F488580

General Info

Members Datasets Scaffolds Average Seq Length
1029 430 1028 158

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0067146|Ga0395898_0067146_2042_2581
Length 179
Sequence MAKTSKPKKKKAPAKTAVKKPRGAKRAGKATPLFTIGYEQAKPAAVMKELEAAKIDLVVDTRAVAASRRPGFSKRQLSASLVEAGIGYVHLQKLGTPAEGRQAARAGDRDTLMRVYDAHINKPEPQAELGKLVSLIKSGKRIALLCYCRDPKTCHRSQIVKRVKARLPLEVENLIPPLF

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2842694124 Methylopila sp. R-72369 Isolate Unclassified
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
139 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
140 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
141 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
142 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
143 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
252 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
253 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
259 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
260 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
276 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
277 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
290 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
293 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
298 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
299 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
303 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
312 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
332 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
333 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
339 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
342 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
349 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
350 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
351 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
352 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
353 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
354 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
355 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
397 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
398 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
399 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
400 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
401 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
407 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
415 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
416 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
419 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
420 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
421 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
422 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
423 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
424 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
425 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
426 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
429 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
430 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 6.41
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_7410661 2162886011 Bacteria 821
2 2214756332 2209111006 Bacteria 3109
3 ARSoilYngRDRAFT_c00187 3300000042 Bacteria 10438
4 ARcpr5yngRDRAFT_c000626 3300000043 Bacteria 4432
5 ARSoilOldRDRAFT_c000105 3300000044 Bacteria 15779
6 ARCol0oldRDRAFT_c00945 3300000045 Bacteria 2244
7 ARCol0yngRDRAFT_1000034 3300000652 Bacteria 23733
8 JGI24736J21556_1020600 3300001904 Bacteria 1035
9 JGI24741J21665_1018201 3300001915 Bacteria 1125
10 JGI24746J21847_1001098 3300001977 Bacteria 4254
11 JGI24739J22299_10000164 3300001989 Bacteria 21825
12 JGI24737J22298_10001508 3300001990 Bacteria 8287
13 JGI24737J22298_10001579 3300001990 Bacteria 8106
14 JGI24743J22301_10012313 3300001991 Bacteria 1554
15 JGI24750J21931_1000344 3300002070 Bacteria 7887
16 JGI24745J21846_1001611 3300002073 Bacteria 2215
17 JGI24738J21930_10000112 3300002075 Bacteria 19038
18 JGI24749J21850_1000411 3300002076 Bacteria 6398
19 JGI24744J21845_10024671 3300002077 Bacteria 1175
20 JGI24035J26624_1000107 3300002126 Bacteria 7155
21 JGI24034J26672_10001485 3300002239 Bacteria 3118
22 JGI24742J22300_10000359 3300002244 Bacteria 6705
23 JGI24751J29686_10062096 3300002459 Bacteria 769
24 JGI24751J29686_10092099 3300002459 Unclassified 631
25 JGI25406J46586_10033300 3300003203 Bacteria 1904
26 JGI26128J50194_1007301 3300003347 Unclassified 712
27 Ga0065712_10071820 3300005290 Bacteria 5036
28 Ga0065712_10098339 3300005290 Bacteria 2122
29 Ga0065712_10615400 3300005290 Bacteria 569
30 Ga0065715_10001049 3300005293 Bacteria 8311
31 Ga0065715_10001550 3300005293 Bacteria 6014
32 Ga0065715_10208859 3300005293 Bacteria 1317
33 Ga0065707_10123077 3300005295 Bacteria 2073
34 Ga0070658_10115505 3300005327 Bacteria 2227
35 Ga0070676_10000755 3300005328 Bacteria 15911
36 Ga0070676_10236745 3300005328 Bacteria 1212
37 Ga0070683_100000376 3300005329 Bacteria 31004
38 Ga0070683_100105366 3300005329 Bacteria 2658
39 Ga0070683_100617469 3300005329 Unclassified 1038
40 Ga0070690_100001711 3300005330 Bacteria 11573
41 Ga0070690_100006546 3300005330 Bacteria 6613
42 Ga0070690_100221375 3300005330 Bacteria 1326
43 Ga0070670_100235031 3300005331 Bacteria 1595
44 Ga0070670_100577328 3300005331 Bacteria 1005
45 Ga0070670_100665518 3300005331 Bacteria 935
46 Ga0070677_10001502 3300005333 Bacteria 7381
47 Ga0068869_100000523 3300005334 Bacteria 21387
48 Ga0068869_100661514 3300005334 Bacteria 888
49 Ga0070666_10001839 3300005335 Bacteria 12930
50 Ga0070666_10006461 3300005335 Bacteria 7206
51 Ga0070680_100007212 3300005336 Bacteria 8473
52 Ga0070680_100102774 3300005336 Bacteria 2374
53 Ga0070680_100124334 3300005336 Bacteria 2155
54 Ga0070680_101282681 3300005336 Bacteria 634
55 Ga0070682_100000141 3300005337 Bacteria 57251
56 Ga0070682_100010911 3300005337 Bacteria 5176
57 Ga0070682_100308753 3300005337 Bacteria 1164
58 Ga0070682_100466906 3300005337 Bacteria 970
59 Ga0068868_100037520 3300005338 Bacteria 3757
60 Ga0068868_100259259 3300005338 Bacteria 1465
61 Ga0068868_100717048 3300005338 Unclassified 896
62 Ga0070660_100002574 3300005339 Bacteria 12436
63 Ga0070660_100430741 3300005339 Unclassified 1093
64 Ga0070689_100038887 3300005340 Bacteria 3641
65 Ga0070689_100049550 3300005340 Bacteria 3243
66 Ga0070689_100084736 3300005340 Bacteria 2491
67 Ga0070689_100224298 3300005340 Bacteria 1543
68 Ga0070691_10000190 3300005341 Bacteria 20511
69 Ga0070691_10060821 3300005341 Bacteria 1816
70 Ga0070687_100000212 3300005343 Bacteria 20234
71 Ga0070687_100030889 3300005343 Bacteria 2622
72 Ga0070661_100000242 3300005344 Bacteria 44945
73 Ga0070661_100092283 3300005344 Bacteria 2243
74 Ga0070661_100686622 3300005344 Bacteria 833
75 Ga0070661_101125174 3300005344 Bacteria 655
76 Ga0070661_101250019 3300005344 Bacteria 622
77 Ga0070692_10007147 3300005345 Bacteria 4901
78 Ga0070669_100000593 3300005353 Bacteria 26849
79 Ga0070675_100000165 3300005354 Bacteria 40656
80 Ga0070671_100010995 3300005355 Bacteria 7262
81 Ga0070671_100091245 3300005355 Bacteria 2551
82 Ga0070671_100250203 3300005355 Unclassified 1505
83 Ga0070671_100397850 3300005355 Bacteria 1178
84 Ga0070674_100000450 3300005356 Bacteria 20737
85 Ga0070673_100781188 3300005364 Bacteria 881
86 Ga0070688_100028095 3300005365 Bacteria 3355
87 Ga0070688_100036300 3300005365 Bacteria 2997
88 Ga0070688_100064025 3300005365 Bacteria 2332
89 Ga0070659_100000988 3300005366 Bacteria 20880
90 Ga0070659_100016224 3300005366 Bacteria 5590
91 Ga0070659_100965221 3300005366 Unclassified 747
92 Ga0070667_100000759 3300005367 Bacteria 30677
93 Ga0070667_100084445 3300005367 Bacteria 2721
94 Ga0070703_10006259 3300005406 Bacteria 3335
95 Ga0070709_10003620 3300005434 Bacteria 8296
96 Ga0070709_10066394 3300005434 Bacteria 2314
97 Ga0070714_100023744 3300005435 Bacteria 5041
98 Ga0070714_100024265 3300005435 Bacteria 4989
99 Ga0070714_100040478 3300005435 Bacteria 3928
100 Ga0070714_100207666 3300005435 Bacteria 1794
101 Ga0070713_100156668 3300005436 Bacteria 2030
102 Ga0070713_100190763 3300005436 Bacteria 1846
103 Ga0070713_100681284 3300005436 Bacteria 981
104 Ga0070713_101606664 3300005436 Unclassified 631
105 Ga0070710_10008897 3300005437 Bacteria 4900
106 Ga0070710_10010783 3300005437 Bacteria 4495
107 Ga0070710_10304996 3300005437 Bacteria 1040
108 Ga0070710_10360499 3300005437 Bacteria 965
109 Ga0070701_10000103 3300005438 Bacteria 24021
110 Ga0070711_100122379 3300005439 Bacteria 1926
111 Ga0070711_100231133 3300005439 Bacteria 1442
112 Ga0070711_100277590 3300005439 Bacteria 1324
113 Ga0070711_100357520 3300005439 Unclassified 1175
114 Ga0070705_100029576 3300005440 Bacteria 3015
115 Ga0070705_100072916 3300005440 Bacteria 2082
116 Ga0070705_100136287 3300005440 Bacteria 1609
117 Ga0070700_100000364 3300005441 Bacteria 23195
118 Ga0070694_100000880 3300005444 Bacteria 16931
119 Ga0070694_100334790 3300005444 Bacteria 1169
120 Ga0070708_100103778 3300005445 Bacteria 2607
121 Ga0070663_100000417 3300005455 Bacteria 22399
122 Ga0070663_100095890 3300005455 Bacteria 2206
123 Ga0070663_100331488 3300005455 Bacteria 1227
124 Ga0070678_100001012 3300005456 Bacteria 14620
125 Ga0070678_100020403 3300005456 Bacteria 4347
126 Ga0070678_100135201 3300005456 Bacteria 1965
127 Ga0070678_100266982 3300005456 Bacteria 1442
128 Ga0070662_100000796 3300005457 Bacteria 19367
129 Ga0070662_100834181 3300005457 Bacteria 785
130 Ga0070681_10002475 3300005458 Bacteria 16918
131 Ga0070681_10016649 3300005458 Bacteria 7339
132 Ga0070681_10076422 3300005458 Bacteria 3307
133 Ga0070681_10139375 3300005458 Bacteria 2355
134 Ga0070681_10160379 3300005458 Bacteria 2173
135 Ga0070681_10824898 3300005458 Bacteria 845
136 Ga0068867_100009775 3300005459 Bacteria 6759
137 Ga0068867_100330952 3300005459 Bacteria 1265
138 Ga0070685_10000547 3300005466 Bacteria 21062
139 Ga0070685_10051382 3300005466 Bacteria 2383
140 Ga0070699_100602141 3300005518 Bacteria 1002
141 Ga0070679_100010894 3300005530 Bacteria 8638
142 Ga0070679_100131590 3300005530 Bacteria 2483
143 Ga0070679_100358833 3300005530 Bacteria 1405
144 Ga0070684_100000755 3300005535 Bacteria 22399
145 Ga0070684_100060283 3300005535 Bacteria 3318
146 Ga0070684_100065596 3300005535 Bacteria 3186
147 Ga0070684_100601370 3300005535 Bacteria 1022
148 Ga0070697_100044337 3300005536 Bacteria 3602
149 Ga0068853_100000483 3300005539 Bacteria 27159
150 Ga0068853_100245345 3300005539 Bacteria 1642
151 Ga0070672_100000527 3300005543 Bacteria 22399
152 Ga0070686_100002014 3300005544 Bacteria 11269
153 Ga0070686_100062310 3300005544 Bacteria 2413
154 Ga0070686_100164667 3300005544 Unclassified 1564
155 Ga0070695_100003705 3300005545 Bacteria 8902
156 Ga0070696_100006474 3300005546 Bacteria 7828
157 Ga0070696_100007364 3300005546 Bacteria 7349
158 Ga0070696_100340163 3300005546 Unclassified 1159
159 Ga0070696_100692801 3300005546 Unclassified 830
160 Ga0070693_100000199 3300005547 Bacteria 28265
161 Ga0070693_100030479 3300005547 Bacteria 2949
162 Ga0070693_100103745 3300005547 Bacteria 1737
163 Ga0070693_100295687 3300005547 Bacteria 1089
164 Ga0070665_100207388 3300005548 Bacteria 1960
165 Ga0070665_100278950 3300005548 Bacteria 1673
166 Ga0070704_100022794 3300005549 Bacteria 4078
167 Ga0068855_100004444 3300005563 Bacteria 17127
168 Ga0068855_100020137 3300005563 Bacteria 8011
169 Ga0068855_100031660 3300005563 Bacteria 6315
170 Ga0068855_100235987 3300005563 Bacteria 2045
171 Ga0068855_100284778 3300005563 Bacteria 1834
172 Ga0070664_100000895 3300005564 Bacteria 23168
173 Ga0070664_100124321 3300005564 Bacteria 2262
174 Ga0070664_100285222 3300005564 Bacteria 1490
175 Ga0070664_100739967 3300005564 Bacteria 917
176 Ga0068857_100001816 3300005577 Bacteria 17161
177 Ga0068857_100363630 3300005577 Bacteria 1341
178 Ga0068857_100618475 3300005577 Bacteria 1025
179 Ga0068854_100001666 3300005578 Bacteria 13522
180 Ga0068856_100001538 3300005614 Bacteria 24179
181 Ga0068856_100164360 3300005614 Bacteria 2230
182 Ga0068856_100449012 3300005614 Bacteria 1310
183 Ga0070702_100001415 3300005615 Bacteria 9801
184 Ga0068852_100002972 3300005616 Bacteria 11773
185 Ga0068852_100079588 3300005616 Bacteria 2903
186 Ga0068852_100110846 3300005616 Bacteria 2494
187 Ga0068852_100514371 3300005616 Bacteria 1194
188 Ga0068859_100013486 3300005617 Bacteria 8195
189 Ga0068859_100173949 3300005617 Bacteria 2235
190 Ga0068859_100310289 3300005617 Unclassified 1671
191 Ga0068859_101007969 3300005617 Bacteria 915
192 Ga0068864_100001172 3300005618 Bacteria 21814
193 Ga0068864_100018526 3300005618 Bacteria 5818
194 Ga0068864_100210126 3300005618 Bacteria 1791
195 Ga0068864_100276215 3300005618 Bacteria 1567
196 Ga0068866_10003190 3300005718 Bacteria 6752
197 Ga0068861_100005060 3300005719 Bacteria 8895
198 Ga0068851_10108129 3300005834 Bacteria 1482
199 Ga0068870_10000155 3300005840 Bacteria 23940
200 Ga0068863_100000495 3300005841 Bacteria 39957
201 Ga0068858_100000783 3300005842 Bacteria 33229
202 Ga0068858_100049192 3300005842 Bacteria 3904
203 Ga0068858_100112198 3300005842 Bacteria 2546
204 Ga0068860_100024037 3300005843 Bacteria 5891
205 Ga0068860_100745695 3300005843 Bacteria 991
206 Ga0068862_100020432 3300005844 Bacteria 5532
207 Ga0068862_100445539 3300005844 Bacteria 1220
208 Ga0068862_101152857 3300005844 Bacteria 772
209 Ga0081455_10000204 3300005937 Bacteria 75793
210 Ga0081455_10242172 3300005937 Bacteria 1325
211 Ga0081539_10004321 3300005985 Bacteria 15860
212 Ga0070717_10006465 3300006028 Bacteria 8622
213 Ga0070717_10423517 3300006028 Bacteria 1198
214 Ga0075432_10147364 3300006058 Unclassified 902
215 Ga0070715_10029891 3300006163 Bacteria 2198
216 Ga0070716_100003033 3300006173 Bacteria 7836
217 Ga0070716_100548250 3300006173 Bacteria 862
218 Ga0070716_100706632 3300006173 Unclassified 771
219 Ga0070712_100254997 3300006175 Bacteria 1403
220 Ga0070712_100269137 3300006175 Bacteria 1368
221 Ga0070712_100562458 3300006175 Bacteria 962
222 Ga0070712_101002837 3300006175 Unclassified 723
223 Ga0075367_10216870 3300006178 Bacteria 1197
224 Ga0075366_10008368 3300006195 Bacteria 5747
225 Ga0097621_100000010 3300006237 Bacteria 112867
226 Ga0097621_100021075 3300006237 Bacteria 5034
227 Ga0097621_100048453 3300006237 Bacteria 3447
228 Ga0068871_100000034 3300006358 Bacteria 71462
229 Ga0068871_100030893 3300006358 Bacteria 4221
230 Ga0068871_100059648 3300006358 Bacteria 3109
231 Ga0075428_100381795 3300006844 Bacteria 1510
232 Ga0075428_101007026 3300006844 Bacteria 882
233 Ga0075430_100005590 3300006846 Bacteria 10623
234 Ga0075431_100004052 3300006847 Bacteria 14278
235 Ga0075433_10000774 3300006852 Bacteria 21997
236 Ga0075433_10009145 3300006852 Bacteria 7912
237 Ga0075433_10267078 3300006852 Bacteria 1516
238 Ga0075434_100001700 3300006871 Bacteria 18837
239 Ga0075434_100005910 3300006871 Bacteria 11193
240 Ga0075434_100061647 3300006871 Bacteria 3732
241 Ga0075434_100234596 3300006871 Bacteria 1854
242 Ga0075434_100944090 3300006871 Bacteria 877
243 Ga0075429_100007130 3300006880 Bacteria 9709
244 Ga0068865_100000230 3300006881 Bacteria 31147
245 Ga0068865_100162809 3300006881 Bacteria 1703
246 Ga0068865_100951326 3300006881 Bacteria 750
247 Ga0075436_100085251 3300006914 Bacteria 2193
248 Ga0075436_100093945 3300006914 Bacteria 2086
249 Ga0075436_100264830 3300006914 Bacteria 1226
250 Ga0097620_100013487 3300006931 Bacteria 8195
251 Ga0097620_100173947 3300006931 Bacteria 2235
252 Ga0097620_100310281 3300006931 Unclassified 1671
253 Ga0097620_101007933 3300006931 Bacteria 915
254 Ga0075435_100054003 3300007076 Bacteria 3242
255 Ga0075435_100300755 3300007076 Bacteria 1372
256 Ga0105251_10009243 3300009011 Bacteria 5842
257 Ga0105250_10055797 3300009092 Bacteria 1585
258 Ga0105240_10101227 3300009093 Bacteria 3505
259 Ga0105240_10398388 3300009093 Bacteria 1551
260 Ga0111539_10000932 3300009094 Bacteria 38323
261 Ga0111539_10002162 3300009094 Bacteria 26296
262 Ga0111539_10010377 3300009094 Bacteria 11726
263 Ga0111539_11341449 3300009094 Bacteria 830
264 Ga0105245_10000258 3300009098 Bacteria 50464
265 Ga0105245_10152565 3300009098 Bacteria 2186
266 Ga0105245_11023069 3300009098 Bacteria 871
267 Ga0105245_11211651 3300009098 Bacteria 803
268 Ga0105245_11634296 3300009098 Unclassified 696
269 Ga0105247_10002128 3300009101 Bacteria 13684
270 Ga0105247_10038860 3300009101 Bacteria 2907
271 Ga0114129_10207007 3300009147 Bacteria 2654
272 Ga0114129_10234184 3300009147 Bacteria 2472
273 Ga0105243_10000846 3300009148 Bacteria 29054
274 Ga0105243_10065468 3300009148 Bacteria 2919
275 Ga0105243_10247884 3300009148 Bacteria 1589
276 Ga0105243_10612432 3300009148 Unclassified 1050
277 Ga0105241_10002261 3300009174 Bacteria 14471
278 Ga0105241_10125441 3300009174 Bacteria 2072
279 Ga0105241_10165873 3300009174 Bacteria 1820
280 Ga0105241_10282491 3300009174 Bacteria 1418
281 Ga0105241_10751454 3300009174 Bacteria 894
282 Ga0105242_10000037 3300009176 Bacteria 91293
283 Ga0105242_10009393 3300009176 Bacteria 7503
284 Ga0105242_10178096 3300009176 Bacteria 1874
285 Ga0105248_10000744 3300009177 Bacteria 36599
286 Ga0105248_10056701 3300009177 Bacteria 4395
287 Ga0105248_10149553 3300009177 Bacteria 2635
288 Ga0105248_10185800 3300009177 Bacteria 2342
289 Ga0105248_10857143 3300009177 Unclassified 1025
290 Ga0105237_10037795 3300009545 Bacteria 4878
291 Ga0105237_10053692 3300009545 Bacteria 4041
292 Ga0105237_10142292 3300009545 Bacteria 2393
293 Ga0105238_10012092 3300009551 Bacteria 8698
294 Ga0105238_10070510 3300009551 Bacteria 3494
295 Ga0105238_10236325 3300009551 Bacteria 1805
296 Ga0105249_10000209 3300009553 Bacteria 67037
297 Ga0105249_10117280 3300009553 Bacteria 2525
298 Ga0105249_10295751 3300009553 Bacteria 1622
299 Ga0105249_11075648 3300009553 Unclassified 874
300 Ga0099796_10003664 3300010159 Bacteria 3601
301 Ga0105239_10001464 3300010375 Bacteria 31391
302 Ga0105239_10012186 3300010375 Bacteria 9585
303 Ga0105239_10488895 3300010375 Bacteria 1399
304 Ga0105239_10710429 3300010375 Unclassified 1149
305 Ga0105239_10835107 3300010375 Bacteria 1056
306 Ga0105246_10002021 3300011119 Bacteria 12259
307 Ga0105246_10062610 3300011119 Bacteria 2592
308 Ga0105246_10482729 3300011119 Bacteria 1049
309 Ga0105246_11317413 3300011119 Bacteria 670
310 Ga0157320_1021615 3300012481 Unclassified 591
311 Ga0157337_1002622 3300012483 Bacteria 1032
312 Ga0157335_1004003 3300012492 Unclassified 972
313 Ga0157339_1002627 3300012505 Bacteria 1231
314 Ga0157342_1004833 3300012507 Bacteria 1215
315 Ga0157338_1008326 3300012515 Unclassified 1003
316 Ga0157373_10014658 3300013100 Bacteria 5748
317 Ga0157373_10196765 3300013100 Bacteria 1421
318 Ga0157371_10008348 3300013102 Bacteria 8263
319 Ga0157371_10060753 3300013102 Bacteria 2679
320 Ga0157370_10510019 3300013104 Bacteria 1104
321 Ga0157370_11080666 3300013104 Unclassified 725
322 Ga0157369_10532119 3300013105 Bacteria 1215
323 Ga0157369_11142614 3300013105 Bacteria 796
324 Ga0157374_10137924 3300013296 Bacteria 2366
325 Ga0157374_10282802 3300013296 Bacteria 1638
326 Ga0157374_10299961 3300013296 Bacteria 1589
327 Ga0157378_10015202 3300013297 Bacteria 6740
328 Ga0157378_10133927 3300013297 Bacteria 2296
329 Ga0157378_10297844 3300013297 Bacteria 1560
330 Ga0157378_11414961 3300013297 Unclassified 738
331 Ga0163162_10001677 3300013306 Bacteria 20764
332 Ga0163162_10017229 3300013306 Bacteria 7069
333 Ga0163162_10044150 3300013306 Bacteria 4463
334 Ga0163162_10163610 3300013306 Bacteria 2348
335 Ga0163162_10895406 3300013306 Bacteria 1001
336 Ga0157372_10006418 3300013307 Bacteria 12516
337 Ga0157372_10052004 3300013307 Bacteria 4560
338 Ga0157372_10117836 3300013307 Bacteria 3046
339 Ga0157372_10886625 3300013307 Bacteria 1035
340 Ga0157372_11720725 3300013307 Unclassified 721
341 Ga0157375_10000263 3300013308 Bacteria 47730
342 Ga0157375_10135976 3300013308 Bacteria 2582
343 Ga0157375_10192704 3300013308 Bacteria 2193
344 Ga0157375_11439516 3300013308 Bacteria 812
345 Ga0163163_10037332 3300014325 Bacteria 4726
346 Ga0163163_10074510 3300014325 Bacteria 3386
347 Ga0163163_10316586 3300014325 Bacteria 1614
348 Ga0163163_10317763 3300014325 Bacteria 1611
349 Ga0163163_12934105 3300014325 Bacteria 532
350 Ga0157380_10000294 3300014326 Bacteria 30013
351 Ga0157380_10122182 3300014326 Bacteria 2207
352 Ga0157380_13237656 3300014326 Bacteria 520
353 Ga0182008_10408393 3300014497 Unclassified 731
354 Ga0157377_10001223 3300014745 Bacteria 10958
355 Ga0157377_10143335 3300014745 Bacteria 1470
356 Ga0157379_10002453 3300014968 Bacteria 15540
357 Ga0157379_10025614 3300014968 Bacteria 5242
358 Ga0157379_10115199 3300014968 Bacteria 2417
359 Ga0157379_10185057 3300014968 Bacteria 1882
360 Ga0157379_10196082 3300014968 Bacteria 1825
361 Ga0157379_10329815 3300014968 Bacteria 1394
362 Ga0157376_10000342 3300014969 Bacteria 31043
363 Ga0157376_10134633 3300014969 Bacteria 2210
364 Ga0157376_10151167 3300014969 Bacteria 2094
365 Ga0163161_10000523 3300017792 Bacteria 31363
366 Ga0163161_10381004 3300017792 Bacteria 1127
367 Ga0213875_10001962 3300021388 Bacteria 12731
368 Ga0207666_1000010 3300025271 Bacteria 46973
369 Ga0207666_1000667 3300025271 Bacteria 4112
370 Ga0207673_1000505 3300025290 Bacteria 4125
371 Ga0207697_10000186 3300025315 Bacteria 32405
372 Ga0207697_10003939 3300025315 Bacteria 7220
373 Ga0207713_1044991 3300025735 Bacteria 1807
374 Ga0207653_10012427 3300025885 Bacteria 2658
375 Ga0207682_10000123 3300025893 Bacteria 34953
376 Ga0207692_10032812 3300025898 Bacteria 2498
377 Ga0207692_10284192 3300025898 Bacteria 1002
378 Ga0207692_11009394 3300025898 Bacteria 550
379 Ga0207642_10005605 3300025899 Bacteria 4110
380 Ga0207710_10002765 3300025900 Bacteria 8022
381 Ga0207710_10006531 3300025900 Bacteria 4972
382 Ga0207710_10257605 3300025900 Bacteria 874
383 Ga0207688_10000340 3300025901 Bacteria 21590
384 Ga0207688_10000889 3300025901 Bacteria 15094
385 Ga0207688_10203185 3300025901 Bacteria 1189
386 Ga0207680_10116477 3300025903 Bacteria 1741
387 Ga0207647_10011455 3300025904 Bacteria 6219
388 Ga0207647_10040398 3300025904 Bacteria 2938
389 Ga0207685_10028132 3300025905 Bacteria 1976
390 Ga0207685_10045413 3300025905 Bacteria 1666
391 Ga0207699_10004580 3300025906 Bacteria 6605
392 Ga0207645_10000023 3300025907 Bacteria 98724
393 Ga0207645_10049222 3300025907 Bacteria 2691
394 Ga0207643_10000007 3300025908 Bacteria 171706
395 Ga0207684_10527420 3300025910 Bacteria 1011
396 Ga0207654_10003445 3300025911 Bacteria 8001
397 Ga0207654_10050507 3300025911 Bacteria 2390
398 Ga0207707_10111063 3300025912 Bacteria 2396
399 Ga0207707_10275817 3300025912 Bacteria 1457
400 Ga0207707_10287031 3300025912 Bacteria 1424
401 Ga0207695_10194754 3300025913 Bacteria 1943
402 Ga0207695_10264455 3300025913 Bacteria 1617
403 Ga0207695_10965032 3300025913 Unclassified 732
404 Ga0207695_11052260 3300025913 Bacteria 693
405 Ga0207671_10024741 3300025914 Bacteria 4510
406 Ga0207671_10039604 3300025914 Bacteria 3489
407 Ga0207693_10185639 3300025915 Bacteria 1637
408 Ga0207693_10580563 3300025915 Bacteria 873
409 Ga0207663_10128103 3300025916 Bacteria 1749
410 Ga0207663_10514025 3300025916 Unclassified 932
411 Ga0207663_10543919 3300025916 Bacteria 907
412 Ga0207660_10000393 3300025917 Bacteria 28822
413 Ga0207660_10076398 3300025917 Bacteria 2449
414 Ga0207660_10163077 3300025917 Bacteria 1721
415 Ga0207660_10186507 3300025917 Bacteria 1613
416 Ga0207662_10000136 3300025918 Bacteria 35258
417 Ga0207662_10063446 3300025918 Bacteria 2222
418 Ga0207662_10652402 3300025918 Bacteria 735
419 Ga0207662_10789516 3300025918 Bacteria 669
420 Ga0207657_10002615 3300025919 Bacteria 19455
421 Ga0207657_10320497 3300025919 Bacteria 1226
422 Ga0207649_10000434 3300025920 Bacteria 30314
423 Ga0207649_10306640 3300025920 Bacteria 1162
424 Ga0207652_10001720 3300025921 Bacteria 19098
425 Ga0207652_10076720 3300025921 Bacteria 2915
426 Ga0207652_10127620 3300025921 Bacteria 2266
427 Ga0207652_10272766 3300025921 Bacteria 1526
428 Ga0207652_10569695 3300025921 Bacteria 1017
429 Ga0207652_10824789 3300025921 Bacteria 822
430 Ga0207681_10000273 3300025923 Bacteria 38704
431 Ga0207681_10295327 3300025923 Bacteria 1280
432 Ga0207694_10103091 3300025924 Bacteria 2262
433 Ga0207650_10020018 3300025925 Bacteria 4712
434 Ga0207650_10169465 3300025925 Bacteria 1735
435 Ga0207650_10944291 3300025925 Bacteria 733
436 Ga0207659_10000097 3300025926 Bacteria 51545
437 Ga0207659_10007932 3300025926 Bacteria 6566
438 Ga0207659_10670072 3300025926 Bacteria 887
439 Ga0207687_10120117 3300025927 Bacteria 1964
440 Ga0207687_10223689 3300025927 Unclassified 1483
441 Ga0207687_10449343 3300025927 Bacteria 1069
442 Ga0207700_10003518 3300025928 Bacteria 9127
443 Ga0207700_10097601 3300025928 Bacteria 2335
444 Ga0207700_10334032 3300025928 Bacteria 1316
445 Ga0207664_10048472 3300025929 Bacteria 3341
446 Ga0207664_10198976 3300025929 Bacteria 1728
447 Ga0207664_10209836 3300025929 Bacteria 1685
448 Ga0207664_10469011 3300025929 Bacteria 1125
449 Ga0207664_11007045 3300025929 Unclassified 747
450 Ga0207644_10003263 3300025931 Bacteria 10474
451 Ga0207644_10005450 3300025931 Bacteria 8289
452 Ga0207644_10557139 3300025931 Unclassified 949
453 Ga0207690_10000962 3300025932 Bacteria 18398
454 Ga0207690_10139249 3300025932 Bacteria 1786
455 Ga0207706_10000867 3300025933 Bacteria 31142
456 Ga0207706_10059941 3300025933 Bacteria 3352
457 Ga0207706_10098568 3300025933 Bacteria 2571
458 Ga0207686_10002591 3300025934 Bacteria 9812
459 Ga0207686_10032046 3300025934 Bacteria 3125
460 Ga0207686_10037852 3300025934 Bacteria 2914
461 Ga0207709_11316769 3300025935 Unclassified 597
462 Ga0207670_10000536 3300025936 Bacteria 20898
463 Ga0207670_10082190 3300025936 Bacteria 2257
464 Ga0207670_10610018 3300025936 Bacteria 897
465 Ga0207669_10001135 3300025937 Bacteria 11370
466 Ga0207669_10165681 3300025937 Bacteria 1567
467 Ga0207704_10000119 3300025938 Bacteria 43208
468 Ga0207704_10003914 3300025938 Bacteria 6770
469 Ga0207704_10939779 3300025938 Bacteria 729
470 Ga0207665_10000417 3300025939 Bacteria 29333
471 Ga0207665_10015059 3300025939 Bacteria 5079
472 Ga0207665_10144157 3300025939 Bacteria 1701
473 Ga0207665_11128519 3300025939 Bacteria 625
474 Ga0207691_10000544 3300025940 Bacteria 37754
475 Ga0207691_10217984 3300025940 Bacteria 1655
476 Ga0207711_10002468 3300025941 Bacteria 16502
477 Ga0207711_10099011 3300025941 Bacteria 2577
478 Ga0207711_10125801 3300025941 Bacteria 2293
479 Ga0207711_10289961 3300025941 Bacteria 1508
480 Ga0207711_10572557 3300025941 Unclassified 1053
481 Ga0207689_10001743 3300025942 Bacteria 20521
482 Ga0207689_10117899 3300025942 Bacteria 2183
483 Ga0207689_10296686 3300025942 Bacteria 1339
484 Ga0207661_10000785 3300025944 Bacteria 20682
485 Ga0207661_10223394 3300025944 Bacteria 1665
486 Ga0207661_10455646 3300025944 Bacteria 1165
487 Ga0207679_10000029 3300025945 Bacteria 183002
488 Ga0207679_10128429 3300025945 Bacteria 2030
489 Ga0207679_10128984 3300025945 Bacteria 2026
490 Ga0207679_10468933 3300025945 Bacteria 1119
491 Ga0207679_10799771 3300025945 Bacteria 860
492 Ga0207679_10822530 3300025945 Bacteria 847
493 Ga0207667_10016422 3300025949 Bacteria 8368
494 Ga0207667_10044449 3300025949 Bacteria 4706
495 Ga0207667_10068650 3300025949 Bacteria 3690
496 Ga0207667_10863785 3300025949 Unclassified 898
497 Ga0207667_10955605 3300025949 Bacteria 846
498 Ga0207651_10000083 3300025960 Bacteria 42310
499 Ga0207651_10139913 3300025960 Bacteria 1868
500 Ga0207712_10000471 3300025961 Bacteria 33929
501 Ga0207712_10084342 3300025961 Bacteria 2321
502 Ga0207712_10281977 3300025961 Bacteria 1356
503 Ga0207712_10586101 3300025961 Bacteria 963
504 Ga0207668_10000862 3300025972 Bacteria 18292
505 Ga0207640_10003185 3300025981 Bacteria 8831
506 Ga0207658_10002203 3300025986 Bacteria 14473
507 Ga0207658_10198152 3300025986 Bacteria 1674
508 Ga0207677_10000992 3300026023 Bacteria 15647
509 Ga0207677_10264725 3300026023 Bacteria 1403
510 Ga0207703_10014801 3300026035 Bacteria 6087
511 Ga0207703_10098576 3300026035 Bacteria 2472
512 Ga0207703_10104241 3300026035 Bacteria 2409
513 Ga0207703_10122397 3300026035 Bacteria 2235
514 Ga0207703_10148000 3300026035 Bacteria 2045
515 Ga0207639_10004451 3300026041 Bacteria 9457
516 Ga0207639_10177779 3300026041 Bacteria 1808
517 Ga0207678_10001568 3300026067 Bacteria 21015
518 Ga0207678_10030143 3300026067 Bacteria 4735
519 Ga0207678_10048617 3300026067 Bacteria 3666
520 Ga0207678_10241654 3300026067 Bacteria 1546
521 Ga0207708_10004251 3300026075 Bacteria 10546
522 Ga0207708_10023945 3300026075 Bacteria 4617
523 Ga0207708_10137355 3300026075 Bacteria 1915
524 Ga0207708_10203604 3300026075 Bacteria 1580
525 Ga0207702_10003639 3300026078 Bacteria 13965
526 Ga0207702_10092756 3300026078 Bacteria 2647
527 Ga0207702_10920268 3300026078 Bacteria 867
528 Ga0207641_10000510 3300026088 Bacteria 43699
529 Ga0207641_10917150 3300026088 Unclassified 870
530 Ga0207641_10959794 3300026088 Unclassified 851
531 Ga0207648_10002351 3300026089 Bacteria 20407
532 Ga0207648_10185015 3300026089 Bacteria 1845
533 Ga0207648_10200614 3300026089 Bacteria 1769
534 Ga0207676_10001371 3300026095 Bacteria 18133
535 Ga0207676_10014152 3300026095 Bacteria 5730
536 Ga0207676_10029204 3300026095 Bacteria 4126
537 Ga0207676_10219149 3300026095 Bacteria 1693
538 Ga0207676_10445788 3300026095 Unclassified 1219
539 Ga0207674_10000608 3300026116 Bacteria 46971
540 Ga0207674_10185416 3300026116 Bacteria 2031
541 Ga0207674_10250096 3300026116 Bacteria 1720
542 Ga0207674_10384519 3300026116 Bacteria 1357
543 Ga0207675_100000805 3300026118 Bacteria 31142
544 Ga0207683_10000082 3300026121 Bacteria 74842
545 Ga0207683_10007216 3300026121 Bacteria 9529
546 Ga0207683_10037275 3300026121 Bacteria 4233
547 Ga0207683_10316409 3300026121 Bacteria 1429
548 Ga0207683_10675933 3300026121 Unclassified 957
549 Ga0207698_10000377 3300026142 Bacteria 25983
550 Ga0207698_10257260 3300026142 Bacteria 1602
551 Ga0207698_10504867 3300026142 Bacteria 1177
552 Ga0207698_11345622 3300026142 Bacteria 729
553 Ga0209973_1011005 3300027252 Bacteria 1079
554 Ga0209984_1008995 3300027424 Bacteria 1263
555 Ga0209179_1056121 3300027512 Bacteria 850
556 Ga0210002_1001321 3300027617 Bacteria 3462
557 Ga0209971_1054660 3300027682 Bacteria 965
558 Ga0209966_1005107 3300027695 Bacteria 2244
559 Ga0209998_10002579 3300027717 Bacteria 4118
560 Ga0209813_10209987 3300027866 Bacteria 724
561 Ga0209974_10005874 3300027876 Bacteria 4304
562 Ga0209974_10020181 3300027876 Bacteria 2209
563 Ga0207428_10000124 3300027907 Bacteria 105795
564 Ga0207428_10000420 3300027907 Bacteria 52679
565 Ga0207428_10000703 3300027907 Bacteria 38851
566 Ga0207428_10905284 3300027907 Unclassified 623
567 Ga0268266_10138505 3300028379 Bacteria 2182
568 Ga0268266_10381955 3300028379 Bacteria 1329
569 Ga0268266_10818748 3300028379 Bacteria 899
570 Ga0268266_11644153 3300028379 Bacteria 618
571 Ga0268265_10001170 3300028380 Bacteria 22993
572 Ga0268265_10352587 3300028380 Bacteria 1344
573 Ga0268264_10001878 3300028381 Bacteria 19073
574 Ga0268264_10203260 3300028381 Bacteria 1814
575 Ga0268264_10217943 3300028381 Bacteria 1755
576 Ga0268264_10394554 3300028381 Bacteria 1328
577 Ga0268264_10590759 3300028381 Unclassified 1093
578 Ga0265337_1004750 3300028556 Bacteria 5571
579 Ga0265338_10081076 3300028800 Bacteria 2723
580 Ga0265338_10534682 3300028800 Bacteria 822
581 Ga0265325_10055164 3300031241 Bacteria 2032
582 Ga0265325_10285780 3300031241 Bacteria 739
583 Ga0265339_10110080 3300031249 Bacteria 1425
584 Ga0265316_10498186 3300031344 Bacteria 870
585 Ga0316575_10055001 3300031665 Bacteria 1585
586 Ga0316575_10068406 3300031665 Bacteria 1425
587 Ga0316583_10000771 3300032133 Bacteria 10056
588 Ga0373930_0001168 3300034816 Bacteria 3838
589 Ga0373948_0000160 3300034817 Bacteria 7409
590 Ga0373948_0010635 3300034817 Unclassified 1611
591 Ga0373958_0001209 3300034819 Bacteria 3443
592 Ga0373958_0003548 3300034819 Bacteria 2256
593 Ga0373958_0004355 3300034819 Bacteria 2094
594 Ga0373959_0002987 3300034820 Bacteria 2687
595 Ga0373959_0008682 3300034820 Bacteria 1735
596 Ga0373959_0012691 3300034820 Unclassified 1509
597 Ga0373938_0000574 3300034957 Bacteria 5948
598 Ga0373938_0030785 3300034957 Bacteria 1147
599 Ga0373928_0002434 3300035084 Bacteria 3607
600 Ga0373928_0005079 3300035084 Bacteria 2509
601 Ga0373928_0019947 3300035084 Unclassified 1402
602 Ga0373929_0005219 3300035085 Bacteria 2335
603 Ga0373929_0024438 3300035085 Bacteria 1248
604 Ga0373929_0036900 3300035085 Unclassified 1069
605 Ga0373934_0088877 3300035086 Bacteria 1244
606 Ga0373934_0145739 3300035086 Bacteria 969
607 Ga0373940_0000069 3300035088 Bacteria 11756
608 Ga0373940_0002640 3300035088 Bacteria 3524
609 Ga0373940_0054586 3300035088 Unclassified 1130
610 Ga0373949_0000870 3300035090 Bacteria 9531
611 Ga0373949_0002073 3300035090 Bacteria 5292
612 Ga0373951_0002636 3300035091 Bacteria 4499
613 Ga0373951_0003101 3300035091 Bacteria 4100
614 Ga0373951_0012104 3300035091 Bacteria 1940
615 Ga0373952_0001400 3300035092 Bacteria 4411
616 Ga0373952_0003512 3300035092 Bacteria 2827
617 Ga0373952_0005360 3300035092 Bacteria 2343
618 Ga0373923_0012915 3300035111 Bacteria 3101
619 Ga0373923_0166864 3300035111 Bacteria 1007
620 Ga0373923_0367730 3300035111 Bacteria 688
621 Ga0373932_0002119 3300035112 Bacteria 5158
622 Ga0373936_0001643 3300035113 Bacteria 8197
623 Ga0373936_0297987 3300035113 Unclassified 727
624 Ga0373939_0001165 3300035114 Bacteria 6436
625 Ga0373939_0003141 3300035114 Bacteria 3883
626 Ga0373939_0064153 3300035114 Bacteria 1178
627 Ga0373941_0000185 3300035115 Bacteria 11732
628 Ga0373941_0001158 3300035115 Bacteria 5499
629 Ga0373945_0000687 3300035116 Bacteria 9768
630 Ga0373945_0000695 3300035116 Bacteria 9737
631 Ga0373945_0203214 3300035116 Bacteria 823
632 Ga0373953_0001909 3300035117 Bacteria 6180
633 Ga0373953_0006813 3300035117 Bacteria 3789
634 Ga0373954_0004095 3300035118 Bacteria 6248
635 Ga0373954_0004312 3300035118 Bacteria 6113
636 Ga0373954_0008788 3300035118 Bacteria 4443
637 Ga0373954_0016524 3300035118 Bacteria 3304
638 Ga0373956_0004180 3300035119 Bacteria 5788
639 Ga0373956_0031693 3300035119 Bacteria 2318
640 Ga0373957_0004330 3300035120 Bacteria 4309
641 Ga0373957_0006881 3300035120 Bacteria 3608
642 Ga0373957_0139488 3300035120 Bacteria 990
643 Ga0373960_0000288 3300035121 Bacteria 9618
644 Ga0373960_0000314 3300035121 Bacteria 9220
645 Ga0373960_0097115 3300035121 Unclassified 950
646 Ga0373943_0003558 3300035170 Bacteria 7091
647 Ga0373943_0025872 3300035170 Bacteria 2745
648 Ga0373946_0011915 3300035171 Bacteria 3249
649 Ga0373946_0057297 3300035171 Bacteria 1648
650 Ga0373946_0451959 3300035171 Bacteria 654
651 Ga0373946_0609450 3300035171 Unclassified 566
652 Ga0373955_0000419 3300035172 Bacteria 17956
653 Ga0373955_0014791 3300035172 Bacteria 3806
654 Ga0373955_0126208 3300035172 Bacteria 1491
655 Ga0373955_0244843 3300035172 Bacteria 1074
656 Ga0373942_0007512 3300035207 Bacteria 2530
657 Ga0373942_0189397 3300035207 Unclassified 677
658 Ga0373961_0000636 3300035241 Bacteria 12674
659 Ga0373961_0001288 3300035241 Bacteria 7639
660 Ga0373961_0005944 3300035241 Bacteria 2932
661 Ga0373961_0110901 3300035241 Bacteria 899
662 Ga0373962_0000974 3300035242 Bacteria 6617
663 Ga0373962_0013472 3300035242 Bacteria 2072
664 Ga0373962_0014241 3300035242 Bacteria 2025
665 Ga0373924_0000402 3300035410 Bacteria 13279
666 Ga0373924_0049898 3300035410 Bacteria 1733
667 Ga0373924_0100828 3300035410 Bacteria 1242
668 Ga0373924_0211517 3300035410 Unclassified 856
669 Ga0373931_0014198 3300035691 Bacteria 3889
670 Ga0373935_0000012 3300035692 Bacteria 81961
671 Ga0373935_0114880 3300035692 Bacteria 1791
672 Ga0373935_0320575 3300035692 Unclassified 1099
673 Ga0373927_0006963 3300035695 Bacteria 7676
674 Ga0373927_0031200 3300035695 Bacteria 3475
675 Ga0373927_0331158 3300035695 Bacteria 1003
676 Ga0373933_0000893 3300035724 Bacteria 18249
677 Ga0373933_0004197 3300035724 Bacteria 7942
678 Ga0373933_0371840 3300035724 Unclassified 930
679 Ga0373947_0002387 3300035725 Bacteria 11336
680 Ga0373947_0013898 3300035725 Bacteria 4615
681 Ga0373947_0106326 3300035725 Bacteria 1768
682 Ga0373937_0000054 3300036401 Bacteria 102542
683 Ga0373937_0036163 3300036401 Bacteria 4499
684 Ga0373937_0084336 3300036401 Bacteria 2939
685 Ga0373937_0260551 3300036401 Bacteria 1635
686 Ga0373937_0334901 3300036401 Unclassified 1433
687 Ga0373937_0626303 3300036401 Bacteria 1021
688 Ga0373925_0000018 3300037068 Bacteria 174213
689 Ga0373925_0149411 3300037068 Bacteria 1833
690 Ga0373925_0374663 3300037068 Bacteria 1158
691 Ga0373925_0532501 3300037068 Bacteria 965
692 Ga0395899_0081389 3300037312 Bacteria 2356
693 Ga0395900_0001369 3300037418 Bacteria 29330
694 Ga0395900_0030158 3300037418 Bacteria 5567
695 Ga0395898_0017006 3300037466 Bacteria 7427
696 Ga0395898_0049455 3300037466 Bacteria 4119
697 Ga0395898_0067146 3300037466 Bacteria 3473
698 Ga0395905_0533525 3300037471 Bacteria 1074
699 Ga0436364_0997377 3300037853 Bacteria 897
700 Ga0436364_1325276 3300037853 Bacteria 58128
701 Ga0395901_0006448 3300038443 Bacteria 11889
702 Ga0395901_0369703 3300038443 Bacteria 1477
703 Ga0242419_022220 3300038698 Unclassified 535
704 Ga0242420_012183 3300038996 Bacteria 1452
705 Ga0436365_1531855 3300039437 Bacteria 1400
706 Ga0436365_1569518 3300039437 Bacteria 1003
707 Ga0436363_0942778 3300039450 Bacteria 1289
708 Ga0436362_0063504 3300039453 Bacteria 800
709 Ga0439450_099769 3300042008 Bacteria 736
710 Ga0439435_0002304 3300042436 Bacteria 3761
711 Ga0439459_0060356 3300042438 Bacteria 855
712 Ga0439464_0098059 3300042439 Bacteria 888
713 Ga0439460_0012096 3300042461 Bacteria 2233
714 Ga0466966_0046303 3300044684 Bacteria 2778
715 Ga0466961_0034949 3300044693 Bacteria 3227
716 Ga0466963_0220717 3300044694 Unclassified 1327
717 Ga0466963_1084952 3300044694 Bacteria 563
718 Ga0466959_0489922 3300045049 Bacteria 831
719 Ga0451576_0309129 3300045051 Unclassified 1654
720 Ga0466958_0038326 3300045836 Bacteria 2876
721 Ga0466958_0191358 3300045836 Bacteria 1300
722 Ga0466967_0732053 3300045976 Bacteria 980
723 Ga0495617_072191 3300046452 Bacteria 1135
724 Ga0495592_0000001 3300046454 Bacteria 305819
725 Ga0495592_0031373 3300046454 Bacteria 4016
726 Ga0495592_0379569 3300046454 Bacteria 900
727 Ga0495592_0701821 3300046454 Unclassified 608
728 Ga0495603_0025839 3300046455 Bacteria 3549
729 Ga0495603_0041607 3300046455 Bacteria 2747
730 Ga0495591_113022 3300046458 Bacteria 666
731 Ga0495629_0002067 3300046459 Bacteria 15573
732 Ga0495629_0006898 3300046459 Bacteria 8377
733 Ga0495629_0041066 3300046459 Bacteria 3255
734 Ga0495629_0076460 3300046459 Bacteria 2337
735 Ga0495641_0017165 3300046461 Bacteria 3781
736 Ga0495641_0089052 3300046461 Unclassified 1380
737 Ga0495651_0003892 3300046462 Bacteria 11420
738 Ga0495651_0003996 3300046462 Bacteria 11277
739 Ga0495651_0013246 3300046462 Bacteria 6376
740 Ga0495653_0000292 3300046463 Bacteria 40544
741 Ga0495653_0010574 3300046463 Bacteria 7556
742 Ga0495653_0038160 3300046463 Bacteria 3770
743 Ga0495653_0196921 3300046463 Bacteria 1370
744 Ga0495653_0245634 3300046463 Bacteria 1190
745 Ga0495580_0035178 3300046472 Bacteria 3602
746 Ga0495582_0059398 3300046473 Bacteria 2109
747 Ga0495582_0110852 3300046473 Bacteria 1541
748 Ga0495639_0030981 3300046475 Bacteria 2378
749 Ga0495639_0051117 3300046475 Bacteria 1879
750 Ga0495639_0064199 3300046475 Bacteria 1687
751 Ga0495662_0002781 3300046476 Bacteria 8842
752 Ga0495662_0028948 3300046476 Bacteria 2674
753 Ga0495662_0278585 3300046476 Bacteria 823
754 Ga0495664_0000001 3300046477 Bacteria 757730
755 Ga0495664_0003348 3300046477 Bacteria 8717
756 Ga0495664_0078730 3300046477 Bacteria 1974
757 Ga0495584_0041089 3300046491 Bacteria 2335
758 Ga0495594_0026532 3300046499 Bacteria 3117
759 Ga0495594_0038501 3300046499 Bacteria 2611
760 Ga0495594_0233935 3300046499 Bacteria 1047
761 Ga0495607_0458264 3300046501 Bacteria 571
762 Ga0495608_0000050 3300046511 Bacteria 96603
763 Ga0495608_0009807 3300046511 Bacteria 6683
764 Ga0495608_0071850 3300046511 Bacteria 2257
765 Ga0495608_0092126 3300046511 Bacteria 1959
766 Ga0495608_0715829 3300046511 Bacteria 595
767 Ga0495618_0000045 3300046514 Bacteria 94654
768 Ga0495618_0004751 3300046514 Bacteria 8305
769 Ga0495618_0072201 3300046514 Bacteria 2196
770 Ga0495618_0199829 3300046514 Bacteria 1265
771 Ga0495628_0000003 3300046516 Bacteria 470339
772 Ga0495628_0002046 3300046516 Bacteria 18273
773 Ga0495628_0049119 3300046516 Bacteria 3341
774 Ga0495628_0091598 3300046516 Bacteria 2353
775 Ga0495630_0002190 3300046517 Bacteria 13605
776 Ga0495630_0030402 3300046517 Bacteria 4017
777 Ga0495630_0055331 3300046517 Bacteria 2973
778 Ga0495631_0117810 3300046518 Bacteria 1142
779 Ga0495637_0038624 3300046520 Bacteria 2066
780 Ga0495644_0061346 3300046523 Bacteria 1413
781 Ga0495663_0103796 3300046525 Bacteria 938
782 Ga0495666_0007624 3300046526 Bacteria 5416
783 Ga0495666_0021257 3300046526 Bacteria 3211
784 Ga0495652_0000001 3300046529 Bacteria 1045081
785 Ga0495652_0020932 3300046529 Bacteria 5812
786 Ga0495665_0261136 3300046531 Bacteria 890
787 Ga0495640_0000006 3300046533 Bacteria 285419
788 Ga0495640_0008637 3300046533 Bacteria 7984
789 Ga0495640_0033258 3300046533 Bacteria 3665
790 Ga0495640_0179741 3300046533 Bacteria 1348
791 Ga0495586_0004089 3300046535 Bacteria 7817
792 Ga0495586_0029120 3300046535 Bacteria 2956
793 Ga0495586_0073218 3300046535 Bacteria 1874
794 Ga0495587_0000028 3300046536 Bacteria 138663
795 Ga0495587_0006079 3300046536 Bacteria 7876
796 Ga0495587_0013640 3300046536 Bacteria 5105
797 Ga0495598_0003603 3300046537 Bacteria 3303
798 Ga0495609_0177304 3300046538 Bacteria 898
799 Ga0495645_0000004 3300046543 Bacteria 532661
800 Ga0495645_0343798 3300046543 Bacteria 963
801 Ga0495622_0013106 3300046557 Bacteria 3847
802 Ga0495622_0262309 3300046557 Bacteria 758
803 Ga0495667_0000001 3300046559 Bacteria 834831
804 Ga0495667_0002342 3300046559 Bacteria 12672
805 Ga0495667_0141398 3300046559 Bacteria 1551
806 Ga0495656_0009862 3300046615 Bacteria 3450
807 Ga0495634_0000531 3300046642 Bacteria 37387
808 Ga0495634_0019375 3300046642 Bacteria 4836
809 Ga0495634_0025736 3300046642 Bacteria 4109
810 Ga0495634_0185453 3300046642 Bacteria 1300
811 Ga0495611_0051766 3300046648 Bacteria 1851
812 Ga0495635_0000007 3300046663 Bacteria 278786
813 Ga0495635_0000736 3300046663 Bacteria 21173
814 Ga0495635_0025074 3300046663 Bacteria 4154
815 Ga0495635_0340919 3300046663 Bacteria 1001
816 Ga0495659_0317643 3300046664 Bacteria 661
817 Ga0495588_0013638 3300046674 Bacteria 3873
818 Ga0495657_0000136 3300046675 Bacteria 65707
819 Ga0495657_0025115 3300046675 Bacteria 4234
820 Ga0495657_0065329 3300046675 Bacteria 2393
821 Ga0495657_0089251 3300046675 Bacteria 1981
822 Ga0495599_0000002 3300046678 Bacteria 348168
823 Ga0495599_0002064 3300046678 Bacteria 11642
824 Ga0495599_0155610 3300046678 Unclassified 1414
825 Ga0495623_0000052 3300046679 Bacteria 71268
826 Ga0495623_0002286 3300046679 Bacteria 12776
827 Ga0495646_0000036 3300046680 Bacteria 81182
828 Ga0495646_0002741 3300046680 Bacteria 10885
829 Ga0495646_0054470 3300046680 Bacteria 2405
830 Ga0495646_0147666 3300046680 Bacteria 1310
831 Ga0495647_0010583 3300046681 Bacteria 3143
832 Ga0495647_0038031 3300046681 Bacteria 1818
833 Ga0495647_0159922 3300046681 Bacteria 970
834 Ga0495658_0001370 3300046683 Bacteria 12779
835 Ga0495658_0018935 3300046683 Bacteria 3588
836 Ga0495669_0020794 3300046684 Bacteria 2844
837 Ga0495669_0359342 3300046684 Unclassified 704
838 Ga0495613_0006674 3300046689 Bacteria 8621
839 Ga0495613_0039955 3300046689 Bacteria 3476
840 Ga0495613_0098623 3300046689 Bacteria 2111
841 Ga0495624_0014439 3300046690 Bacteria 5358
842 Ga0495624_0174582 3300046690 Bacteria 1310
843 Ga0495670_0006726 3300046691 Bacteria 5655
844 Ga0495600_0000037 3300046809 Bacteria 78434
845 Ga0495600_0003589 3300046809 Bacteria 9137
846 Ga0495600_0109398 3300046809 Bacteria 1799
847 Ga0495581_0002869 3300047315 Bacteria 9849
848 Ga0495581_0005348 3300047315 Bacteria 7424
849 Ga0495581_0046501 3300047315 Bacteria 2508
850 Ga0495581_0114681 3300047315 Bacteria 1567
851 Ga0495581_0125649 3300047315 Bacteria 1493
852 Ga0495604_0000602 3300047317 Bacteria 31009
853 Ga0495604_0020434 3300047317 Bacteria 5288
854 Ga0495604_0058771 3300047317 Bacteria 2952
855 Ga0495604_0075847 3300047317 Bacteria 2530
856 Ga0495674_0000001 3300047319 Bacteria 778665
857 Ga0495674_0012879 3300047319 Bacteria 7875
858 Ga0495674_0046522 3300047319 Bacteria 3850
859 Ga0495674_0146363 3300047319 Bacteria 1983
860 Ga0495676_0072815 3300047321 Bacteria 2637
861 Ga0495676_0251189 3300047321 Bacteria 1206
862 Ga0495680_0000705 3300047322 Bacteria 37488
863 Ga0495680_0011290 3300047322 Bacteria 7916
864 Ga0495680_0021145 3300047322 Bacteria 5453
865 Ga0495680_0036428 3300047322 Bacteria 3949
866 Ga0495680_0116258 3300047322 Bacteria 1978
867 Ga0495675_0000049 3300047444 Bacteria 80913
868 Ga0495675_0000480 3300047444 Bacteria 26138
869 Ga0495684_0000046 3300047471 Bacteria 92658
870 Ga0495684_0009067 3300047471 Bacteria 7683
871 Ga0495684_0529609 3300047471 Unclassified 805
872 Ga0495593_0009427 3300047673 Bacteria 5664
873 Ga0495593_0013719 3300047673 Bacteria 4615
874 Ga0495593_0070727 3300047673 Bacteria 1812
875 Ga0495602_0000102 3300048088 Bacteria 81094
876 Ga0495602_0178747 3300048088 Bacteria 1639
877 Ga0495602_0352227 3300048088 Bacteria 1062
878 Ga0495614_0022914 3300048089 Bacteria 2692
879 Ga0496100_0000057 3300048903 Bacteria 67216
880 Ga0496100_0008197 3300048903 Bacteria 5818
881 Ga0496100_0068502 3300048903 Bacteria 2360
882 Ga0496101_0065500 3300048904 Bacteria 2649
883 Ga0496101_0167695 3300048904 Bacteria 1686
884 Ga0496101_0253127 3300048904 Unclassified 1372
885 Ga0496102_0001628 3300048905 Bacteria 19791
886 Ga0496102_0023116 3300048905 Bacteria 5517
887 Ga0496102_0232125 3300048905 Bacteria 1739
888 Ga0496102_0241653 3300048905 Unclassified 1702
889 Ga0496102_0257080 3300048905 Bacteria 1646
890 Ga0496102_0398302 3300048905 Bacteria 1294
891 Ga0496102_0441266 3300048905 Bacteria 1221
892 Ga0496103_0039242 3300048906 Bacteria 2910
893 Ga0496103_0306285 3300048906 Unclassified 1022
894 Ga0496104_0059037 3300048907 Bacteria 3631
895 Ga0496104_0062929 3300048907 Bacteria 3518
896 Ga0496104_0072866 3300048907 Bacteria 3267
897 Ga0496104_0120451 3300048907 Bacteria 2519
898 Ga0496104_0156717 3300048907 Bacteria 2185
899 Ga0496105_0071127 3300048908 Bacteria 2875
900 Ga0496105_0116920 3300048908 Bacteria 2199
901 Ga0496105_0523047 3300048908 Unclassified 929
902 Ga0496106_0028707 3300048909 Bacteria 4144
903 Ga0496106_0423263 3300048909 Bacteria 1070
904 Ga0496107_0001129 3300048910 Bacteria 16115
905 Ga0496107_0064606 3300048910 Bacteria 2653
906 Ga0496107_0192756 3300048910 Bacteria 1514
907 Ga0496107_0785625 3300048910 Bacteria 697
908 Ga0496108_0003535 3300048911 Bacteria 12534
909 Ga0496108_0043797 3300048911 Bacteria 3738
910 Ga0496108_0086379 3300048911 Bacteria 2663
911 Ga0496108_0160018 3300048911 Bacteria 1945
912 Ga0496109_0002432 3300048912 Bacteria 15587
913 Ga0496109_0033913 3300048912 Bacteria 4594
914 Ga0496109_0061718 3300048912 Bacteria 3427
915 Ga0496109_0074074 3300048912 Bacteria 3130
916 Ga0496109_0093167 3300048912 Bacteria 2787
917 Ga0496109_0144608 3300048912 Bacteria 2224
918 Ga0496110_0077993 3300048913 Bacteria 2948
919 Ga0496110_0083286 3300048913 Bacteria 2853
920 Ga0496110_0143879 3300048913 Bacteria 2156
921 Ga0496110_0691338 3300048913 Unclassified 921
922 Ga0496111_0022875 3300048914 Bacteria 4381
923 Ga0496111_0043097 3300048914 Bacteria 3243
924 Ga0496111_0098747 3300048914 Bacteria 2144
925 Ga0496111_0171211 3300048914 Bacteria 1613
926 Ga0496111_0310351 3300048914 Bacteria 1169
927 Ga0496112_0070793 3300048915 Bacteria 3446
928 Ga0496112_0079005 3300048915 Bacteria 3254
929 Ga0496112_0100086 3300048915 Bacteria 2868
930 Ga0496112_0121818 3300048915 Bacteria 2578
931 Ga0496112_0339166 3300048915 Unclassified 1446
932 Ga0496112_0406554 3300048915 Unclassified 1301
933 Ga0496112_1029737 3300048915 Bacteria 743
934 Ga0496113_0049425 3300048916 Bacteria 3131
935 Ga0496113_0057193 3300048916 Bacteria 2930
936 Ga0496113_0076978 3300048916 Bacteria 2549
937 Ga0496114_0002944 3300048917 Bacteria 13059
938 Ga0496114_0010304 3300048917 Bacteria 7438
939 Ga0496114_0757422 3300048917 Bacteria 848
940 Ga0496115_0002786 3300048918 Bacteria 12565
941 Ga0496115_0047377 3300048918 Bacteria 3437
942 Ga0496115_0142243 3300048918 Bacteria 1979
943 Ga0496115_0189633 3300048918 Bacteria 1698
944 Ga0496115_0508287 3300048918 Bacteria 967
945 Ga0496121_0601147 3300048924 Bacteria 679
946 Ga0496125_0131914 3300048928 Bacteria 1757
947 Ga0501031_0327693 3300049568 Bacteria 992
948 Ga0501036_0652256 3300049572 Bacteria 871
949 Ga0501037_0783430 3300049573 Bacteria 630
950 Ga0501042_0127565 3300049578 Bacteria 1832
951 Ga0501046_0776403 3300049580 Bacteria 672
952 Ga0501047_0722528 3300049581 Unclassified 813
953 Ga0501048_0152945 3300049582 Bacteria 1632
954 Ga0501048_1282069 3300049582 Unclassified 527
955 Ga0501067_0538171 3300049583 Bacteria 654
956 Ga0501068_0271736 3300049584 Bacteria 1082
957 Ga0501068_1095784 3300049584 Bacteria 527
958 Ga0501070_0244160 3300049586 Bacteria 1470
959 Ga0501071_0013555 3300049587 Bacteria 5558
960 Ga0501072_0044486 3300049588 Bacteria 3491
961 Ga0501073_0045999 3300049589 Bacteria 3072
962 Ga0501075_0299893 3300049591 Bacteria 1224
963 Ga0501076_0661325 3300049592 Bacteria 862
964 Ga0501077_0123062 3300049593 Unclassified 1644
965 Ga0501077_0460576 3300049593 Bacteria 814
966 Ga0501079_0216088 3300049741 Bacteria 1498
967 Ga0501079_0404254 3300049741 Bacteria 1071
968 Ga0501081_0073391 3300049743 Bacteria 2386
969 Ga0501083_0008454 3300049744 Bacteria 7274
970 Ga0501083_0853241 3300049744 Bacteria 593
971 Ga0501044_0555230 3300049823 Bacteria 1045
972 Ga0501045_0576953 3300049824 Bacteria 833
973 nmdc:mga03n38_606528_c1 3300050490 Bacteria 624
974 nmdc:mga0k408_120181_c1 3300050493 Bacteria 1556
975 nmdc:mga0k408_746501_c1 3300050493 Unclassified 572
976 nmdc:mga06z11_211456_c1 3300050494 Bacteria 1130
977 nmdc:mga05p37_45_c2 3300050507 Bacteria 24882
978 nmdc:mga05p37_839451_c1 3300050507 Bacteria 999
979 nmdc:mga05p37_92628_c1 3300050507 Bacteria 3724
980 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
981 nmdc:mga0qj67_1012_c1 3300050509 Bacteria 19405
982 nmdc:mga0qj67_92436_c1 3300050509 Bacteria 2432
983 nmdc:mga06r32_56570_c1 3300050510 Bacteria 3766
984 nmdc:mga08y16_1134_c1 3300050511 Bacteria 26246
985 nmdc:mga08y16_12172_c1 3300050511 Bacteria 9043
986 nmdc:mga08y16_1989_c1 3300050511 Bacteria 20867
987 nmdc:mga0n895_286420_c1 3300050512 Bacteria 1670
988 nmdc:mga0n895_3165_c1 3300050512 Bacteria 13152
989 nmdc:mga0n895_404960_c1 3300050512 Bacteria 1380
990 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
991 nmdc:mga0rr50_45762_c1 3300050513 Bacteria 3219
992 nmdc:mga0rr50_77520_c1 3300050513 Bacteria 2554
993 nmdc:mga0rr50_950190_c1 3300050513 Unclassified 733
994 nmdc:mga08x19_536788_c1 3300050514 Bacteria 827
995 nmdc:mga08x19_75835_c1 3300050514 Bacteria 2199
996 nmdc:mga08x19_86249_c1 3300050514 Bacteria 2067
997 nmdc:mga0a205_171569_c1 3300050515 Unclassified 2065
998 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
999 nmdc:mga0a205_5479_c1 3300050515 Bacteria 11429
1000 Ga0495601_0000006 3300053077 Bacteria 373770
1001 Ga0495601_0004549 3300053077 Bacteria 8015
1002 Ga0495601_0010204 3300053077 Bacteria 5583
1003 Ga0495601_0011553 3300053077 Bacteria 5288
1004 Ga0495601_0041259 3300053077 Bacteria 2892
1005 Ga0495601_0189704 3300053077 Bacteria 1343
1006 Ga0495612_0000004 3300053078 Bacteria 286946
1007 Ga0495612_0004274 3300053078 Bacteria 5935
1008 Ga0495612_0139684 3300053078 Bacteria 1050
1009 Ga0495612_0210593 3300053078 Bacteria 859
1010 Ga0495595_0000227 3300053084 Bacteria 22346
1011 Ga0495595_0000420 3300053084 Bacteria 16034
1012 Ga0495595_0002620 3300053084 Bacteria 7052
1013 Ga0495595_0003875 3300053084 Bacteria 5969
1014 Ga0495595_0109261 3300053084 Bacteria 1339
1015 Ga0495619_0000027 3300053085 Bacteria 165001
1016 Ga0495619_0000260 3300053085 Bacteria 38574
1017 Ga0495619_0013843 3300053085 Bacteria 5090
1018 Ga0495619_0016793 3300053085 Bacteria 4634
1019 Ga0495619_0053926 3300053085 Bacteria 2661
1020 Ga0495619_0057856 3300053085 Bacteria 2572
1021 Ga0495619_0060868 3300053085 Bacteria 2510
1022 Ga0500566_0193529 3300053094 Bacteria 1033
1023 Ga0501084_0544356 3300054114 Unclassified 981
1024 Ga0501082_0007806 3300060353 Bacteria 9234
1025 Ga0501082_0222206 3300060353 Bacteria 1643
1026 Ga0466962_0034260 3300061719 Bacteria 2431
1027 Ga0530510_0219739 3300061734 Bacteria 1412
1028 Ga0530510_0767135 3300061734 Bacteria 735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842694124 2842695400 146
2 3300028379 Ga0268266_11644153 Ga0268266_116441531 147
3 3300049584 Ga0501068_1095784 Ga0501068_1095784_43_489 147
4 3300002459 JGI24751J29686_10062096 JGI24751J29686_100620962 148
5 3300003203 JGI25406J46586_10033300 JGI25406J46586_100333001 148
6 3300005290 Ga0065712_10615400 Ga0065712_106154001 148
7 3300005331 Ga0070670_100577328 Ga0070670_1005773282 148
8 3300005331 Ga0070670_100665518 Ga0070670_1006655181 148
9 3300005340 Ga0070689_100224298 Ga0070689_1002242982 148
10 3300005365 Ga0070688_100028095 Ga0070688_1000280951 148
11 3300005539 Ga0068853_100245345 Ga0068853_1002453452 148
12 3300005577 Ga0068857_100363630 Ga0068857_1003636302 148
13 3300005617 Ga0068859_100310289 Ga0068859_1003102892 148
14 3300005617 Ga0068859_101007969 Ga0068859_1010079692 148
15 3300005618 Ga0068864_100210126 Ga0068864_1002101262 148
16 3300005844 Ga0068862_100445539 Ga0068862_1004455392 148
17 3300005844 Ga0068862_101152857 Ga0068862_1011528571 148
18 3300005985 Ga0081539_10004321 Ga0081539_100043214 148
19 3300006175 Ga0070712_100562458 Ga0070712_1005624581 148
20 3300006195 Ga0075366_10008368 Ga0075366_100083686 148
21 3300006931 Ga0097620_100310281 Ga0097620_1003102812 148
22 3300006931 Ga0097620_101007933 Ga0097620_1010079332 148
23 3300009094 Ga0111539_11341449 Ga0111539_113414491 148
24 3300014325 Ga0163163_12934105 Ga0163163_129341051 148
25 3300014326 Ga0157380_13237656 Ga0157380_132376561 148
26 3300017792 Ga0163161_10381004 Ga0163161_103810042 148
27 3300025923 Ga0207681_10295327 Ga0207681_102953272 148
28 3300025925 Ga0207650_10169465 Ga0207650_101694652 148
29 3300025925 Ga0207650_10944291 Ga0207650_109442912 148
30 3300025926 Ga0207659_10670072 Ga0207659_106700721 148
31 3300025927 Ga0207687_10449343 Ga0207687_104493432 148
32 3300025936 Ga0207670_10610018 Ga0207670_106100182 148
33 3300025942 Ga0207689_10117899 Ga0207689_101178992 148
34 3300025961 Ga0207712_10586101 Ga0207712_105861012 148
35 3300026035 Ga0207703_10148000 Ga0207703_101480002 148
36 3300026041 Ga0207639_10177779 Ga0207639_101777792 148
37 3300026095 Ga0207676_10029204 Ga0207676_100292042 148
38 3300026116 Ga0207674_10185416 Ga0207674_101854162 148
39 3300027866 Ga0209813_10209987 Ga0209813_102099872 148
40 3300028380 Ga0268265_10352587 Ga0268265_103525872 148
41 3300037853 Ga0436364_0997377 Ga0436364_0997377_261_710 148
42 3300039437 Ga0436365_1569518 Ga0436365_1569518_296_745 148
43 3300042436 Ga0439435_0002304 Ga0439435_0002304_2931_3380 148
44 3300044694 Ga0466963_1084952 Ga0466963_1084952_69_518 148
45 3300050493 nmdc:mga0k408_120181_c1 nmdc:mga0k408_120181_c1_286_735 148
46 3300050507 nmdc:mga05p37_839451_c1 nmdc:mga05p37_839451_c1_423_872 148
47 3300050509 nmdc:mga0qj67_92436_c1 nmdc:mga0qj67_92436_c1_1402_1848 148
48 3300039437 Ga0436365_1531855 Ga0436365_1531855_777_1229 149
49 3300039450 Ga0436363_0942778 Ga0436363_0942778_744_1196 149
50 3300039453 Ga0436362_0063504 Ga0436362_0063504_265_717 149
51 3300005329 Ga0070683_100105366 Ga0070683_1001053662 150
52 3300005336 Ga0070680_100102774 Ga0070680_1001027743 150
53 3300005434 Ga0070709_10066394 Ga0070709_100663943 150
54 3300005435 Ga0070714_100023744 Ga0070714_1000237446 150
55 3300005435 Ga0070714_100024265 Ga0070714_1000242656 150
56 3300005436 Ga0070713_100681284 Ga0070713_1006812841 150
57 3300005437 Ga0070710_10360499 Ga0070710_103604992 150
58 3300005439 Ga0070711_100277590 Ga0070711_1002775902 150
59 3300005458 Ga0070681_10139375 Ga0070681_101393751 150
60 3300005535 Ga0070684_100065596 Ga0070684_1000655961 150
61 3300005547 Ga0070693_100295687 Ga0070693_1002956872 150
62 3300005563 Ga0068855_100235987 Ga0068855_1002359871 150
63 3300006173 Ga0070716_100706632 Ga0070716_1007066322 150
64 3300006175 Ga0070712_100254997 Ga0070712_1002549973 150
65 3300009093 Ga0105240_10398388 Ga0105240_103983882 150
66 3300009174 Ga0105241_10165873 Ga0105241_101658732 150
67 3300009174 Ga0105241_10751454 Ga0105241_107514542 150
68 3300009551 Ga0105238_10070510 Ga0105238_100705104 150
69 3300010159 Ga0099796_10003664 Ga0099796_100036644 150
70 3300013100 Ga0157373_10196765 Ga0157373_101967651 150
71 3300013102 Ga0157371_10060753 Ga0157371_100607532 150
72 3300013104 Ga0157370_10510019 Ga0157370_105100192 150
73 3300013307 Ga0157372_10052004 Ga0157372_100520044 150
74 3300013307 Ga0157372_11720725 Ga0157372_117207252 150
75 3300021388 Ga0213875_10001962 Ga0213875_100019622 150
76 3300025898 Ga0207692_11009394 Ga0207692_110093941 150
77 3300025911 Ga0207654_10050507 Ga0207654_100505073 150
78 3300025913 Ga0207695_10264455 Ga0207695_102644552 150
79 3300025916 Ga0207663_10543919 Ga0207663_105439191 150
80 3300025917 Ga0207660_10163077 Ga0207660_101630772 150
81 3300025929 Ga0207664_10198976 Ga0207664_101989761 150
82 3300025929 Ga0207664_10469011 Ga0207664_104690112 150
83 3300025929 Ga0207664_11007045 Ga0207664_110070452 150
84 3300025939 Ga0207665_11128519 Ga0207665_111285191 150
85 3300025949 Ga0207667_10955605 Ga0207667_109556051 150
86 3300026078 Ga0207702_10092756 Ga0207702_100927562 150
87 3300027512 Ga0209179_1056121 Ga0209179_10561212 150
88 3300028556 Ga0265337_1004750 Ga0265337_10047502 150
89 3300028800 Ga0265338_10081076 Ga0265338_100810762 150
90 3300028800 Ga0265338_10534682 Ga0265338_105346821 150
91 3300031241 Ga0265325_10055164 Ga0265325_100551642 150
92 3300031241 Ga0265325_10285780 Ga0265325_102857801 150
93 3300031249 Ga0265339_10110080 Ga0265339_101100802 150
94 3300031344 Ga0265316_10498186 Ga0265316_104981862 150
95 3300031665 Ga0316575_10055001 Ga0316575_100550012 150
96 3300031665 Ga0316575_10068406 Ga0316575_100684062 150
97 3300032133 Ga0316583_10000771 Ga0316583_100007714 150
98 3300035086 Ga0373934_0145739 Ga0373934_0145739_202_654 150
99 3300035111 Ga0373923_0166864 Ga0373923_0166864_172_624 150
100 3300035113 Ga0373936_0001643 Ga0373936_0001643_4131_4583 150
101 3300035116 Ga0373945_0000695 Ga0373945_0000695_5584_6036 150
102 3300035117 Ga0373953_0006813 Ga0373953_0006813_2682_3134 150
103 3300035118 Ga0373954_0004095 Ga0373954_0004095_23_475 150
104 3300035118 Ga0373954_0004312 Ga0373954_0004312_4782_5234 150
105 3300035119 Ga0373956_0031693 Ga0373956_0031693_810_1262 150
106 3300035120 Ga0373957_0006881 Ga0373957_0006881_1597_2049 150
107 3300035170 Ga0373943_0003558 Ga0373943_0003558_4545_4997 150
108 3300035172 Ga0373955_0000419 Ga0373955_0000419_6060_6512 150
109 3300035172 Ga0373955_0126208 Ga0373955_0126208_171_623 150
110 3300035241 Ga0373961_0110901 Ga0373961_0110901_387_839 150
111 3300035410 Ga0373924_0000402 Ga0373924_0000402_9850_10302 150
112 3300035410 Ga0373924_0211517 Ga0373924_0211517_354_806 150
113 3300035692 Ga0373935_0000012 Ga0373935_0000012_53585_54037 150
114 3300035695 Ga0373927_0006963 Ga0373927_0006963_1217_1669 150
115 3300035724 Ga0373933_0004197 Ga0373933_0004197_4838_5290 150
116 3300035724 Ga0373933_0371840 Ga0373933_0371840_449_901 150
117 3300035725 Ga0373947_0002387 Ga0373947_0002387_9127_9579 150
118 3300036401 Ga0373937_0000054 Ga0373937_0000054_13616_14068 150
119 3300036401 Ga0373937_0260551 Ga0373937_0260551_254_706 150
120 3300037068 Ga0373925_0000018 Ga0373925_0000018_120150_120602 150
121 3300037853 Ga0436364_1325276 Ga0436364_1325276_33848_34324 150
122 3300046454 Ga0495592_0000001 Ga0495592_0000001_87796_88248 150
123 3300046454 Ga0495592_0379569 Ga0495592_0379569_362_814 150
124 3300046459 Ga0495629_0006898 Ga0495629_0006898_7039_7491 150
125 3300046462 Ga0495651_0003996 Ga0495651_0003996_7799_8251 150
126 3300046463 Ga0495653_0000292 Ga0495653_0000292_21621_22073 150
127 3300046476 Ga0495662_0002781 Ga0495662_0002781_5017_5469 150
128 3300046477 Ga0495664_0000001 Ga0495664_0000001_228113_228565 150
129 3300046511 Ga0495608_0000050 Ga0495608_0000050_46101_46553 150
130 3300046511 Ga0495608_0092126 Ga0495608_0092126_300_752 150
131 3300046514 Ga0495618_0000045 Ga0495618_0000045_66236_66688 150
132 3300046516 Ga0495628_0000003 Ga0495628_0000003_59170_59622 150
133 3300046517 Ga0495630_0002190 Ga0495630_0002190_6392_6844 150
134 3300046529 Ga0495652_0000001 Ga0495652_0000001_598600_599052 150
135 3300046533 Ga0495640_0000006 Ga0495640_0000006_46236_46688 150
136 3300046535 Ga0495586_0073218 Ga0495586_0073218_584_1036 150
137 3300046536 Ga0495587_0000028 Ga0495587_0000028_105213_105665 150
138 3300046543 Ga0495645_0000004 Ga0495645_0000004_121619_122071 150
139 3300046559 Ga0495667_0000001 Ga0495667_0000001_438568_439020 150
140 3300046559 Ga0495667_0141398 Ga0495667_0141398_960_1412 150
141 3300046642 Ga0495634_0000531 Ga0495634_0000531_21371_21823 150
142 3300046663 Ga0495635_0000007 Ga0495635_0000007_252647_253099 150
143 3300046675 Ga0495657_0000136 Ga0495657_0000136_59162_59614 150
144 3300046675 Ga0495657_0065329 Ga0495657_0065329_1553_2005 150
145 3300046678 Ga0495599_0000002 Ga0495599_0000002_319699_320151 150
146 3300046679 Ga0495623_0000052 Ga0495623_0000052_21598_22050 150
147 3300046680 Ga0495646_0000036 Ga0495646_0000036_59285_59737 150
148 3300046681 Ga0495647_0159922 Ga0495647_0159922_347_799 150
149 3300046689 Ga0495613_0039955 Ga0495613_0039955_562_1014 150
150 3300046690 Ga0495624_0174582 Ga0495624_0174582_405_857 150
151 3300046809 Ga0495600_0000037 Ga0495600_0000037_21430_21882 150
152 3300047315 Ga0495581_0002869 Ga0495581_0002869_4902_5354 150
153 3300047317 Ga0495604_0000602 Ga0495604_0000602_27947_28399 150
154 3300047319 Ga0495674_0000001 Ga0495674_0000001_428050_428502 150
155 3300047321 Ga0495676_0251189 Ga0495676_0251189_283_735 150
156 3300047322 Ga0495680_0000705 Ga0495680_0000705_30977_31429 150
157 3300047322 Ga0495680_0116258 Ga0495680_0116258_1324_1776 150
158 3300047444 Ga0495675_0000049 Ga0495675_0000049_59056_59508 150
159 3300047471 Ga0495684_0000046 Ga0495684_0000046_78213_78665 150
160 3300047673 Ga0495593_0013719 Ga0495593_0013719_1119_1571 150
161 3300048088 Ga0495602_0000102 Ga0495602_0000102_59207_59659 150
162 3300048088 Ga0495602_0178747 Ga0495602_0178747_123_575 150
163 3300048915 Ga0496112_1029737 Ga0496112_1029737_260_715 150
164 3300049581 Ga0501047_0722528 Ga0501047_0722528_72_524 150
165 3300049584 Ga0501068_0271736 Ga0501068_0271736_456_914 150
166 3300049741 Ga0501079_0404254 Ga0501079_0404254_547_1005 150
167 3300049743 Ga0501081_0073391 Ga0501081_0073391_980_1438 150
168 3300049744 Ga0501083_0853241 Ga0501083_0853241_57_515 150
169 3300049823 Ga0501044_0555230 Ga0501044_0555230_355_807 150
170 3300053077 Ga0495601_0000006 Ga0495601_0000006_268100_268552 150
171 3300053077 Ga0495601_0041259 Ga0495601_0041259_506_958 150
172 3300053078 Ga0495612_0000004 Ga0495612_0000004_46108_46560 150
173 3300053078 Ga0495612_0210593 Ga0495612_0210593_214_666 150
174 3300053084 Ga0495595_0000227 Ga0495595_0000227_6407_6859 150
175 3300053084 Ga0495595_0109261 Ga0495595_0109261_150_602 150
176 3300053085 Ga0495619_0000027 Ga0495619_0000027_59358_59810 150
177 3300053085 Ga0495619_0053926 Ga0495619_0053926_446_898 150
178 3300060353 Ga0501082_0007806 Ga0501082_0007806_7413_7871 150
179 3300061734 Ga0530510_0767135 Ga0530510_0767135_67_525 150
180 3300005344 Ga0070661_101250019 Ga0070661_1012500192 151
181 3300005458 Ga0070681_10824898 Ga0070681_108248982 151
182 3300013308 Ga0157375_11439516 Ga0157375_114395162 151
183 3300025912 Ga0207707_10287031 Ga0207707_102870311 151
184 3300049572 Ga0501036_0652256 Ga0501036_0652256_167_622 151
185 3300049573 Ga0501037_0783430 Ga0501037_0783430_163_618 151
186 3300049578 Ga0501042_0127565 Ga0501042_0127565_949_1404 151
187 3300049580 Ga0501046_0776403 Ga0501046_0776403_144_599 151
188 3300049582 Ga0501048_0152945 Ga0501048_0152945_317_772 151
189 3300049587 Ga0501071_0013555 Ga0501071_0013555_1706_2161 151
190 3300049588 Ga0501072_0044486 Ga0501072_0044486_2886_3341 151
191 3300049591 Ga0501075_0299893 Ga0501075_0299893_566_1021 151
192 3300049592 Ga0501076_0661325 Ga0501076_0661325_131_586 151
193 3300049593 Ga0501077_0460576 Ga0501077_0460576_327_782 151
194 3300049824 Ga0501045_0576953 Ga0501045_0576953_101_556 151
195 3300054114 Ga0501084_0544356 Ga0501084_0544356_264_719 151
196 3300061734 Ga0530510_0219739 Ga0530510_0219739_749_1204 151
197 3300042438 Ga0439459_0060356 Ga0439459_0060356_330_830 152
198 3300025915 Ga0207693_10580563 Ga0207693_105805632 153
199 3300035410 Ga0373924_0100828 Ga0373924_0100828_195_716 153
200 3300037068 Ga0373925_0532501 Ga0373925_0532501_157_690 153
201 3300037418 Ga0395900_0001369 Ga0395900_0001369_9485_9946 153
202 3300037466 Ga0395898_0017006 Ga0395898_0017006_2342_2803 153
203 3300037471 Ga0395905_0533525 Ga0395905_0533525_490_951 153
204 3300046473 Ga0495582_0110852 Ga0495582_0110852_804_1325 153
205 3300046476 Ga0495662_0278585 Ga0495662_0278585_106_627 153
206 3300046514 Ga0495618_0072201 Ga0495618_0072201_782_1315 153
207 3300046526 Ga0495666_0007624 Ga0495666_0007624_3678_4211 153
208 3300046543 Ga0495645_0343798 Ga0495645_0343798_245_778 153
209 3300046557 Ga0495622_0262309 Ga0495622_0262309_74_595 153
210 3300046642 Ga0495634_0185453 Ga0495634_0185453_89_610 153
211 3300046680 Ga0495646_0147666 Ga0495646_0147666_578_1111 153
212 3300046681 Ga0495647_0038031 Ga0495647_0038031_108_641 153
213 3300047315 Ga0495581_0125649 Ga0495581_0125649_476_1009 153
214 3300047319 Ga0495674_0046522 Ga0495674_0046522_1159_1692 153
215 3300049583 Ga0501067_0538171 Ga0501067_0538171_63_527 153
216 3300053077 Ga0495601_0010204 Ga0495601_0010204_1297_1830 153
217 3300053085 Ga0495619_0013843 Ga0495619_0013843_1349_1882 153
218 3300005327 Ga0070658_10115505 Ga0070658_101155052 154
219 3300005436 Ga0070713_101606664 Ga0070713_1016066641 154
220 3300005563 Ga0068855_100020137 Ga0068855_1000201377 154
221 3300005577 Ga0068857_100618475 Ga0068857_1006184752 154
222 3300009551 Ga0105238_10012092 Ga0105238_100120927 154
223 3300013307 Ga0157372_10117836 Ga0157372_101178362 154
224 3300014497 Ga0182008_10408393 Ga0182008_104083931 154
225 3300025913 Ga0207695_11052260 Ga0207695_110522602 154
226 3300025924 Ga0207694_10103091 Ga0207694_101030913 154
227 3300025949 Ga0207667_10044449 Ga0207667_100444493 154
228 3300026116 Ga0207674_10250096 Ga0207674_102500962 154
229 3300044684 Ga0466966_0046303 Ga0466966_0046303_1470_1934 154
230 3300044693 Ga0466961_0034949 Ga0466961_0034949_762_1226 154
231 3300044694 Ga0466963_0220717 Ga0466963_0220717_160_624 154
232 3300045049 Ga0466959_0489922 Ga0466959_0489922_246_710 154
233 3300045836 Ga0466958_0038326 Ga0466958_0038326_1371_1835 154
234 3300045836 Ga0466958_0191358 Ga0466958_0191358_369_833 154
235 3300050490 nmdc:mga03n38_606528_c1 nmdc:mga03n38_606528_c1_135_605 154
236 3300061719 Ga0466962_0034260 Ga0466962_0034260_1301_1765 154
237 3300009098 Ga0105245_11211651 Ga0105245_112116512 155
238 3300046475 Ga0495639_0051117 Ga0495639_0051117_1096_1629 155
239 3300049568 Ga0501031_0327693 Ga0501031_0327693_65_595 155
240 3300005337 Ga0070682_100308753 Ga0070682_1003087532 156
241 3300005344 Ga0070661_101125174 Ga0070661_1011251741 156
242 3300005364 Ga0070673_100781188 Ga0070673_1007811882 156
243 3300005436 Ga0070713_100190763 Ga0070713_1001907632 156
244 3300005437 Ga0070710_10010783 Ga0070710_100107832 156
245 3300005457 Ga0070662_100834181 Ga0070662_1008341812 156
246 3300005563 Ga0068855_100284778 Ga0068855_1002847782 156
247 3300005616 Ga0068852_100514371 Ga0068852_1005143712 156
248 3300009545 Ga0105237_10142292 Ga0105237_101422923 156
249 3300013297 Ga0157378_11414961 Ga0157378_114149612 156
250 3300013306 Ga0163162_10044150 Ga0163162_100441504 156
251 3300013307 Ga0157372_10886625 Ga0157372_108866252 156
252 3300014968 Ga0157379_10329815 Ga0157379_103298152 156
253 3300025898 Ga0207692_10032812 Ga0207692_100328123 156
254 3300025905 Ga0207685_10045413 Ga0207685_100454132 156
255 3300025921 Ga0207652_10824789 Ga0207652_108247891 156
256 3300025928 Ga0207700_10334032 Ga0207700_103340322 156
257 3300025933 Ga0207706_10098568 Ga0207706_100985683 156
258 3300025960 Ga0207651_10139913 Ga0207651_101399132 156
259 3300025961 Ga0207712_10281977 Ga0207712_102819772 156
260 3300037312 Ga0395899_0081389 Ga0395899_0081389_935_1474 156
261 3300037418 Ga0395900_0030158 Ga0395900_0030158_3719_4258 156
262 3300037466 Ga0395898_0049455 Ga0395898_0049455_344_883 156
263 3300038443 Ga0395901_0006448 Ga0395901_0006448_3787_4326 156
264 3300046455 Ga0495603_0041607 Ga0495603_0041607_106_633 156
265 3300046499 Ga0495594_0233935 Ga0495594_0233935_33_560 156
266 3300048904 Ga0496101_0167695 Ga0496101_0167695_359_892 156
267 3300048905 Ga0496102_0023116 Ga0496102_0023116_3155_3688 156
268 3300048907 Ga0496104_0120451 Ga0496104_0120451_1903_2436 156
269 3300048910 Ga0496107_0192756 Ga0496107_0192756_356_889 156
270 3300048912 Ga0496109_0074074 Ga0496109_0074074_656_1189 156
271 3300048915 Ga0496112_0079005 Ga0496112_0079005_281_808 156
272 3300048918 Ga0496115_0508287 Ga0496115_0508287_379_912 156
273 3300049586 Ga0501070_0244160 Ga0501070_0244160_295_825 156
274 3300049589 Ga0501073_0045999 Ga0501073_0045999_1129_1659 156
275 3300049744 Ga0501083_0008454 Ga0501083_0008454_6102_6632 156
276 3300060353 Ga0501082_0222206 Ga0501082_0222206_1067_1597 156
277 3300005444 Ga0070694_100334790 Ga0070694_1003347902 157
278 3300005456 Ga0070678_100135201 Ga0070678_1001352012 157
279 3300005563 Ga0068855_100031660 Ga0068855_1000316603 157
280 3300005564 Ga0070664_100285222 Ga0070664_1002852222 157
281 3300005614 Ga0068856_100164360 Ga0068856_1001643602 157
282 3300005616 Ga0068852_100079588 Ga0068852_1000795883 157
283 3300006028 Ga0070717_10423517 Ga0070717_104235172 157
284 3300006173 Ga0070716_100548250 Ga0070716_1005482502 157
285 3300006175 Ga0070712_101002837 Ga0070712_1010028371 157
286 3300006237 Ga0097621_100021075 Ga0097621_1000210754 157
287 3300006358 Ga0068871_100030893 Ga0068871_1000308932 157
288 3300009098 Ga0105245_10152565 Ga0105245_101525652 157
289 3300009174 Ga0105241_10282491 Ga0105241_102824912 157
290 3300009177 Ga0105248_10056701 Ga0105248_100567014 157
291 3300011119 Ga0105246_10482729 Ga0105246_104827292 157
292 3300012481 Ga0157320_1021615 Ga0157320_10216152 157
293 3300013104 Ga0157370_11080666 Ga0157370_110806661 157
294 3300013105 Ga0157369_10532119 Ga0157369_105321192 157
295 3300014325 Ga0163163_10316586 Ga0163163_103165862 157
296 3300025898 Ga0207692_10284192 Ga0207692_102841922 157
297 3300025934 Ga0207686_10037852 Ga0207686_100378523 157
298 3300025939 Ga0207665_10015059 Ga0207665_100150592 157
299 3300025941 Ga0207711_10099011 Ga0207711_100990112 157
300 3300025945 Ga0207679_10128984 Ga0207679_101289842 157
301 3300025949 Ga0207667_10068650 Ga0207667_100686502 157
302 3300026067 Ga0207678_10030143 Ga0207678_100301432 157
303 3300026088 Ga0207641_10959794 Ga0207641_109597942 157
304 3300026121 Ga0207683_10007216 Ga0207683_100072163 157
305 3300035086 Ga0373934_0088877 Ga0373934_0088877_615_1124 157
306 3300035111 Ga0373923_0367730 Ga0373923_0367730_90_599 157
307 3300035117 Ga0373953_0001909 Ga0373953_0001909_2462_2971 157
308 3300035118 Ga0373954_0016524 Ga0373954_0016524_926_1435 157
309 3300035119 Ga0373956_0004180 Ga0373956_0004180_1936_2445 157
310 3300035120 Ga0373957_0004330 Ga0373957_0004330_1915_2424 157
311 3300035171 Ga0373946_0451959 Ga0373946_0451959_13_522 157
312 3300035172 Ga0373955_0014791 Ga0373955_0014791_1774_2283 157
313 3300035692 Ga0373935_0114880 Ga0373935_0114880_225_734 157
314 3300035695 Ga0373927_0331158 Ga0373927_0331158_58_567 157
315 3300035724 Ga0373933_0000893 Ga0373933_0000893_16123_16632 157
316 3300037068 Ga0373925_0374663 Ga0373925_0374663_296_805 157
317 3300046454 Ga0495592_0031373 Ga0495592_0031373_297_806 157
318 3300046459 Ga0495629_0041066 Ga0495629_0041066_479_988 157
319 3300046462 Ga0495651_0013246 Ga0495651_0013246_2898_3407 157
320 3300046463 Ga0495653_0038160 Ga0495653_0038160_184_693 157
321 3300046477 Ga0495664_0003348 Ga0495664_0003348_2830_3339 157
322 3300046511 Ga0495608_0009807 Ga0495608_0009807_1214_1723 157
323 3300046514 Ga0495618_0004751 Ga0495618_0004751_4126_4635 157
324 3300046516 Ga0495628_0002046 Ga0495628_0002046_15879_16388 157
325 3300046517 Ga0495630_0055331 Ga0495630_0055331_82_591 157
326 3300046529 Ga0495652_0020932 Ga0495652_0020932_2771_3280 157
327 3300046533 Ga0495640_0008637 Ga0495640_0008637_2959_3468 157
328 3300046535 Ga0495586_0004089 Ga0495586_0004089_6941_7450 157
329 3300046536 Ga0495587_0006079 Ga0495587_0006079_5020_5529 157
330 3300046642 Ga0495634_0019375 Ga0495634_0019375_2628_3137 157
331 3300046663 Ga0495635_0000736 Ga0495635_0000736_16954_17463 157
332 3300046675 Ga0495657_0025115 Ga0495657_0025115_189_698 157
333 3300046678 Ga0495599_0002064 Ga0495599_0002064_10837_11346 157
334 3300046679 Ga0495623_0002286 Ga0495623_0002286_11302_11811 157
335 3300046680 Ga0495646_0002741 Ga0495646_0002741_7549_8058 157
336 3300046690 Ga0495624_0014439 Ga0495624_0014439_2742_3251 157
337 3300046809 Ga0495600_0109398 Ga0495600_0109398_347_856 157
338 3300047317 Ga0495604_0020434 Ga0495604_0020434_1619_2128 157
339 3300047319 Ga0495674_0012879 Ga0495674_0012879_4023_4532 157
340 3300047322 Ga0495680_0021145 Ga0495680_0021145_1799_2308 157
341 3300047444 Ga0495675_0000480 Ga0495675_0000480_2988_3497 157
342 3300048910 Ga0496107_0785625 Ga0496107_0785625_144_653 157
343 3300048913 Ga0496110_0691338 Ga0496110_0691338_297_806 157
344 3300048914 Ga0496111_0310351 Ga0496111_0310351_625_1134 157
345 3300048917 Ga0496114_0757422 Ga0496114_0757422_238_747 157
346 3300053077 Ga0495601_0011553 Ga0495601_0011553_1491_2000 157
347 3300053078 Ga0495612_0004274 Ga0495612_0004274_1048_1557 157
348 3300053084 Ga0495595_0000420 Ga0495595_0000420_12472_12981 157
349 3300053085 Ga0495619_0016793 Ga0495619_0016793_1663_2172 157
350 3300005530 Ga0070679_100358833 Ga0070679_1003588332 158
351 3300025921 Ga0207652_10272766 Ga0207652_102727662 158
352 3300045976 Ga0466967_0732053 Ga0466967_0732053_308_835 158
353 3300005328 Ga0070676_10236745 Ga0070676_102367452 159
354 3300005331 Ga0070670_100235031 Ga0070670_1002350312 159
355 3300005334 Ga0068869_100661514 Ga0068869_1006615142 159
356 3300005335 Ga0070666_10001839 Ga0070666_1000183915 159
357 3300005336 Ga0070680_100124334 Ga0070680_1001243342 159
358 3300005337 Ga0070682_100010911 Ga0070682_1000109112 159
359 3300005338 Ga0068868_100259259 Ga0068868_1002592591 159
360 3300005338 Ga0068868_100717048 Ga0068868_1007170481 159
361 3300005339 Ga0070660_100430741 Ga0070660_1004307412 159
362 3300005340 Ga0070689_100049550 Ga0070689_1000495502 159
363 3300005341 Ga0070691_10060821 Ga0070691_100608212 159
364 3300005344 Ga0070661_100092283 Ga0070661_1000922833 159
365 3300005355 Ga0070671_100091245 Ga0070671_1000912452 159
366 3300005355 Ga0070671_100250203 Ga0070671_1002502032 159
367 3300005365 Ga0070688_100064025 Ga0070688_1000640253 159
368 3300005366 Ga0070659_100965221 Ga0070659_1009652212 159
369 3300005367 Ga0070667_100084445 Ga0070667_1000844453 159
370 3300005434 Ga0070709_10003620 Ga0070709_100036203 159
371 3300005435 Ga0070714_100040478 Ga0070714_1000404781 159
372 3300005436 Ga0070713_100156668 Ga0070713_1001566682 159
373 3300005437 Ga0070710_10008897 Ga0070710_100088974 159
374 3300005439 Ga0070711_100122379 Ga0070711_1001223792 159
375 3300005439 Ga0070711_100357520 Ga0070711_1003575202 159
376 3300005440 Ga0070705_100072916 Ga0070705_1000729162 159
377 3300005455 Ga0070663_100331488 Ga0070663_1003314882 159
378 3300005456 Ga0070678_100020403 Ga0070678_1000204033 159
379 3300005456 Ga0070678_100266982 Ga0070678_1002669822 159
380 3300005458 Ga0070681_10016649 Ga0070681_100166493 159
381 3300005459 Ga0068867_100330952 Ga0068867_1003309522 159
382 3300005466 Ga0070685_10051382 Ga0070685_100513822 159
383 3300005530 Ga0070679_100131590 Ga0070679_1001315902 159
384 3300005535 Ga0070684_100060283 Ga0070684_1000602833 159
385 3300005535 Ga0070684_100601370 Ga0070684_1006013702 159
386 3300005544 Ga0070686_100164667 Ga0070686_1001646672 159
387 3300005546 Ga0070696_100340163 Ga0070696_1003401632 159
388 3300005547 Ga0070693_100030479 Ga0070693_1000304793 159
389 3300005547 Ga0070693_100103745 Ga0070693_1001037452 159
390 3300005548 Ga0070665_100207388 Ga0070665_1002073882 159
391 3300005564 Ga0070664_100739967 Ga0070664_1007399672 159
392 3300005614 Ga0068856_100449012 Ga0068856_1004490122 159
393 3300005618 Ga0068864_100018526 Ga0068864_1000185265 159
394 3300005834 Ga0068851_10108129 Ga0068851_101081292 159
395 3300005842 Ga0068858_100112198 Ga0068858_1001121982 159
396 3300005843 Ga0068860_100745695 Ga0068860_1007456951 159
397 3300006028 Ga0070717_10006465 Ga0070717_1000646510 159
398 3300006163 Ga0070715_10029891 Ga0070715_100298912 159
399 3300006173 Ga0070716_100003033 Ga0070716_1000030332 159
400 3300006237 Ga0097621_100048453 Ga0097621_1000484533 159
401 3300006358 Ga0068871_100059648 Ga0068871_1000596483 159
402 3300006871 Ga0075434_100234596 Ga0075434_1002345962 159
403 3300006881 Ga0068865_100162809 Ga0068865_1001628092 159
404 3300006881 Ga0068865_100951326 Ga0068865_1009513262 159
405 3300006914 Ga0075436_100093945 Ga0075436_1000939452 159
406 3300009011 Ga0105251_10009243 Ga0105251_100092437 159
407 3300009098 Ga0105245_11023069 Ga0105245_110230692 159
408 3300009098 Ga0105245_11634296 Ga0105245_116342962 159
409 3300009101 Ga0105247_10038860 Ga0105247_100388603 159
410 3300009148 Ga0105243_10247884 Ga0105243_102478842 159
411 3300009148 Ga0105243_10612432 Ga0105243_106124322 159
412 3300009174 Ga0105241_10125441 Ga0105241_101254412 159
413 3300009176 Ga0105242_10009393 Ga0105242_100093937 159
414 3300009177 Ga0105248_10185800 Ga0105248_101858002 159
415 3300009177 Ga0105248_10857143 Ga0105248_108571432 159
416 3300009553 Ga0105249_10295751 Ga0105249_102957512 159
417 3300009553 Ga0105249_11075648 Ga0105249_110756482 159
418 3300010375 Ga0105239_10710429 Ga0105239_107104292 159
419 3300010375 Ga0105239_10835107 Ga0105239_108351072 159
420 3300011119 Ga0105246_10062610 Ga0105246_100626103 159
421 3300012505 Ga0157339_1002627 Ga0157339_10026272 159
422 3300013296 Ga0157374_10282802 Ga0157374_102828021 159
423 3300013296 Ga0157374_10299961 Ga0157374_102999612 159
424 3300013297 Ga0157378_10133927 Ga0157378_101339272 159
425 3300013297 Ga0157378_10297844 Ga0157378_102978442 159
426 3300013306 Ga0163162_10163610 Ga0163162_101636102 159
427 3300013306 Ga0163162_10895406 Ga0163162_108954062 159
428 3300013308 Ga0157375_10192704 Ga0157375_101927042 159
429 3300014325 Ga0163163_10074510 Ga0163163_100745103 159
430 3300014325 Ga0163163_10317763 Ga0163163_103177632 159
431 3300014745 Ga0157377_10143335 Ga0157377_101433352 159
432 3300014968 Ga0157379_10115199 Ga0157379_101151992 159
433 3300014968 Ga0157379_10196082 Ga0157379_101960822 159
434 3300014969 Ga0157376_10134633 Ga0157376_101346333 159
435 3300014969 Ga0157376_10151167 Ga0157376_101511672 159
436 3300025735 Ga0207713_1044991 Ga0207713_10449912 159
437 3300025900 Ga0207710_10006531 Ga0207710_100065312 159
438 3300025900 Ga0207710_10257605 Ga0207710_102576052 159
439 3300025901 Ga0207688_10203185 Ga0207688_102031852 159
440 3300025903 Ga0207680_10116477 Ga0207680_101164772 159
441 3300025905 Ga0207685_10028132 Ga0207685_100281322 159
442 3300025906 Ga0207699_10004580 Ga0207699_100045802 159
443 3300025907 Ga0207645_10049222 Ga0207645_100492223 159
444 3300025912 Ga0207707_10111063 Ga0207707_101110632 159
445 3300025913 Ga0207695_10965032 Ga0207695_109650321 159
446 3300025916 Ga0207663_10128103 Ga0207663_101281032 159
447 3300025916 Ga0207663_10514025 Ga0207663_105140252 159
448 3300025917 Ga0207660_10186507 Ga0207660_101865072 159
449 3300025918 Ga0207662_10652402 Ga0207662_106524022 159
450 3300025919 Ga0207657_10320497 Ga0207657_103204972 159
451 3300025920 Ga0207649_10306640 Ga0207649_103066402 159
452 3300025921 Ga0207652_10076720 Ga0207652_100767203 159
453 3300025925 Ga0207650_10020018 Ga0207650_100200185 159
454 3300025927 Ga0207687_10120117 Ga0207687_101201172 159
455 3300025927 Ga0207687_10223689 Ga0207687_102236892 159
456 3300025928 Ga0207700_10003518 Ga0207700_100035185 159
457 3300025929 Ga0207664_10048472 Ga0207664_100484723 159
458 3300025931 Ga0207644_10003263 Ga0207644_100032635 159
459 3300025931 Ga0207644_10557139 Ga0207644_105571392 159
460 3300025932 Ga0207690_10139249 Ga0207690_101392491 159
461 3300025934 Ga0207686_10032046 Ga0207686_100320463 159
462 3300025937 Ga0207669_10165681 Ga0207669_101656812 159
463 3300025938 Ga0207704_10003914 Ga0207704_100039144 159
464 3300025938 Ga0207704_10939779 Ga0207704_109397792 159
465 3300025939 Ga0207665_10000417 Ga0207665_1000041735 159
466 3300025941 Ga0207711_10289961 Ga0207711_102899612 159
467 3300025942 Ga0207689_10296686 Ga0207689_102966861 159
468 3300025944 Ga0207661_10223394 Ga0207661_102233942 159
469 3300025944 Ga0207661_10455646 Ga0207661_104556462 159
470 3300025945 Ga0207679_10468933 Ga0207679_104689332 159
471 3300025945 Ga0207679_10799771 Ga0207679_107997712 159
472 3300025961 Ga0207712_10084342 Ga0207712_100843422 159
473 3300025986 Ga0207658_10198152 Ga0207658_101981522 159
474 3300026023 Ga0207677_10264725 Ga0207677_102647252 159
475 3300026035 Ga0207703_10122397 Ga0207703_101223973 159
476 3300026067 Ga0207678_10048617 Ga0207678_100486172 159
477 3300026075 Ga0207708_10137355 Ga0207708_101373553 159
478 3300026075 Ga0207708_10203604 Ga0207708_102036042 159
479 3300026078 Ga0207702_10920268 Ga0207702_109202682 159
480 3300026088 Ga0207641_10917150 Ga0207641_109171502 159
481 3300026089 Ga0207648_10185015 Ga0207648_101850152 159
482 3300026095 Ga0207676_10014152 Ga0207676_100141525 159
483 3300026095 Ga0207676_10445788 Ga0207676_104457882 159
484 3300026121 Ga0207683_10037275 Ga0207683_100372754 159
485 3300026121 Ga0207683_10316409 Ga0207683_103164091 159
486 3300026142 Ga0207698_11345622 Ga0207698_113456221 159
487 3300027907 Ga0207428_10905284 Ga0207428_109052841 159
488 3300028379 Ga0268266_10818748 Ga0268266_108187482 159
489 3300028381 Ga0268264_10217943 Ga0268264_102179432 159
490 3300028381 Ga0268264_10394554 Ga0268264_103945542 159
491 3300028381 Ga0268264_10590759 Ga0268264_105907592 159
492 3300034817 Ga0373948_0010635 Ga0373948_0010635_459_938 159
493 3300034819 Ga0373958_0004355 Ga0373958_0004355_266_745 159
494 3300034820 Ga0373959_0012691 Ga0373959_0012691_516_995 159
495 3300034957 Ga0373938_0030785 Ga0373938_0030785_161_640 159
496 3300035084 Ga0373928_0005079 Ga0373928_0005079_825_1304 159
497 3300035085 Ga0373929_0024438 Ga0373929_0024438_749_1228 159
498 3300035088 Ga0373940_0054586 Ga0373940_0054586_141_620 159
499 3300035091 Ga0373951_0012104 Ga0373951_0012104_1050_1565 159
500 3300035092 Ga0373952_0005360 Ga0373952_0005360_217_696 159
501 3300035111 Ga0373923_0012915 Ga0373923_0012915_1716_2195 159
502 3300035113 Ga0373936_0297987 Ga0373936_0297987_93_572 159
503 3300035114 Ga0373939_0064153 Ga0373939_0064153_82_561 159
504 3300035116 Ga0373945_0000687 Ga0373945_0000687_1817_2296 159
505 3300035118 Ga0373954_0008788 Ga0373954_0008788_488_967 159
506 3300035120 Ga0373957_0139488 Ga0373957_0139488_40_519 159
507 3300035121 Ga0373960_0097115 Ga0373960_0097115_299_778 159
508 3300035170 Ga0373943_0025872 Ga0373943_0025872_1712_2191 159
509 3300035171 Ga0373946_0011915 Ga0373946_0011915_1773_2252 159
510 3300035171 Ga0373946_0057297 Ga0373946_0057297_313_792 159
511 3300035172 Ga0373955_0244843 Ga0373955_0244843_89_568 159
512 3300035207 Ga0373942_0007512 Ga0373942_0007512_293_772 159
513 3300035207 Ga0373942_0189397 Ga0373942_0189397_145_660 159
514 3300035241 Ga0373961_0005944 Ga0373961_0005944_1453_1932 159
515 3300035242 Ga0373962_0013472 Ga0373962_0013472_1128_1607 159
516 3300035410 Ga0373924_0049898 Ga0373924_0049898_303_782 159
517 3300035692 Ga0373935_0320575 Ga0373935_0320575_359_838 159
518 3300035695 Ga0373927_0031200 Ga0373927_0031200_1428_1907 159
519 3300035725 Ga0373947_0013898 Ga0373947_0013898_1610_2089 159
520 3300035725 Ga0373947_0106326 Ga0373947_0106326_998_1477 159
521 3300036401 Ga0373937_0084336 Ga0373937_0084336_1740_2219 159
522 3300036401 Ga0373937_0334901 Ga0373937_0334901_509_988 159
523 3300037068 Ga0373925_0149411 Ga0373925_0149411_1330_1809 159
524 3300045051 Ga0451576_0309129 Ga0451576_0309129_608_1087 159
525 3300046452 Ga0495617_072191 Ga0495617_072191_152_631 159
526 3300046455 Ga0495603_0025839 Ga0495603_0025839_1410_1889 159
527 3300046458 Ga0495591_113022 Ga0495591_113022_83_562 159
528 3300046459 Ga0495629_0002067 Ga0495629_0002067_2478_2957 159
529 3300046459 Ga0495629_0076460 Ga0495629_0076460_1696_2175 159
530 3300046461 Ga0495641_0017165 Ga0495641_0017165_1816_2295 159
531 3300046461 Ga0495641_0089052 Ga0495641_0089052_648_1127 159
532 3300046462 Ga0495651_0003892 Ga0495651_0003892_10929_11408 159
533 3300046463 Ga0495653_0010574 Ga0495653_0010574_5546_6025 159
534 3300046463 Ga0495653_0245634 Ga0495653_0245634_27_506 159
535 3300046472 Ga0495580_0035178 Ga0495580_0035178_1794_2273 159
536 3300046473 Ga0495582_0059398 Ga0495582_0059398_90_569 159
537 3300046475 Ga0495639_0030981 Ga0495639_0030981_570_1049 159
538 3300046475 Ga0495639_0064199 Ga0495639_0064199_1020_1499 159
539 3300046476 Ga0495662_0028948 Ga0495662_0028948_1330_1809 159
540 3300046477 Ga0495664_0078730 Ga0495664_0078730_614_1093 159
541 3300046491 Ga0495584_0041089 Ga0495584_0041089_20_499 159
542 3300046499 Ga0495594_0026532 Ga0495594_0026532_1724_2203 159
543 3300046499 Ga0495594_0038501 Ga0495594_0038501_803_1282 159
544 3300046501 Ga0495607_0458264 Ga0495607_0458264_20_499 159
545 3300046511 Ga0495608_0071850 Ga0495608_0071850_703_1182 159
546 3300046514 Ga0495618_0199829 Ga0495618_0199829_89_568 159
547 3300046516 Ga0495628_0049119 Ga0495628_0049119_1466_1945 159
548 3300046517 Ga0495630_0030402 Ga0495630_0030402_1841_2320 159
549 3300046518 Ga0495631_0117810 Ga0495631_0117810_643_1122 159
550 3300046520 Ga0495637_0038624 Ga0495637_0038624_612_1091 159
551 3300046523 Ga0495644_0061346 Ga0495644_0061346_20_499 159
552 3300046525 Ga0495663_0103796 Ga0495663_0103796_65_544 159
553 3300046526 Ga0495666_0021257 Ga0495666_0021257_1258_1737 159
554 3300046531 Ga0495665_0261136 Ga0495665_0261136_244_723 159
555 3300046533 Ga0495640_0179741 Ga0495640_0179741_780_1259 159
556 3300046535 Ga0495586_0029120 Ga0495586_0029120_1872_2351 159
557 3300046536 Ga0495587_0013640 Ga0495587_0013640_618_1097 159
558 3300046537 Ga0495598_0003603 Ga0495598_0003603_222_701 159
559 3300046557 Ga0495622_0013106 Ga0495622_0013106_592_1071 159
560 3300046559 Ga0495667_0002342 Ga0495667_0002342_10523_11002 159
561 3300046615 Ga0495656_0009862 Ga0495656_0009862_2115_2594 159
562 3300046642 Ga0495634_0025736 Ga0495634_0025736_1684_2163 159
563 3300046648 Ga0495611_0051766 Ga0495611_0051766_1247_1726 159
564 3300046663 Ga0495635_0025074 Ga0495635_0025074_1879_2358 159
565 3300046664 Ga0495659_0317643 Ga0495659_0317643_163_642 159
566 3300046674 Ga0495588_0013638 Ga0495588_0013638_2142_2621 159
567 3300046678 Ga0495599_0155610 Ga0495599_0155610_813_1292 159
568 3300046680 Ga0495646_0054470 Ga0495646_0054470_104_583 159
569 3300046681 Ga0495647_0010583 Ga0495647_0010583_1637_2116 159
570 3300046683 Ga0495658_0001370 Ga0495658_0001370_1481_1960 159
571 3300046684 Ga0495669_0020794 Ga0495669_0020794_1156_1635 159
572 3300046689 Ga0495613_0006674 Ga0495613_0006674_287_766 159
573 3300046689 Ga0495613_0098623 Ga0495613_0098623_507_986 159
574 3300046691 Ga0495670_0006726 Ga0495670_0006726_2032_2511 159
575 3300046809 Ga0495600_0003589 Ga0495600_0003589_7004_7483 159
576 3300047315 Ga0495581_0005348 Ga0495581_0005348_697_1176 159
577 3300047315 Ga0495581_0046501 Ga0495581_0046501_598_1077 159
578 3300047317 Ga0495604_0075847 Ga0495604_0075847_1125_1604 159
579 3300047321 Ga0495676_0072815 Ga0495676_0072815_1819_2298 159
580 3300047322 Ga0495680_0011290 Ga0495680_0011290_3043_3522 159
581 3300047322 Ga0495680_0036428 Ga0495680_0036428_2242_2721 159
582 3300047471 Ga0495684_0009067 Ga0495684_0009067_4564_5043 159
583 3300047673 Ga0495593_0009427 Ga0495593_0009427_2792_3271 159
584 3300047673 Ga0495593_0070727 Ga0495593_0070727_1126_1605 159
585 3300048088 Ga0495602_0352227 Ga0495602_0352227_89_568 159
586 3300048089 Ga0495614_0022914 Ga0495614_0022914_123_602 159
587 3300048903 Ga0496100_0008197 Ga0496100_0008197_4394_4873 159
588 3300048903 Ga0496100_0068502 Ga0496100_0068502_494_973 159
589 3300048904 Ga0496101_0253127 Ga0496101_0253127_402_881 159
590 3300048905 Ga0496102_0232125 Ga0496102_0232125_388_903 159
591 3300048905 Ga0496102_0241653 Ga0496102_0241653_230_709 159
592 3300048905 Ga0496102_0257080 Ga0496102_0257080_1023_1502 159
593 3300048905 Ga0496102_0441266 Ga0496102_0441266_447_926 159
594 3300048906 Ga0496103_0039242 Ga0496103_0039242_898_1377 159
595 3300048907 Ga0496104_0059037 Ga0496104_0059037_1148_1627 159
596 3300048907 Ga0496104_0062929 Ga0496104_0062929_2277_2756 159
597 3300048908 Ga0496105_0071127 Ga0496105_0071127_185_664 159
598 3300048908 Ga0496105_0116920 Ga0496105_0116920_1216_1695 159
599 3300048908 Ga0496105_0523047 Ga0496105_0523047_131_646 159
600 3300048909 Ga0496106_0028707 Ga0496106_0028707_505_1020 159
601 3300048909 Ga0496106_0423263 Ga0496106_0423263_282_761 159
602 3300048910 Ga0496107_0064606 Ga0496107_0064606_1562_2077 159
603 3300048911 Ga0496108_0043797 Ga0496108_0043797_2565_3044 159
604 3300048911 Ga0496108_0160018 Ga0496108_0160018_316_795 159
605 3300048912 Ga0496109_0033913 Ga0496109_0033913_930_1409 159
606 3300048912 Ga0496109_0061718 Ga0496109_0061718_2050_2529 159
607 3300048912 Ga0496109_0093167 Ga0496109_0093167_1124_1603 159
608 3300048913 Ga0496110_0077993 Ga0496110_0077993_1548_2027 159
609 3300048914 Ga0496111_0022875 Ga0496111_0022875_844_1323 159
610 3300048914 Ga0496111_0171211 Ga0496111_0171211_808_1287 159
611 3300048915 Ga0496112_0070793 Ga0496112_0070793_2350_2829 159
612 3300048915 Ga0496112_0121818 Ga0496112_0121818_1002_1481 159
613 3300048915 Ga0496112_0339166 Ga0496112_0339166_102_581 159
614 3300048916 Ga0496113_0076978 Ga0496113_0076978_1052_1531 159
615 3300048917 Ga0496114_0010304 Ga0496114_0010304_1430_1909 159
616 3300048918 Ga0496115_0047377 Ga0496115_0047377_1195_1710 159
617 3300048918 Ga0496115_0142243 Ga0496115_0142243_353_832 159
618 3300048918 Ga0496115_0189633 Ga0496115_0189633_241_720 159
619 3300048924 Ga0496121_0601147 Ga0496121_0601147_112_591 159
620 3300048928 Ga0496125_0131914 Ga0496125_0131914_638_1117 159
621 3300050512 nmdc:mga0n895_286420_c1 nmdc:mga0n895_286420_c1_135_650 159
622 3300050513 nmdc:mga0rr50_950190_c1 nmdc:mga0rr50_950190_c1_97_576 159
623 3300053077 Ga0495601_0189704 Ga0495601_0189704_110_589 159
624 3300053084 Ga0495595_0002620 Ga0495595_0002620_5794_6273 159
625 3300053085 Ga0495619_0057856 Ga0495619_0057856_1984_2463 159
626 3300053085 Ga0495619_0060868 Ga0495619_0060868_1264_1743 159
627 3300053094 Ga0500566_0193529 Ga0500566_0193529_383_862 159
628 3300006175 Ga0070712_100269137 Ga0070712_1002691372 160
629 3300025915 Ga0207693_10185639 Ga0207693_101856392 160
630 2162886011 MRS1b_contig_7410661 MRS1b_0691.00001930 161
631 2209111006 2214756332 2213770193 161
632 3300000042 ARSoilYngRDRAFT_c00187 ARSoilYngRDRAFT_0018710 161
633 3300000043 ARcpr5yngRDRAFT_c000626 ARcpr5yngRDRAFT_0006262 161
634 3300000044 ARSoilOldRDRAFT_c000105 ARSoilOldRDRAFT_0001052 161
635 3300000045 ARCol0oldRDRAFT_c00945 ARCol0oldRDRAFT_009452 161
636 3300000652 ARCol0yngRDRAFT_1000034 ARCol0yngRDRAFT_10000342 161
637 3300001904 JGI24736J21556_1020600 JGI24736J21556_10206002 161
638 3300001915 JGI24741J21665_1018201 JGI24741J21665_10182012 161
639 3300001977 JGI24746J21847_1001098 JGI24746J21847_10010982 161
640 3300001989 JGI24739J22299_10000164 JGI24739J22299_1000016423 161
641 3300001990 JGI24737J22298_10001508 JGI24737J22298_100015084 161
642 3300001990 JGI24737J22298_10001579 JGI24737J22298_100015797 161
643 3300001991 JGI24743J22301_10012313 JGI24743J22301_100123132 161
644 3300002070 JGI24750J21931_1000344 JGI24750J21931_10003444 161
645 3300002073 JGI24745J21846_1001611 JGI24745J21846_10016112 161
646 3300002075 JGI24738J21930_10000112 JGI24738J21930_1000011219 161
647 3300002076 JGI24749J21850_1000411 JGI24749J21850_10004116 161
648 3300002077 JGI24744J21845_10024671 JGI24744J21845_100246712 161
649 3300002126 JGI24035J26624_1000107 JGI24035J26624_10001075 161
650 3300002239 JGI24034J26672_10001485 JGI24034J26672_100014853 161
651 3300002244 JGI24742J22300_10000359 JGI24742J22300_100003594 161
652 3300002459 JGI24751J29686_10092099 JGI24751J29686_100920991 161
653 3300003347 JGI26128J50194_1007301 JGI26128J50194_10073012 161
654 3300005290 Ga0065712_10071820 Ga0065712_100718203 161
655 3300005290 Ga0065712_10098339 Ga0065712_100983392 161
656 3300005293 Ga0065715_10001049 Ga0065715_100010495 161
657 3300005293 Ga0065715_10001550 Ga0065715_100015503 161
658 3300005293 Ga0065715_10208859 Ga0065715_102088592 161
659 3300005295 Ga0065707_10123077 Ga0065707_101230773 161
660 3300005328 Ga0070676_10000755 Ga0070676_100007558 161
661 3300005329 Ga0070683_100000376 Ga0070683_10000037631 161
662 3300005329 Ga0070683_100617469 Ga0070683_1006174692 161
663 3300005330 Ga0070690_100001711 Ga0070690_1000017117 161
664 3300005330 Ga0070690_100006546 Ga0070690_1000065465 161
665 3300005330 Ga0070690_100221375 Ga0070690_1002213752 161
666 3300005333 Ga0070677_10001502 Ga0070677_100015027 161
667 3300005334 Ga0068869_100000523 Ga0068869_10000052320 161
668 3300005335 Ga0070666_10006461 Ga0070666_100064615 161
669 3300005336 Ga0070680_100007212 Ga0070680_1000072127 161
670 3300005336 Ga0070680_101282681 Ga0070680_1012826811 161
671 3300005337 Ga0070682_100000141 Ga0070682_10000014125 161
672 3300005337 Ga0070682_100466906 Ga0070682_1004669062 161
673 3300005338 Ga0068868_100037520 Ga0068868_1000375204 161
674 3300005339 Ga0070660_100002574 Ga0070660_10000257412 161
675 3300005340 Ga0070689_100038887 Ga0070689_1000388873 161
676 3300005340 Ga0070689_100084736 Ga0070689_1000847362 161
677 3300005341 Ga0070691_10000190 Ga0070691_100001907 161
678 3300005343 Ga0070687_100000212 Ga0070687_1000002127 161
679 3300005343 Ga0070687_100030889 Ga0070687_1000308892 161
680 3300005344 Ga0070661_100000242 Ga0070661_10000024252 161
681 3300005344 Ga0070661_100686622 Ga0070661_1006866222 161
682 3300005345 Ga0070692_10007147 Ga0070692_100071475 161
683 3300005353 Ga0070669_100000593 Ga0070669_10000059321 161
684 3300005354 Ga0070675_100000165 Ga0070675_10000016541 161
685 3300005355 Ga0070671_100010995 Ga0070671_1000109953 161
686 3300005355 Ga0070671_100397850 Ga0070671_1003978502 161
687 3300005356 Ga0070674_100000450 Ga0070674_10000045020 161
688 3300005365 Ga0070688_100036300 Ga0070688_1000363002 161
689 3300005366 Ga0070659_100000988 Ga0070659_1000009885 161
690 3300005366 Ga0070659_100016224 Ga0070659_1000162244 161
691 3300005367 Ga0070667_100000759 Ga0070667_1000007599 161
692 3300005406 Ga0070703_10006259 Ga0070703_100062593 161
693 3300005435 Ga0070714_100207666 Ga0070714_1002076662 161
694 3300005437 Ga0070710_10304996 Ga0070710_103049961 161
695 3300005438 Ga0070701_10000103 Ga0070701_1000010324 161
696 3300005439 Ga0070711_100231133 Ga0070711_1002311331 161
697 3300005440 Ga0070705_100029576 Ga0070705_1000295763 161
698 3300005440 Ga0070705_100136287 Ga0070705_1001362872 161
699 3300005441 Ga0070700_100000364 Ga0070700_1000003647 161
700 3300005444 Ga0070694_100000880 Ga0070694_10000088018 161
701 3300005445 Ga0070708_100103778 Ga0070708_1001037782 161
702 3300005455 Ga0070663_100000417 Ga0070663_10000041720 161
703 3300005455 Ga0070663_100095890 Ga0070663_1000958902 161
704 3300005456 Ga0070678_100001012 Ga0070678_1000010122 161
705 3300005457 Ga0070662_100000796 Ga0070662_1000007963 161
706 3300005458 Ga0070681_10002475 Ga0070681_100024752 161
707 3300005458 Ga0070681_10076422 Ga0070681_100764222 161
708 3300005458 Ga0070681_10160379 Ga0070681_101603792 161
709 3300005459 Ga0068867_100009775 Ga0068867_1000097752 161
710 3300005466 Ga0070685_10000547 Ga0070685_100005479 161
711 3300005518 Ga0070699_100602141 Ga0070699_1006021412 161
712 3300005530 Ga0070679_100010894 Ga0070679_1000108943 161
713 3300005535 Ga0070684_100000755 Ga0070684_10000075520 161
714 3300005536 Ga0070697_100044337 Ga0070697_1000443374 161
715 3300005539 Ga0068853_100000483 Ga0068853_10000048316 161
716 3300005543 Ga0070672_100000527 Ga0070672_10000052720 161
717 3300005544 Ga0070686_100002014 Ga0070686_1000020147 161
718 3300005544 Ga0070686_100062310 Ga0070686_1000623102 161
719 3300005545 Ga0070695_100003705 Ga0070695_1000037055 161
720 3300005546 Ga0070696_100006474 Ga0070696_1000064746 161
721 3300005546 Ga0070696_100007364 Ga0070696_1000073643 161
722 3300005546 Ga0070696_100692801 Ga0070696_1006928012 161
723 3300005547 Ga0070693_100000199 Ga0070693_1000001997 161
724 3300005548 Ga0070665_100278950 Ga0070665_1002789502 161
725 3300005549 Ga0070704_100022794 Ga0070704_1000227942 161
726 3300005563 Ga0068855_100004444 Ga0068855_1000044443 161
727 3300005564 Ga0070664_100000895 Ga0070664_1000008955 161
728 3300005564 Ga0070664_100124321 Ga0070664_1001243212 161
729 3300005577 Ga0068857_100001816 Ga0068857_10000181616 161
730 3300005578 Ga0068854_100001666 Ga0068854_1000016669 161
731 3300005614 Ga0068856_100001538 Ga0068856_1000015389 161
732 3300005615 Ga0070702_100001415 Ga0070702_1000014152 161
733 3300005616 Ga0068852_100002972 Ga0068852_1000029727 161
734 3300005616 Ga0068852_100110846 Ga0068852_1001108462 161
735 3300005617 Ga0068859_100013486 Ga0068859_1000134867 161
736 3300005617 Ga0068859_100173949 Ga0068859_1001739492 161
737 3300005618 Ga0068864_100001172 Ga0068864_1000011724 161
738 3300005618 Ga0068864_100276215 Ga0068864_1002762152 161
739 3300005718 Ga0068866_10003190 Ga0068866_100031907 161
740 3300005719 Ga0068861_100005060 Ga0068861_1000050604 161
741 3300005840 Ga0068870_10000155 Ga0068870_1000015513 161
742 3300005841 Ga0068863_100000495 Ga0068863_10000049526 161
743 3300005842 Ga0068858_100000783 Ga0068858_10000078323 161
744 3300005842 Ga0068858_100049192 Ga0068858_1000491923 161
745 3300005843 Ga0068860_100024037 Ga0068860_1000240374 161
746 3300005844 Ga0068862_100020432 Ga0068862_1000204325 161
747 3300005937 Ga0081455_10000204 Ga0081455_1000020488 161
748 3300005937 Ga0081455_10242172 Ga0081455_102421721 161
749 3300006058 Ga0075432_10147364 Ga0075432_101473642 161
750 3300006178 Ga0075367_10216870 Ga0075367_102168702 161
751 3300006237 Ga0097621_100000010 Ga0097621_10000001029 161
752 3300006358 Ga0068871_100000034 Ga0068871_10000003442 161
753 3300006844 Ga0075428_100381795 Ga0075428_1003817952 161
754 3300006844 Ga0075428_101007026 Ga0075428_1010070262 161
755 3300006846 Ga0075430_100005590 Ga0075430_10000559010 161
756 3300006847 Ga0075431_100004052 Ga0075431_1000040524 161
757 3300006852 Ga0075433_10000774 Ga0075433_1000077422 161
758 3300006852 Ga0075433_10009145 Ga0075433_100091459 161
759 3300006852 Ga0075433_10267078 Ga0075433_102670782 161
760 3300006871 Ga0075434_100001700 Ga0075434_1000017004 161
761 3300006871 Ga0075434_100005910 Ga0075434_10000591010 161
762 3300006871 Ga0075434_100061647 Ga0075434_1000616474 161
763 3300006871 Ga0075434_100944090 Ga0075434_1009440902 161
764 3300006880 Ga0075429_100007130 Ga0075429_10000713010 161
765 3300006881 Ga0068865_100000230 Ga0068865_10000023016 161
766 3300006914 Ga0075436_100085251 Ga0075436_1000852512 161
767 3300006914 Ga0075436_100264830 Ga0075436_1002648302 161
768 3300006931 Ga0097620_100013487 Ga0097620_1000134877 161
769 3300006931 Ga0097620_100173947 Ga0097620_1001739473 161
770 3300007076 Ga0075435_100054003 Ga0075435_1000540032 161
771 3300007076 Ga0075435_100300755 Ga0075435_1003007552 161
772 3300009092 Ga0105250_10055797 Ga0105250_100557972 161
773 3300009093 Ga0105240_10101227 Ga0105240_101012273 161
774 3300009094 Ga0111539_10000932 Ga0111539_100009323 161
775 3300009094 Ga0111539_10002162 Ga0111539_100021627 161
776 3300009094 Ga0111539_10010377 Ga0111539_1001037710 161
777 3300009098 Ga0105245_10000258 Ga0105245_1000025818 161
778 3300009101 Ga0105247_10002128 Ga0105247_100021283 161
779 3300009147 Ga0114129_10207007 Ga0114129_102070072 161
780 3300009147 Ga0114129_10234184 Ga0114129_102341842 161
781 3300009148 Ga0105243_10000846 Ga0105243_100008463 161
782 3300009148 Ga0105243_10065468 Ga0105243_100654684 161
783 3300009174 Ga0105241_10002261 Ga0105241_100022617 161
784 3300009176 Ga0105242_10000037 Ga0105242_1000003747 161
785 3300009176 Ga0105242_10178096 Ga0105242_101780962 161
786 3300009177 Ga0105248_10000744 Ga0105248_100007442 161
787 3300009177 Ga0105248_10149553 Ga0105248_101495533 161
788 3300009545 Ga0105237_10037795 Ga0105237_100377954 161
789 3300009545 Ga0105237_10053692 Ga0105237_100536923 161
790 3300009551 Ga0105238_10236325 Ga0105238_102363252 161
791 3300009553 Ga0105249_10000209 Ga0105249_1000020938 161
792 3300009553 Ga0105249_10117280 Ga0105249_101172803 161
793 3300010375 Ga0105239_10001464 Ga0105239_1000146430 161
794 3300010375 Ga0105239_10012186 Ga0105239_100121863 161
795 3300010375 Ga0105239_10488895 Ga0105239_104888952 161
796 3300011119 Ga0105246_10002021 Ga0105246_100020213 161
797 3300011119 Ga0105246_11317413 Ga0105246_113174132 161
798 3300012483 Ga0157337_1002622 Ga0157337_10026222 161
799 3300012492 Ga0157335_1004003 Ga0157335_10040032 161
800 3300012507 Ga0157342_1004833 Ga0157342_10048331 161
801 3300012515 Ga0157338_1008326 Ga0157338_10083262 161
802 3300013100 Ga0157373_10014658 Ga0157373_100146583 161
803 3300013102 Ga0157371_10008348 Ga0157371_100083488 161
804 3300013105 Ga0157369_11142614 Ga0157369_111426142 161
805 3300013296 Ga0157374_10137924 Ga0157374_101379243 161
806 3300013297 Ga0157378_10015202 Ga0157378_100152023 161
807 3300013306 Ga0163162_10001677 Ga0163162_1000167720 161
808 3300013306 Ga0163162_10017229 Ga0163162_100172297 161
809 3300013307 Ga0157372_10006418 Ga0157372_1000641813 161
810 3300013308 Ga0157375_10000263 Ga0157375_1000026342 161
811 3300013308 Ga0157375_10135976 Ga0157375_101359762 161
812 3300014325 Ga0163163_10037332 Ga0163163_100373322 161
813 3300014326 Ga0157380_10000294 Ga0157380_100002947 161
814 3300014326 Ga0157380_10122182 Ga0157380_101221822 161
815 3300014745 Ga0157377_10001223 Ga0157377_1000122310 161
816 3300014968 Ga0157379_10002453 Ga0157379_100024533 161
817 3300014968 Ga0157379_10025614 Ga0157379_100256143 161
818 3300014968 Ga0157379_10185057 Ga0157379_101850573 161
819 3300014969 Ga0157376_10000342 Ga0157376_1000034232 161
820 3300017792 Ga0163161_10000523 Ga0163161_1000052310 161
821 3300025271 Ga0207666_1000010 Ga0207666_100001020 161
822 3300025271 Ga0207666_1000667 Ga0207666_10006673 161
823 3300025290 Ga0207673_1000505 Ga0207673_10005053 161
824 3300025315 Ga0207697_10000186 Ga0207697_1000018618 161
825 3300025315 Ga0207697_10003939 Ga0207697_100039392 161
826 3300025885 Ga0207653_10012427 Ga0207653_100124273 161
827 3300025893 Ga0207682_10000123 Ga0207682_1000012338 161
828 3300025899 Ga0207642_10005605 Ga0207642_100056054 161
829 3300025900 Ga0207710_10002765 Ga0207710_100027653 161
830 3300025901 Ga0207688_10000340 Ga0207688_1000034024 161
831 3300025901 Ga0207688_10000889 Ga0207688_1000088916 161
832 3300025904 Ga0207647_10011455 Ga0207647_100114553 161
833 3300025904 Ga0207647_10040398 Ga0207647_100403983 161
834 3300025907 Ga0207645_10000023 Ga0207645_1000002316 161
835 3300025908 Ga0207643_10000007 Ga0207643_100000077 161
836 3300025910 Ga0207684_10527420 Ga0207684_105274201 161
837 3300025911 Ga0207654_10003445 Ga0207654_100034454 161
838 3300025912 Ga0207707_10275817 Ga0207707_102758172 161
839 3300025913 Ga0207695_10194754 Ga0207695_101947542 161
840 3300025914 Ga0207671_10024741 Ga0207671_100247413 161
841 3300025914 Ga0207671_10039604 Ga0207671_100396042 161
842 3300025917 Ga0207660_10000393 Ga0207660_1000039326 161
843 3300025917 Ga0207660_10076398 Ga0207660_100763983 161
844 3300025918 Ga0207662_10000136 Ga0207662_1000013623 161
845 3300025918 Ga0207662_10063446 Ga0207662_100634462 161
846 3300025918 Ga0207662_10789516 Ga0207662_107895161 161
847 3300025919 Ga0207657_10002615 Ga0207657_1000261516 161
848 3300025920 Ga0207649_10000434 Ga0207649_100004344 161
849 3300025921 Ga0207652_10001720 Ga0207652_100017204 161
850 3300025921 Ga0207652_10127620 Ga0207652_101276202 161
851 3300025921 Ga0207652_10569695 Ga0207652_105696952 161
852 3300025923 Ga0207681_10000273 Ga0207681_1000027338 161
853 3300025926 Ga0207659_10000097 Ga0207659_1000009718 161
854 3300025926 Ga0207659_10007932 Ga0207659_100079325 161
855 3300025928 Ga0207700_10097601 Ga0207700_100976012 161
856 3300025929 Ga0207664_10209836 Ga0207664_102098362 161
857 3300025931 Ga0207644_10005450 Ga0207644_100054503 161
858 3300025932 Ga0207690_10000962 Ga0207690_1000096216 161
859 3300025933 Ga0207706_10000867 Ga0207706_1000086716 161
860 3300025933 Ga0207706_10059941 Ga0207706_100599412 161
861 3300025934 Ga0207686_10002591 Ga0207686_100025914 161
862 3300025935 Ga0207709_11316769 Ga0207709_113167691 161
863 3300025936 Ga0207670_10000536 Ga0207670_100005367 161
864 3300025936 Ga0207670_10082190 Ga0207670_100821902 161
865 3300025937 Ga0207669_10001135 Ga0207669_100011357 161
866 3300025938 Ga0207704_10000119 Ga0207704_1000011939 161
867 3300025939 Ga0207665_10144157 Ga0207665_101441572 161
868 3300025940 Ga0207691_10000544 Ga0207691_1000054420 161
869 3300025940 Ga0207691_10217984 Ga0207691_102179842 161
870 3300025941 Ga0207711_10002468 Ga0207711_100024684 161
871 3300025941 Ga0207711_10125801 Ga0207711_101258012 161
872 3300025941 Ga0207711_10572557 Ga0207711_105725572 161
873 3300025942 Ga0207689_10001743 Ga0207689_100017434 161
874 3300025944 Ga0207661_10000785 Ga0207661_100007857 161
875 3300025945 Ga0207679_10000029 Ga0207679_10000029191 161
876 3300025945 Ga0207679_10128429 Ga0207679_101284292 161
877 3300025945 Ga0207679_10822530 Ga0207679_108225302 161
878 3300025949 Ga0207667_10016422 Ga0207667_100164223 161
879 3300025949 Ga0207667_10863785 Ga0207667_108637852 161
880 3300025960 Ga0207651_10000083 Ga0207651_100000838 161
881 3300025961 Ga0207712_10000471 Ga0207712_100004714 161
882 3300025972 Ga0207668_10000862 Ga0207668_100008627 161
883 3300025981 Ga0207640_10003185 Ga0207640_100031854 161
884 3300025986 Ga0207658_10002203 Ga0207658_1000220316 161
885 3300026023 Ga0207677_10000992 Ga0207677_100009923 161
886 3300026035 Ga0207703_10014801 Ga0207703_100148014 161
887 3300026035 Ga0207703_10098576 Ga0207703_100985762 161
888 3300026035 Ga0207703_10104241 Ga0207703_101042412 161
889 3300026041 Ga0207639_10004451 Ga0207639_100044514 161
890 3300026067 Ga0207678_10001568 Ga0207678_100015687 161
891 3300026067 Ga0207678_10241654 Ga0207678_102416542 161
892 3300026075 Ga0207708_10004251 Ga0207708_1000425110 161
893 3300026075 Ga0207708_10023945 Ga0207708_100239452 161
894 3300026078 Ga0207702_10003639 Ga0207702_100036397 161
895 3300026088 Ga0207641_10000510 Ga0207641_100005107 161
896 3300026089 Ga0207648_10002351 Ga0207648_1000235116 161
897 3300026089 Ga0207648_10200614 Ga0207648_102006142 161
898 3300026095 Ga0207676_10001371 Ga0207676_100013714 161
899 3300026095 Ga0207676_10219149 Ga0207676_102191492 161
900 3300026116 Ga0207674_10000608 Ga0207674_1000060820 161
901 3300026116 Ga0207674_10384519 Ga0207674_103845191 161
902 3300026118 Ga0207675_100000805 Ga0207675_10000080520 161
903 3300026121 Ga0207683_10000082 Ga0207683_1000008258 161
904 3300026121 Ga0207683_10675933 Ga0207683_106759332 161
905 3300026142 Ga0207698_10000377 Ga0207698_1000037727 161
906 3300026142 Ga0207698_10257260 Ga0207698_102572602 161
907 3300026142 Ga0207698_10504867 Ga0207698_105048672 161
908 3300027252 Ga0209973_1011005 Ga0209973_10110052 161
909 3300027424 Ga0209984_1008995 Ga0209984_10089951 161
910 3300027617 Ga0210002_1001321 Ga0210002_10013213 161
911 3300027682 Ga0209971_1054660 Ga0209971_10546602 161
912 3300027695 Ga0209966_1005107 Ga0209966_10051072 161
913 3300027717 Ga0209998_10002579 Ga0209998_100025793 161
914 3300027876 Ga0209974_10005874 Ga0209974_100058743 161
915 3300027876 Ga0209974_10020181 Ga0209974_100201812 161
916 3300027907 Ga0207428_10000124 Ga0207428_1000012496 161
917 3300027907 Ga0207428_10000420 Ga0207428_1000042044 161
918 3300027907 Ga0207428_10000703 Ga0207428_1000070341 161
919 3300028379 Ga0268266_10138505 Ga0268266_101385053 161
920 3300028379 Ga0268266_10381955 Ga0268266_103819552 161
921 3300028380 Ga0268265_10001170 Ga0268265_1000117022 161
922 3300028381 Ga0268264_10001878 Ga0268264_1000187820 161
923 3300028381 Ga0268264_10203260 Ga0268264_102032602 161
924 3300034816 Ga0373930_0001168 Ga0373930_0001168_1179_1664 161
925 3300034817 Ga0373948_0000160 Ga0373948_0000160_5203_5688 161
926 3300034819 Ga0373958_0001209 Ga0373958_0001209_921_1406 161
927 3300034819 Ga0373958_0003548 Ga0373958_0003548_1180_1665 161
928 3300034820 Ga0373959_0002987 Ga0373959_0002987_280_765 161
929 3300034820 Ga0373959_0008682 Ga0373959_0008682_173_658 161
930 3300034957 Ga0373938_0000574 Ga0373938_0000574_1001_1486 161
931 3300035084 Ga0373928_0002434 Ga0373928_0002434_1288_1773 161
932 3300035084 Ga0373928_0019947 Ga0373928_0019947_617_1102 161
933 3300035085 Ga0373929_0005219 Ga0373929_0005219_1176_1661 161
934 3300035085 Ga0373929_0036900 Ga0373929_0036900_500_985 161
935 3300035088 Ga0373940_0000069 Ga0373940_0000069_5357_5842 161
936 3300035088 Ga0373940_0002640 Ga0373940_0002640_2477_2962 161
937 3300035090 Ga0373949_0000870 Ga0373949_0000870_8635_9120 161
938 3300035090 Ga0373949_0002073 Ga0373949_0002073_3916_4401 161
939 3300035091 Ga0373951_0002636 Ga0373951_0002636_1179_1664 161
940 3300035091 Ga0373951_0003101 Ga0373951_0003101_381_866 161
941 3300035092 Ga0373952_0001400 Ga0373952_0001400_1003_1488 161
942 3300035092 Ga0373952_0003512 Ga0373952_0003512_2042_2527 161
943 3300035112 Ga0373932_0002119 Ga0373932_0002119_3410_3895 161
944 3300035114 Ga0373939_0001165 Ga0373939_0001165_922_1407 161
945 3300035114 Ga0373939_0003141 Ga0373939_0003141_950_1435 161
946 3300035115 Ga0373941_0000185 Ga0373941_0000185_2912_3397 161
947 3300035115 Ga0373941_0001158 Ga0373941_0001158_906_1391 161
948 3300035116 Ga0373945_0203214 Ga0373945_0203214_149_670 161
949 3300035121 Ga0373960_0000288 Ga0373960_0000288_963_1448 161
950 3300035121 Ga0373960_0000314 Ga0373960_0000314_6964_7449 161
951 3300035171 Ga0373946_0609450 Ga0373946_0609450_22_507 161
952 3300035241 Ga0373961_0000636 Ga0373961_0000636_6268_6753 161
953 3300035241 Ga0373961_0001288 Ga0373961_0001288_2459_2944 161
954 3300035242 Ga0373962_0000974 Ga0373962_0000974_4980_5465 161
955 3300035242 Ga0373962_0014241 Ga0373962_0014241_372_857 161
956 3300035691 Ga0373931_0014198 Ga0373931_0014198_956_1441 161
957 3300036401 Ga0373937_0036163 Ga0373937_0036163_117_602 161
958 3300036401 Ga0373937_0626303 Ga0373937_0626303_418_903 161
959 3300037466 Ga0395898_0067146 Ga0395898_0067146_2042_2581 161
960 3300038443 Ga0395901_0369703 Ga0395901_0369703_171_710 161
961 3300038698 Ga0242419_022220 Ga0242419_022220_24_509 161
962 3300038996 Ga0242420_012183 Ga0242420_012183_863_1348 161
963 3300042008 Ga0439450_099769 Ga0439450_099769_165_650 161
964 3300042439 Ga0439464_0098059 Ga0439464_0098059_226_711 161
965 3300042461 Ga0439460_0012096 Ga0439460_0012096_682_1167 161
966 3300046454 Ga0495592_0701821 Ga0495592_0701821_68_553 161
967 3300046463 Ga0495653_0196921 Ga0495653_0196921_258_743 161
968 3300046511 Ga0495608_0715829 Ga0495608_0715829_78_563 161
969 3300046516 Ga0495628_0091598 Ga0495628_0091598_1260_1745 161
970 3300046533 Ga0495640_0033258 Ga0495640_0033258_2331_2816 161
971 3300046538 Ga0495609_0177304 Ga0495609_0177304_67_552 161
972 3300046663 Ga0495635_0340919 Ga0495635_0340919_162_683 161
973 3300046675 Ga0495657_0089251 Ga0495657_0089251_922_1407 161
974 3300046683 Ga0495658_0018935 Ga0495658_0018935_1403_1888 161
975 3300046684 Ga0495669_0359342 Ga0495669_0359342_64_549 161
976 3300047315 Ga0495581_0114681 Ga0495581_0114681_466_951 161
977 3300047317 Ga0495604_0058771 Ga0495604_0058771_2243_2728 161
978 3300047319 Ga0495674_0146363 Ga0495674_0146363_627_1112 161
979 3300047471 Ga0495684_0529609 Ga0495684_0529609_112_597 161
980 3300048903 Ga0496100_0000057 Ga0496100_0000057_2706_3191 161
981 3300048904 Ga0496101_0065500 Ga0496101_0065500_1456_1941 161
982 3300048905 Ga0496102_0001628 Ga0496102_0001628_18419_18904 161
983 3300048905 Ga0496102_0398302 Ga0496102_0398302_76_561 161
984 3300048906 Ga0496103_0306285 Ga0496103_0306285_195_680 161
985 3300048907 Ga0496104_0072866 Ga0496104_0072866_826_1311 161
986 3300048907 Ga0496104_0156717 Ga0496104_0156717_403_888 161
987 3300048910 Ga0496107_0001129 Ga0496107_0001129_14615_15100 161
988 3300048911 Ga0496108_0003535 Ga0496108_0003535_7527_8012 161
989 3300048911 Ga0496108_0086379 Ga0496108_0086379_647_1132 161
990 3300048912 Ga0496109_0002432 Ga0496109_0002432_11864_12349 161
991 3300048912 Ga0496109_0144608 Ga0496109_0144608_1182_1667 161
992 3300048913 Ga0496110_0083286 Ga0496110_0083286_881_1366 161
993 3300048913 Ga0496110_0143879 Ga0496110_0143879_711_1196 161
994 3300048914 Ga0496111_0043097 Ga0496111_0043097_465_950 161
995 3300048914 Ga0496111_0098747 Ga0496111_0098747_63_548 161
996 3300048915 Ga0496112_0100086 Ga0496112_0100086_2262_2747 161
997 3300048915 Ga0496112_0406554 Ga0496112_0406554_564_1049 161
998 3300048916 Ga0496113_0049425 Ga0496113_0049425_70_555 161
999 3300048916 Ga0496113_0057193 Ga0496113_0057193_20_505 161
1000 3300048917 Ga0496114_0002944 Ga0496114_0002944_11972_12457 161
1001 3300048918 Ga0496115_0002786 Ga0496115_0002786_3127_3612 161
1002 3300049582 Ga0501048_1282069 Ga0501048_1282069_22_507 161
1003 3300049593 Ga0501077_0123062 Ga0501077_0123062_805_1290 161
1004 3300049741 Ga0501079_0216088 Ga0501079_0216088_520_1005 161
1005 3300050493 nmdc:mga0k408_746501_c1 nmdc:mga0k408_746501_c1_43_528 161
1006 3300050494 nmdc:mga06z11_211456_c1 nmdc:mga06z11_211456_c1_163_648 161
1007 3300050507 nmdc:mga05p37_45_c2 nmdc:mga05p37_45_c2_8302_8787 161
1008 3300050507 nmdc:mga05p37_92628_c1 nmdc:mga05p37_92628_c1_950_1441 161
1009 3300050508 nmdc:mga09592_1055_c1 nmdc:mga09592_1055_c1_18419_18904 161
1010 3300050509 nmdc:mga0qj67_1012_c1 nmdc:mga0qj67_1012_c1_16593_17078 161
1011 3300050510 nmdc:mga06r32_56570_c1 nmdc:mga06r32_56570_c1_339_824 161
1012 3300050511 nmdc:mga08y16_1134_c1 nmdc:mga08y16_1134_c1_16593_17078 161
1013 3300050511 nmdc:mga08y16_12172_c1 nmdc:mga08y16_12172_c1_2783_3268 161
1014 3300050511 nmdc:mga08y16_1989_c1 nmdc:mga08y16_1989_c1_11749_12234 161
1015 3300050512 nmdc:mga0n895_3165_c1 nmdc:mga0n895_3165_c1_9535_10020 161
1016 3300050512 nmdc:mga0n895_404960_c1 nmdc:mga0n895_404960_c1_84_575 161
1017 3300050512 nmdc:mga0n895_50_c1 nmdc:mga0n895_50_c1_67999_68484 161
1018 3300050513 nmdc:mga0rr50_45762_c1 nmdc:mga0rr50_45762_c1_1863_2348 161
1019 3300050513 nmdc:mga0rr50_77520_c1 nmdc:mga0rr50_77520_c1_137_622 161
1020 3300050514 nmdc:mga08x19_536788_c1 nmdc:mga08x19_536788_c1_14_499 161
1021 3300050514 nmdc:mga08x19_75835_c1 nmdc:mga08x19_75835_c1_528_1013 161
1022 3300050514 nmdc:mga08x19_86249_c1 nmdc:mga08x19_86249_c1_246_731 161
1023 3300050515 nmdc:mga0a205_171569_c1 nmdc:mga0a205_171569_c1_833_1324 161
1024 3300050515 nmdc:mga0a205_2228_c1 nmdc:mga0a205_2228_c1_1197_1682 161
1025 3300050515 nmdc:mga0a205_5479_c1 nmdc:mga0a205_5479_c1_1350_1835 161
1026 3300053077 Ga0495601_0004549 Ga0495601_0004549_4210_4695 161
1027 3300053078 Ga0495612_0139684 Ga0495612_0139684_327_812 161
1028 3300053084 Ga0495595_0003875 Ga0495595_0003875_5232_5717 161
1029 3300053085 Ga0495619_0000260 Ga0495619_0000260_34120_34605 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

42

163

0.94

PF22751

DUF488-N3a

Active DUF488-N3 subclade

59

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.7238 10 129
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.7204 10 129
6pqz-assembly1.cif.gz_A p133g/s128a s. typhimurium siroheme synthase 0.6699 14 160
1pjt-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6668 13 160
6p7d-assembly1.cif.gz_B d104n s. typhimurium siroheme synthase 0.661 10 160
ID Description Score Start End Superfamily
af_Q9VVU7_1_266_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6944 25 72 3.40.50.2300
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6866 10 129 3.90.190.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6645 12 156 3.40.1010.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6459 12 156 3.40.1010.10
2qbuB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6388 12 161 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A6L5FI35-F1-model_v4 DUF488 family protein 0.9649 12 161
AF-A0A7T8MFV8-F1-model_v4 deleted 0.9597 11 161
AF-A0A6L5FI35-F1-model_v4 DUF488 family protein 0.9587 12 161
AF-A0A7D7VI00-F1-model_v4 DUF488 family protein 0.9573 12 157
AF-A0A1E4MYY9-F1-model_v4 deleted 0.9569 12 159

Feature Viewer

pLDDT pTM Quality
87.39 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map