070715_10029891 | Ga0070715_100298912 | 159 |
| 399 | 3300006173 | Ga0070716_100003033 | Ga0070716_1000030332 | 159 |
| 400 | 3300006237 | Ga0097621_100048453 | Ga0097621_1000484533 | 159 |
| 401 | 3300006358 | Ga0068871_100059648 | Ga0068871_1000596483 | 159 |
| 402 | 3300006871 | Ga0075434_100234596 | Ga0075434_1002345962 | 159 |
| 403 | 3300006881 | Ga0068865_100162809 | Ga0068865_1001628092 | 159 |
| 404 | 3300006881 | Ga0068865_100951326 | Ga0068865_1009513262 | 159 |
| 405 | 3300006914 | Ga0075436_100093945 | Ga0075436_1000939452 | 159 |
| 406 | 3300009011 | Ga0105251_10009243 | Ga0105251_100092437 | 159 |
| 407 | 3300009098 | Ga0105245_11023069 | Ga0105245_110230692 | 159 |
| 408 | 3300009098 | Ga0105245_11634296 | Ga0105245_116342962 | 159 |
| 409 | 3300009101 | Ga0105247_10038860 | Ga0105247_100388603 | 159 |
| 410 | 3300009148 | Ga0105243_10247884 | Ga0105243_102478842 | 159 |
| 411 | 3300009148 | Ga0105243_10612432 | Ga0105243_106124322 | 159 |
| 412 | 3300009174 | Ga0105241_10125441 | Ga0105241_101254412 | 159 |
| 413 | 3300009176 | Ga0105242_10009393 | Ga0105242_100093937 | 159 |
| 414 | 3300009177 | Ga0105248_10185800 | Ga0105248_101858002 | 159 |
| 415 | 3300009177 | Ga0105248_10857143 | Ga0105248_108571432 | 159 |
| 416 | 3300009553 | Ga0105249_10295751 | Ga0105249_102957512 | 159 |
| 417 | 3300009553 | Ga0105249_11075648 | Ga0105249_110756482 | 159 |
| 418 | 3300010375 | Ga0105239_10710429 | Ga0105239_107104292 | 159 |
| 419 | 3300010375 | Ga0105239_10835107 | Ga0105239_108351072 | 159 |
| 420 | 3300011119 | Ga0105246_10062610 | Ga0105246_100626103 | 159 |
| 421 | 3300012505 | Ga0157339_1002627 | Ga0157339_10026272 | 159 |
| 422 | 3300013296 | Ga0157374_10282802 | Ga0157374_102828021 | 159 |
| 423 | 3300013296 | Ga0157374_10299961 | Ga0157374_102999612 | 159 |
| 424 | 3300013297 | Ga0157378_10133927 | Ga0157378_101339272 | 159 |
| 425 | 3300013297 | Ga0157378_10297844 | Ga0157378_102978442 | 159 |
| 426 | 3300013306 | Ga0163162_10163610 | Ga0163162_101636102 | 159 |
| 427 | 3300013306 | Ga0163162_10895406 | Ga0163162_108954062 | 159 |
| 428 | 3300013308 | Ga0157375_10192704 | Ga0157375_101927042 | 159 |
| 429 | 3300014325 | Ga0163163_10074510 | Ga0163163_100745103 | 159 |
| 430 | 3300014325 | Ga0163163_10317763 | Ga0163163_103177632 | 159 |
| 431 | 3300014745 | Ga0157377_10143335 | Ga0157377_101433352 | 159 |
| 432 | 3300014968 | Ga0157379_10115199 | Ga0157379_101151992 | 159 |
| 433 | 3300014968 | Ga0157379_10196082 | Ga0157379_101960822 | 159 |
| 434 | 3300014969 | Ga0157376_10134633 | Ga0157376_101346333 | 159 |
| 435 | 3300014969 | Ga0157376_10151167 | Ga0157376_101511672 | 159 |
| 436 | 3300025735 | Ga0207713_1044991 | Ga0207713_10449912 | 159 |
| 437 | 3300025900 | Ga0207710_10006531 | Ga0207710_100065312 | 159 |
| 438 | 3300025900 | Ga0207710_10257605 | Ga0207710_102576052 | 159 |
| 439 | 3300025901 | Ga0207688_10203185 | Ga0207688_102031852 | 159 |
| 440 | 3300025903 | Ga0207680_10116477 | Ga0207680_101164772 | 159 |
| 441 | 3300025905 | Ga0207685_10028132 | Ga0207685_100281322 | 159 |
| 442 | 3300025906 | Ga0207699_10004580 | Ga0207699_100045802 | 159 |
| 443 | 3300025907 | Ga0207645_10049222 | Ga0207645_100492223 | 159 |
| 444 | 3300025912 | Ga0207707_10111063 | Ga0207707_101110632 | 159 |
| 445 | 3300025913 | Ga0207695_10965032 | Ga0207695_109650321 | 159 |
| 446 | 3300025916 | Ga0207663_10128103 | Ga0207663_101281032 | 159 |
| 447 | 3300025916 | Ga0207663_10514025 | Ga0207663_105140252 | 159 |
| 448 | 3300025917 | Ga0207660_10186507 | Ga0207660_101865072 | 159 |
| 449 | 3300025918 | Ga0207662_10652402 | Ga0207662_106524022 | 159 |
| 450 | 3300025919 | Ga0207657_10320497 | Ga0207657_103204972 | 159 |
| 451 | 3300025920 | Ga0207649_10306640 | Ga0207649_103066402 | 159 |
| 452 | 3300025921 | Ga0207652_10076720 | Ga0207652_100767203 | 159 |
| 453 | 3300025925 | Ga0207650_10020018 | Ga0207650_100200185 | 159 |
| 454 | 3300025927 | Ga0207687_10120117 | Ga0207687_101201172 | 159 |
| 455 | 3300025927 | Ga0207687_10223689 | Ga0207687_102236892 | 159 |
| 456 | 3300025928 | Ga0207700_10003518 | Ga0207700_100035185 | 159 |
| 457 | 3300025929 | Ga0207664_10048472 | Ga0207664_100484723 | 159 |
| 458 | 3300025931 | Ga0207644_10003263 | Ga0207644_100032635 | 159 |
| 459 | 3300025931 | Ga0207644_10557139 | Ga0207644_105571392 | 159 |
| 460 | 3300025932 | Ga0207690_10139249 | Ga0207690_101392491 | 159 |
| 461 | 3300025934 | Ga0207686_10032046 | Ga0207686_100320463 | 159 |
| 462 | 3300025937 | Ga0207669_10165681 | Ga0207669_101656812 | 159 |
| 463 | 3300025938 | Ga0207704_10003914 | Ga0207704_100039144 | 159 |
| 464 | 3300025938 | Ga0207704_10939779 | Ga0207704_109397792 | 159 |
| 465 | 3300025939 | Ga0207665_10000417 | Ga0207665_1000041735 | 159 |
| 466 | 3300025941 | Ga0207711_10289961 | Ga0207711_102899612 | 159 |
| 467 | 3300025942 | Ga0207689_10296686 | Ga0207689_102966861 | 159 |
| 468 | 3300025944 | Ga0207661_10223394 | Ga0207661_102233942 | 159 |
| 469 | 3300025944 | Ga0207661_10455646 | Ga0207661_104556462 | 159 |
| 470 | 3300025945 | Ga0207679_10468933 | Ga0207679_104689332 | 159 |
| 471 | 3300025945 | Ga0207679_10799771 | Ga0207679_107997712 | 159 |
| 472 | 3300025961 | Ga0207712_10084342 | Ga0207712_100843422 | 159 |
| 473 | 3300025986 | Ga0207658_10198152 | Ga0207658_101981522 | 159 |
| 474 | 3300026023 | Ga0207677_10264725 | Ga0207677_102647252 | 159 |
| 475 | 3300026035 | Ga0207703_10122397 | Ga0207703_101223973 | 159 |
| 476 | 3300026067 | Ga0207678_10048617 | Ga0207678_100486172 | 159 |
| 477 | 3300026075 | Ga0207708_10137355 | Ga0207708_101373553 | 159 |
| 478 | 3300026075 | Ga0207708_10203604 | Ga0207708_102036042 | 159 |
| 479 | 3300026078 | Ga0207702_10920268 | Ga0207702_109202682 | 159 |
| 480 | 3300026088 | Ga0207641_10917150 | Ga0207641_109171502 | 159 |
| 481 | 3300026089 | Ga0207648_10185015 | Ga0207648_101850152 | 159 |
| 482 | 3300026095 | Ga0207676_10014152 | Ga0207676_100141525 | 159 |
| 483 | 3300026095 | Ga0207676_10445788 | Ga0207676_104457882 | 159 |
| 484 | 3300026121 | Ga0207683_10037275 | Ga0207683_100372754 | 159 |
| 485 | 3300026121 | Ga0207683_10316409 | Ga0207683_103164091 | 159 |
| 486 | 3300026142 | Ga0207698_11345622 | Ga0207698_113456221 | 159 |
| 487 | 3300027907 | Ga0207428_10905284 | Ga0207428_109052841 | 159 |
| 488 | 3300028379 | Ga0268266_10818748 | Ga0268266_108187482 | 159 |
| 489 | 3300028381 | Ga0268264_10217943 | Ga0268264_102179432 | 159 |
| 490 | 3300028381 | Ga0268264_10394554 | Ga0268264_103945542 | 159 |
| 491 | 3300028381 | Ga0268264_10590759 | Ga0268264_105907592 | 159 |
| 492 | 3300034817 | Ga0373948_0010635 | Ga0373948_0010635_459_938 | 159 |
| 493 | 3300034819 | Ga0373958_0004355 | Ga0373958_0004355_266_745 | 159 |
| 494 | 3300034820 | Ga0373959_0012691 | Ga0373959_0012691_516_995 | 159 |
| 495 | 3300034957 | Ga0373938_0030785 | Ga0373938_0030785_161_640 | 159 |
| 496 | 3300035084 | Ga0373928_0005079 | Ga0373928_0005079_825_1304 | 159 |
| 497 | 3300035085 | Ga0373929_0024438 | Ga0373929_0024438_749_1228 | 159 |
| 498 | 3300035088 | Ga0373940_0054586 | Ga0373940_0054586_141_620 | 159 |
| 499 | 3300035091 | Ga0373951_0012104 | Ga0373951_0012104_1050_1565 | 159 |
| 500 | 3300035092 | Ga0373952_0005360 | Ga0373952_0005360_217_696 | 159 |
| 501 | 3300035111 | Ga0373923_0012915 | Ga0373923_0012915_1716_2195 | 159 |
| 502 | 3300035113 | Ga0373936_0297987 | Ga0373936_0297987_93_572 | 159 |
| 503 | 3300035114 | Ga0373939_0064153 | Ga0373939_0064153_82_561 | 159 |
| 504 | 3300035116 | Ga0373945_0000687 | Ga0373945_0000687_1817_2296 | 159 |
| 505 | 3300035118 | Ga0373954_0008788 | Ga0373954_0008788_488_967 | 159 |
| 506 | 3300035120 | Ga0373957_0139488 | Ga0373957_0139488_40_519 | 159 |
| 507 | 3300035121 | Ga0373960_0097115 | Ga0373960_0097115_299_778 | 159 |
| 508 | 3300035170 | Ga0373943_0025872 | Ga0373943_0025872_1712_2191 | 159 |
| 509 | 3300035171 | Ga0373946_0011915 | Ga0373946_0011915_1773_2252 | 159 |
| 510 | 3300035171 | Ga0373946_0057297 | Ga0373946_0057297_313_792 | 159 |
| 511 | 3300035172 | Ga0373955_0244843 | Ga0373955_0244843_89_568 | 159 |
| 512 | 3300035207 | Ga0373942_0007512 | Ga0373942_0007512_293_772 | 159 |
| 513 | 3300035207 | Ga0373942_0189397 | Ga0373942_0189397_145_660 | 159 |
| 514 | 3300035241 | Ga0373961_0005944 | Ga0373961_0005944_1453_1932 | 159 |
| 515 | 3300035242 | Ga0373962_0013472 | Ga0373962_0013472_1128_1607 | 159 |
| 516 | 3300035410 | Ga0373924_0049898 | Ga0373924_0049898_303_782 | 159 |
| 517 | 3300035692 | Ga0373935_0320575 | Ga0373935_0320575_359_838 | 159 |
| 518 | 3300035695 | Ga0373927_0031200 | Ga0373927_0031200_1428_1907 | 159 |
| 519 | 3300035725 | Ga0373947_0013898 | Ga0373947_0013898_1610_2089 | 159 |
| 520 | 3300035725 | Ga0373947_0106326 | Ga0373947_0106326_998_1477 | 159 |
| 521 | 3300036401 | Ga0373937_0084336 | Ga0373937_0084336_1740_2219 | 159 |
| 522 | 3300036401 | Ga0373937_0334901 | Ga0373937_0334901_509_988 | 159 |
| 523 | 3300037068 | Ga0373925_0149411 | Ga0373925_0149411_1330_1809 | 159 |
| 524 | 3300045051 | Ga0451576_0309129 | Ga0451576_0309129_608_1087 | 159 |
| 525 | 3300046452 | Ga0495617_072191 | Ga0495617_072191_152_631 | 159 |
| 526 | 3300046455 | Ga0495603_0025839 | Ga0495603_0025839_1410_1889 | 159 |
| 527 | 3300046458 | Ga0495591_113022 | Ga0495591_113022_83_562 | 159 |
| 528 | 3300046459 | Ga0495629_0002067 | Ga0495629_0002067_2478_2957 | 159 |
| 529 | 3300046459 | Ga0495629_0076460 | Ga0495629_0076460_1696_2175 | 159 |
| 530 | 3300046461 | Ga0495641_0017165 | Ga0495641_0017165_1816_2295 | 159 |
| 531 | 3300046461 | Ga0495641_0089052 | Ga0495641_0089052_648_1127 | 159 |
| 532 | 3300046462 | Ga0495651_0003892 | Ga0495651_0003892_10929_11408 | 159 |
| 533 | 3300046463 | Ga0495653_0010574 | Ga0495653_0010574_5546_6025 | 159 |
| 534 | 3300046463 | Ga0495653_0245634 | Ga0495653_0245634_27_506 | 159 |
| 535 | 3300046472 | Ga0495580_0035178 | Ga0495580_0035178_1794_2273 | 159 |
| 536 | 3300046473 | Ga0495582_0059398 | Ga0495582_0059398_90_569 | 159 |
| 537 | 3300046475 | Ga0495639_0030981 | Ga0495639_0030981_570_1049 | 159 |
| 538 | 3300046475 | Ga0495639_0064199 | Ga0495639_0064199_1020_1499 | 159 |
| 539 | 3300046476 | Ga0495662_0028948 | Ga0495662_0028948_1330_1809 | 159 |
| 540 | 3300046477 | Ga0495664_0078730 | Ga0495664_0078730_614_1093 | 159 |
| 541 | 3300046491 | Ga0495584_0041089 | Ga0495584_0041089_20_499 | 159 |
| 542 | 3300046499 | Ga0495594_0026532 | Ga0495594_0026532_1724_2203 | 159 |
| 543 | 3300046499 | Ga0495594_0038501 | Ga0495594_0038501_803_1282 | 159 |
| 544 | 3300046501 | Ga0495607_0458264 | Ga0495607_0458264_20_499 | 159 |
| 545 | 3300046511 | Ga0495608_0071850 | Ga0495608_0071850_703_1182 | 159 |
| 546 | 3300046514 | Ga0495618_0199829 | Ga0495618_0199829_89_568 | 159 |
| 547 | 3300046516 | Ga0495628_0049119 | Ga0495628_0049119_1466_1945 | 159 |
| 548 | 3300046517 | Ga0495630_0030402 | Ga0495630_0030402_1841_2320 | 159 |
| 549 | 3300046518 | Ga0495631_0117810 | Ga0495631_0117810_643_1122 | 159 |
| 550 | 3300046520 | Ga0495637_0038624 | Ga0495637_0038624_612_1091 | 159 |
| 551 | 3300046523 | Ga0495644_0061346 | Ga0495644_0061346_20_499 | 159 |
| 552 | 3300046525 | Ga0495663_0103796 | Ga0495663_0103796_65_544 | 159 |
| 553 | 3300046526 | Ga0495666_0021257 | Ga0495666_0021257_1258_1737 | 159 |
| 554 | 3300046531 | Ga0495665_0261136 | Ga0495665_0261136_244_723 | 159 |
| 555 | 3300046533 | Ga0495640_0179741 | Ga0495640_0179741_780_1259 | 159 |
| 556 | 3300046535 | Ga0495586_0029120 | Ga0495586_0029120_1872_2351 | 159 |
| 557 | 3300046536 | Ga0495587_0013640 | Ga0495587_0013640_618_1097 | 159 |
| 558 | 3300046537 | Ga0495598_0003603 | Ga0495598_0003603_222_701 | 159 |
| 559 | 3300046557 | Ga0495622_0013106 | Ga0495622_0013106_592_1071 | 159 |
| 560 | 3300046559 | Ga0495667_0002342 | Ga0495667_0002342_10523_11002 | 159 |
| 561 | 3300046615 | Ga0495656_0009862 | Ga0495656_0009862_2115_2594 | 159 |
| 562 | 3300046642 | Ga0495634_0025736 | Ga0495634_0025736_1684_2163 | 159 |
| 563 | 3300046648 | Ga0495611_0051766 | Ga0495611_0051766_1247_1726 | 159 |
| 564 | 3300046663 | Ga0495635_0025074 | Ga0495635_0025074_1879_2358 | 159 |
| 565 | 3300046664 | Ga0495659_0317643 | Ga0495659_0317643_163_642 | 159 |
| 566 | 3300046674 | Ga0495588_0013638 | Ga0495588_0013638_2142_2621 | 159 |
| 567 | 3300046678 | Ga0495599_0155610 | Ga0495599_0155610_813_1292 | 159 |
| 568 | 3300046680 | Ga0495646_0054470 | Ga0495646_0054470_104_583 | 159 |
| 569 | 3300046681 | Ga0495647_0010583 | Ga0495647_0010583_1637_2116 | 159 |
| 570 | 3300046683 | Ga0495658_0001370 | Ga0495658_0001370_1481_1960 | 159 |
| 571 | 3300046684 | Ga0495669_0020794 | Ga0495669_0020794_1156_1635 | 159 |
| 572 | 3300046689 | Ga0495613_0006674 | Ga0495613_0006674_287_766 | 159 |
| 573 | 3300046689 | Ga0495613_0098623 | Ga0495613_0098623_507_986 | 159 |
| 574 | 3300046691 | Ga0495670_0006726 | Ga0495670_0006726_2032_2511 | 159 |
| 575 | 3300046809 | Ga0495600_0003589 | Ga0495600_0003589_7004_7483 | 159 |
| 576 | 3300047315 | Ga0495581_0005348 | Ga0495581_0005348_697_1176 | 159 |
| 577 | 3300047315 | Ga0495581_0046501 | Ga0495581_0046501_598_1077 | 159 |
| 578 | 3300047317 | Ga0495604_0075847 | Ga0495604_0075847_1125_1604 | 159 |
| 579 | 3300047321 | Ga0495676_0072815 | Ga0495676_0072815_1819_2298 | 159 |
| 580 | 3300047322 | Ga0495680_0011290 | Ga0495680_0011290_3043_3522 | 159 |
| 581 | 3300047322 | Ga0495680_0036428 | Ga0495680_0036428_2242_2721 | 159 |
| 582 | 3300047471 | Ga0495684_0009067 | Ga0495684_0009067_4564_5043 | 159 |
| 583 | 3300047673 | Ga0495593_0009427 | Ga0495593_0009427_2792_3271 | 159 |
| 584 | 3300047673 | Ga0495593_0070727 | Ga0495593_0070727_1126_1605 | 159 |
| 585 | 3300048088 | Ga0495602_0352227 | Ga0495602_0352227_89_568 | 159 |
| 586 | 3300048089 | Ga0495614_0022914 | Ga0495614_0022914_123_602 | 159 |
| 587 | 3300048903 | Ga0496100_0008197 | Ga0496100_0008197_4394_4873 | 159 |
| 588 | 3300048903 | Ga0496100_0068502 | Ga0496100_0068502_494_973 | 159 |
| 589 | 3300048904 | Ga0496101_0253127 | Ga0496101_0253127_402_881 | 159 |
| 590 | 3300048905 | Ga0496102_0232125 | Ga0496102_0232125_388_903 | 159 |
| 591 | 3300048905 | Ga0496102_0241653 | Ga0496102_0241653_230_709 | 159 |
| 592 | 3300048905 | Ga0496102_0257080 | Ga0496102_0257080_1023_1502 | 159 |
| 593 | 3300048905 | Ga0496102_0441266 | Ga0496102_0441266_447_926 | 159 |
| 594 | 3300048906 | Ga0496103_0039242 | Ga0496103_0039242_898_1377 | 159 |
| 595 | 3300048907 | Ga0496104_0059037 | Ga0496104_0059037_1148_1627 | 159 |
| 596 | 3300048907 | Ga0496104_0062929 | Ga0496104_0062929_2277_2756 | 159 |
| 597 | 3300048908 | Ga0496105_0071127 | Ga0496105_0071127_185_664 | 159 |
| 598 | 3300048908 | Ga0496105_0116920 | Ga0496105_0116920_1216_1695 | 159 |
| 599 | 3300048908 | Ga0496105_0523047 | Ga0496105_0523047_131_646 | 159 |
| 600 | 3300048909 | Ga0496106_0028707 | Ga0496106_0028707_505_1020 | 159 |
| 601 | 3300048909 | Ga0496106_0423263 | Ga0496106_0423263_282_761 | 159 |
| 602 | 3300048910 | Ga0496107_0064606 | Ga0496107_0064606_1562_2077 | 159 |
| 603 | 3300048911 | Ga0496108_0043797 | Ga0496108_0043797_2565_3044 | 159 |
| 604 | 3300048911 | Ga0496108_0160018 | Ga0496108_0160018_316_795 | 159 |
| 605 | 3300048912 | Ga0496109_0033913 | Ga0496109_0033913_930_1409 | 159 |
| 606 | 3300048912 | Ga0496109_0061718 | Ga0496109_0061718_2050_2529 | 159 |
| 607 | 3300048912 | Ga0496109_0093167 | Ga0496109_0093167_1124_1603 | 159 |
| 608 | 3300048913 | Ga0496110_0077993 | Ga0496110_0077993_1548_2027 | 159 |
| 609 | 3300048914 | Ga0496111_0022875 | Ga0496111_0022875_844_1323 | 159 |
| 610 | 3300048914 | Ga0496111_0171211 | Ga0496111_0171211_808_1287 | 159 |
| 611 | 3300048915 | Ga0496112_0070793 | Ga0496112_0070793_2350_2829 | 159 |
| 612 | 3300048915 | Ga0496112_0121818 | Ga0496112_0121818_1002_1481 | 159 |
| 613 | 3300048915 | Ga0496112_0339166 | Ga0496112_0339166_102_581 | 159 |
| 614 | 3300048916 | Ga0496113_0076978 | Ga0496113_0076978_1052_1531 | 159 |
| 615 | 3300048917 | Ga0496114_0010304 | Ga0496114_0010304_1430_1909 | 159 |
| 616 | 3300048918 | Ga0496115_0047377 | Ga0496115_0047377_1195_1710 | 159 |
| 617 | 3300048918 | Ga0496115_0142243 | Ga0496115_0142243_353_832 | 159 |
| 618 | 3300048918 | Ga0496115_0189633 | Ga0496115_0189633_241_720 | 159 |
| 619 | 3300048924 | Ga0496121_0601147 | Ga0496121_0601147_112_591 | 159 |
| 620 | 3300048928 | Ga0496125_0131914 | Ga0496125_0131914_638_1117 | 159 |
| 621 | 3300050512 | nmdc:mga0n895_286420_c1 | nmdc:mga0n895_286420_c1_135_650 | 159 |
| 622 | 3300050513 | nmdc:mga0rr50_950190_c1 | nmdc:mga0rr50_950190_c1_97_576 | 159 |
| 623 | 3300053077 | Ga0495601_0189704 | Ga0495601_0189704_110_589 | 159 |
| 624 | 3300053084 | Ga0495595_0002620 | Ga0495595_0002620_5794_6273 | 159 |
| 625 | 3300053085 | Ga0495619_0057856 | Ga0495619_0057856_1984_2463 | 159 |
| 626 | 3300053085 | Ga0495619_0060868 | Ga0495619_0060868_1264_1743 | 159 |
| 627 | 3300053094 | Ga0500566_0193529 | Ga0500566_0193529_383_862 | 159 |
| 628 | 3300006175 | Ga0070712_100269137 | Ga0070712_1002691372 | 160 |
| 629 | 3300025915 | Ga0207693_10185639 | Ga0207693_101856392 | 160 |
| 630 | 2162886011 | MRS1b_contig_7410661 | MRS1b_0691.00001930 | 161 |
| 631 | 2209111006 | 2214756332 | 2213770193 | 161 |
| 632 | 3300000042 | ARSoilYngRDRAFT_c00187 | ARSoilYngRDRAFT_0018710 | 161 |
| 633 | 3300000043 | ARcpr5yngRDRAFT_c000626 | ARcpr5yngRDRAFT_0006262 | 161 |
| 634 | 3300000044 | ARSoilOldRDRAFT_c000105 | ARSoilOldRDRAFT_0001052 | 161 |
| 635 | 3300000045 | ARCol0oldRDRAFT_c00945 | ARCol0oldRDRAFT_009452 | 161 |
| 636 | 3300000652 | ARCol0yngRDRAFT_1000034 | ARCol0yngRDRAFT_10000342 | 161 |
| 637 | 3300001904 | JGI24736J21556_1020600 | JGI24736J21556_10206002 | 161 |
| 638 | 3300001915 | JGI24741J21665_1018201 | JGI24741J21665_10182012 | 161 |
| 639 | 3300001977 | JGI24746J21847_1001098 | JGI24746J21847_10010982 | 161 |
| 640 | 3300001989 | JGI24739J22299_10000164 | JGI24739J22299_1000016423 | 161 |
| 641 | 3300001990 | JGI24737J22298_10001508 | JGI24737J22298_100015084 | 161 |
| 642 | 3300001990 | JGI24737J22298_10001579 | JGI24737J22298_100015797 | 161 |
| 643 | 3300001991 | JGI24743J22301_10012313 | JGI24743J22301_100123132 | 161 |
| 644 | 3300002070 | JGI24750J21931_1000344 | JGI24750J21931_10003444 | 161 |
| 645 | 3300002073 | JGI24745J21846_1001611 | JGI24745J21846_10016112 | 161 |
| 646 | 3300002075 | JGI24738J21930_10000112 | JGI24738J21930_1000011219 | 161 |
| 647 | 3300002076 | JGI24749J21850_1000411 | JGI24749J21850_10004116 | 161 |
| 648 | 3300002077 | JGI24744J21845_10024671 | JGI24744J21845_100246712 | 161 |
| 649 | 3300002126 | JGI24035J26624_1000107 | JGI24035J26624_10001075 | 161 |
| 650 | 3300002239 | JGI24034J26672_10001485 | JGI24034J26672_100014853 | 161 |
| 651 | 3300002244 | JGI24742J22300_10000359 | JGI24742J22300_100003594 | 161 |
| 652 | 3300002459 | JGI24751J29686_10092099 | JGI24751J29686_100920991 | 161 |
| 653 | 3300003347 | JGI26128J50194_1007301 | JGI26128J50194_10073012 | 161 |
| 654 | 3300005290 | Ga0065712_10071820 | Ga0065712_100718203 | 161 |
| 655 | 3300005290 | Ga0065712_10098339 | Ga0065712_100983392 | 161 |
| 656 | 3300005293 | Ga0065715_10001049 | Ga0065715_100010495 | 161 |
| 657 | 3300005293 | Ga0065715_10001550 | Ga0065715_100015503 | 161 |
| 658 | 3300005293 | Ga0065715_10208859 | Ga0065715_102088592 | 161 |
| 659 | 3300005295 | Ga0065707_10123077 | Ga0065707_101230773 | 161 |
| 660 | 3300005328 | Ga0070676_10000755 | Ga0070676_100007558 | 161 |
| 661 | 3300005329 | Ga0070683_100000376 | Ga0070683_10000037631 | 161 |
| 662 | 3300005329 | Ga0070683_100617469 | Ga0070683_1006174692 | 161 |
| 663 | 3300005330 | Ga0070690_100001711 | Ga0070690_1000017117 | 161 |
| 664 | 3300005330 | Ga0070690_100006546 | Ga0070690_1000065465 | 161 |
| 665 | 3300005330 | Ga0070690_100221375 | Ga0070690_1002213752 | 161 |
| 666 | 3300005333 | Ga0070677_10001502 | Ga0070677_100015027 | 161 |
| 667 | 3300005334 | Ga0068869_100000523 | Ga0068869_10000052320 | 161 |
| 668 | 3300005335 | Ga0070666_10006461 | Ga0070666_100064615 | 161 |
| 669 | 3300005336 | Ga0070680_100007212 | Ga0070680_1000072127 | 161 |
| 670 | 3300005336 | Ga0070680_101282681 | Ga0070680_1012826811 | 161 |
| 671 | 3300005337 | Ga0070682_100000141 | Ga0070682_10000014125 | 161 |
| 672 | 3300005337 | Ga0070682_100466906 | Ga0070682_1004669062 | 161 |
| 673 | 3300005338 | Ga0068868_100037520 | Ga0068868_1000375204 | 161 |
| 674 | 3300005339 | Ga0070660_100002574 | Ga0070660_10000257412 | 161 |
| 675 | 3300005340 | Ga0070689_100038887 | Ga0070689_1000388873 | 161 |
| 676 | 3300005340 | Ga0070689_100084736 | Ga0070689_1000847362 | 161 |
| 677 | 3300005341 | Ga0070691_10000190 | Ga0070691_100001907 | 161 |
| 678 | 3300005343 | Ga0070687_100000212 | Ga0070687_1000002127 | 161 |
| 679 | 3300005343 | Ga0070687_100030889 | Ga0070687_1000308892 | 161 |
| 680 | 3300005344 | Ga0070661_100000242 | Ga0070661_10000024252 | 161 |
| 681 | 3300005344 | Ga0070661_100686622 | Ga0070661_1006866222 | 161 |
| 682 | 3300005345 | Ga0070692_10007147 | Ga0070692_100071475 | 161 |
| 683 | 3300005353 | Ga0070669_100000593 | Ga0070669_10000059321 | 161 |
| 684 | 3300005354 | Ga0070675_100000165 | Ga0070675_10000016541 | 161 |
| 685 | 3300005355 | Ga0070671_100010995 | Ga0070671_1000109953 | 161 |
| 686 | 3300005355 | Ga0070671_100397850 | Ga0070671_1003978502 | 161 |
| 687 | 3300005356 | Ga0070674_100000450 | Ga0070674_10000045020 | 161 |
| 688 | 3300005365 | Ga0070688_100036300 | Ga0070688_1000363002 | 161 |
| 689 | 3300005366 | Ga0070659_100000988 | Ga0070659_1000009885 | 161 |
| 690 | 3300005366 | Ga0070659_100016224 | Ga0070659_1000162244 | 161 |
| 691 | 3300005367 | Ga0070667_100000759 | Ga0070667_1000007599 | 161 |
| 692 | 3300005406 | Ga0070703_10006259 | Ga0070703_100062593 | 161 |
| 693 | 3300005435 | Ga0070714_100207666 | Ga0070714_1002076662 | 161 |
| 694 | 3300005437 | Ga0070710_10304996 | Ga0070710_103049961 | 161 |
| 695 | 3300005438 | Ga0070701_10000103 | Ga0070701_1000010324 | 161 |
| 696 | 3300005439 | Ga0070711_100231133 | Ga0070711_1002311331 | 161 |
| 697 | 3300005440 | Ga0070705_100029576 | Ga0070705_1000295763 | 161 |
| 698 | 3300005440 | Ga0070705_100136287 | Ga0070705_1001362872 | 161 |
| 699 | 3300005441 | Ga0070700_100000364 | Ga0070700_1000003647 | 161 |
| 700 | 3300005444 | Ga0070694_100000880 | Ga0070694_10000088018 | 161 |
| 701 | 3300005445 | Ga0070708_100103778 | Ga0070708_1001037782 | 161 |
| 702 | 3300005455 | Ga0070663_100000417 | Ga0070663_10000041720 | 161 |
| 703 | 3300005455 | Ga0070663_100095890 | Ga0070663_1000958902 | 161 |
| 704 | 3300005456 | Ga0070678_100001012 | Ga0070678_1000010122 | 161 |
| 705 | 3300005457 | Ga0070662_100000796 | Ga0070662_1000007963 | 161 |
| 706 | 3300005458 | Ga0070681_10002475 | Ga0070681_100024752 | 161 |
| 707 | 3300005458 | Ga0070681_10076422 | Ga0070681_100764222 | 161 |
| 708 | 3300005458 | Ga0070681_10160379 | Ga0070681_101603792 | 161 |
| 709 | 3300005459 | Ga0068867_100009775 | Ga0068867_1000097752 | 161 |
| 710 | 3300005466 | Ga0070685_10000547 | Ga0070685_100005479 | 161 |
| 711 | 3300005518 | Ga0070699_100602141 | Ga0070699_1006021412 | 161 |
| 712 | 3300005530 | Ga0070679_100010894 | Ga0070679_1000108943 | 161 |
| 713 | 3300005535 | Ga0070684_100000755 | Ga0070684_10000075520 | 161 |
| 714 | 3300005536 | Ga0070697_100044337 | Ga0070697_1000443374 | 161 |
| 715 | 3300005539 | Ga0068853_100000483 | Ga0068853_10000048316 | 161 |
| 716 | 3300005543 | Ga0070672_100000527 | Ga0070672_10000052720 | 161 |
| 717 | 3300005544 | Ga0070686_100002014 | Ga0070686_1000020147 | 161 |
| 718 | 3300005544 | Ga0070686_100062310 | Ga0070686_1000623102 | 161 |
| 719 | 3300005545 | Ga0070695_100003705 | Ga0070695_1000037055 | 161 |
| 720 | 3300005546 | Ga0070696_100006474 | Ga0070696_1000064746 | 161 |
| 721 | 3300005546 | Ga0070696_100007364 | Ga0070696_1000073643 | 161 |
| 722 | 3300005546 | Ga0070696_100692801 | Ga0070696_1006928012 | 161 |
| 723 | 3300005547 | Ga0070693_100000199 | Ga0070693_1000001997 | 161 |
| 724 | 3300005548 | Ga0070665_100278950 | Ga0070665_1002789502 | 161 |
| 725 | 3300005549 | Ga0070704_100022794 | Ga0070704_1000227942 | 161 |
| 726 | 3300005563 | Ga0068855_100004444 | Ga0068855_1000044443 | 161 |
| 727 | 3300005564 | Ga0070664_100000895 | Ga0070664_1000008955 | 161 |
| 728 | 3300005564 | Ga0070664_100124321 | Ga0070664_1001243212 | 161 |
| 729 | 3300005577 | Ga0068857_100001816 | Ga0068857_10000181616 | 161 |
| 730 | 3300005578 | Ga0068854_100001666 | Ga0068854_1000016669 | 161 |
| 731 | 3300005614 | Ga0068856_100001538 | Ga0068856_1000015389 | 161 |
| 732 | 3300005615 | Ga0070702_100001415 | Ga0070702_1000014152 | 161 |
| 733 | 3300005616 | Ga0068852_100002972 | Ga0068852_1000029727 | 161 |
| 734 | 3300005616 | Ga0068852_100110846 | Ga0068852_1001108462 | 161 |
| 735 | 3300005617 | Ga0068859_100013486 | Ga0068859_1000134867 | 161 |
| 736 | 3300005617 | Ga0068859_100173949 | Ga0068859_1001739492 | 161 |
| 737 | 3300005618 | Ga0068864_100001172 | Ga0068864_1000011724 | 161 |
| 738 | 3300005618 | Ga0068864_100276215 | Ga0068864_1002762152 | 161 |
| 739 | 3300005718 | Ga0068866_10003190 | Ga0068866_100031907 | 161 |
| 740 | 3300005719 | Ga0068861_100005060 | Ga0068861_1000050604 | 161 |
| 741 | 3300005840 | Ga0068870_10000155 | Ga0068870_1000015513 | 161 |
| 742 | 3300005841 | Ga0068863_100000495 | Ga0068863_10000049526 | 161 |
| 743 | 3300005842 | Ga0068858_100000783 | Ga0068858_10000078323 | 161 |
| 744 | 3300005842 | Ga0068858_100049192 | Ga0068858_1000491923 | 161 |
| 745 | 3300005843 | Ga0068860_100024037 | Ga0068860_1000240374 | 161 |
| 746 | 3300005844 | Ga0068862_100020432 | Ga0068862_1000204325 | 161 |
| 747 | 3300005937 | Ga0081455_10000204 | Ga0081455_1000020488 | 161 |
| 748 | 3300005937 | Ga0081455_10242172 | Ga0081455_102421721 | 161 |
| 749 | 3300006058 | Ga0075432_10147364 | Ga0075432_101473642 | 161 |
| 750 | 3300006178 | Ga0075367_10216870 | Ga0075367_102168702 | 161 |
| 751 | 3300006237 | Ga0097621_100000010 | Ga0097621_10000001029 | 161 |
| 752 | 3300006358 | Ga0068871_100000034 | Ga0068871_10000003442 | 161 |
| 753 | 3300006844 | Ga0075428_100381795 | Ga0075428_1003817952 | 161 |
| 754 | 3300006844 | Ga0075428_101007026 | Ga0075428_1010070262 | 161 |
| 755 | 3300006846 | Ga0075430_100005590 | Ga0075430_10000559010 | 161 |
| 756 | 3300006847 | Ga0075431_100004052 | Ga0075431_1000040524 | 161 |
| 757 | 3300006852 | Ga0075433_10000774 | Ga0075433_1000077422 | 161 |
| 758 | 3300006852 | Ga0075433_10009145 | Ga0075433_100091459 | 161 |
| 759 | 3300006852 | Ga0075433_10267078 | Ga0075433_102670782 | 161 |
| 760 | 3300006871 | Ga0075434_100001700 | Ga0075434_1000017004 | 161 |
| 761 | 3300006871 | Ga0075434_100005910 | Ga0075434_10000591010 | 161 |
| 762 | 3300006871 | Ga0075434_100061647 | Ga0075434_1000616474 | 161 |
| 763 | 3300006871 | Ga0075434_100944090 | Ga0075434_1009440902 | 161 |
| 764 | 3300006880 | Ga0075429_100007130 | Ga0075429_10000713010 | 161 |
| 765 | 3300006881 | Ga0068865_100000230 | Ga0068865_10000023016 | 161 |
| 766 | 3300006914 | Ga0075436_100085251 | Ga0075436_1000852512 | 161 |
| 767 | 3300006914 | Ga0075436_100264830 | Ga0075436_1002648302 | 161 |
| 768 | 3300006931 | Ga0097620_100013487 | Ga0097620_1000134877 | 161 |
| 769 | 3300006931 | Ga0097620_100173947 | Ga0097620_1001739473 | 161 |
| 770 | 3300007076 | Ga0075435_100054003 | Ga0075435_1000540032 | 161 |
| 771 | 3300007076 | Ga0075435_100300755 | Ga0075435_1003007552 | 161 |
| 772 | 3300009092 | Ga0105250_10055797 | Ga0105250_100557972 | 161 |
| 773 | 3300009093 | Ga0105240_10101227 | Ga0105240_101012273 | 161 |
| 774 | 3300009094 | Ga0111539_10000932 | Ga0111539_100009323 | 161 |
| 775 | 3300009094 | Ga0111539_10002162 | Ga0111539_100021627 | 161 |
| 776 | 3300009094 | Ga0111539_10010377 | Ga0111539_1001037710 | 161 |
| 777 | 3300009098 | Ga0105245_10000258 | Ga0105245_1000025818 | 161 |
| 778 | 3300009101 | Ga0105247_10002128 | Ga0105247_100021283 | 161 |
| 779 | 3300009147 | Ga0114129_10207007 | Ga0114129_102070072 | 161 |
| 780 | 3300009147 | Ga0114129_10234184 | Ga0114129_102341842 | 161 |
| 781 | 3300009148 | Ga0105243_10000846 | Ga0105243_100008463 | 161 |
| 782 | 3300009148 | Ga0105243_10065468 | Ga0105243_100654684 | 161 |
| 783 | 3300009174 | Ga0105241_10002261 | Ga0105241_100022617 | 161 |
| 784 | 3300009176 | Ga0105242_10000037 | Ga0105242_1000003747 | 161 |
| 785 | 3300009176 | Ga0105242_10178096 | Ga0105242_101780962 | 161 |
| 786 | 3300009177 | Ga0105248_10000744 | Ga0105248_100007442 | 161 |
| 787 | 3300009177 | Ga0105248_10149553 | Ga0105248_101495533 | 161 |
| 788 | 3300009545 | Ga0105237_10037795 | Ga0105237_100377954 | 161 |
| 789 | 3300009545 | Ga0105237_10053692 | Ga0105237_100536923 | 161 |
| 790 | 3300009551 | Ga0105238_10236325 | Ga0105238_102363252 | 161 |
| 791 | 3300009553 | Ga0105249_10000209 | Ga0105249_1000020938 | 161 |
| 792 | 3300009553 | Ga0105249_10117280 | Ga0105249_101172803 | 161 |
| 793 | 3300010375 | Ga0105239_10001464 | Ga0105239_1000146430 | 161 |
| 794 | 3300010375 | Ga0105239_10012186 | Ga0105239_100121863 | 161 |
| 795 | 3300010375 | Ga0105239_10488895 | Ga0105239_104888952 | 161 |
| 796 | 3300011119 | Ga0105246_10002021 | Ga0105246_100020213 | 161 |
| 797 | 3300011119 | Ga0105246_11317413 | Ga0105246_113174132 | 161 |
| 798 | 3300012483 | Ga0157337_1002622 | Ga0157337_10026222 | 161 |
| 799 | 3300012492 | Ga0157335_1004003 | Ga0157335_10040032 | 161 |
| 800 | 3300012507 | Ga0157342_1004833 | Ga0157342_10048331 | 161 |
| 801 | 3300012515 | Ga0157338_1008326 | Ga0157338_10083262 | 161 |
| 802 | 3300013100 | Ga0157373_10014658 | Ga0157373_100146583 | 161 |
| 803 | 3300013102 | Ga0157371_10008348 | Ga0157371_100083488 | 161 |
| 804 | 3300013105 | Ga0157369_11142614 | Ga0157369_111426142 | 161 |
| 805 | 3300013296 | Ga0157374_10137924 | Ga0157374_101379243 | 161 |
| 806 | 3300013297 | Ga0157378_10015202 | Ga0157378_100152023 | 161 |
| 807 | 3300013306 | Ga0163162_10001677 | Ga0163162_1000167720 | 161 |
| 808 | 3300013306 | Ga0163162_10017229 | Ga0163162_100172297 | 161 |
| 809 | 3300013307 | Ga0157372_10006418 | Ga0157372_1000641813 | 161 |
| 810 | 3300013308 | Ga0157375_10000263 | Ga0157375_1000026342 | 161 |
| 811 | 3300013308 | Ga0157375_10135976 | Ga0157375_101359762 | 161 |
| 812 | 3300014325 | Ga0163163_10037332 | Ga0163163_100373322 | 161 |
| 813 | 3300014326 | Ga0157380_10000294 | Ga0157380_100002947 | 161 |
| 814 | 3300014326 | Ga0157380_10122182 | Ga0157380_101221822 | 161 |
| 815 | 3300014745 | Ga0157377_10001223 | Ga0157377_1000122310 | 161 |
| 816 | 3300014968 | Ga0157379_10002453 | Ga0157379_100024533 | 161 |
| 817 | 3300014968 | Ga0157379_10025614 | Ga0157379_100256143 | 161 |
| 818 | 3300014968 | Ga0157379_10185057 | Ga0157379_101850573 | 161 |
| 819 | 3300014969 | Ga0157376_10000342 | Ga0157376_1000034232 | 161 |
| 820 | 3300017792 | Ga0163161_10000523 | Ga0163161_1000052310 | 161 |
| 821 | 3300025271 | Ga0207666_1000010 | Ga0207666_100001020 | 161 |
| 822 | 3300025271 | Ga0207666_1000667 | Ga0207666_10006673 | 161 |
| 823 | 3300025290 | Ga0207673_1000505 | Ga0207673_10005053 | 161 |
| 824 | 3300025315 | Ga0207697_10000186 | Ga0207697_1000018618 | 161 |
| 825 | 3300025315 | Ga0207697_10003939 | Ga0207697_100039392 | 161 |
| 826 | 3300025885 | Ga0207653_10012427 | Ga0207653_100124273 | 161 |
| 827 | 3300025893 | Ga0207682_10000123 | Ga0207682_1000012338 | 161 |
| 828 | 3300025899 | Ga0207642_10005605 | Ga0207642_100056054 | 161 |
| 829 | 3300025900 | Ga0207710_10002765 | Ga0207710_100027653 | 161 |
| 830 | 3300025901 | Ga0207688_10000340 | Ga0207688_1000034024 | 161 |
| 831 | 3300025901 | Ga0207688_10000889 | Ga0207688_1000088916 | 161 |
| 832 | 3300025904 | Ga0207647_10011455 | Ga0207647_100114553 | 161 |
| 833 | 3300025904 | Ga0207647_10040398 | Ga0207647_100403983 | 161 |
| 834 | 3300025907 | Ga0207645_10000023 | Ga0207645_1000002316 | 161 |
| 835 | 3300025908 | Ga0207643_10000007 | Ga0207643_100000077 | 161 |
| 836 | 3300025910 | Ga0207684_10527420 | Ga0207684_105274201 | 161 |
| 837 | 3300025911 | Ga0207654_10003445 | Ga0207654_100034454 | 161 |
| 838 | 3300025912 | Ga0207707_10275817 | Ga0207707_102758172 | 161 |
| 839 | 3300025913 | Ga0207695_10194754 | Ga0207695_101947542 | 161 |
| 840 | 3300025914 | Ga0207671_10024741 | Ga0207671_100247413 | 161 |
| 841 | 3300025914 | Ga0207671_10039604 | Ga0207671_100396042 | 161 |
| 842 | 3300025917 | Ga0207660_10000393 | Ga0207660_1000039326 | 161 |
| 843 | 3300025917 | Ga0207660_10076398 | Ga0207660_100763983 | 161 |
| 844 | 3300025918 | Ga0207662_10000136 | Ga0207662_1000013623 | 161 |
| 845 | 3300025918 | Ga0207662_10063446 | Ga0207662_100634462 | 161 |
| 846 | 3300025918 | Ga0207662_10789516 | Ga0207662_107895161 | 161 |
| 847 | 3300025919 | Ga0207657_10002615 | Ga0207657_1000261516 | 161 |
| 848 | 3300025920 | Ga0207649_10000434 | Ga0207649_100004344 | 161 |
| 849 | 3300025921 | Ga0207652_10001720 | Ga0207652_100017204 | 161 |
| 850 | 3300025921 | Ga0207652_10127620 | Ga0207652_101276202 | 161 |
| 851 | 3300025921 | Ga0207652_10569695 | Ga0207652_105696952 | 161 |
| 852 | 3300025923 | Ga0207681_10000273 | Ga0207681_1000027338 | 161 |
| 853 | 3300025926 | Ga0207659_10000097 | Ga0207659_1000009718 | 161 |
| 854 | 3300025926 | Ga0207659_10007932 | Ga0207659_100079325 | 161 |
| 855 | 3300025928 | Ga0207700_10097601 | Ga0207700_100976012 | 161 |
| 856 | 3300025929 | Ga0207664_10209836 | Ga0207664_102098362 | 161 |
| 857 | 3300025931 | Ga0207644_10005450 | Ga0207644_100054503 | 161 |
| 858 | 3300025932 | Ga0207690_10000962 | Ga0207690_1000096216 | 161 |
| 859 | 3300025933 | Ga0207706_10000867 | Ga0207706_1000086716 | 161 |
| 860 | 3300025933 | Ga0207706_10059941 | Ga0207706_100599412 | 161 |
| 861 | 3300025934 | Ga0207686_10002591 | Ga0207686_100025914 | 161 |
| 862 | 3300025935 | Ga0207709_11316769 | Ga0207709_113167691 | 161 |
| 863 | 3300025936 | Ga0207670_10000536 | Ga0207670_100005367 | 161 |
| 864 | 3300025936 | Ga0207670_10082190 | Ga0207670_100821902 | 161 |
| 865 | 3300025937 | Ga0207669_10001135 | Ga0207669_100011357 | 161 |
| 866 | 3300025938 | Ga0207704_10000119 | Ga0207704_1000011939 | 161 |
| 867 | 3300025939 | Ga0207665_10144157 | Ga0207665_101441572 | 161 |
| 868 | 3300025940 | Ga0207691_10000544 | Ga0207691_1000054420 | 161 |
| 869 | 3300025940 | Ga0207691_10217984 | Ga0207691_102179842 | 161 |
| 870 | 3300025941 | Ga0207711_10002468 | Ga0207711_100024684 | 161 |
| 871 | 3300025941 | Ga0207711_10125801 | Ga0207711_101258012 | 161 |
| 872 | 3300025941 | Ga0207711_10572557 | Ga0207711_105725572 | 161 |
| 873 | 3300025942 | Ga0207689_10001743 | Ga0207689_100017434 | 161 |
| 874 | 3300025944 | Ga0207661_10000785 | Ga0207661_100007857 | 161 |
| 875 | 3300025945 | Ga0207679_10000029 | Ga0207679_10000029191 | 161 |
| 876 | 3300025945 | Ga0207679_10128429 | Ga0207679_101284292 | 161 |
| 877 | 3300025945 | Ga0207679_10822530 | Ga0207679_108225302 | 161 |
| 878 | 3300025949 | Ga0207667_10016422 | Ga0207667_100164223 | 161 |
| 879 | 3300025949 | Ga0207667_10863785 | Ga0207667_108637852 | 161 |
| 880 | 3300025960 | Ga0207651_10000083 | Ga0207651_100000838 | 161 |
| 881 | 3300025961 | Ga0207712_10000471 | Ga0207712_100004714 | 161 |
| 882 | 3300025972 | Ga0207668_10000862 | Ga0207668_100008627 | 161 |
| 883 | 3300025981 | Ga0207640_10003185 | Ga0207640_100031854 | 161 |
| 884 | 3300025986 | Ga0207658_10002203 | Ga0207658_1000220316 | 161 |
| 885 | 3300026023 | Ga0207677_10000992 | Ga0207677_100009923 | 161 |
| 886 | 3300026035 | Ga0207703_10014801 | Ga0207703_100148014 | 161 |
| 887 | 3300026035 | Ga0207703_10098576 | Ga0207703_100985762 | 161 |
| 888 | 3300026035 | Ga0207703_10104241 | Ga0207703_101042412 | 161 |
| 889 | 3300026041 | Ga0207639_10004451 | Ga0207639_100044514 | 161 |
| 890 | 3300026067 | Ga0207678_10001568 | Ga0207678_100015687 | 161 |
| 891 | 3300026067 | Ga0207678_10241654 | Ga0207678_102416542 | 161 |
| 892 | 3300026075 | Ga0207708_10004251 | Ga0207708_1000425110 | 161 |
| 893 | 3300026075 | Ga0207708_10023945 | Ga0207708_100239452 | 161 |
| 894 | 3300026078 | Ga0207702_10003639 | Ga0207702_100036397 | 161 |
| 895 | 3300026088 | Ga0207641_10000510 | Ga0207641_100005107 | 161 |
| 896 | 3300026089 | Ga0207648_10002351 | Ga0207648_1000235116 | 161 |
| 897 | 3300026089 | Ga0207648_10200614 | Ga0207648_102006142 | 161 |
| 898 | 3300026095 | Ga0207676_10001371 | Ga0207676_100013714 | 161 |
| 899 | 3300026095 | Ga0207676_10219149 | Ga0207676_102191492 | 161 |
| 900 | 3300026116 | Ga0207674_10000608 | Ga0207674_1000060820 | 161 |
| 901 | 3300026116 | Ga0207674_10384519 | Ga0207674_103845191 | 161 |
| 902 | 3300026118 | Ga0207675_100000805 | Ga0207675_10000080520 | 161 |
| 903 | 3300026121 | Ga0207683_10000082 | Ga0207683_1000008258 | 161 |
| 904 | 3300026121 | Ga0207683_10675933 | Ga0207683_106759332 | 161 |
| 905 | 3300026142 | Ga0207698_10000377 | Ga0207698_1000037727 | 161 |
| 906 | 3300026142 | Ga0207698_10257260 | Ga0207698_102572602 | 161 |
| 907 | 3300026142 | Ga0207698_10504867 | Ga0207698_105048672 | 161 |
| 908 | 3300027252 | Ga0209973_1011005 | Ga0209973_10110052 | 161 |
| 909 | 3300027424 | Ga0209984_1008995 | Ga0209984_10089951 | 161 |
| 910 | 3300027617 | Ga0210002_1001321 | Ga0210002_10013213 | 161 |
| 911 | 3300027682 | Ga0209971_1054660 | Ga0209971_10546602 | 161 |
| 912 | 3300027695 | Ga0209966_1005107 | Ga0209966_10051072 | 161 |
| 913 | 3300027717 | Ga0209998_10002579 | Ga0209998_100025793 | 161 |
| 914 | 3300027876 | Ga0209974_10005874 | Ga0209974_100058743 | 161 |
| 915 | 3300027876 | Ga0209974_10020181 | Ga0209974_100201812 | 161 |
| 916 | 3300027907 | Ga0207428_10000124 | Ga0207428_1000012496 | 161 |
| 917 | 3300027907 | Ga0207428_10000420 | Ga0207428_1000042044 | 161 |
| 918 | 3300027907 | Ga0207428_10000703 | Ga0207428_1000070341 | 161 |
| 919 | 3300028379 | Ga0268266_10138505 | Ga0268266_101385053 | 161 |
| 920 | 3300028379 | Ga0268266_10381955 | Ga0268266_103819552 | 161 |
| 921 | 3300028380 | Ga0268265_10001170 | Ga0268265_1000117022 | 161 |
| 922 | 3300028381 | Ga0268264_10001878 | Ga0268264_1000187820 | 161 |
| 923 | 3300028381 | Ga0268264_10203260 | Ga0268264_102032602 | 161 |
| 924 | 3300034816 | Ga0373930_0001168 | Ga0373930_0001168_1179_1664 | 161 |
| 925 | 3300034817 | Ga0373948_0000160 | Ga0373948_0000160_5203_5688 | 161 |
| 926 | 3300034819 | Ga0373958_0001209 | Ga0373958_0001209_921_1406 | 161 |
| 927 | 3300034819 | Ga0373958_0003548 | Ga0373958_0003548_1180_1665 | 161 |
| 928 | 3300034820 | Ga0373959_0002987 | Ga0373959_0002987_280_765 | 161 |
| 929 | 3300034820 | Ga0373959_0008682 | Ga0373959_0008682_173_658 | 161 |
| 930 | 3300034957 | Ga0373938_0000574 | Ga0373938_0000574_1001_1486 | 161 |
| 931 | 3300035084 | Ga0373928_0002434 | Ga0373928_0002434_1288_1773 | 161 |
| 932 | 3300035084 | Ga0373928_0019947 | Ga0373928_0019947_617_1102 | 161 |
| 933 | 3300035085 | Ga0373929_0005219 | Ga0373929_0005219_1176_1661 | 161 |
| 934 | 3300035085 | Ga0373929_0036900 | Ga0373929_0036900_500_985 | 161 |
| 935 | 3300035088 | Ga0373940_0000069 | Ga0373940_0000069_5357_5842 | 161 |
| 936 | 3300035088 | Ga0373940_0002640 | Ga0373940_0002640_2477_2962 | 161 |
| 937 | 3300035090 | Ga0373949_0000870 | Ga0373949_0000870_8635_9120 | 161 |
| 938 | 3300035090 | Ga0373949_0002073 | Ga0373949_0002073_3916_4401 | 161 |
| 939 | 3300035091 | Ga0373951_0002636 | Ga0373951_0002636_1179_1664 | 161 |
| 940 | 3300035091 | Ga0373951_0003101 | Ga0373951_0003101_381_866 | 161 |
| 941 | 3300035092 | Ga0373952_0001400 | Ga0373952_0001400_1003_1488 | 161 |
| 942 | 3300035092 | Ga0373952_0003512 | Ga0373952_0003512_2042_2527 | 161 |
| 943 | 3300035112 | Ga0373932_0002119 | Ga0373932_0002119_3410_3895 | 161 |
| 944 | 3300035114 | Ga0373939_0001165 | Ga0373939_0001165_922_1407 | 161 |
| 945 | 3300035114 | Ga0373939_0003141 | Ga0373939_0003141_950_1435 | 161 |
| 946 | 3300035115 | Ga0373941_0000185 | Ga0373941_0000185_2912_3397 | 161 |
| 947 | 3300035115 | Ga0373941_0001158 | Ga0373941_0001158_906_1391 | 161 |
| 948 | 3300035116 | Ga0373945_0203214 | Ga0373945_0203214_149_670 | 161 |
| 949 | 3300035121 | Ga0373960_0000288 | Ga0373960_0000288_963_1448 | 161 |
| 950 | 3300035121 | Ga0373960_0000314 | Ga0373960_0000314_6964_7449 | 161 |
| 951 | 3300035171 | Ga0373946_0609450 | Ga0373946_0609450_22_507 | 161 |
| 952 | 3300035241 | Ga0373961_0000636 | Ga0373961_0000636_6268_6753 | 161 |
| 953 | 3300035241 | Ga0373961_0001288 | Ga0373961_0001288_2459_2944 | 161 |
| 954 | 3300035242 | Ga0373962_0000974 | Ga0373962_0000974_4980_5465 | 161 |
| 955 | 3300035242 | Ga0373962_0014241 | Ga0373962_0014241_372_857 | 161 |
| 956 | 3300035691 | Ga0373931_0014198 | Ga0373931_0014198_956_1441 | 161 |
| 957 | 3300036401 | Ga0373937_0036163 | Ga0373937_0036163_117_602 | 161 |
| 958 | 3300036401 | Ga0373937_0626303 | Ga0373937_0626303_418_903 | 161 |
| 959 | 3300037466 | Ga0395898_0067146 | Ga0395898_0067146_2042_2581 | 161 |
| 960 | 3300038443 | Ga0395901_0369703 | Ga0395901_0369703_171_710 | 161 |
| 961 | 3300038698 | Ga0242419_022220 | Ga0242419_022220_24_509 | 161 |
| 962 | 3300038996 | Ga0242420_012183 | Ga0242420_012183_863_1348 | 161 |
| 963 | 3300042008 | Ga0439450_099769 | Ga0439450_099769_165_650 | 161 |
| 964 | 3300042439 | Ga0439464_0098059 | Ga0439464_0098059_226_711 | 161 |
| 965 | 3300042461 | Ga0439460_0012096 | Ga0439460_0012096_682_1167 | 161 |
| 966 | 3300046454 | Ga0495592_0701821 | Ga0495592_0701821_68_553 | 161 |
| 967 | 3300046463 | Ga0495653_0196921 | Ga0495653_0196921_258_743 | 161 |
| 968 | 3300046511 | Ga0495608_0715829 | Ga0495608_0715829_78_563 | 161 |
| 969 | 3300046516 | Ga0495628_0091598 | Ga0495628_0091598_1260_1745 | 161 |
| 970 | 3300046533 | Ga0495640_0033258 | Ga0495640_0033258_2331_2816 | 161 |
| 971 | 3300046538 | Ga0495609_0177304 | Ga0495609_0177304_67_552 | 161 |
| 972 | 3300046663 | Ga0495635_0340919 | Ga0495635_0340919_162_683 | 161 |
| 973 | 3300046675 | Ga0495657_0089251 | Ga0495657_0089251_922_1407 | 161 |
| 974 | 3300046683 | Ga0495658_0018935 | Ga0495658_0018935_1403_1888 | 161 |
| 975 | 3300046684 | Ga0495669_0359342 | Ga0495669_0359342_64_549 | 161 |
| 976 | 3300047315 | Ga0495581_0114681 | Ga0495581_0114681_466_951 | 161 |
| 977 | 3300047317 | Ga0495604_0058771 | Ga0495604_0058771_2243_2728 | 161 |
| 978 | 3300047319 | Ga0495674_0146363 | Ga0495674_0146363_627_1112 | 161 |
| 979 | 3300047471 | Ga0495684_0529609 | Ga0495684_0529609_112_597 | 161 |
| 980 | 3300048903 | Ga0496100_0000057 | Ga0496100_0000057_2706_3191 | 161 |
| 981 | 3300048904 | Ga0496101_0065500 | Ga0496101_0065500_1456_1941 | 161 |
| 982 | 3300048905 | Ga0496102_0001628 | Ga0496102_0001628_18419_18904 | 161 |
| 983 | 3300048905 | Ga0496102_0398302 | Ga0496102_0398302_76_561 | 161 |
| 984 | 3300048906 | Ga0496103_0306285 | Ga0496103_0306285_195_680 | 161 |
| 985 | 3300048907 | Ga0496104_0072866 | Ga0496104_0072866_826_1311 | 161 |
| 986 | 3300048907 | Ga0496104_0156717 | Ga0496104_0156717_403_888 | 161 |
| 987 | 3300048910 | Ga0496107_0001129 | Ga0496107_0001129_14615_15100 | 161 |
| 988 | 3300048911 | Ga0496108_0003535 | Ga0496108_0003535_7527_8012 | 161 |
| 989 | 3300048911 | Ga0496108_0086379 | Ga0496108_0086379_647_1132 | 161 |
| 990 | 3300048912 | Ga0496109_0002432 | Ga0496109_0002432_11864_12349 | 161 |
| 991 | 3300048912 | Ga0496109_0144608 | Ga0496109_0144608_1182_1667 | 161 |
| 992 | 3300048913 | Ga0496110_0083286 | Ga0496110_0083286_881_1366 | 161 |
| 993 | 3300048913 | Ga0496110_0143879 | Ga0496110_0143879_711_1196 | 161 |
| 994 | 3300048914 | Ga0496111_0043097 | Ga0496111_0043097_465_950 | 161 |
| 995 | 3300048914 | Ga0496111_0098747 | Ga0496111_0098747_63_548 | 161 |
| 996 | 3300048915 | Ga0496112_0100086 | Ga0496112_0100086_2262_2747 | 161 |
| 997 | 3300048915 | Ga0496112_0406554 | Ga0496112_0406554_564_1049 | 161 |
| 998 | 3300048916 | Ga0496113_0049425 | Ga0496113_0049425_70_555 | 161 |
| 999 | 3300048916 | Ga0496113_0057193 | Ga0496113_0057193_20_505 | 161 |
| 1000 | 3300048917 | Ga0496114_0002944 | Ga0496114_0002944_11972_12457 | 161 |
| 1001 | 3300048918 | Ga0496115_0002786 | Ga0496115_0002786_3127_3612 | 161 |
| 1002 | 3300049582 | Ga0501048_1282069 | Ga0501048_1282069_22_507 | 161 |
| 1003 | 3300049593 | Ga0501077_0123062 | Ga0501077_0123062_805_1290 | 161 |
| 1004 | 3300049741 | Ga0501079_0216088 | Ga0501079_0216088_520_1005 | 161 |
| 1005 | 3300050493 | nmdc:mga0k408_746501_c1 | nmdc:mga0k408_746501_c1_43_528 | 161 |
| 1006 | 3300050494 | nmdc:mga06z11_211456_c1 | nmdc:mga06z11_211456_c1_163_648 | 161 |
| 1007 | 3300050507 | nmdc:mga05p37_45_c2 | nmdc:mga05p37_45_c2_8302_8787 | 161 |
| 1008 | 3300050507 | nmdc:mga05p37_92628_c1 | nmdc:mga05p37_92628_c1_950_1441 | 161 |
| 1009 | 3300050508 | nmdc:mga09592_1055_c1 | nmdc:mga09592_1055_c1_18419_18904 | 161 |
| 1010 | 3300050509 | nmdc:mga0qj67_1012_c1 | nmdc:mga0qj67_1012_c1_16593_17078 | 161 |
| 1011 | 3300050510 | nmdc:mga06r32_56570_c1 | nmdc:mga06r32_56570_c1_339_824 | 161 |
| 1012 | 3300050511 | nmdc:mga08y16_1134_c1 | nmdc:mga08y16_1134_c1_16593_17078 | 161 |
| 1013 | 3300050511 | nmdc:mga08y16_12172_c1 | nmdc:mga08y16_12172_c1_2783_3268 | 161 |
| 1014 | 3300050511 | nmdc:mga08y16_1989_c1 | nmdc:mga08y16_1989_c1_11749_12234 | 161 |
| 1015 | 3300050512 | nmdc:mga0n895_3165_c1 | nmdc:mga0n895_3165_c1_9535_10020 | 161 |
| 1016 | 3300050512 | nmdc:mga0n895_404960_c1 | nmdc:mga0n895_404960_c1_84_575 | 161 |
| 1017 | 3300050512 | nmdc:mga0n895_50_c1 | nmdc:mga0n895_50_c1_67999_68484 | 161 |
| 1018 | 3300050513 | nmdc:mga0rr50_45762_c1 | nmdc:mga0rr50_45762_c1_1863_2348 | 161 |
| 1019 | 3300050513 | nmdc:mga0rr50_77520_c1 | nmdc:mga0rr50_77520_c1_137_622 | 161 |
| 1020 | 3300050514 | nmdc:mga08x19_536788_c1 | nmdc:mga08x19_536788_c1_14_499 | 161 |
| 1021 | 3300050514 | nmdc:mga08x19_75835_c1 | nmdc:mga08x19_75835_c1_528_1013 | 161 |
| 1022 | 3300050514 | nmdc:mga08x19_86249_c1 | nmdc:mga08x19_86249_c1_246_731 | 161 |
| 1023 | 3300050515 | nmdc:mga0a205_171569_c1 | nmdc:mga0a205_171569_c1_833_1324 | 161 |
| 1024 | 3300050515 | nmdc:mga0a205_2228_c1 | nmdc:mga0a205_2228_c1_1197_1682 | 161 |
| 1025 | 3300050515 | nmdc:mga0a205_5479_c1 | nmdc:mga0a205_5479_c1_1350_1835 | 161 |
| 1026 | 3300053077 | Ga0495601_0004549 | Ga0495601_0004549_4210_4695 | 161 |
| 1027 | 3300053078 | Ga0495612_0139684 | Ga0495612_0139684_327_812 | 161 |
| 1028 | 3300053084 | Ga0495595_0003875 | Ga0495595_0003875_5232_5717 | 161 |
| 1029 | 3300053085 | Ga0495619_0000260 | Ga0495619_0000260_34120_34605 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i6o-assembly1.cif.gz_A | crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n | 0.7238 | 10 | 129 |
| 2i6i-assembly1.cif.gz_A | crystal structures of the archaeal sulfolobus ptp-fold phosphatase | 0.7204 | 10 | 129 |
| 6pqz-assembly1.cif.gz_A | p133g/s128a s. typhimurium siroheme synthase | 0.6699 | 14 | 160 |
| 1pjt-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6668 | 13 | 160 |
| 6p7d-assembly1.cif.gz_B | d104n s. typhimurium siroheme synthase | 0.661 | 10 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VVU7_1_266_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6944 | 25 | 72 | 3.40.50.2300 |
| 2dxpA00 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.6866 | 10 | 129 | 3.90.190.10 |
| af_P9WGW7_1_114_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.6645 | 12 | 156 | 3.40.1010.10 |
| af_P9WGW7_1_114_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.6459 | 12 | 156 | 3.40.1010.10 |
| 2qbuB01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.6388 | 12 | 161 | 3.40.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5FI35-F1-model_v4 | DUF488 family protein | 0.9649 | 12 | 161 |
|
| AF-A0A7T8MFV8-F1-model_v4 | deleted | 0.9597 | 11 | 161 |
|
| AF-A0A6L5FI35-F1-model_v4 | DUF488 family protein | 0.9587 | 12 | 161 |
|
| AF-A0A7D7VI00-F1-model_v4 | DUF488 family protein | 0.9573 | 12 | 157 |
|
| AF-A0A1E4MYY9-F1-model_v4 | deleted | 0.9569 | 12 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar