F488566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 398 | 1026 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300005545|Ga0070695_100212983|Ga0070695_1002129832 |
| Length | 235 |
| Sequence | MPTVSHRKREVLLKIVYYGPGLGGKTTNLEYIHAHSRPEHRGKLLSLTSDNERTLFFDLLPIDLGEFKGYTIRLHLCTVPGQLAFDRTRRLILRGVDGVVFVVDSQPAQIDANVVSLENLATNLRVLGMDPDHIPVVVQYNKRDIDGVLETSELKFVLGIPQGVQELEASAKYGEGVFDTLKAIVRECLKIVGDPRRAPEGRTASILPALVGSATRNRAASEATSAPENRNPAER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 2 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 7 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 8 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 228 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 246 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 254 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 255 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 280 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 281 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 284 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 288 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 289 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 290 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 291 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 292 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 293 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 294 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 295 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 328 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 329 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 330 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 355 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 356 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 357 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 358 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 361 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 362 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 363 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 364 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 366 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 367 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 373 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 387 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.15 |
| Metatranscriptomes | 1.55 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 95.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000053 | 3300000532 | Bacteria | 8226 |
| 2 | JGI24737J22298_10042841 | 3300001990 | Bacteria | 1387 |
| 3 | JGI24751J29686_10000040 | 3300002459 | Bacteria | 79191 |
| 4 | JGI26128J50194_1000536 | 3300003347 | Bacteria | 2121 |
| 5 | JGI26145J50221_1007769 | 3300003371 | Bacteria | 915 |
| 6 | JGI26138J51218_101769 | 3300003504 | Bacteria | 856 |
| 7 | JGI25405J52794_10006415 | 3300003911 | Bacteria | 2149 |
| 8 | Ga0058859_11802859 | 3300004798 | Bacteria | 866 |
| 9 | Ga0058862_11798388 | 3300004803 | Bacteria | 1313 |
| 10 | Ga0065714_10236356 | 3300005288 | Bacteria | 779 |
| 11 | Ga0065704_10070138 | 3300005289 | Bacteria | 546071 |
| 12 | Ga0065704_10253889 | 3300005289 | Bacteria | 982 |
| 13 | Ga0065712_10022016 | 3300005290 | Bacteria | 1520 |
| 14 | Ga0065712_10116807 | 3300005290 | Bacteria | 1730 |
| 15 | Ga0065712_10125065 | 3300005290 | Bacteria | 1618 |
| 16 | Ga0065715_10013657 | 3300005293 | Bacteria | 2928 |
| 17 | Ga0065715_10053092 | 3300005293 | Bacteria | 1080 |
| 18 | Ga0065707_10018862 | 3300005295 | Bacteria | 1566 |
| 19 | Ga0065707_10033643 | 3300005295 | Bacteria | 826 |
| 20 | Ga0065707_10188570 | 3300005295 | Bacteria | 1374 |
| 21 | Ga0065707_10318035 | 3300005295 | Bacteria | 972 |
| 22 | Ga0065707_10395974 | 3300005295 | Bacteria | 812 |
| 23 | Ga0065707_10459045 | 3300005295 | Bacteria | 793 |
| 24 | Ga0070658_10003921 | 3300005327 | Bacteria | 12198 |
| 25 | Ga0070658_10028262 | 3300005327 | Bacteria | 4501 |
| 26 | Ga0070658_10049378 | 3300005327 | Bacteria | 3408 |
| 27 | Ga0070658_10231757 | 3300005327 | Bacteria | 1564 |
| 28 | Ga0070676_10000776 | 3300005328 | Bacteria | 15742 |
| 29 | Ga0070676_10017341 | 3300005328 | Bacteria | 3986 |
| 30 | Ga0070683_100432047 | 3300005329 | Bacteria | 1256 |
| 31 | Ga0070690_100078482 | 3300005330 | Bacteria | 2157 |
| 32 | Ga0070690_100122144 | 3300005330 | Bacteria | 1749 |
| 33 | Ga0070690_100424206 | 3300005330 | Bacteria | 981 |
| 34 | Ga0070670_100000676 | 3300005331 | Bacteria | 26494 |
| 35 | Ga0070670_100004672 | 3300005331 | Bacteria | 11489 |
| 36 | Ga0070670_101189389 | 3300005331 | Bacteria | 696 |
| 37 | Ga0070677_10098142 | 3300005333 | Bacteria | 1287 |
| 38 | Ga0068869_100001260 | 3300005334 | Bacteria | 14959 |
| 39 | Ga0068869_100003281 | 3300005334 | Bacteria | 9876 |
| 40 | Ga0068869_100010655 | 3300005334 | Bacteria | 6001 |
| 41 | Ga0068869_100108807 | 3300005334 | Bacteria | 2106 |
| 42 | Ga0068869_100296890 | 3300005334 | Bacteria | 1303 |
| 43 | Ga0068869_100401364 | 3300005334 | Bacteria | 1128 |
| 44 | Ga0068869_100693547 | 3300005334 | Bacteria | 868 |
| 45 | Ga0070666_10008628 | 3300005335 | Bacteria | 6336 |
| 46 | Ga0070666_10084913 | 3300005335 | Bacteria | 2168 |
| 47 | Ga0070680_100000528 | 3300005336 | Bacteria | 26092 |
| 48 | Ga0070680_100026974 | 3300005336 | Bacteria | 4598 |
| 49 | Ga0070680_100247255 | 3300005336 | Bacteria | 1508 |
| 50 | Ga0070680_100529036 | 3300005336 | Bacteria | 1010 |
| 51 | Ga0070682_100002753 | 3300005337 | Bacteria | 9736 |
| 52 | Ga0070682_100050043 | 3300005337 | Bacteria | 2607 |
| 53 | Ga0070682_100074909 | 3300005337 | Bacteria | 2175 |
| 54 | Ga0070682_100358479 | 3300005337 | Bacteria | 1089 |
| 55 | Ga0068868_100043453 | 3300005338 | Bacteria | 3510 |
| 56 | Ga0068868_100349035 | 3300005338 | Bacteria | 1267 |
| 57 | Ga0068868_100527212 | 3300005338 | Bacteria | 1038 |
| 58 | Ga0068868_100643200 | 3300005338 | Bacteria | 943 |
| 59 | Ga0068868_100646692 | 3300005338 | Bacteria | 941 |
| 60 | Ga0068868_100849815 | 3300005338 | Bacteria | 827 |
| 61 | Ga0068868_101371715 | 3300005338 | Bacteria | 659 |
| 62 | Ga0070660_100000426 | 3300005339 | Bacteria | 27900 |
| 63 | Ga0070689_100000006 | 3300005340 | Bacteria | 332562 |
| 64 | Ga0070689_100006524 | 3300005340 | Bacteria | 8089 |
| 65 | Ga0070689_100053411 | 3300005340 | Bacteria | 3127 |
| 66 | Ga0070689_100726877 | 3300005340 | Bacteria | 869 |
| 67 | Ga0070691_10032656 | 3300005341 | Bacteria | 2447 |
| 68 | Ga0070691_10118880 | 3300005341 | Bacteria | 1329 |
| 69 | Ga0070687_100043723 | 3300005343 | Bacteria | 2278 |
| 70 | Ga0070661_100003135 | 3300005344 | Bacteria | 11375 |
| 71 | Ga0070692_10244994 | 3300005345 | Bacteria | 1070 |
| 72 | Ga0070668_100105404 | 3300005347 | Bacteria | 2239 |
| 73 | Ga0070669_100000101 | 3300005353 | Bacteria | 82365 |
| 74 | Ga0070669_100064427 | 3300005353 | Bacteria | 2699 |
| 75 | Ga0070669_100174558 | 3300005353 | Bacteria | 1678 |
| 76 | Ga0070675_100168526 | 3300005354 | Bacteria | 1887 |
| 77 | Ga0070675_100246739 | 3300005354 | Bacteria | 1561 |
| 78 | Ga0070675_100339621 | 3300005354 | Bacteria | 1330 |
| 79 | Ga0070671_100000754 | 3300005355 | Bacteria | 23220 |
| 80 | Ga0070671_100011000 | 3300005355 | Bacteria | 7261 |
| 81 | Ga0070671_100190950 | 3300005355 | Bacteria | 1736 |
| 82 | Ga0070671_100216405 | 3300005355 | Bacteria | 1625 |
| 83 | Ga0070671_100280035 | 3300005355 | Bacteria | 1418 |
| 84 | Ga0070673_100172544 | 3300005364 | Bacteria | 1846 |
| 85 | Ga0070673_100179567 | 3300005364 | Bacteria | 1811 |
| 86 | Ga0070688_100169213 | 3300005365 | Bacteria | 1507 |
| 87 | Ga0070688_100175465 | 3300005365 | Bacteria | 1483 |
| 88 | Ga0070688_100304993 | 3300005365 | Bacteria | 1152 |
| 89 | Ga0070659_100001410 | 3300005366 | Bacteria | 17337 |
| 90 | Ga0070659_100267117 | 3300005366 | Bacteria | 1420 |
| 91 | Ga0070659_100376844 | 3300005366 | Bacteria | 1194 |
| 92 | Ga0070667_100045969 | 3300005367 | Bacteria | 3672 |
| 93 | Ga0070667_100863394 | 3300005367 | Bacteria | 841 |
| 94 | Ga0070703_10015428 | 3300005406 | Bacteria | 2185 |
| 95 | Ga0070709_10000069 | 3300005434 | Bacteria | 79502 |
| 96 | Ga0070713_100426348 | 3300005436 | Bacteria | 1242 |
| 97 | Ga0070710_10007735 | 3300005437 | Bacteria | 5213 |
| 98 | Ga0070701_10004224 | 3300005438 | Bacteria | 5789 |
| 99 | Ga0070711_100043027 | 3300005439 | Bacteria | 3057 |
| 100 | Ga0070705_100054346 | 3300005440 | Bacteria | 2348 |
| 101 | Ga0070705_100346418 | 3300005440 | Bacteria | 1082 |
| 102 | Ga0070700_100122581 | 3300005441 | Bacteria | 1744 |
| 103 | Ga0070700_100131739 | 3300005441 | Bacteria | 1688 |
| 104 | Ga0070700_100136942 | 3300005441 | Bacteria | 1659 |
| 105 | Ga0070700_100235160 | 3300005441 | Bacteria | 1306 |
| 106 | Ga0070694_100010732 | 3300005444 | Bacteria | 5663 |
| 107 | Ga0070694_100012515 | 3300005444 | Bacteria | 5277 |
| 108 | Ga0070694_100093735 | 3300005444 | Bacteria | 2111 |
| 109 | Ga0070708_100000621 | 3300005445 | Bacteria | 26821 |
| 110 | Ga0070708_100065834 | 3300005445 | Bacteria | 3250 |
| 111 | Ga0070708_100131352 | 3300005445 | Bacteria | 2318 |
| 112 | Ga0070708_100603563 | 3300005445 | Bacteria | 1035 |
| 113 | Ga0070663_100012081 | 3300005455 | Bacteria | 5449 |
| 114 | Ga0070678_100050349 | 3300005456 | Bacteria | 3013 |
| 115 | Ga0070662_100266469 | 3300005457 | Bacteria | 1382 |
| 116 | Ga0070662_100616214 | 3300005457 | Bacteria | 914 |
| 117 | Ga0070681_10007431 | 3300005458 | Bacteria | 10713 |
| 118 | Ga0068867_100011967 | 3300005459 | Bacteria | 6129 |
| 119 | Ga0068867_100014424 | 3300005459 | Bacteria | 5600 |
| 120 | Ga0068867_100042244 | 3300005459 | Bacteria | 3334 |
| 121 | Ga0068867_100080215 | 3300005459 | Bacteria | 2457 |
| 122 | Ga0068867_100083186 | 3300005459 | Bacteria | 2416 |
| 123 | Ga0068867_101178989 | 3300005459 | Bacteria | 702 |
| 124 | Ga0068867_101230599 | 3300005459 | Bacteria | 689 |
| 125 | Ga0070685_10009467 | 3300005466 | Bacteria | 5037 |
| 126 | Ga0070685_10223236 | 3300005466 | Bacteria | 1235 |
| 127 | Ga0070706_100008802 | 3300005467 | Bacteria | 9406 |
| 128 | Ga0070706_100017482 | 3300005467 | Bacteria | 6618 |
| 129 | Ga0070706_100159195 | 3300005467 | Bacteria | 2108 |
| 130 | Ga0070706_100467393 | 3300005467 | Bacteria | 1173 |
| 131 | Ga0070707_100001880 | 3300005468 | Bacteria | 20147 |
| 132 | Ga0070707_100003551 | 3300005468 | Bacteria | 14721 |
| 133 | Ga0070707_100014668 | 3300005468 | Bacteria | 7342 |
| 134 | Ga0070707_100027446 | 3300005468 | Bacteria | 5417 |
| 135 | Ga0070698_100002838 | 3300005471 | Bacteria | 19064 |
| 136 | Ga0070698_100006715 | 3300005471 | Bacteria | 12480 |
| 137 | Ga0070698_100019650 | 3300005471 | Bacteria | 7086 |
| 138 | Ga0070699_100001882 | 3300005518 | Bacteria | 18986 |
| 139 | Ga0070699_100153937 | 3300005518 | Bacteria | 2034 |
| 140 | Ga0070699_100235698 | 3300005518 | Bacteria | 1632 |
| 141 | Ga0070699_100318279 | 3300005518 | Bacteria | 1398 |
| 142 | Ga0070679_100006685 | 3300005530 | Bacteria | 10755 |
| 143 | Ga0070679_100056145 | 3300005530 | Bacteria | 3923 |
| 144 | Ga0070679_100707717 | 3300005530 | Bacteria | 950 |
| 145 | Ga0070684_100009490 | 3300005535 | Bacteria | 7666 |
| 146 | Ga0070684_100457829 | 3300005535 | Bacteria | 1179 |
| 147 | Ga0070697_100001301 | 3300005536 | Bacteria | 18814 |
| 148 | Ga0070697_100005940 | 3300005536 | Bacteria | 9433 |
| 149 | Ga0070697_100059755 | 3300005536 | Bacteria | 3105 |
| 150 | Ga0070697_100079164 | 3300005536 | Bacteria | 2705 |
| 151 | Ga0070697_100143944 | 3300005536 | Bacteria | 2006 |
| 152 | Ga0070697_100646549 | 3300005536 | Unclassified | 931 |
| 153 | Ga0068853_100001027 | 3300005539 | Bacteria | 19664 |
| 154 | Ga0068853_100007929 | 3300005539 | Bacteria | 8514 |
| 155 | Ga0070672_100369788 | 3300005543 | Bacteria | 1225 |
| 156 | Ga0070686_100250168 | 3300005544 | Bacteria | 1294 |
| 157 | Ga0070686_100613463 | 3300005544 | Bacteria | 859 |
| 158 | Ga0070686_100665735 | 3300005544 | Bacteria | 827 |
| 159 | Ga0070695_100000929 | 3300005545 | Bacteria | 15797 |
| 160 | Ga0070695_100001843 | 3300005545 | Bacteria | 11953 |
| 161 | Ga0070695_100002584 | 3300005545 | Bacteria | 10448 |
| 162 | Ga0070695_100181513 | 3300005545 | Bacteria | 1491 |
| 163 | Ga0070695_100199301 | 3300005545 | Bacteria | 1430 |
| 164 | Ga0070695_100212983 | 3300005545 | Unclassified | 1388 |
| 165 | Ga0070695_101036855 | 3300005545 | Bacteria | 669 |
| 166 | Ga0070696_100004929 | 3300005546 | Bacteria | 8911 |
| 167 | Ga0070696_100089371 | 3300005546 | Unclassified | 2190 |
| 168 | Ga0070696_100266438 | 3300005546 | Bacteria | 1301 |
| 169 | Ga0070693_100000146 | 3300005547 | Bacteria | 32133 |
| 170 | Ga0070693_100026273 | 3300005547 | Bacteria | 3142 |
| 171 | Ga0070693_100029579 | 3300005547 | Bacteria | 2989 |
| 172 | Ga0070693_100195444 | 3300005547 | Bacteria | 1311 |
| 173 | Ga0070665_100000468 | 3300005548 | Bacteria | 58504 |
| 174 | Ga0070665_100477260 | 3300005548 | Bacteria | 1258 |
| 175 | Ga0070704_100002293 | 3300005549 | Bacteria | 10695 |
| 176 | Ga0070704_100309548 | 3300005549 | Bacteria | 1319 |
| 177 | Ga0070704_100325789 | 3300005549 | Bacteria | 1289 |
| 178 | Ga0070704_100668278 | 3300005549 | Bacteria | 919 |
| 179 | Ga0070704_101064703 | 3300005549 | Bacteria | 734 |
| 180 | Ga0068855_100000008 | 3300005563 | Bacteria | 269155 |
| 181 | Ga0068855_100004311 | 3300005563 | Bacteria | 17392 |
| 182 | Ga0068855_100088555 | 3300005563 | Bacteria | 3575 |
| 183 | Ga0068855_100105844 | 3300005563 | Bacteria | 3234 |
| 184 | Ga0068855_100614019 | 3300005563 | Bacteria | 1171 |
| 185 | Ga0070664_100038167 | 3300005564 | Bacteria | 4042 |
| 186 | Ga0070664_100113499 | 3300005564 | Bacteria | 2367 |
| 187 | Ga0068857_100042188 | 3300005577 | Bacteria | 4046 |
| 188 | Ga0068857_100346116 | 3300005577 | Bacteria | 1376 |
| 189 | Ga0068857_100792529 | 3300005577 | Bacteria | 905 |
| 190 | Ga0068854_100023122 | 3300005578 | Bacteria | 4242 |
| 191 | Ga0068854_100396325 | 3300005578 | Bacteria | 1141 |
| 192 | Ga0068856_100003684 | 3300005614 | Bacteria | 15368 |
| 193 | Ga0068856_100051817 | 3300005614 | Bacteria | 4046 |
| 194 | Ga0068856_100079170 | 3300005614 | Bacteria | 3259 |
| 195 | Ga0068856_100153581 | 3300005614 | Bacteria | 2312 |
| 196 | Ga0068856_100838497 | 3300005614 | Bacteria | 938 |
| 197 | Ga0070702_100109728 | 3300005615 | Bacteria | 1708 |
| 198 | Ga0070702_100127848 | 3300005615 | Bacteria | 1601 |
| 199 | Ga0068852_100097267 | 3300005616 | Bacteria | 2648 |
| 200 | Ga0068852_100440316 | 3300005616 | Bacteria | 1288 |
| 201 | Ga0068852_100579372 | 3300005616 | Bacteria | 1125 |
| 202 | Ga0068859_100002098 | 3300005617 | Bacteria | 20297 |
| 203 | Ga0068859_100006613 | 3300005617 | Bacteria | 11772 |
| 204 | Ga0068859_100060025 | 3300005617 | Bacteria | 3832 |
| 205 | Ga0068859_100063320 | 3300005617 | Bacteria | 3729 |
| 206 | Ga0068859_100089358 | 3300005617 | Bacteria | 3131 |
| 207 | Ga0068859_100114628 | 3300005617 | Bacteria | 2759 |
| 208 | Ga0068859_100266656 | 3300005617 | Bacteria | 1804 |
| 209 | Ga0068859_100316163 | 3300005617 | Bacteria | 1655 |
| 210 | Ga0068859_100447648 | 3300005617 | Bacteria | 1388 |
| 211 | Ga0068859_100498827 | 3300005617 | Bacteria | 1312 |
| 212 | Ga0068864_100027908 | 3300005618 | Bacteria | 4770 |
| 213 | Ga0068864_100064732 | 3300005618 | Bacteria | 3171 |
| 214 | Ga0068866_10279337 | 3300005718 | Bacteria | 1034 |
| 215 | Ga0068861_100005474 | 3300005719 | Bacteria | 8605 |
| 216 | Ga0068861_100006238 | 3300005719 | Bacteria | 8111 |
| 217 | Ga0068861_100028482 | 3300005719 | Bacteria | 4076 |
| 218 | Ga0068861_100069556 | 3300005719 | Bacteria | 2723 |
| 219 | Ga0068861_101240086 | 3300005719 | Bacteria | 723 |
| 220 | Ga0068870_10001679 | 3300005840 | Bacteria | 9049 |
| 221 | Ga0068870_10138939 | 3300005840 | Bacteria | 1419 |
| 222 | Ga0068863_100103772 | 3300005841 | Bacteria | 2704 |
| 223 | Ga0068863_100915485 | 3300005841 | Bacteria | 878 |
| 224 | Ga0068858_100028938 | 3300005842 | Bacteria | 5145 |
| 225 | Ga0068858_100034519 | 3300005842 | Bacteria | 4693 |
| 226 | Ga0068858_100034572 | 3300005842 | Bacteria | 4688 |
| 227 | Ga0068858_100242639 | 3300005842 | Bacteria | 1710 |
| 228 | Ga0068858_100981203 | 3300005842 | Bacteria | 827 |
| 229 | Ga0068860_100000731 | 3300005843 | Bacteria | 37386 |
| 230 | Ga0068860_100023127 | 3300005843 | Bacteria | 6009 |
| 231 | Ga0068860_100053835 | 3300005843 | Bacteria | 3825 |
| 232 | Ga0068860_100069494 | 3300005843 | Bacteria | 3348 |
| 233 | Ga0068860_100126643 | 3300005843 | Bacteria | 2448 |
| 234 | Ga0068860_100147832 | 3300005843 | Bacteria | 2262 |
| 235 | Ga0068860_100183978 | 3300005843 | Bacteria | 2020 |
| 236 | Ga0068860_100247134 | 3300005843 | Bacteria | 1736 |
| 237 | Ga0068860_100283547 | 3300005843 | Bacteria | 1619 |
| 238 | Ga0068860_100468415 | 3300005843 | Bacteria | 1254 |
| 239 | Ga0068860_100493520 | 3300005843 | Bacteria | 1222 |
| 240 | Ga0068860_100901671 | 3300005843 | Bacteria | 900 |
| 241 | Ga0068862_100002423 | 3300005844 | Bacteria | 16565 |
| 242 | Ga0068862_100018123 | 3300005844 | Bacteria | 5862 |
| 243 | Ga0068862_100058160 | 3300005844 | Bacteria | 3316 |
| 244 | Ga0068862_100085623 | 3300005844 | Bacteria | 2739 |
| 245 | Ga0081455_10001014 | 3300005937 | Bacteria | 35534 |
| 246 | Ga0081455_10037749 | 3300005937 | Bacteria | 4285 |
| 247 | Ga0081539_10011597 | 3300005985 | Bacteria | 6944 |
| 248 | Ga0075363_100302046 | 3300006048 | Bacteria | 929 |
| 249 | Ga0070716_100001417 | 3300006173 | Bacteria | 10648 |
| 250 | Ga0075366_10129618 | 3300006195 | Bacteria | 1522 |
| 251 | Ga0097621_100112150 | 3300006237 | Bacteria | 2305 |
| 252 | Ga0097621_100401702 | 3300006237 | Bacteria | 1227 |
| 253 | Ga0068871_100123063 | 3300006358 | Bacteria | 2193 |
| 254 | Ga0068871_100145538 | 3300006358 | Bacteria | 2017 |
| 255 | Ga0075428_100006662 | 3300006844 | Bacteria | 12849 |
| 256 | Ga0075428_100052589 | 3300006844 | Bacteria | 4463 |
| 257 | Ga0075428_100200965 | 3300006844 | Bacteria | 2155 |
| 258 | Ga0075430_100195039 | 3300006846 | Bacteria | 1682 |
| 259 | Ga0075431_100022715 | 3300006847 | Bacteria | 6411 |
| 260 | Ga0075433_10000359 | 3300006852 | Bacteria | 28647 |
| 261 | Ga0075433_10077553 | 3300006852 | Bacteria | 2927 |
| 262 | Ga0075434_100005805 | 3300006871 | Bacteria | 11270 |
| 263 | Ga0075434_100033813 | 3300006871 | Bacteria | 5047 |
| 264 | Ga0075434_100066243 | 3300006871 | Bacteria | 3597 |
| 265 | Ga0075434_100101803 | 3300006871 | Bacteria | 2879 |
| 266 | Ga0075434_100139278 | 3300006871 | Bacteria | 2446 |
| 267 | Ga0075434_100305050 | 3300006871 | Bacteria | 1612 |
| 268 | Ga0075434_100414855 | 3300006871 | Bacteria | 1367 |
| 269 | Ga0075429_100064624 | 3300006880 | Bacteria | 3187 |
| 270 | Ga0075429_100213610 | 3300006880 | Bacteria | 1690 |
| 271 | Ga0068865_100093495 | 3300006881 | Bacteria | 2187 |
| 272 | Ga0068865_100257007 | 3300006881 | Bacteria | 1381 |
| 273 | Ga0075436_100011613 | 3300006914 | Bacteria | 6043 |
| 274 | Ga0075436_100076996 | 3300006914 | Bacteria | 2310 |
| 275 | Ga0097620_100002098 | 3300006931 | Bacteria | 20297 |
| 276 | Ga0097620_100006613 | 3300006931 | Bacteria | 11772 |
| 277 | Ga0097620_100060026 | 3300006931 | Bacteria | 3832 |
| 278 | Ga0097620_100063323 | 3300006931 | Bacteria | 3729 |
| 279 | Ga0097620_100089354 | 3300006931 | Bacteria | 3131 |
| 280 | Ga0097620_100114627 | 3300006931 | Bacteria | 2759 |
| 281 | Ga0097620_100266646 | 3300006931 | Bacteria | 1804 |
| 282 | Ga0097620_100316154 | 3300006931 | Bacteria | 1655 |
| 283 | Ga0097620_100447629 | 3300006931 | Bacteria | 1388 |
| 284 | Ga0097620_100498849 | 3300006931 | Bacteria | 1312 |
| 285 | Ga0075435_100013015 | 3300007076 | Bacteria | 6175 |
| 286 | Ga0075435_100051960 | 3300007076 | Bacteria | 3302 |
| 287 | Ga0099794_10000473 | 3300007265 | Bacteria | 13477 |
| 288 | Ga0099794_10439255 | 3300007265 | Bacteria | 684 |
| 289 | Ga0105240_10003810 | 3300009093 | Bacteria | 23297 |
| 290 | Ga0111539_10020642 | 3300009094 | Bacteria | 8113 |
| 291 | Ga0111539_10022170 | 3300009094 | Bacteria | 7807 |
| 292 | Ga0111539_10031784 | 3300009094 | Bacteria | 6413 |
| 293 | Ga0111539_10138106 | 3300009094 | Bacteria | 2855 |
| 294 | Ga0111539_10144756 | 3300009094 | Bacteria | 2782 |
| 295 | Ga0111539_10180876 | 3300009094 | Bacteria | 2462 |
| 296 | Ga0111539_10341252 | 3300009094 | Bacteria | 1744 |
| 297 | Ga0111539_10395178 | 3300009094 | Bacteria | 1610 |
| 298 | Ga0111539_10403280 | 3300009094 | Bacteria | 1592 |
| 299 | Ga0111539_10897299 | 3300009094 | Bacteria | 1031 |
| 300 | Ga0105245_10254118 | 3300009098 | Bacteria | 1708 |
| 301 | Ga0105245_10827073 | 3300009098 | Bacteria | 965 |
| 302 | Ga0105247_10005229 | 3300009101 | Bacteria | 8196 |
| 303 | Ga0105247_10009646 | 3300009101 | Bacteria | 5856 |
| 304 | Ga0105247_10083679 | 3300009101 | Bacteria | 2015 |
| 305 | Ga0114129_10045507 | 3300009147 | Bacteria | 6170 |
| 306 | Ga0114129_10107418 | 3300009147 | Unclassified | 3855 |
| 307 | Ga0114129_10141275 | 3300009147 | Bacteria | 3300 |
| 308 | Ga0114129_10179061 | 3300009147 | Bacteria | 2886 |
| 309 | Ga0114129_10278763 | 3300009147 | Bacteria | 2234 |
| 310 | Ga0105243_10013772 | 3300009148 | Bacteria | 6118 |
| 311 | Ga0105243_10107048 | 3300009148 | Bacteria | 2331 |
| 312 | Ga0105243_10169537 | 3300009148 | Bacteria | 1889 |
| 313 | Ga0105243_10239279 | 3300009148 | Bacteria | 1614 |
| 314 | Ga0105241_10001244 | 3300009174 | Bacteria | 19451 |
| 315 | Ga0105241_10019852 | 3300009174 | Bacteria | 4960 |
| 316 | Ga0105241_11213857 | 3300009174 | Bacteria | 715 |
| 317 | Ga0105241_11304685 | 3300009174 | Bacteria | 691 |
| 318 | Ga0105242_10058807 | 3300009176 | Bacteria | 3153 |
| 319 | Ga0105242_10080837 | 3300009176 | Bacteria | 2716 |
| 320 | Ga0105242_10741139 | 3300009176 | Bacteria | 966 |
| 321 | Ga0105242_10802452 | 3300009176 | Bacteria | 932 |
| 322 | Ga0105242_11315218 | 3300009176 | Bacteria | 747 |
| 323 | Ga0105248_10034283 | 3300009177 | Bacteria | 5675 |
| 324 | Ga0105248_10071591 | 3300009177 | Unclassified | 3895 |
| 325 | Ga0105248_10092938 | 3300009177 | Bacteria | 3397 |
| 326 | Ga0105248_10700745 | 3300009177 | Bacteria | 1142 |
| 327 | Ga0105248_11245377 | 3300009177 | Bacteria | 841 |
| 328 | Ga0105237_10025830 | 3300009545 | Bacteria | 6005 |
| 329 | Ga0105237_10063412 | 3300009545 | Bacteria | 3693 |
| 330 | Ga0105237_10090891 | 3300009545 | Bacteria | 3042 |
| 331 | Ga0105237_10436219 | 3300009545 | Bacteria | 1315 |
| 332 | Ga0105237_11368577 | 3300009545 | Bacteria | 714 |
| 333 | Ga0105238_10012280 | 3300009551 | Bacteria | 8637 |
| 334 | Ga0105238_10021367 | 3300009551 | Bacteria | 6594 |
| 335 | Ga0105249_10016555 | 3300009553 | Bacteria | 6543 |
| 336 | Ga0105249_10043997 | 3300009553 | Bacteria | 4061 |
| 337 | Ga0105249_10061068 | 3300009553 | Bacteria | 3458 |
| 338 | Ga0105249_10062638 | 3300009553 | Bacteria | 3415 |
| 339 | Ga0105249_10148838 | 3300009553 | Bacteria | 2252 |
| 340 | Ga0105249_10227386 | 3300009553 | Bacteria | 1839 |
| 341 | Ga0105239_10143070 | 3300010375 | Bacteria | 2666 |
| 342 | Ga0105246_10112952 | 3300011119 | Bacteria | 1999 |
| 343 | Ga0105246_11218262 | 3300011119 | Bacteria | 694 |
| 344 | Ga0157373_10000365 | 3300013100 | Bacteria | 36276 |
| 345 | Ga0157373_10049691 | 3300013100 | Bacteria | 2988 |
| 346 | Ga0157371_10136548 | 3300013102 | Bacteria | 1746 |
| 347 | Ga0157370_10078508 | 3300013104 | Bacteria | 3109 |
| 348 | Ga0157369_10042793 | 3300013105 | Bacteria | 4941 |
| 349 | Ga0157374_10505737 | 3300013296 | Bacteria | 1213 |
| 350 | Ga0157374_10861474 | 3300013296 | Bacteria | 923 |
| 351 | Ga0157378_10602834 | 3300013297 | Bacteria | 1110 |
| 352 | Ga0157378_11267619 | 3300013297 | Bacteria | 778 |
| 353 | Ga0163162_10097139 | 3300013306 | Bacteria | 3034 |
| 354 | Ga0163162_10292499 | 3300013306 | Bacteria | 1760 |
| 355 | Ga0163162_10346842 | 3300013306 | Bacteria | 1617 |
| 356 | Ga0163162_10517914 | 3300013306 | Bacteria | 1322 |
| 357 | Ga0163162_10734787 | 3300013306 | Bacteria | 1107 |
| 358 | Ga0163162_11302732 | 3300013306 | Bacteria | 825 |
| 359 | Ga0157372_10000337 | 3300013307 | Bacteria | 51578 |
| 360 | Ga0157372_10083849 | 3300013307 | Bacteria | 3610 |
| 361 | Ga0157372_10579165 | 3300013307 | Bacteria | 1308 |
| 362 | Ga0157375_10084173 | 3300013308 | Bacteria | 3228 |
| 363 | Ga0157375_10142074 | 3300013308 | Bacteria | 2528 |
| 364 | Ga0157375_10179993 | 3300013308 | Bacteria | 2265 |
| 365 | Ga0157375_10342129 | 3300013308 | Bacteria | 1661 |
| 366 | Ga0157375_11020151 | 3300013308 | Bacteria | 966 |
| 367 | Ga0163163_10004457 | 3300014325 | Bacteria | 11940 |
| 368 | Ga0163163_10084984 | 3300014325 | Bacteria | 3172 |
| 369 | Ga0163163_10991655 | 3300014325 | Bacteria | 903 |
| 370 | Ga0163163_11763240 | 3300014325 | Bacteria | 679 |
| 371 | Ga0157380_10039465 | 3300014326 | Bacteria | 3672 |
| 372 | Ga0157380_10152978 | 3300014326 | Bacteria | 1997 |
| 373 | Ga0157380_10263923 | 3300014326 | Bacteria | 1566 |
| 374 | Ga0157380_10292821 | 3300014326 | Bacteria | 1495 |
| 375 | Ga0157380_10458909 | 3300014326 | Bacteria | 1226 |
| 376 | Ga0182008_10222118 | 3300014497 | Bacteria | 967 |
| 377 | Ga0157377_10137349 | 3300014745 | Bacteria | 1499 |
| 378 | Ga0157379_10303007 | 3300014968 | Bacteria | 1457 |
| 379 | Ga0157379_10568998 | 3300014968 | Bacteria | 1055 |
| 380 | Ga0157376_10252572 | 3300014969 | Bacteria | 1648 |
| 381 | Ga0157376_10816212 | 3300014969 | Bacteria | 946 |
| 382 | Ga0163161_10310229 | 3300017792 | Bacteria | 1245 |
| 383 | Ga0163161_10315658 | 3300017792 | Bacteria | 1234 |
| 384 | Ga0163161_10654360 | 3300017792 | Bacteria | 871 |
| 385 | Ga0213876_10055671 | 3300021384 | Bacteria | 2088 |
| 386 | Ga0207653_10001878 | 3300025885 | Bacteria | 6727 |
| 387 | Ga0207653_10062310 | 3300025885 | Bacteria | 1260 |
| 388 | Ga0207682_10110724 | 3300025893 | Bacteria | 1209 |
| 389 | Ga0207692_10009090 | 3300025898 | Bacteria | 4136 |
| 390 | Ga0207710_10001835 | 3300025900 | Bacteria | 10234 |
| 391 | Ga0207710_10002733 | 3300025900 | Bacteria | 8080 |
| 392 | Ga0207710_10046541 | 3300025900 | Bacteria | 1937 |
| 393 | Ga0207710_10203397 | 3300025900 | Bacteria | 979 |
| 394 | Ga0207688_10140724 | 3300025901 | Bacteria | 1420 |
| 395 | Ga0207680_10070357 | 3300025903 | Bacteria | 2165 |
| 396 | Ga0207680_10167778 | 3300025903 | Bacteria | 1476 |
| 397 | Ga0207685_10188480 | 3300025905 | Bacteria | 961 |
| 398 | Ga0207699_10000032 | 3300025906 | Bacteria | 137608 |
| 399 | Ga0207645_10001806 | 3300025907 | Bacteria | 17280 |
| 400 | Ga0207645_10024477 | 3300025907 | Bacteria | 3913 |
| 401 | Ga0207643_10003293 | 3300025908 | Bacteria | 8720 |
| 402 | Ga0207643_10142433 | 3300025908 | Bacteria | 1433 |
| 403 | Ga0207643_10302606 | 3300025908 | Bacteria | 995 |
| 404 | Ga0207705_10032167 | 3300025909 | Bacteria | 3748 |
| 405 | Ga0207684_10015141 | 3300025910 | Bacteria | 6641 |
| 406 | Ga0207684_10023721 | 3300025910 | Bacteria | 5235 |
| 407 | Ga0207684_10068409 | 3300025910 | Bacteria | 3018 |
| 408 | Ga0207684_10455147 | 3300025910 | Bacteria | 1099 |
| 409 | Ga0207654_10008756 | 3300025911 | Bacteria | 5130 |
| 410 | Ga0207654_10009448 | 3300025911 | Bacteria | 4952 |
| 411 | Ga0207707_10004696 | 3300025912 | Bacteria | 11991 |
| 412 | Ga0207671_10006096 | 3300025914 | Bacteria | 10856 |
| 413 | Ga0207671_10064278 | 3300025914 | Bacteria | 2728 |
| 414 | Ga0207660_10028839 | 3300025917 | Bacteria | 3801 |
| 415 | Ga0207660_10140624 | 3300025917 | Bacteria | 1845 |
| 416 | Ga0207660_10472524 | 3300025917 | Bacteria | 1015 |
| 417 | Ga0207662_10074356 | 3300025918 | Bacteria | 2062 |
| 418 | Ga0207662_10206742 | 3300025918 | Bacteria | 1273 |
| 419 | Ga0207657_10000869 | 3300025919 | Bacteria | 31879 |
| 420 | Ga0207657_10662685 | 3300025919 | Bacteria | 812 |
| 421 | Ga0207649_10007930 | 3300025920 | Bacteria | 5780 |
| 422 | Ga0207652_10003687 | 3300025921 | Bacteria | 12594 |
| 423 | Ga0207652_10017916 | 3300025921 | Bacteria | 5803 |
| 424 | Ga0207652_10024161 | 3300025921 | Bacteria | 5040 |
| 425 | Ga0207646_10002690 | 3300025922 | Bacteria | 20839 |
| 426 | Ga0207646_10010797 | 3300025922 | Bacteria | 8880 |
| 427 | Ga0207646_10017494 | 3300025922 | Bacteria | 6707 |
| 428 | Ga0207681_10000006 | 3300025923 | Bacteria | 496979 |
| 429 | Ga0207681_10291479 | 3300025923 | Bacteria | 1288 |
| 430 | Ga0207681_10449942 | 3300025923 | Bacteria | 1048 |
| 431 | Ga0207694_10121602 | 3300025924 | Bacteria | 2085 |
| 432 | Ga0207694_10381457 | 3300025924 | Bacteria | 1170 |
| 433 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 434 | Ga0207650_10021459 | 3300025925 | Bacteria | 4564 |
| 435 | Ga0207650_10114118 | 3300025925 | Bacteria | 2095 |
| 436 | Ga0207650_10181712 | 3300025925 | Bacteria | 1676 |
| 437 | Ga0207650_10337678 | 3300025925 | Bacteria | 1237 |
| 438 | Ga0207659_10213718 | 3300025926 | Bacteria | 1547 |
| 439 | Ga0207687_10159312 | 3300025927 | Bacteria | 1730 |
| 440 | Ga0207687_10315559 | 3300025927 | Bacteria | 1264 |
| 441 | Ga0207700_10250206 | 3300025928 | Bacteria | 1514 |
| 442 | Ga0207644_10000588 | 3300025931 | Bacteria | 23241 |
| 443 | Ga0207644_10062151 | 3300025931 | Bacteria | 2707 |
| 444 | Ga0207644_10632233 | 3300025931 | Bacteria | 890 |
| 445 | Ga0207644_10845973 | 3300025931 | Bacteria | 766 |
| 446 | Ga0207690_10011627 | 3300025932 | Bacteria | 5260 |
| 447 | Ga0207706_10001836 | 3300025933 | Bacteria | 20828 |
| 448 | Ga0207686_10046819 | 3300025934 | Bacteria | 2670 |
| 449 | Ga0207686_10347348 | 3300025934 | Bacteria | 1116 |
| 450 | Ga0207709_10028978 | 3300025935 | Bacteria | 3205 |
| 451 | Ga0207709_10191543 | 3300025935 | Bacteria | 1453 |
| 452 | Ga0207709_10254613 | 3300025935 | Bacteria | 1284 |
| 453 | Ga0207670_10000003 | 3300025936 | Bacteria | 760449 |
| 454 | Ga0207670_10011404 | 3300025936 | Bacteria | 5158 |
| 455 | Ga0207670_10056731 | 3300025936 | Bacteria | 2653 |
| 456 | Ga0207670_10057504 | 3300025936 | Bacteria | 2638 |
| 457 | Ga0207670_10133043 | 3300025936 | Bacteria | 1825 |
| 458 | Ga0207670_11061220 | 3300025936 | Bacteria | 683 |
| 459 | Ga0207669_10094462 | 3300025937 | Bacteria | 1957 |
| 460 | Ga0207704_10155920 | 3300025938 | Bacteria | 1618 |
| 461 | Ga0207665_10000918 | 3300025939 | Bacteria | 19914 |
| 462 | Ga0207665_10461065 | 3300025939 | Bacteria | 977 |
| 463 | Ga0207691_10073114 | 3300025940 | Bacteria | 3092 |
| 464 | Ga0207691_10260398 | 3300025940 | Bacteria | 1495 |
| 465 | Ga0207691_10875762 | 3300025940 | Bacteria | 752 |
| 466 | Ga0207691_10915505 | 3300025940 | Bacteria | 734 |
| 467 | Ga0207711_10123123 | 3300025941 | Bacteria | 2317 |
| 468 | Ga0207711_10159900 | 3300025941 | Bacteria | 2038 |
| 469 | Ga0207711_10209004 | 3300025941 | Bacteria | 1782 |
| 470 | Ga0207711_10251832 | 3300025941 | Bacteria | 1622 |
| 471 | Ga0207711_10677938 | 3300025941 | Bacteria | 961 |
| 472 | Ga0207711_10716374 | 3300025941 | Bacteria | 933 |
| 473 | Ga0207689_10000110 | 3300025942 | Bacteria | 67347 |
| 474 | Ga0207689_10003348 | 3300025942 | Bacteria | 14679 |
| 475 | Ga0207689_10041955 | 3300025942 | Bacteria | 3786 |
| 476 | Ga0207689_10122087 | 3300025942 | Bacteria | 2142 |
| 477 | Ga0207689_10953625 | 3300025942 | Bacteria | 724 |
| 478 | Ga0207689_11073846 | 3300025942 | Bacteria | 679 |
| 479 | Ga0207679_10002898 | 3300025945 | Bacteria | 10642 |
| 480 | Ga0207679_10136955 | 3300025945 | Bacteria | 1973 |
| 481 | Ga0207667_10000088 | 3300025949 | Bacteria | 149413 |
| 482 | Ga0207667_10001835 | 3300025949 | Bacteria | 26686 |
| 483 | Ga0207667_10020739 | 3300025949 | Bacteria | 7301 |
| 484 | Ga0207667_10585350 | 3300025949 | Bacteria | 1126 |
| 485 | Ga0207651_10232562 | 3300025960 | Bacteria | 1497 |
| 486 | Ga0207651_10367386 | 3300025960 | Bacteria | 1216 |
| 487 | Ga0207712_10003176 | 3300025961 | Bacteria | 10463 |
| 488 | Ga0207712_10007574 | 3300025961 | Bacteria | 6860 |
| 489 | Ga0207712_10057735 | 3300025961 | Bacteria | 2740 |
| 490 | Ga0207712_10118073 | 3300025961 | Bacteria | 2002 |
| 491 | Ga0207712_10124735 | 3300025961 | Bacteria | 1954 |
| 492 | Ga0207712_10205234 | 3300025961 | Bacteria | 1566 |
| 493 | Ga0207712_10458923 | 3300025961 | Bacteria | 1082 |
| 494 | Ga0207712_10599535 | 3300025961 | Bacteria | 953 |
| 495 | Ga0207640_10007214 | 3300025981 | Bacteria | 6128 |
| 496 | Ga0207658_10068101 | 3300025986 | Bacteria | 2684 |
| 497 | Ga0207677_10016559 | 3300026023 | Bacteria | 4371 |
| 498 | Ga0207677_10027695 | 3300026023 | Bacteria | 3574 |
| 499 | Ga0207677_10588495 | 3300026023 | Bacteria | 975 |
| 500 | Ga0207677_11220261 | 3300026023 | Bacteria | 689 |
| 501 | Ga0207703_10050125 | 3300026035 | Bacteria | 3378 |
| 502 | Ga0207703_10190554 | 3300026035 | Bacteria | 1816 |
| 503 | Ga0207703_10286952 | 3300026035 | Bacteria | 1497 |
| 504 | Ga0207703_10782568 | 3300026035 | Bacteria | 910 |
| 505 | Ga0207639_10008046 | 3300026041 | Bacteria | 7207 |
| 506 | Ga0207639_10048141 | 3300026041 | Bacteria | 3225 |
| 507 | Ga0207678_10000307 | 3300026067 | Bacteria | 44046 |
| 508 | Ga0207708_10051505 | 3300026075 | Bacteria | 3134 |
| 509 | Ga0207708_10113443 | 3300026075 | Bacteria | 2106 |
| 510 | Ga0207708_10144672 | 3300026075 | Bacteria | 1868 |
| 511 | Ga0207708_10165362 | 3300026075 | Bacteria | 1749 |
| 512 | Ga0207708_10194037 | 3300026075 | Bacteria | 1618 |
| 513 | Ga0207708_10203007 | 3300026075 | Bacteria | 1582 |
| 514 | Ga0207708_10587247 | 3300026075 | Bacteria | 942 |
| 515 | Ga0207702_10030507 | 3300026078 | Bacteria | 4493 |
| 516 | Ga0207702_10080749 | 3300026078 | Bacteria | 2822 |
| 517 | Ga0207702_10292056 | 3300026078 | Bacteria | 1545 |
| 518 | Ga0207702_10644715 | 3300026078 | Bacteria | 1041 |
| 519 | Ga0207641_10157056 | 3300026088 | Bacteria | 2064 |
| 520 | Ga0207641_10621966 | 3300026088 | Bacteria | 1059 |
| 521 | Ga0207641_11091688 | 3300026088 | Bacteria | 796 |
| 522 | Ga0207648_10009631 | 3300026089 | Bacteria | 9240 |
| 523 | Ga0207648_10103166 | 3300026089 | Bacteria | 2501 |
| 524 | Ga0207648_10104211 | 3300026089 | Bacteria | 2487 |
| 525 | Ga0207648_10133891 | 3300026089 | Bacteria | 2182 |
| 526 | Ga0207648_10144118 | 3300026089 | Bacteria | 2101 |
| 527 | Ga0207648_10190493 | 3300026089 | Bacteria | 1817 |
| 528 | Ga0207676_10007116 | 3300026095 | Bacteria | 7927 |
| 529 | Ga0207674_10000181 | 3300026116 | Bacteria | 77248 |
| 530 | Ga0207674_10167742 | 3300026116 | Bacteria | 2149 |
| 531 | Ga0207674_10305356 | 3300026116 | Bacteria | 1540 |
| 532 | Ga0207674_10388083 | 3300026116 | Bacteria | 1350 |
| 533 | Ga0207675_100029052 | 3300026118 | Bacteria | 5152 |
| 534 | Ga0207675_100054950 | 3300026118 | Bacteria | 3715 |
| 535 | Ga0207675_100082780 | 3300026118 | Bacteria | 3010 |
| 536 | Ga0207675_100088344 | 3300026118 | Bacteria | 2911 |
| 537 | Ga0207675_100219711 | 3300026118 | Bacteria | 1831 |
| 538 | Ga0207675_100269438 | 3300026118 | Bacteria | 1652 |
| 539 | Ga0207683_10006580 | 3300026121 | Bacteria | 9946 |
| 540 | Ga0207683_10793317 | 3300026121 | Bacteria | 879 |
| 541 | Ga0207698_10010871 | 3300026142 | Bacteria | 5876 |
| 542 | Ga0207698_10141744 | 3300026142 | Bacteria | 2072 |
| 543 | Ga0207698_11323502 | 3300026142 | Bacteria | 735 |
| 544 | Ga0209969_1008892 | 3300027360 | Bacteria | 1426 |
| 545 | Ga0209967_1009478 | 3300027364 | Bacteria | 1350 |
| 546 | Ga0209981_1003950 | 3300027378 | Bacteria | 1931 |
| 547 | Ga0209996_1001105 | 3300027395 | Bacteria | 3217 |
| 548 | Ga0209984_1002122 | 3300027424 | Bacteria | 2199 |
| 549 | Ga0210000_1007312 | 3300027462 | Bacteria | 1615 |
| 550 | Ga0209995_1001050 | 3300027471 | Bacteria | 4249 |
| 551 | Ga0209968_1003024 | 3300027526 | Bacteria | 2522 |
| 552 | Ga0209999_1000025 | 3300027543 | Bacteria | 15396 |
| 553 | Ga0209982_1001508 | 3300027552 | Bacteria | 3195 |
| 554 | Ga0209970_1007998 | 3300027614 | Bacteria | 1736 |
| 555 | Ga0210002_1003118 | 3300027617 | Bacteria | 2434 |
| 556 | Ga0209983_1000033 | 3300027665 | Bacteria | 19538 |
| 557 | Ga0209588_1000002 | 3300027671 | Bacteria | 311181 |
| 558 | Ga0209971_1000127 | 3300027682 | Bacteria | 22754 |
| 559 | Ga0209971_1021525 | 3300027682 | Bacteria | 1534 |
| 560 | Ga0209966_1000147 | 3300027695 | Bacteria | 30199 |
| 561 | Ga0209998_10000063 | 3300027717 | Bacteria | 42726 |
| 562 | Ga0209998_10002609 | 3300027717 | Bacteria | 4084 |
| 563 | Ga0209998_10064551 | 3300027717 | Bacteria | 867 |
| 564 | Ga0209974_10009869 | 3300027876 | Bacteria | 3229 |
| 565 | Ga0209974_10024507 | 3300027876 | Bacteria | 1997 |
| 566 | Ga0209974_10036896 | 3300027876 | Bacteria | 1623 |
| 567 | Ga0207428_10071934 | 3300027907 | Bacteria | 2715 |
| 568 | Ga0207428_10104750 | 3300027907 | Bacteria | 2182 |
| 569 | Ga0207428_10205343 | 3300027907 | Bacteria | 1482 |
| 570 | Ga0207428_10599782 | 3300027907 | Bacteria | 794 |
| 571 | Ga0268266_10001122 | 3300028379 | Bacteria | 33408 |
| 572 | Ga0268266_10338834 | 3300028379 | Bacteria | 1411 |
| 573 | Ga0268266_10414700 | 3300028379 | Bacteria | 1275 |
| 574 | Ga0268266_10866496 | 3300028379 | Bacteria | 873 |
| 575 | Ga0268265_10008184 | 3300028380 | Bacteria | 7062 |
| 576 | Ga0268265_10010285 | 3300028380 | Bacteria | 6319 |
| 577 | Ga0268265_10010902 | 3300028380 | Bacteria | 6139 |
| 578 | Ga0268265_10016947 | 3300028380 | Bacteria | 5016 |
| 579 | Ga0268265_10055261 | 3300028380 | Bacteria | 3016 |
| 580 | Ga0268265_10549715 | 3300028380 | Bacteria | 1096 |
| 581 | Ga0268265_11334530 | 3300028380 | Bacteria | 718 |
| 582 | Ga0268264_10012235 | 3300028381 | Bacteria | 7059 |
| 583 | Ga0268264_10047256 | 3300028381 | Bacteria | 3578 |
| 584 | Ga0268264_10190245 | 3300028381 | Bacteria | 1870 |
| 585 | Ga0268264_10211988 | 3300028381 | Bacteria | 1779 |
| 586 | Ga0268264_10313492 | 3300028381 | Bacteria | 1481 |
| 587 | Ga0268264_10382123 | 3300028381 | Bacteria | 1349 |
| 588 | Ga0268264_10464202 | 3300028381 | Bacteria | 1229 |
| 589 | Ga0268264_10802402 | 3300028381 | Bacteria | 940 |
| 590 | Ga0265337_1001863 | 3300028556 | Bacteria | 10066 |
| 591 | Ga0265337_1016100 | 3300028556 | Bacteria | 2428 |
| 592 | Ga0265319_1000099 | 3300028563 | Bacteria | 66865 |
| 593 | Ga0265334_10014627 | 3300028573 | Bacteria | 3269 |
| 594 | Ga0265334_10046285 | 3300028573 | Bacteria | 1682 |
| 595 | Ga0265318_10000029 | 3300028577 | Bacteria | 147471 |
| 596 | Ga0265318_10000030 | 3300028577 | Bacteria | 146681 |
| 597 | Ga0265318_10000475 | 3300028577 | Bacteria | 29608 |
| 598 | Ga0265318_10004793 | 3300028577 | Bacteria | 6477 |
| 599 | Ga0265318_10007653 | 3300028577 | Bacteria | 4864 |
| 600 | Ga0265318_10061542 | 3300028577 | Bacteria | 1398 |
| 601 | Ga0265323_10001946 | 3300028653 | Bacteria | 9742 |
| 602 | Ga0265323_10004203 | 3300028653 | Bacteria | 6229 |
| 603 | Ga0265323_10013094 | 3300028653 | Bacteria | 3316 |
| 604 | Ga0265323_10014451 | 3300028653 | Bacteria | 3127 |
| 605 | Ga0265323_10097669 | 3300028653 | Bacteria | 975 |
| 606 | Ga0265322_10002919 | 3300028654 | Bacteria | 5205 |
| 607 | Ga0265322_10036956 | 3300028654 | Bacteria | 1391 |
| 608 | Ga0265322_10125536 | 3300028654 | Bacteria | 731 |
| 609 | Ga0307515_10372973 | 3300028794 | Bacteria | 1063 |
| 610 | Ga0265338_10014764 | 3300028800 | Bacteria | 8650 |
| 611 | Ga0265338_10018298 | 3300028800 | Bacteria | 7506 |
| 612 | Ga0265338_10096509 | 3300028800 | Bacteria | 2425 |
| 613 | Ga0265338_10120824 | 3300028800 | Bacteria | 2088 |
| 614 | Ga0265324_10000038 | 3300029957 | Bacteria | 119212 |
| 615 | Ga0265324_10015664 | 3300029957 | Bacteria | 2785 |
| 616 | Ga0307511_10015383 | 3300030521 | Bacteria | 7412 |
| 617 | Ga0265760_10083153 | 3300031090 | Bacteria | 994 |
| 618 | Ga0265760_10205980 | 3300031090 | Bacteria | 666 |
| 619 | Ga0265330_10000105 | 3300031235 | Bacteria | 69914 |
| 620 | Ga0265330_10000241 | 3300031235 | Bacteria | 41254 |
| 621 | Ga0265330_10000632 | 3300031235 | Bacteria | 22707 |
| 622 | Ga0265330_10001005 | 3300031235 | Bacteria | 17146 |
| 623 | Ga0265330_10002964 | 3300031235 | Bacteria | 9036 |
| 624 | Ga0265330_10006503 | 3300031235 | Bacteria | 5780 |
| 625 | Ga0265330_10025563 | 3300031235 | Bacteria | 2675 |
| 626 | Ga0265330_10041190 | 3300031235 | Bacteria | 2048 |
| 627 | Ga0265330_10073806 | 3300031235 | Bacteria | 1474 |
| 628 | Ga0265330_10077872 | 3300031235 | Bacteria | 1430 |
| 629 | Ga0265332_10000032 | 3300031238 | Bacteria | 154668 |
| 630 | Ga0265332_10015705 | 3300031238 | Bacteria | 3342 |
| 631 | Ga0265332_10042803 | 3300031238 | Bacteria | 1956 |
| 632 | Ga0265328_10002510 | 3300031239 | Bacteria | 8229 |
| 633 | Ga0265328_10051728 | 3300031239 | Bacteria | 1508 |
| 634 | Ga0265320_10000017 | 3300031240 | Bacteria | 196688 |
| 635 | Ga0265320_10000044 | 3300031240 | Bacteria | 121907 |
| 636 | Ga0265320_10006167 | 3300031240 | Bacteria | 7587 |
| 637 | Ga0265320_10072652 | 3300031240 | Bacteria | 1618 |
| 638 | Ga0265325_10000206 | 3300031241 | Bacteria | 41713 |
| 639 | Ga0265325_10008209 | 3300031241 | Bacteria | 6180 |
| 640 | Ga0265325_10020686 | 3300031241 | Bacteria | 3624 |
| 641 | Ga0265329_10000025 | 3300031242 | Bacteria | 61323 |
| 642 | Ga0265329_10000043 | 3300031242 | Bacteria | 53348 |
| 643 | Ga0265329_10000299 | 3300031242 | Bacteria | 26141 |
| 644 | Ga0265329_10009972 | 3300031242 | Bacteria | 3513 |
| 645 | Ga0265329_10010702 | 3300031242 | Bacteria | 3358 |
| 646 | Ga0265329_10024535 | 3300031242 | Bacteria | 2002 |
| 647 | Ga0265329_10035248 | 3300031242 | Bacteria | 1615 |
| 648 | Ga0265340_10000434 | 3300031247 | Bacteria | 22478 |
| 649 | Ga0265340_10002905 | 3300031247 | Bacteria | 9753 |
| 650 | Ga0265340_10010701 | 3300031247 | Bacteria | 4902 |
| 651 | Ga0265339_10000039 | 3300031249 | Bacteria | 120661 |
| 652 | Ga0265339_10019068 | 3300031249 | Bacteria | 4031 |
| 653 | Ga0265339_10031471 | 3300031249 | Bacteria | 2998 |
| 654 | Ga0265331_10000027 | 3300031250 | Bacteria | 220058 |
| 655 | Ga0265331_10000451 | 3300031250 | Bacteria | 39806 |
| 656 | Ga0265331_10001080 | 3300031250 | Bacteria | 20991 |
| 657 | Ga0265331_10007233 | 3300031250 | Bacteria | 6440 |
| 658 | Ga0265331_10024917 | 3300031250 | Bacteria | 3022 |
| 659 | Ga0265327_10175481 | 3300031251 | Unclassified | 982 |
| 660 | Ga0265316_10000065 | 3300031344 | Bacteria | 111353 |
| 661 | Ga0265316_10000149 | 3300031344 | Bacteria | 76775 |
| 662 | Ga0265316_10000295 | 3300031344 | Bacteria | 56326 |
| 663 | Ga0265316_10000335 | 3300031344 | Bacteria | 52689 |
| 664 | Ga0265316_10000357 | 3300031344 | Bacteria | 51535 |
| 665 | Ga0265316_10003769 | 3300031344 | Bacteria | 15247 |
| 666 | Ga0265316_10005799 | 3300031344 | Bacteria | 11915 |
| 667 | Ga0265316_10006101 | 3300031344 | Bacteria | 11562 |
| 668 | Ga0265316_10015302 | 3300031344 | Bacteria | 6711 |
| 669 | Ga0265316_10030110 | 3300031344 | Bacteria | 4455 |
| 670 | Ga0265316_10048454 | 3300031344 | Bacteria | 3353 |
| 671 | Ga0265316_10049586 | 3300031344 | Bacteria | 3306 |
| 672 | Ga0265316_10254787 | 3300031344 | Bacteria | 1288 |
| 673 | Ga0307513_10368745 | 3300031456 | Bacteria | 1179 |
| 674 | Ga0265313_10000002 | 3300031595 | Bacteria | 205344 |
| 675 | Ga0265313_10000236 | 3300031595 | Bacteria | 59962 |
| 676 | Ga0265313_10000738 | 3300031595 | Bacteria | 33542 |
| 677 | Ga0265313_10006604 | 3300031595 | Bacteria | 8151 |
| 678 | Ga0265313_10016017 | 3300031595 | Bacteria | 4334 |
| 679 | Ga0265313_10033854 | 3300031595 | Bacteria | 2591 |
| 680 | Ga0265313_10035680 | 3300031595 | Bacteria | 2502 |
| 681 | Ga0265313_10050459 | 3300031595 | Bacteria | 1996 |
| 682 | Ga0307508_10000625 | 3300031616 | Bacteria | 42514 |
| 683 | Ga0307508_10036128 | 3300031616 | Bacteria | 4450 |
| 684 | Ga0265314_10000015 | 3300031711 | Bacteria | 397180 |
| 685 | Ga0265314_10000069 | 3300031711 | Bacteria | 153728 |
| 686 | Ga0265314_10000701 | 3300031711 | Bacteria | 40596 |
| 687 | Ga0265314_10001957 | 3300031711 | Bacteria | 21929 |
| 688 | Ga0265314_10013250 | 3300031711 | Bacteria | 6673 |
| 689 | Ga0265314_10014365 | 3300031711 | Bacteria | 6342 |
| 690 | Ga0265314_10081691 | 3300031711 | Bacteria | 2128 |
| 691 | Ga0265342_10000072 | 3300031712 | Bacteria | 106658 |
| 692 | Ga0265342_10000228 | 3300031712 | Bacteria | 63409 |
| 693 | Ga0265342_10000724 | 3300031712 | Bacteria | 34052 |
| 694 | Ga0265342_10002007 | 3300031712 | Bacteria | 18103 |
| 695 | Ga0265342_10009882 | 3300031712 | Bacteria | 6674 |
| 696 | Ga0265342_10009972 | 3300031712 | Bacteria | 6638 |
| 697 | Ga0265342_10014161 | 3300031712 | Bacteria | 5305 |
| 698 | Ga0265342_10017542 | 3300031712 | Bacteria | 4652 |
| 699 | Ga0265342_10018406 | 3300031712 | Bacteria | 4526 |
| 700 | Ga0265342_10019495 | 3300031712 | Bacteria | 4369 |
| 701 | Ga0265342_10021206 | 3300031712 | Bacteria | 4153 |
| 702 | Ga0316576_10037033 | 3300031727 | Bacteria | 3490 |
| 703 | Ga0316576_10156263 | 3300031727 | Bacteria | 1719 |
| 704 | Ga0316576_10194326 | 3300031727 | Bacteria | 1529 |
| 705 | Ga0316576_10232406 | 3300031727 | Bacteria | 1386 |
| 706 | Ga0316576_10286860 | 3300031727 | Bacteria | 1232 |
| 707 | Ga0316576_10777193 | 3300031727 | Bacteria | 690 |
| 708 | Ga0316578_10017309 | 3300031728 | Bacteria | 3919 |
| 709 | Ga0316578_10058448 | 3300031728 | Bacteria | 2267 |
| 710 | Ga0316578_10113217 | 3300031728 | Bacteria | 1630 |
| 711 | Ga0307516_10076755 | 3300031730 | Bacteria | 3192 |
| 712 | Ga0307405_10735750 | 3300031731 | Bacteria | 820 |
| 713 | Ga0307410_10338206 | 3300031852 | Bacteria | 1199 |
| 714 | Ga0307406_10070939 | 3300031901 | Bacteria | 2282 |
| 715 | Ga0307407_10084008 | 3300031903 | Bacteria | 1933 |
| 716 | Ga0307407_10810146 | 3300031903 | Bacteria | 713 |
| 717 | Ga0307409_100133090 | 3300031995 | Bacteria | 2129 |
| 718 | Ga0307409_100280293 | 3300031995 | Bacteria | 1540 |
| 719 | Ga0307409_100609875 | 3300031995 | Bacteria | 1080 |
| 720 | Ga0316583_10104212 | 3300032133 | Bacteria | 989 |
| 721 | Ga0307507_10026247 | 3300033179 | Bacteria | 6287 |
| 722 | Ga0316588_1089920 | 3300033528 | Bacteria | 764 |
| 723 | Ga0316596_1128160 | 3300033541 | Bacteria | 692 |
| 724 | Ga0373948_0003013 | 3300034817 | Bacteria | 2549 |
| 725 | Ga0373950_0000025 | 3300034818 | Bacteria | 177524 |
| 726 | Ga0373929_0000003 | 3300035085 | Bacteria | 575058 |
| 727 | Ga0373929_0054054 | 3300035085 | Bacteria | 924 |
| 728 | Ga0373951_0006119 | 3300035091 | Bacteria | 2764 |
| 729 | Ga0373941_0076371 | 3300035115 | Bacteria | 1123 |
| 730 | Ga0373941_0125926 | 3300035115 | Bacteria | 918 |
| 731 | Ga0373953_0031638 | 3300035117 | Bacteria | 2059 |
| 732 | Ga0373943_0599808 | 3300035170 | Bacteria | 649 |
| 733 | Ga0373961_0001172 | 3300035241 | Bacteria | 8187 |
| 734 | Ga0373961_0108842 | 3300035241 | Bacteria | 906 |
| 735 | Ga0373961_0184894 | 3300035241 | Unclassified | 728 |
| 736 | Ga0316574_0005968 | 3300035398 | Bacteria | 6536 |
| 737 | Ga0316574_0125277 | 3300035398 | Bacteria | 1651 |
| 738 | Ga0373935_0002532 | 3300035692 | Bacteria | 10467 |
| 739 | Ga0373935_0812402 | 3300035692 | Bacteria | 691 |
| 740 | Ga0373927_0392351 | 3300035695 | Bacteria | 916 |
| 741 | Ga0373933_0056772 | 3300035724 | Bacteria | 2351 |
| 742 | Ga0373933_0568646 | 3300035724 | Bacteria | 744 |
| 743 | Ga0373937_0051072 | 3300036401 | Bacteria | 3790 |
| 744 | Ga0373937_0507409 | 3300036401 | Bacteria | 1146 |
| 745 | Ga0316582_0105272 | 3300036647 | Bacteria | 1873 |
| 746 | Ga0316582_0267449 | 3300036647 | Bacteria | 1173 |
| 747 | Ga0316584_0000540 | 3300036712 | Bacteria | 20258 |
| 748 | Ga0316584_0032828 | 3300036712 | Bacteria | 3842 |
| 749 | Ga0373925_0934834 | 3300037068 | Bacteria | 714 |
| 750 | Ga0395900_0021425 | 3300037418 | Bacteria | 6608 |
| 751 | Ga0395905_0000007 | 3300037471 | Bacteria | 521849 |
| 752 | Ga0395905_0040561 | 3300037471 | Bacteria | 4368 |
| 753 | Ga0395905_0377252 | 3300037471 | Bacteria | 1312 |
| 754 | Ga0400489_22377 | 3300039093 | Bacteria | 2187 |
| 755 | Ga0400489_46890 | 3300039093 | Bacteria | 1504 |
| 756 | Ga0436365_0236220 | 3300039437 | Bacteria | 841 |
| 757 | Ga0436365_0443710 | 3300039437 | Bacteria | 1398 |
| 758 | Ga0436365_0746798 | 3300039437 | Bacteria | 1272 |
| 759 | Ga0436360_0270732 | 3300039438 | Bacteria | 1049 |
| 760 | Ga0436360_1236090 | 3300039438 | Bacteria | 800 |
| 761 | Ga0436361_0457863 | 3300039447 | Bacteria | 688 |
| 762 | Ga0436362_0969985 | 3300039453 | Bacteria | 929 |
| 763 | Ga0439465_0006935 | 3300041413 | Bacteria | 3597 |
| 764 | Ga0451804_1112314 | 3300041463 | Bacteria | 683 |
| 765 | Ga0451807_0466492 | 3300041486 | Bacteria | 841 |
| 766 | Ga0451807_0748572 | 3300041486 | Bacteria | 793 |
| 767 | Ga0451807_2420813 | 3300041486 | Bacteria | 684 |
| 768 | Ga0451837_0432478 | 3300041494 | Bacteria | 1908 |
| 769 | Ga0451837_1517064 | 3300041494 | Bacteria | 675 |
| 770 | Ga0451849_0266999 | 3300041505 | Bacteria | 1973 |
| 771 | Ga0451853_2328441 | 3300041512 | Bacteria | 8190 |
| 772 | Ga0439448_0057917 | 3300042005 | Bacteria | 1277 |
| 773 | Ga0439449_0126597 | 3300042007 | Bacteria | 949 |
| 774 | Ga0450914_015202 | 3300042118 | Bacteria | 802 |
| 775 | Ga0439458_0002681 | 3300042157 | Bacteria | 4297 |
| 776 | Ga0439459_0003940 | 3300042438 | Bacteria | 2376 |
| 777 | Ga0439460_0005362 | 3300042461 | Unclassified | 3144 |
| 778 | Ga0451577_0004861 | 3300042876 | Bacteria | 14000 |
| 779 | Ga0451577_0060969 | 3300042876 | Bacteria | 3363 |
| 780 | Ga0451577_0068708 | 3300042876 | Bacteria | 3159 |
| 781 | Ga0451577_0187372 | 3300042876 | Bacteria | 1866 |
| 782 | Ga0451577_0187777 | 3300042876 | Bacteria | 1864 |
| 783 | Ga0451577_0221684 | 3300042876 | Bacteria | 1709 |
| 784 | Ga0451577_0300251 | 3300042876 | Bacteria | 1455 |
| 785 | Ga0451577_0437455 | 3300042876 | Bacteria | 1187 |
| 786 | Ga0451577_0648440 | 3300042876 | Bacteria | 957 |
| 787 | Ga0451577_0847925 | 3300042876 | Bacteria | 824 |
| 788 | Ga0439440_0157996 | 3300042993 | Bacteria | 653 |
| 789 | Ga0453683_0005763 | 3300044673 | Bacteria | 8587 |
| 790 | Ga0453683_0007604 | 3300044673 | Bacteria | 7342 |
| 791 | Ga0453683_0084631 | 3300044673 | Bacteria | 1987 |
| 792 | Ga0453683_0115539 | 3300044673 | Bacteria | 1688 |
| 793 | Ga0453683_0145449 | 3300044673 | Bacteria | 1496 |
| 794 | Ga0453683_0157653 | 3300044673 | Bacteria | 1435 |
| 795 | Ga0453683_0179694 | 3300044673 | Bacteria | 1342 |
| 796 | Ga0453683_0191359 | 3300044673 | Bacteria | 1298 |
| 797 | Ga0466965_0192703 | 3300044683 | Bacteria | 1079 |
| 798 | Ga0453684_0000248 | 3300044712 | Bacteria | 232277 |
| 799 | Ga0453684_0001332 | 3300044712 | Bacteria | 72577 |
| 800 | Ga0453684_0022768 | 3300044712 | Bacteria | 9277 |
| 801 | Ga0453684_0066745 | 3300044712 | Bacteria | 4579 |
| 802 | Ga0453684_0070346 | 3300044712 | Bacteria | 4432 |
| 803 | Ga0453684_0071348 | 3300044712 | Bacteria | 4392 |
| 804 | Ga0453684_0081014 | 3300044712 | Bacteria | 4050 |
| 805 | Ga0453684_0085533 | 3300044712 | Bacteria | 3917 |
| 806 | Ga0453684_0087813 | 3300044712 | Bacteria | 3852 |
| 807 | Ga0453684_0089075 | 3300044712 | Bacteria | 3818 |
| 808 | Ga0453684_0111758 | 3300044712 | Bacteria | 3318 |
| 809 | Ga0453684_0117881 | 3300044712 | Bacteria | 3212 |
| 810 | Ga0453684_0236095 | 3300044712 | Bacteria | 2108 |
| 811 | Ga0453684_0236534 | 3300044712 | Bacteria | 2105 |
| 812 | Ga0453684_0250322 | 3300044712 | Bacteria | 2035 |
| 813 | Ga0453684_0417920 | 3300044712 | Bacteria | 1498 |
| 814 | Ga0453684_0467878 | 3300044712 | Bacteria | 1401 |
| 815 | Ga0453684_1070516 | 3300044712 | Bacteria | 854 |
| 816 | Ga0453684_1100224 | 3300044712 | Bacteria | 839 |
| 817 | Ga0466957_0603979 | 3300044842 | Bacteria | 768 |
| 818 | Ga0466960_0058594 | 3300044901 | Bacteria | 1881 |
| 819 | Ga0466959_0336449 | 3300045049 | Bacteria | 1030 |
| 820 | Ga0451576_0009882 | 3300045051 | Bacteria | 11020 |
| 821 | Ga0451576_0021018 | 3300045051 | Bacteria | 7100 |
| 822 | Ga0451576_0216876 | 3300045051 | Bacteria | 1998 |
| 823 | Ga0451576_0330478 | 3300045051 | Bacteria | 1595 |
| 824 | Ga0466967_0184983 | 3300045976 | Bacteria | 1967 |
| 825 | Ga0466967_0347253 | 3300045976 | Bacteria | 1436 |
| 826 | Ga0495603_0186071 | 3300046455 | Bacteria | 1201 |
| 827 | Ga0495603_0292366 | 3300046455 | Bacteria | 936 |
| 828 | Ga0495582_0153000 | 3300046473 | Bacteria | 1310 |
| 829 | Ga0495584_0096153 | 3300046491 | Bacteria | 1496 |
| 830 | Ga0495644_0076239 | 3300046523 | Bacteria | 1263 |
| 831 | Ga0495640_0196607 | 3300046533 | Bacteria | 1280 |
| 832 | Ga0495598_0038431 | 3300046537 | Bacteria | 1386 |
| 833 | Ga0495621_0007472 | 3300046539 | Bacteria | 3238 |
| 834 | Ga0495622_0043156 | 3300046557 | Bacteria | 2097 |
| 835 | Ga0495622_0091996 | 3300046557 | Bacteria | 1393 |
| 836 | Ga0495661_0369374 | 3300046665 | Bacteria | 703 |
| 837 | Ga0495647_0096502 | 3300046681 | Bacteria | 1219 |
| 838 | Ga0495658_0245136 | 3300046683 | Bacteria | 1126 |
| 839 | Ga0495581_0023218 | 3300047315 | Bacteria | 3594 |
| 840 | Ga0495581_0080963 | 3300047315 | Bacteria | 1880 |
| 841 | Ga0495676_0130318 | 3300047321 | Bacteria | 1816 |
| 842 | Ga0495680_0142001 | 3300047322 | Bacteria | 1756 |
| 843 | Ga0495680_0288996 | 3300047322 | Bacteria | 1154 |
| 844 | Ga0495593_0344461 | 3300047673 | Bacteria | 745 |
| 845 | Ga0496101_0548091 | 3300048904 | Bacteria | 914 |
| 846 | Ga0496102_0255886 | 3300048905 | Bacteria | 1651 |
| 847 | Ga0496103_0424588 | 3300048906 | Bacteria | 853 |
| 848 | Ga0496104_0051995 | 3300048907 | Bacteria | 3869 |
| 849 | Ga0496104_0091351 | 3300048907 | Bacteria | 2910 |
| 850 | Ga0496106_0372597 | 3300048909 | Bacteria | 1147 |
| 851 | Ga0496110_0530442 | 3300048913 | Bacteria | 1071 |
| 852 | Ga0496112_0404731 | 3300048915 | Bacteria | 1304 |
| 853 | Ga0496112_0977681 | 3300048915 | Unclassified | 767 |
| 854 | Ga0496113_0382434 | 3300048916 | Bacteria | 1130 |
| 855 | Ga0496113_0819229 | 3300048916 | Bacteria | 739 |
| 856 | Ga0496114_0000035 | 3300048917 | Bacteria | 160029 |
| 857 | Ga0496114_0003291 | 3300048917 | Bacteria | 12403 |
| 858 | Ga0496114_0509991 | 3300048917 | Bacteria | 1064 |
| 859 | Ga0496115_0186239 | 3300048918 | Bacteria | 1715 |
| 860 | Ga0501291_005747 | 3300049514 | Bacteria | 1634 |
| 861 | Ga0501292_012292 | 3300049515 | Bacteria | 1305 |
| 862 | Ga0501297_011089 | 3300049520 | Bacteria | 1029 |
| 863 | Ga0501311_005612 | 3300049527 | Bacteria | 1382 |
| 864 | Ga0501312_012397 | 3300049528 | Bacteria | 1172 |
| 865 | Ga0501032_0296431 | 3300049569 | Bacteria | 1046 |
| 866 | Ga0501034_0000120 | 3300049571 | Bacteria | 144382 |
| 867 | Ga0501034_1067182 | 3300049571 | Bacteria | 690 |
| 868 | Ga0501036_0008740 | 3300049572 | Bacteria | 8310 |
| 869 | Ga0501036_0091021 | 3300049572 | Bacteria | 2577 |
| 870 | Ga0501038_0156688 | 3300049574 | Bacteria | 1854 |
| 871 | Ga0501038_0308702 | 3300049574 | Bacteria | 1240 |
| 872 | Ga0501038_0491170 | 3300049574 | Bacteria | 940 |
| 873 | Ga0501039_0247476 | 3300049575 | Bacteria | 1402 |
| 874 | Ga0501040_0000236 | 3300049576 | Bacteria | 32441 |
| 875 | Ga0501040_0757000 | 3300049576 | Bacteria | 703 |
| 876 | Ga0501041_0020874 | 3300049577 | Bacteria | 3921 |
| 877 | Ga0501042_0023757 | 3300049578 | Bacteria | 4293 |
| 878 | Ga0501042_0445260 | 3300049578 | Bacteria | 939 |
| 879 | Ga0501042_0837557 | 3300049578 | Bacteria | 670 |
| 880 | Ga0501043_0021008 | 3300049579 | Bacteria | 5118 |
| 881 | Ga0501046_0000111 | 3300049580 | Bacteria | 86335 |
| 882 | Ga0501046_0000355 | 3300049580 | Bacteria | 46138 |
| 883 | Ga0501046_0334428 | 3300049580 | Bacteria | 1102 |
| 884 | Ga0501047_0000009 | 3300049581 | Bacteria | 436619 |
| 885 | Ga0501047_0151956 | 3300049581 | Bacteria | 2191 |
| 886 | Ga0501048_0000918 | 3300049582 | Bacteria | 21704 |
| 887 | Ga0501048_0001804 | 3300049582 | Bacteria | 16275 |
| 888 | Ga0501048_0134910 | 3300049582 | Bacteria | 1744 |
| 889 | Ga0501048_0479984 | 3300049582 | Bacteria | 891 |
| 890 | Ga0501067_0008110 | 3300049583 | Bacteria | 5833 |
| 891 | Ga0501068_0004352 | 3300049584 | Bacteria | 7697 |
| 892 | Ga0501068_0011942 | 3300049584 | Bacteria | 4912 |
| 893 | Ga0501068_0018570 | 3300049584 | Bacteria | 4026 |
| 894 | Ga0501068_0075130 | 3300049584 | Bacteria | 2067 |
| 895 | Ga0501070_0000323 | 3300049586 | Bacteria | 43475 |
| 896 | Ga0501070_0000423 | 3300049586 | Bacteria | 38429 |
| 897 | Ga0501071_0044198 | 3300049587 | Bacteria | 3195 |
| 898 | Ga0501071_0303557 | 3300049587 | Bacteria | 1210 |
| 899 | Ga0501072_0000022 | 3300049588 | Bacteria | 152450 |
| 900 | Ga0501072_0330581 | 3300049588 | Bacteria | 1211 |
| 901 | Ga0501073_0002636 | 3300049589 | Bacteria | 13444 |
| 902 | Ga0501073_0042906 | 3300049589 | Bacteria | 3191 |
| 903 | Ga0501073_0056861 | 3300049589 | Bacteria | 2735 |
| 904 | Ga0501073_0347834 | 3300049589 | Bacteria | 1023 |
| 905 | Ga0501074_0001477 | 3300049590 | Bacteria | 15806 |
| 906 | Ga0501074_0002458 | 3300049590 | Bacteria | 12912 |
| 907 | Ga0501074_0031618 | 3300049590 | Bacteria | 3834 |
| 908 | Ga0501074_0101822 | 3300049590 | Bacteria | 2056 |
| 909 | Ga0501074_0206933 | 3300049590 | Bacteria | 1398 |
| 910 | Ga0501075_0000724 | 3300049591 | Bacteria | 20473 |
| 911 | Ga0501075_0037992 | 3300049591 | Bacteria | 3599 |
| 912 | Ga0501075_0058006 | 3300049591 | Bacteria | 2915 |
| 913 | Ga0501076_0025421 | 3300049592 | Bacteria | 4582 |
| 914 | Ga0501076_0108973 | 3300049592 | Bacteria | 2237 |
| 915 | Ga0501076_0508250 | 3300049592 | Bacteria | 993 |
| 916 | Ga0501076_0662686 | 3300049592 | Bacteria | 861 |
| 917 | Ga0501077_0002509 | 3300049593 | Bacteria | 10986 |
| 918 | Ga0501077_0004705 | 3300049593 | Bacteria | 8295 |
| 919 | Ga0501077_0044847 | 3300049593 | Bacteria | 2808 |
| 920 | Ga0501202_016474 | 3300049652 | Bacteria | 1435 |
| 921 | Ga0501208_079349 | 3300049655 | Bacteria | 673 |
| 922 | Ga0501217_117222 | 3300049661 | Bacteria | 770 |
| 923 | Ga0501223_028024 | 3300049663 | Bacteria | 1096 |
| 924 | Ga0501227_094889 | 3300049665 | Bacteria | 789 |
| 925 | Ga0501235_020743 | 3300049669 | Bacteria | 1459 |
| 926 | Ga0501240_021439 | 3300049673 | Bacteria | 976 |
| 927 | Ga0501243_029352 | 3300049675 | Bacteria | 934 |
| 928 | Ga0501247_015130 | 3300049677 | Bacteria | 961 |
| 929 | Ga0501249_006889 | 3300049679 | Bacteria | 2343 |
| 930 | Ga0501250_012425 | 3300049680 | Bacteria | 1007 |
| 931 | Ga0501257_014898 | 3300049686 | Bacteria | 1793 |
| 932 | Ga0501221_048864 | 3300049704 | Bacteria | 947 |
| 933 | Ga0501225_0010653 | 3300049705 | Bacteria | 2602 |
| 934 | Ga0501079_0000167 | 3300049741 | Bacteria | 36490 |
| 935 | Ga0501079_0000304 | 3300049741 | Bacteria | 30512 |
| 936 | Ga0501079_0000923 | 3300049741 | Bacteria | 20166 |
| 937 | Ga0501079_0014643 | 3300049741 | Bacteria | 5981 |
| 938 | Ga0501079_0575125 | 3300049741 | Bacteria | 886 |
| 939 | Ga0501080_0004524 | 3300049742 | Bacteria | 12393 |
| 940 | Ga0501080_0009716 | 3300049742 | Bacteria | 8786 |
| 941 | Ga0501080_0157934 | 3300049742 | Bacteria | 2095 |
| 942 | Ga0501080_0273341 | 3300049742 | Bacteria | 1537 |
| 943 | Ga0501080_0301843 | 3300049742 | Bacteria | 1452 |
| 944 | Ga0501081_0006215 | 3300049743 | Bacteria | 7740 |
| 945 | Ga0501081_0178347 | 3300049743 | Bacteria | 1536 |
| 946 | Ga0501083_0001196 | 3300049744 | Bacteria | 17535 |
| 947 | Ga0501083_0003486 | 3300049744 | Bacteria | 11005 |
| 948 | Ga0501083_0005690 | 3300049744 | Bacteria | 8822 |
| 949 | Ga0501083_0012209 | 3300049744 | Bacteria | 6012 |
| 950 | Ga0501083_0014052 | 3300049744 | Bacteria | 5597 |
| 951 | Ga0501083_0035604 | 3300049744 | Bacteria | 3399 |
| 952 | Ga0501083_0062049 | 3300049744 | Bacteria | 2495 |
| 953 | Ga0501083_0327039 | 3300049744 | Bacteria | 997 |
| 954 | Ga0501263_010800 | 3300049760 | Bacteria | 1126 |
| 955 | Ga0501279_028159 | 3300049775 | Bacteria | 825 |
| 956 | Ga0501035_0085866 | 3300049822 | Bacteria | 2773 |
| 957 | Ga0501045_0002211 | 3300049824 | Bacteria | 13196 |
| 958 | Ga0501045_0250658 | 3300049824 | Bacteria | 1318 |
| 959 | Ga0501045_0493330 | 3300049824 | Bacteria | 909 |
| 960 | nmdc:mga0k408_125463_c1 | 3300050493 | Bacteria | 1522 |
| 961 | nmdc:mga0k408_186480_c1 | 3300050493 | Bacteria | 1237 |
| 962 | nmdc:mga05p37_1079265_c1 | 3300050507 | Bacteria | 843 |
| 963 | nmdc:mga05p37_116972_c1 | 3300050507 | Bacteria | 3276 |
| 964 | nmdc:mga05p37_1364638_c1 | 3300050507 | Bacteria | 717 |
| 965 | nmdc:mga05p37_14807_c1 | 3300050507 | Bacteria | 9365 |
| 966 | nmdc:mga05p37_187641_c1 | 3300050507 | Bacteria | 2513 |
| 967 | nmdc:mga05p37_223906_c1 | 3300050507 | Bacteria | 2269 |
| 968 | nmdc:mga05p37_327047_c1 | 3300050507 | Bacteria | 1812 |
| 969 | nmdc:mga05p37_592770_c1 | 3300050507 | Bacteria | 1252 |
| 970 | nmdc:mga05p37_9153_c1 | 3300050507 | Bacteria | 11707 |
| 971 | nmdc:mga09592_133433_c1 | 3300050508 | Bacteria | 2138 |
| 972 | nmdc:mga0qj67_836651_c1 | 3300050509 | Bacteria | 727 |
| 973 | nmdc:mga06r32_1032541_c1 | 3300050510 | Bacteria | 773 |
| 974 | nmdc:mga06r32_3042_c1 | 3300050510 | Bacteria | 15014 |
| 975 | nmdc:mga08y16_114999_c1 | 3300050511 | Bacteria | 2801 |
| 976 | nmdc:mga08y16_171500_c1 | 3300050511 | Bacteria | 2253 |
| 977 | nmdc:mga08y16_26576_c1 | 3300050511 | Bacteria | 6101 |
| 978 | nmdc:mga08y16_408695_c1 | 3300050511 | Bacteria | 1388 |
| 979 | nmdc:mga08y16_7505_c1 | 3300050511 | Bacteria | 11420 |
| 980 | nmdc:mga08y16_963792_c1 | 3300050511 | Bacteria | 835 |
| 981 | nmdc:mga08y16_974359_c1 | 3300050511 | Bacteria | 829 |
| 982 | nmdc:mga0n895_12489_c1 | 3300050512 | Bacteria | 7622 |
| 983 | nmdc:mga0n895_149411_c1 | 3300050512 | Bacteria | 2366 |
| 984 | nmdc:mga0n895_17952_c1 | 3300050512 | Bacteria | 6539 |
| 985 | nmdc:mga0n895_389045_c1 | 3300050512 | Bacteria | 1411 |
| 986 | nmdc:mga0n895_396895_c1 | 3300050512 | Bacteria | 1395 |
| 987 | nmdc:mga0n895_548781_c1 | 3300050512 | Bacteria | 1162 |
| 988 | nmdc:mga0rr50_30246_c1 | 3300050513 | Bacteria | 3832 |
| 989 | nmdc:mga0rr50_94434_c1 | 3300050513 | Bacteria | 2336 |
| 990 | nmdc:mga08x19_38466_c1 | 3300050514 | Bacteria | 3040 |
| 991 | nmdc:mga08x19_80335_c1 | 3300050514 | Bacteria | 2140 |
| 992 | nmdc:mga0a205_13556_c2 | 3300050515 | Bacteria | 6192 |
| 993 | nmdc:mga0a205_20046_c1 | 3300050515 | Bacteria | 6309 |
| 994 | nmdc:mga0a205_2044_c1 | 3300050515 | Bacteria | 17626 |
| 995 | nmdc:mga0a205_38031_c1 | 3300050515 | Bacteria | 4628 |
| 996 | nmdc:mga0a205_71511_c2 | 3300050515 | Bacteria | 1991 |
| 997 | Ga0500635_0033936 | 3300053080 | Bacteria | 1668 |
| 998 | Ga0495595_0343583 | 3300053084 | Bacteria | 753 |
| 999 | Ga0500644_0004509 | 3300053088 | Bacteria | 3489 |
| 1000 | Ga0500650_0135385 | 3300053098 | Bacteria | 1144 |
| 1001 | Ga0501084_0000006 | 3300054114 | Bacteria | 234041 |
| 1002 | Ga0501084_0001672 | 3300054114 | Bacteria | 17630 |
| 1003 | Ga0501084_0010675 | 3300054114 | Bacteria | 7602 |
| 1004 | Ga0501084_0060806 | 3300054114 | Bacteria | 3162 |
| 1005 | Ga0501084_0176906 | 3300054114 | Bacteria | 1801 |
| 1006 | Ga0587077_104851 | 3300059493 | Bacteria | 684 |
| 1007 | Ga0587085_012672 | 3300059506 | Bacteria | 1161 |
| 1008 | Ga0587106_027990 | 3300059605 | Bacteria | 886 |
| 1009 | Ga0587101_006064 | 3300059623 | Bacteria | 1369 |
| 1010 | Ga0587109_015968 | 3300059624 | Bacteria | 1282 |
| 1011 | Ga0587109_020404 | 3300059624 | Bacteria | 1176 |
| 1012 | Ga0587062_006709 | 3300059639 | Bacteria | 1318 |
| 1013 | Ga0587062_059339 | 3300059639 | Bacteria | 667 |
| 1014 | Ga0501082_0000081 | 3300060353 | Bacteria | 71114 |
| 1015 | Ga0501082_0000280 | 3300060353 | Bacteria | 45085 |
| 1016 | Ga0501082_0002810 | 3300060353 | Bacteria | 15194 |
| 1017 | Ga0501082_0002975 | 3300060353 | Bacteria | 14800 |
| 1018 | Ga0501082_0011756 | 3300060353 | Bacteria | 7524 |
| 1019 | Ga0501082_0050770 | 3300060353 | Bacteria | 3577 |
| 1020 | Ga0501082_0184224 | 3300060353 | Bacteria | 1816 |
| 1021 | Ga0501082_0265142 | 3300060353 | Bacteria | 1495 |
| 1022 | Ga0501082_0345772 | 3300060353 | Bacteria | 1296 |
| 1023 | Ga0530510_0045451 | 3300061734 | Bacteria | 3173 |
| 1024 | Ga0530510_0134930 | 3300061734 | Bacteria | 1817 |
| 1025 | Ga0530510_0233163 | 3300061734 | Bacteria | 1369 |
| 1026 | Ga0530510_0551147 | 3300061734 | Bacteria | 876 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035241 | Ga0373961_0184894 | Ga0373961_0184894_179_679 | 166 |
| 2 | 3300042993 | Ga0439440_0157996 | Ga0439440_0157996_116_616 | 166 |
| 3 | 3300048915 | Ga0496112_0977681 | Ga0496112_0977681_35_535 | 166 |
| 4 | 3300048916 | Ga0496113_0819229 | Ga0496113_0819229_171_671 | 166 |
| 5 | 3300049661 | Ga0501217_117222 | Ga0501217_117222_33_533 | 166 |
| 6 | 3300031727 | Ga0316576_10232406 | Ga0316576_102324062 | 173 |
| 7 | 3300042876 | Ga0451577_0068708 | Ga0451577_0068708_2613_3143 | 173 |
| 8 | 3300050507 | nmdc:mga05p37_1364638_c1 | nmdc:mga05p37_1364638_c1_148_702 | 173 |
| 9 | 3300050515 | nmdc:mga0a205_13556_c2 | nmdc:mga0a205_13556_c2_69_590 | 173 |
| 10 | 3300006844 | Ga0075428_100052589 | Ga0075428_1000525894 | 175 |
| 11 | 3300033528 | Ga0316588_1089920 | Ga0316588_10899201 | 175 |
| 12 | 3300033541 | Ga0316596_1128160 | Ga0316596_11281601 | 175 |
| 13 | 3300050513 | nmdc:mga0rr50_94434_c1 | nmdc:mga0rr50_94434_c1_1753_2325 | 179 |
| 14 | 3300006844 | Ga0075428_100006662 | Ga0075428_1000066627 | 183 |
| 15 | 3300044712 | Ga0453684_0071348 | Ga0453684_0071348_3785_4372 | 187 |
| 16 | iso_pu_bacteria | 2524614857 | 2526062343 | 189 |
| 17 | iso_pu_bacteria | 2739367875 | 2740063690 | 189 |
| 18 | iso_pu_bacteria | 2524614857 | 2526061933 | 190 |
| 19 | 3300005719 | Ga0068861_101240086 | Ga0068861_1012400861 | 191 |
| 20 | 3300005290 | Ga0065712_10125065 | Ga0065712_101250651 | 192 |
| 21 | 3300005336 | Ga0070680_100026974 | Ga0070680_1000269745 | 192 |
| 22 | 3300005340 | Ga0070689_100726877 | Ga0070689_1007268771 | 192 |
| 23 | 3300005536 | Ga0070697_100059755 | Ga0070697_1000597552 | 192 |
| 24 | 3300005536 | Ga0070697_100143944 | Ga0070697_1001439442 | 192 |
| 25 | 3300013296 | Ga0157374_10505737 | Ga0157374_105057372 | 192 |
| 26 | 3300026075 | Ga0207708_10203007 | Ga0207708_102030072 | 192 |
| 27 | 3300031235 | Ga0265330_10077872 | Ga0265330_100778722 | 192 |
| 28 | 3300036647 | Ga0316582_0105272 | Ga0316582_0105272_1180_1758 | 192 |
| 29 | 3300046523 | Ga0495644_0076239 | Ga0495644_0076239_50_628 | 192 |
| 30 | 3300046537 | Ga0495598_0038431 | Ga0495598_0038431_315_893 | 192 |
| 31 | 3300046665 | Ga0495661_0369374 | Ga0495661_0369374_80_658 | 192 |
| 32 | 3300009176 | Ga0105242_10741139 | Ga0105242_107411392 | 193 |
| 33 | 3300032133 | Ga0316583_10104212 | Ga0316583_101042122 | 193 |
| 34 | 3300042438 | Ga0439459_0003940 | Ga0439459_0003940_687_1280 | 193 |
| 35 | 3300049571 | Ga0501034_1067182 | Ga0501034_1067182_71_658 | 193 |
| 36 | 3300000532 | CNAas_1000053 | CNAas_10000533 | 194 |
| 37 | 3300001990 | JGI24737J22298_10042841 | JGI24737J22298_100428413 | 194 |
| 38 | 3300002459 | JGI24751J29686_10000040 | JGI24751J29686_1000004055 | 194 |
| 39 | 3300003347 | JGI26128J50194_1000536 | JGI26128J50194_10005362 | 194 |
| 40 | 3300003371 | JGI26145J50221_1007769 | JGI26145J50221_10077692 | 194 |
| 41 | 3300003504 | JGI26138J51218_101769 | JGI26138J51218_1017692 | 194 |
| 42 | 3300003911 | JGI25405J52794_10006415 | JGI25405J52794_100064152 | 194 |
| 43 | 3300004798 | Ga0058859_11802859 | Ga0058859_118028592 | 194 |
| 44 | 3300004803 | Ga0058862_11798388 | Ga0058862_117983882 | 194 |
| 45 | 3300005288 | Ga0065714_10236356 | Ga0065714_102363561 | 194 |
| 46 | 3300005289 | Ga0065704_10070138 | Ga0065704_1007013812 | 194 |
| 47 | 3300005289 | Ga0065704_10253889 | Ga0065704_102538892 | 194 |
| 48 | 3300005290 | Ga0065712_10022016 | Ga0065712_100220161 | 194 |
| 49 | 3300005290 | Ga0065712_10116807 | Ga0065712_101168073 | 194 |
| 50 | 3300005293 | Ga0065715_10013657 | Ga0065715_100136572 | 194 |
| 51 | 3300005293 | Ga0065715_10053092 | Ga0065715_100530922 | 194 |
| 52 | 3300005295 | Ga0065707_10018862 | Ga0065707_100188622 | 194 |
| 53 | 3300005295 | Ga0065707_10033643 | Ga0065707_100336432 | 194 |
| 54 | 3300005295 | Ga0065707_10188570 | Ga0065707_101885702 | 194 |
| 55 | 3300005295 | Ga0065707_10318035 | Ga0065707_103180352 | 194 |
| 56 | 3300005295 | Ga0065707_10395974 | Ga0065707_103959741 | 194 |
| 57 | 3300005295 | Ga0065707_10459045 | Ga0065707_104590452 | 194 |
| 58 | 3300005327 | Ga0070658_10003921 | Ga0070658_100039217 | 194 |
| 59 | 3300005327 | Ga0070658_10028262 | Ga0070658_100282622 | 194 |
| 60 | 3300005327 | Ga0070658_10049378 | Ga0070658_100493785 | 194 |
| 61 | 3300005327 | Ga0070658_10231757 | Ga0070658_102317572 | 194 |
| 62 | 3300005328 | Ga0070676_10000776 | Ga0070676_100007766 | 194 |
| 63 | 3300005328 | Ga0070676_10017341 | Ga0070676_100173413 | 194 |
| 64 | 3300005329 | Ga0070683_100432047 | Ga0070683_1004320472 | 194 |
| 65 | 3300005330 | Ga0070690_100078482 | Ga0070690_1000784824 | 194 |
| 66 | 3300005330 | Ga0070690_100122144 | Ga0070690_1001221443 | 194 |
| 67 | 3300005330 | Ga0070690_100424206 | Ga0070690_1004242061 | 194 |
| 68 | 3300005331 | Ga0070670_100000676 | Ga0070670_10000067613 | 194 |
| 69 | 3300005331 | Ga0070670_100004672 | Ga0070670_1000046722 | 194 |
| 70 | 3300005331 | Ga0070670_101189389 | Ga0070670_1011893891 | 194 |
| 71 | 3300005333 | Ga0070677_10098142 | Ga0070677_100981422 | 194 |
| 72 | 3300005334 | Ga0068869_100001260 | Ga0068869_1000012604 | 194 |
| 73 | 3300005334 | Ga0068869_100003281 | Ga0068869_1000032812 | 194 |
| 74 | 3300005334 | Ga0068869_100010655 | Ga0068869_1000106556 | 194 |
| 75 | 3300005334 | Ga0068869_100108807 | Ga0068869_1001088073 | 194 |
| 76 | 3300005334 | Ga0068869_100296890 | Ga0068869_1002968902 | 194 |
| 77 | 3300005334 | Ga0068869_100401364 | Ga0068869_1004013642 | 194 |
| 78 | 3300005334 | Ga0068869_100693547 | Ga0068869_1006935472 | 194 |
| 79 | 3300005335 | Ga0070666_10008628 | Ga0070666_100086284 | 194 |
| 80 | 3300005335 | Ga0070666_10084913 | Ga0070666_100849133 | 194 |
| 81 | 3300005336 | Ga0070680_100000528 | Ga0070680_1000005281 | 194 |
| 82 | 3300005336 | Ga0070680_100247255 | Ga0070680_1002472552 | 194 |
| 83 | 3300005336 | Ga0070680_100529036 | Ga0070680_1005290361 | 194 |
| 84 | 3300005337 | Ga0070682_100002753 | Ga0070682_1000027531 | 194 |
| 85 | 3300005337 | Ga0070682_100050043 | Ga0070682_1000500433 | 194 |
| 86 | 3300005337 | Ga0070682_100074909 | Ga0070682_1000749092 | 194 |
| 87 | 3300005337 | Ga0070682_100358479 | Ga0070682_1003584792 | 194 |
| 88 | 3300005338 | Ga0068868_100043453 | Ga0068868_1000434532 | 194 |
| 89 | 3300005338 | Ga0068868_100349035 | Ga0068868_1003490352 | 194 |
| 90 | 3300005338 | Ga0068868_100527212 | Ga0068868_1005272122 | 194 |
| 91 | 3300005338 | Ga0068868_100643200 | Ga0068868_1006432002 | 194 |
| 92 | 3300005338 | Ga0068868_100646692 | Ga0068868_1006466922 | 194 |
| 93 | 3300005338 | Ga0068868_100849815 | Ga0068868_1008498152 | 194 |
| 94 | 3300005338 | Ga0068868_101371715 | Ga0068868_1013717151 | 194 |
| 95 | 3300005339 | Ga0070660_100000426 | Ga0070660_10000042611 | 194 |
| 96 | 3300005340 | Ga0070689_100000006 | Ga0070689_10000000632 | 194 |
| 97 | 3300005340 | Ga0070689_100006524 | Ga0070689_1000065245 | 194 |
| 98 | 3300005340 | Ga0070689_100053411 | Ga0070689_1000534116 | 194 |
| 99 | 3300005341 | Ga0070691_10032656 | Ga0070691_100326562 | 194 |
| 100 | 3300005341 | Ga0070691_10118880 | Ga0070691_101188802 | 194 |
| 101 | 3300005343 | Ga0070687_100043723 | Ga0070687_1000437232 | 194 |
| 102 | 3300005344 | Ga0070661_100003135 | Ga0070661_1000031355 | 194 |
| 103 | 3300005345 | Ga0070692_10244994 | Ga0070692_102449941 | 194 |
| 104 | 3300005347 | Ga0070668_100105404 | Ga0070668_1001054042 | 194 |
| 105 | 3300005353 | Ga0070669_100000101 | Ga0070669_10000010132 | 194 |
| 106 | 3300005353 | Ga0070669_100064427 | Ga0070669_1000644273 | 194 |
| 107 | 3300005353 | Ga0070669_100174558 | Ga0070669_1001745582 | 194 |
| 108 | 3300005354 | Ga0070675_100168526 | Ga0070675_1001685264 | 194 |
| 109 | 3300005354 | Ga0070675_100246739 | Ga0070675_1002467392 | 194 |
| 110 | 3300005354 | Ga0070675_100339621 | Ga0070675_1003396212 | 194 |
| 111 | 3300005355 | Ga0070671_100000754 | Ga0070671_10000075410 | 194 |
| 112 | 3300005355 | Ga0070671_100011000 | Ga0070671_1000110006 | 194 |
| 113 | 3300005355 | Ga0070671_100190950 | Ga0070671_1001909501 | 194 |
| 114 | 3300005355 | Ga0070671_100216405 | Ga0070671_1002164053 | 194 |
| 115 | 3300005355 | Ga0070671_100280035 | Ga0070671_1002800352 | 194 |
| 116 | 3300005364 | Ga0070673_100172544 | Ga0070673_1001725442 | 194 |
| 117 | 3300005364 | Ga0070673_100179567 | Ga0070673_1001795673 | 194 |
| 118 | 3300005365 | Ga0070688_100169213 | Ga0070688_1001692131 | 194 |
| 119 | 3300005365 | Ga0070688_100175465 | Ga0070688_1001754652 | 194 |
| 120 | 3300005365 | Ga0070688_100304993 | Ga0070688_1003049932 | 194 |
| 121 | 3300005366 | Ga0070659_100001410 | Ga0070659_1000014109 | 194 |
| 122 | 3300005366 | Ga0070659_100267117 | Ga0070659_1002671172 | 194 |
| 123 | 3300005366 | Ga0070659_100376844 | Ga0070659_1003768443 | 194 |
| 124 | 3300005367 | Ga0070667_100045969 | Ga0070667_1000459693 | 194 |
| 125 | 3300005367 | Ga0070667_100863394 | Ga0070667_1008633941 | 194 |
| 126 | 3300005406 | Ga0070703_10015428 | Ga0070703_100154283 | 194 |
| 127 | 3300005434 | Ga0070709_10000069 | Ga0070709_1000006961 | 194 |
| 128 | 3300005436 | Ga0070713_100426348 | Ga0070713_1004263482 | 194 |
| 129 | 3300005437 | Ga0070710_10007735 | Ga0070710_100077354 | 194 |
| 130 | 3300005438 | Ga0070701_10004224 | Ga0070701_100042244 | 194 |
| 131 | 3300005439 | Ga0070711_100043027 | Ga0070711_1000430272 | 194 |
| 132 | 3300005440 | Ga0070705_100054346 | Ga0070705_1000543462 | 194 |
| 133 | 3300005440 | Ga0070705_100346418 | Ga0070705_1003464182 | 194 |
| 134 | 3300005441 | Ga0070700_100122581 | Ga0070700_1001225812 | 194 |
| 135 | 3300005441 | Ga0070700_100131739 | Ga0070700_1001317393 | 194 |
| 136 | 3300005441 | Ga0070700_100136942 | Ga0070700_1001369423 | 194 |
| 137 | 3300005441 | Ga0070700_100235160 | Ga0070700_1002351603 | 194 |
| 138 | 3300005444 | Ga0070694_100010732 | Ga0070694_1000107326 | 194 |
| 139 | 3300005444 | Ga0070694_100012515 | Ga0070694_1000125152 | 194 |
| 140 | 3300005444 | Ga0070694_100093735 | Ga0070694_1000937352 | 194 |
| 141 | 3300005445 | Ga0070708_100000621 | Ga0070708_1000006217 | 194 |
| 142 | 3300005445 | Ga0070708_100065834 | Ga0070708_1000658343 | 194 |
| 143 | 3300005445 | Ga0070708_100131352 | Ga0070708_1001313522 | 194 |
| 144 | 3300005445 | Ga0070708_100603563 | Ga0070708_1006035632 | 194 |
| 145 | 3300005455 | Ga0070663_100012081 | Ga0070663_1000120816 | 194 |
| 146 | 3300005456 | Ga0070678_100050349 | Ga0070678_1000503491 | 194 |
| 147 | 3300005457 | Ga0070662_100266469 | Ga0070662_1002664692 | 194 |
| 148 | 3300005457 | Ga0070662_100616214 | Ga0070662_1006162141 | 194 |
| 149 | 3300005458 | Ga0070681_10007431 | Ga0070681_100074315 | 194 |
| 150 | 3300005459 | Ga0068867_100011967 | Ga0068867_1000119676 | 194 |
| 151 | 3300005459 | Ga0068867_100014424 | Ga0068867_1000144246 | 194 |
| 152 | 3300005459 | Ga0068867_100042244 | Ga0068867_1000422441 | 194 |
| 153 | 3300005459 | Ga0068867_100080215 | Ga0068867_1000802152 | 194 |
| 154 | 3300005459 | Ga0068867_100083186 | Ga0068867_1000831862 | 194 |
| 155 | 3300005459 | Ga0068867_101178989 | Ga0068867_1011789891 | 194 |
| 156 | 3300005459 | Ga0068867_101230599 | Ga0068867_1012305991 | 194 |
| 157 | 3300005466 | Ga0070685_10009467 | Ga0070685_100094673 | 194 |
| 158 | 3300005466 | Ga0070685_10223236 | Ga0070685_102232362 | 194 |
| 159 | 3300005467 | Ga0070706_100008802 | Ga0070706_1000088026 | 194 |
| 160 | 3300005467 | Ga0070706_100017482 | Ga0070706_1000174823 | 194 |
| 161 | 3300005467 | Ga0070706_100159195 | Ga0070706_1001591952 | 194 |
| 162 | 3300005467 | Ga0070706_100467393 | Ga0070706_1004673932 | 194 |
| 163 | 3300005468 | Ga0070707_100001880 | Ga0070707_10000188020 | 194 |
| 164 | 3300005468 | Ga0070707_100003551 | Ga0070707_1000035516 | 194 |
| 165 | 3300005468 | Ga0070707_100014668 | Ga0070707_1000146687 | 194 |
| 166 | 3300005468 | Ga0070707_100027446 | Ga0070707_1000274463 | 194 |
| 167 | 3300005471 | Ga0070698_100002838 | Ga0070698_10000283813 | 194 |
| 168 | 3300005471 | Ga0070698_100006715 | Ga0070698_1000067152 | 194 |
| 169 | 3300005471 | Ga0070698_100019650 | Ga0070698_1000196508 | 194 |
| 170 | 3300005518 | Ga0070699_100001882 | Ga0070699_10000188218 | 194 |
| 171 | 3300005518 | Ga0070699_100153937 | Ga0070699_1001539373 | 194 |
| 172 | 3300005518 | Ga0070699_100235698 | Ga0070699_1002356983 | 194 |
| 173 | 3300005518 | Ga0070699_100318279 | Ga0070699_1003182792 | 194 |
| 174 | 3300005530 | Ga0070679_100006685 | Ga0070679_1000066856 | 194 |
| 175 | 3300005530 | Ga0070679_100056145 | Ga0070679_1000561455 | 194 |
| 176 | 3300005530 | Ga0070679_100707717 | Ga0070679_1007077172 | 194 |
| 177 | 3300005535 | Ga0070684_100009490 | Ga0070684_1000094906 | 194 |
| 178 | 3300005535 | Ga0070684_100457829 | Ga0070684_1004578292 | 194 |
| 179 | 3300005536 | Ga0070697_100001301 | Ga0070697_1000013015 | 194 |
| 180 | 3300005536 | Ga0070697_100005940 | Ga0070697_1000059407 | 194 |
| 181 | 3300005536 | Ga0070697_100079164 | Ga0070697_1000791643 | 194 |
| 182 | 3300005536 | Ga0070697_100646549 | Ga0070697_1006465492 | 194 |
| 183 | 3300005539 | Ga0068853_100001027 | Ga0068853_10000102710 | 194 |
| 184 | 3300005539 | Ga0068853_100007929 | Ga0068853_1000079296 | 194 |
| 185 | 3300005543 | Ga0070672_100369788 | Ga0070672_1003697882 | 194 |
| 186 | 3300005544 | Ga0070686_100250168 | Ga0070686_1002501682 | 194 |
| 187 | 3300005544 | Ga0070686_100613463 | Ga0070686_1006134631 | 194 |
| 188 | 3300005544 | Ga0070686_100665735 | Ga0070686_1006657351 | 194 |
| 189 | 3300005545 | Ga0070695_100000929 | Ga0070695_1000009297 | 194 |
| 190 | 3300005545 | Ga0070695_100001843 | Ga0070695_1000018432 | 194 |
| 191 | 3300005545 | Ga0070695_100002584 | Ga0070695_1000025846 | 194 |
| 192 | 3300005545 | Ga0070695_100181513 | Ga0070695_1001815132 | 194 |
| 193 | 3300005545 | Ga0070695_100199301 | Ga0070695_1001993012 | 194 |
| 194 | 3300005545 | Ga0070695_100212983 | Ga0070695_1002129832 | 194 |
| 195 | 3300005545 | Ga0070695_101036855 | Ga0070695_1010368551 | 194 |
| 196 | 3300005546 | Ga0070696_100004929 | Ga0070696_1000049298 | 194 |
| 197 | 3300005546 | Ga0070696_100089371 | Ga0070696_1000893712 | 194 |
| 198 | 3300005546 | Ga0070696_100266438 | Ga0070696_1002664382 | 194 |
| 199 | 3300005547 | Ga0070693_100000146 | Ga0070693_10000014611 | 194 |
| 200 | 3300005547 | Ga0070693_100026273 | Ga0070693_1000262732 | 194 |
| 201 | 3300005547 | Ga0070693_100029579 | Ga0070693_1000295792 | 194 |
| 202 | 3300005547 | Ga0070693_100195444 | Ga0070693_1001954442 | 194 |
| 203 | 3300005548 | Ga0070665_100000468 | Ga0070665_10000046812 | 194 |
| 204 | 3300005548 | Ga0070665_100477260 | Ga0070665_1004772602 | 194 |
| 205 | 3300005549 | Ga0070704_100002293 | Ga0070704_1000022931 | 194 |
| 206 | 3300005549 | Ga0070704_100309548 | Ga0070704_1003095482 | 194 |
| 207 | 3300005549 | Ga0070704_100325789 | Ga0070704_1003257891 | 194 |
| 208 | 3300005549 | Ga0070704_100668278 | Ga0070704_1006682782 | 194 |
| 209 | 3300005549 | Ga0070704_101064703 | Ga0070704_1010647031 | 194 |
| 210 | 3300005563 | Ga0068855_100000008 | Ga0068855_10000000872 | 194 |
| 211 | 3300005563 | Ga0068855_100004311 | Ga0068855_1000043115 | 194 |
| 212 | 3300005563 | Ga0068855_100088555 | Ga0068855_1000885553 | 194 |
| 213 | 3300005563 | Ga0068855_100105844 | Ga0068855_1001058443 | 194 |
| 214 | 3300005563 | Ga0068855_100614019 | Ga0068855_1006140192 | 194 |
| 215 | 3300005564 | Ga0070664_100038167 | Ga0070664_1000381675 | 194 |
| 216 | 3300005564 | Ga0070664_100113499 | Ga0070664_1001134994 | 194 |
| 217 | 3300005577 | Ga0068857_100042188 | Ga0068857_1000421885 | 194 |
| 218 | 3300005577 | Ga0068857_100346116 | Ga0068857_1003461162 | 194 |
| 219 | 3300005577 | Ga0068857_100792529 | Ga0068857_1007925291 | 194 |
| 220 | 3300005578 | Ga0068854_100023122 | Ga0068854_1000231222 | 194 |
| 221 | 3300005578 | Ga0068854_100396325 | Ga0068854_1003963251 | 194 |
| 222 | 3300005614 | Ga0068856_100003684 | Ga0068856_10000368412 | 194 |
| 223 | 3300005614 | Ga0068856_100051817 | Ga0068856_1000518171 | 194 |
| 224 | 3300005614 | Ga0068856_100079170 | Ga0068856_1000791703 | 194 |
| 225 | 3300005614 | Ga0068856_100153581 | Ga0068856_1001535811 | 194 |
| 226 | 3300005614 | Ga0068856_100838497 | Ga0068856_1008384972 | 194 |
| 227 | 3300005615 | Ga0070702_100109728 | Ga0070702_1001097282 | 194 |
| 228 | 3300005615 | Ga0070702_100127848 | Ga0070702_1001278482 | 194 |
| 229 | 3300005616 | Ga0068852_100097267 | Ga0068852_1000972673 | 194 |
| 230 | 3300005616 | Ga0068852_100440316 | Ga0068852_1004403161 | 194 |
| 231 | 3300005616 | Ga0068852_100579372 | Ga0068852_1005793722 | 194 |
| 232 | 3300005617 | Ga0068859_100002098 | Ga0068859_1000020985 | 194 |
| 233 | 3300005617 | Ga0068859_100006613 | Ga0068859_1000066136 | 194 |
| 234 | 3300005617 | Ga0068859_100060025 | Ga0068859_1000600251 | 194 |
| 235 | 3300005617 | Ga0068859_100063320 | Ga0068859_1000633205 | 194 |
| 236 | 3300005617 | Ga0068859_100089358 | Ga0068859_1000893584 | 194 |
| 237 | 3300005617 | Ga0068859_100114628 | Ga0068859_1001146282 | 194 |
| 238 | 3300005617 | Ga0068859_100266656 | Ga0068859_1002666563 | 194 |
| 239 | 3300005617 | Ga0068859_100316163 | Ga0068859_1003161632 | 194 |
| 240 | 3300005617 | Ga0068859_100447648 | Ga0068859_1004476482 | 194 |
| 241 | 3300005617 | Ga0068859_100498827 | Ga0068859_1004988272 | 194 |
| 242 | 3300005618 | Ga0068864_100027908 | Ga0068864_1000279083 | 194 |
| 243 | 3300005618 | Ga0068864_100064732 | Ga0068864_1000647324 | 194 |
| 244 | 3300005718 | Ga0068866_10279337 | Ga0068866_102793372 | 194 |
| 245 | 3300005719 | Ga0068861_100005474 | Ga0068861_1000054748 | 194 |
| 246 | 3300005719 | Ga0068861_100006238 | Ga0068861_1000062383 | 194 |
| 247 | 3300005719 | Ga0068861_100028482 | Ga0068861_1000284826 | 194 |
| 248 | 3300005719 | Ga0068861_100069556 | Ga0068861_1000695562 | 194 |
| 249 | 3300005840 | Ga0068870_10001679 | Ga0068870_100016796 | 194 |
| 250 | 3300005840 | Ga0068870_10138939 | Ga0068870_101389392 | 194 |
| 251 | 3300005841 | Ga0068863_100103772 | Ga0068863_1001037723 | 194 |
| 252 | 3300005841 | Ga0068863_100915485 | Ga0068863_1009154852 | 194 |
| 253 | 3300005842 | Ga0068858_100028938 | Ga0068858_1000289382 | 194 |
| 254 | 3300005842 | Ga0068858_100034519 | Ga0068858_1000345193 | 194 |
| 255 | 3300005842 | Ga0068858_100034572 | Ga0068858_1000345722 | 194 |
| 256 | 3300005842 | Ga0068858_100242639 | Ga0068858_1002426393 | 194 |
| 257 | 3300005842 | Ga0068858_100981203 | Ga0068858_1009812032 | 194 |
| 258 | 3300005843 | Ga0068860_100000731 | Ga0068860_10000073120 | 194 |
| 259 | 3300005843 | Ga0068860_100023127 | Ga0068860_1000231275 | 194 |
| 260 | 3300005843 | Ga0068860_100053835 | Ga0068860_1000538352 | 194 |
| 261 | 3300005843 | Ga0068860_100069494 | Ga0068860_1000694942 | 194 |
| 262 | 3300005843 | Ga0068860_100126643 | Ga0068860_1001266434 | 194 |
| 263 | 3300005843 | Ga0068860_100147832 | Ga0068860_1001478324 | 194 |
| 264 | 3300005843 | Ga0068860_100183978 | Ga0068860_1001839783 | 194 |
| 265 | 3300005843 | Ga0068860_100247134 | Ga0068860_1002471342 | 194 |
| 266 | 3300005843 | Ga0068860_100283547 | Ga0068860_1002835472 | 194 |
| 267 | 3300005843 | Ga0068860_100468415 | Ga0068860_1004684152 | 194 |
| 268 | 3300005843 | Ga0068860_100493520 | Ga0068860_1004935202 | 194 |
| 269 | 3300005843 | Ga0068860_100901671 | Ga0068860_1009016712 | 194 |
| 270 | 3300005844 | Ga0068862_100002423 | Ga0068862_10000242318 | 194 |
| 271 | 3300005844 | Ga0068862_100018123 | Ga0068862_1000181232 | 194 |
| 272 | 3300005844 | Ga0068862_100058160 | Ga0068862_1000581603 | 194 |
| 273 | 3300005844 | Ga0068862_100085623 | Ga0068862_1000856233 | 194 |
| 274 | 3300005937 | Ga0081455_10001014 | Ga0081455_1000101430 | 194 |
| 275 | 3300005937 | Ga0081455_10037749 | Ga0081455_100377492 | 194 |
| 276 | 3300005985 | Ga0081539_10011597 | Ga0081539_100115974 | 194 |
| 277 | 3300006048 | Ga0075363_100302046 | Ga0075363_1003020461 | 194 |
| 278 | 3300006173 | Ga0070716_100001417 | Ga0070716_1000014172 | 194 |
| 279 | 3300006195 | Ga0075366_10129618 | Ga0075366_101296184 | 194 |
| 280 | 3300006237 | Ga0097621_100112150 | Ga0097621_1001121501 | 194 |
| 281 | 3300006237 | Ga0097621_100401702 | Ga0097621_1004017022 | 194 |
| 282 | 3300006358 | Ga0068871_100123063 | Ga0068871_1001230633 | 194 |
| 283 | 3300006358 | Ga0068871_100145538 | Ga0068871_1001455383 | 194 |
| 284 | 3300006844 | Ga0075428_100200965 | Ga0075428_1002009654 | 194 |
| 285 | 3300006846 | Ga0075430_100195039 | Ga0075430_1001950393 | 194 |
| 286 | 3300006847 | Ga0075431_100022715 | Ga0075431_1000227153 | 194 |
| 287 | 3300006852 | Ga0075433_10000359 | Ga0075433_1000035921 | 194 |
| 288 | 3300006852 | Ga0075433_10077553 | Ga0075433_100775535 | 194 |
| 289 | 3300006871 | Ga0075434_100005805 | Ga0075434_1000058055 | 194 |
| 290 | 3300006871 | Ga0075434_100033813 | Ga0075434_1000338131 | 194 |
| 291 | 3300006871 | Ga0075434_100066243 | Ga0075434_1000662432 | 194 |
| 292 | 3300006871 | Ga0075434_100101803 | Ga0075434_1001018033 | 194 |
| 293 | 3300006871 | Ga0075434_100139278 | Ga0075434_1001392782 | 194 |
| 294 | 3300006871 | Ga0075434_100305050 | Ga0075434_1003050502 | 194 |
| 295 | 3300006871 | Ga0075434_100414855 | Ga0075434_1004148552 | 194 |
| 296 | 3300006880 | Ga0075429_100064624 | Ga0075429_1000646243 | 194 |
| 297 | 3300006880 | Ga0075429_100213610 | Ga0075429_1002136104 | 194 |
| 298 | 3300006881 | Ga0068865_100093495 | Ga0068865_1000934952 | 194 |
| 299 | 3300006881 | Ga0068865_100257007 | Ga0068865_1002570072 | 194 |
| 300 | 3300006914 | Ga0075436_100011613 | Ga0075436_1000116133 | 194 |
| 301 | 3300006914 | Ga0075436_100076996 | Ga0075436_1000769962 | 194 |
| 302 | 3300006931 | Ga0097620_100002098 | Ga0097620_10000209813 | 194 |
| 303 | 3300006931 | Ga0097620_100006613 | Ga0097620_1000066135 | 194 |
| 304 | 3300006931 | Ga0097620_100060026 | Ga0097620_1000600261 | 194 |
| 305 | 3300006931 | Ga0097620_100063323 | Ga0097620_1000633234 | 194 |
| 306 | 3300006931 | Ga0097620_100089354 | Ga0097620_1000893544 | 194 |
| 307 | 3300006931 | Ga0097620_100114627 | Ga0097620_1001146272 | 194 |
| 308 | 3300006931 | Ga0097620_100266646 | Ga0097620_1002666462 | 194 |
| 309 | 3300006931 | Ga0097620_100316154 | Ga0097620_1003161542 | 194 |
| 310 | 3300006931 | Ga0097620_100447629 | Ga0097620_1004476292 | 194 |
| 311 | 3300006931 | Ga0097620_100498849 | Ga0097620_1004988492 | 194 |
| 312 | 3300007076 | Ga0075435_100013015 | Ga0075435_1000130153 | 194 |
| 313 | 3300007076 | Ga0075435_100051960 | Ga0075435_1000519603 | 194 |
| 314 | 3300007265 | Ga0099794_10000473 | Ga0099794_1000047316 | 194 |
| 315 | 3300007265 | Ga0099794_10439255 | Ga0099794_104392551 | 194 |
| 316 | 3300009093 | Ga0105240_10003810 | Ga0105240_1000381013 | 194 |
| 317 | 3300009094 | Ga0111539_10020642 | Ga0111539_100206429 | 194 |
| 318 | 3300009094 | Ga0111539_10022170 | Ga0111539_100221701 | 194 |
| 319 | 3300009094 | Ga0111539_10031784 | Ga0111539_100317843 | 194 |
| 320 | 3300009094 | Ga0111539_10138106 | Ga0111539_101381064 | 194 |
| 321 | 3300009094 | Ga0111539_10144756 | Ga0111539_101447562 | 194 |
| 322 | 3300009094 | Ga0111539_10180876 | Ga0111539_101808763 | 194 |
| 323 | 3300009094 | Ga0111539_10341252 | Ga0111539_103412521 | 194 |
| 324 | 3300009094 | Ga0111539_10395178 | Ga0111539_103951782 | 194 |
| 325 | 3300009094 | Ga0111539_10403280 | Ga0111539_104032802 | 194 |
| 326 | 3300009094 | Ga0111539_10897299 | Ga0111539_108972992 | 194 |
| 327 | 3300009098 | Ga0105245_10254118 | Ga0105245_102541183 | 194 |
| 328 | 3300009098 | Ga0105245_10827073 | Ga0105245_108270732 | 194 |
| 329 | 3300009101 | Ga0105247_10005229 | Ga0105247_100052297 | 194 |
| 330 | 3300009101 | Ga0105247_10009646 | Ga0105247_100096467 | 194 |
| 331 | 3300009101 | Ga0105247_10083679 | Ga0105247_100836792 | 194 |
| 332 | 3300009147 | Ga0114129_10045507 | Ga0114129_100455072 | 194 |
| 333 | 3300009147 | Ga0114129_10107418 | Ga0114129_101074184 | 194 |
| 334 | 3300009147 | Ga0114129_10141275 | Ga0114129_101412753 | 194 |
| 335 | 3300009147 | Ga0114129_10179061 | Ga0114129_101790612 | 194 |
| 336 | 3300009147 | Ga0114129_10278763 | Ga0114129_102787632 | 194 |
| 337 | 3300009148 | Ga0105243_10013772 | Ga0105243_100137723 | 194 |
| 338 | 3300009148 | Ga0105243_10107048 | Ga0105243_101070483 | 194 |
| 339 | 3300009148 | Ga0105243_10169537 | Ga0105243_101695372 | 194 |
| 340 | 3300009148 | Ga0105243_10239279 | Ga0105243_102392792 | 194 |
| 341 | 3300009174 | Ga0105241_10001244 | Ga0105241_1000124416 | 194 |
| 342 | 3300009174 | Ga0105241_10019852 | Ga0105241_100198526 | 194 |
| 343 | 3300009174 | Ga0105241_11213857 | Ga0105241_112138572 | 194 |
| 344 | 3300009174 | Ga0105241_11304685 | Ga0105241_113046851 | 194 |
| 345 | 3300009176 | Ga0105242_10058807 | Ga0105242_100588072 | 194 |
| 346 | 3300009176 | Ga0105242_10080837 | Ga0105242_100808371 | 194 |
| 347 | 3300009176 | Ga0105242_10802452 | Ga0105242_108024522 | 194 |
| 348 | 3300009176 | Ga0105242_11315218 | Ga0105242_113152182 | 194 |
| 349 | 3300009177 | Ga0105248_10034283 | Ga0105248_100342835 | 194 |
| 350 | 3300009177 | Ga0105248_10071591 | Ga0105248_100715912 | 194 |
| 351 | 3300009177 | Ga0105248_10092938 | Ga0105248_100929383 | 194 |
| 352 | 3300009177 | Ga0105248_10700745 | Ga0105248_107007452 | 194 |
| 353 | 3300009177 | Ga0105248_11245377 | Ga0105248_112453772 | 194 |
| 354 | 3300009545 | Ga0105237_10025830 | Ga0105237_100258304 | 194 |
| 355 | 3300009545 | Ga0105237_10063412 | Ga0105237_100634122 | 194 |
| 356 | 3300009545 | Ga0105237_10090891 | Ga0105237_100908911 | 194 |
| 357 | 3300009545 | Ga0105237_10436219 | Ga0105237_104362192 | 194 |
| 358 | 3300009545 | Ga0105237_11368577 | Ga0105237_113685771 | 194 |
| 359 | 3300009551 | Ga0105238_10012280 | Ga0105238_100122805 | 194 |
| 360 | 3300009551 | Ga0105238_10021367 | Ga0105238_100213673 | 194 |
| 361 | 3300009553 | Ga0105249_10016555 | Ga0105249_100165553 | 194 |
| 362 | 3300009553 | Ga0105249_10043997 | Ga0105249_100439972 | 194 |
| 363 | 3300009553 | Ga0105249_10061068 | Ga0105249_100610683 | 194 |
| 364 | 3300009553 | Ga0105249_10062638 | Ga0105249_100626384 | 194 |
| 365 | 3300009553 | Ga0105249_10148838 | Ga0105249_101488382 | 194 |
| 366 | 3300009553 | Ga0105249_10227386 | Ga0105249_102273862 | 194 |
| 367 | 3300010375 | Ga0105239_10143070 | Ga0105239_101430701 | 194 |
| 368 | 3300011119 | Ga0105246_10112952 | Ga0105246_101129522 | 194 |
| 369 | 3300011119 | Ga0105246_11218262 | Ga0105246_112182621 | 194 |
| 370 | 3300013100 | Ga0157373_10000365 | Ga0157373_1000036516 | 194 |
| 371 | 3300013100 | Ga0157373_10049691 | Ga0157373_100496912 | 194 |
| 372 | 3300013102 | Ga0157371_10136548 | Ga0157371_101365482 | 194 |
| 373 | 3300013104 | Ga0157370_10078508 | Ga0157370_100785082 | 194 |
| 374 | 3300013105 | Ga0157369_10042793 | Ga0157369_100427932 | 194 |
| 375 | 3300013296 | Ga0157374_10861474 | Ga0157374_108614742 | 194 |
| 376 | 3300013297 | Ga0157378_10602834 | Ga0157378_106028342 | 194 |
| 377 | 3300013297 | Ga0157378_11267619 | Ga0157378_112676191 | 194 |
| 378 | 3300013306 | Ga0163162_10097139 | Ga0163162_100971394 | 194 |
| 379 | 3300013306 | Ga0163162_10292499 | Ga0163162_102924992 | 194 |
| 380 | 3300013306 | Ga0163162_10346842 | Ga0163162_103468422 | 194 |
| 381 | 3300013306 | Ga0163162_10517914 | Ga0163162_105179143 | 194 |
| 382 | 3300013306 | Ga0163162_10734787 | Ga0163162_107347872 | 194 |
| 383 | 3300013306 | Ga0163162_11302732 | Ga0163162_113027321 | 194 |
| 384 | 3300013307 | Ga0157372_10000337 | Ga0157372_1000033727 | 194 |
| 385 | 3300013307 | Ga0157372_10083849 | Ga0157372_100838492 | 194 |
| 386 | 3300013307 | Ga0157372_10579165 | Ga0157372_105791652 | 194 |
| 387 | 3300013308 | Ga0157375_10084173 | Ga0157375_100841735 | 194 |
| 388 | 3300013308 | Ga0157375_10142074 | Ga0157375_101420742 | 194 |
| 389 | 3300013308 | Ga0157375_10179993 | Ga0157375_101799932 | 194 |
| 390 | 3300013308 | Ga0157375_10342129 | Ga0157375_103421292 | 194 |
| 391 | 3300013308 | Ga0157375_11020151 | Ga0157375_110201512 | 194 |
| 392 | 3300014325 | Ga0163163_10004457 | Ga0163163_1000445718 | 194 |
| 393 | 3300014325 | Ga0163163_10084984 | Ga0163163_100849841 | 194 |
| 394 | 3300014325 | Ga0163163_10991655 | Ga0163163_109916552 | 194 |
| 395 | 3300014325 | Ga0163163_11763240 | Ga0163163_117632401 | 194 |
| 396 | 3300014326 | Ga0157380_10039465 | Ga0157380_100394654 | 194 |
| 397 | 3300014326 | Ga0157380_10152978 | Ga0157380_101529783 | 194 |
| 398 | 3300014326 | Ga0157380_10263923 | Ga0157380_102639232 | 194 |
| 399 | 3300014326 | Ga0157380_10292821 | Ga0157380_102928212 | 194 |
| 400 | 3300014326 | Ga0157380_10458909 | Ga0157380_104589092 | 194 |
| 401 | 3300014497 | Ga0182008_10222118 | Ga0182008_102221182 | 194 |
| 402 | 3300014745 | Ga0157377_10137349 | Ga0157377_101373492 | 194 |
| 403 | 3300014968 | Ga0157379_10303007 | Ga0157379_103030073 | 194 |
| 404 | 3300014968 | Ga0157379_10568998 | Ga0157379_105689982 | 194 |
| 405 | 3300014969 | Ga0157376_10252572 | Ga0157376_102525723 | 194 |
| 406 | 3300014969 | Ga0157376_10816212 | Ga0157376_108162122 | 194 |
| 407 | 3300017792 | Ga0163161_10310229 | Ga0163161_103102291 | 194 |
| 408 | 3300017792 | Ga0163161_10315658 | Ga0163161_103156581 | 194 |
| 409 | 3300017792 | Ga0163161_10654360 | Ga0163161_106543602 | 194 |
| 410 | 3300021384 | Ga0213876_10055671 | Ga0213876_100556711 | 194 |
| 411 | 3300025885 | Ga0207653_10001878 | Ga0207653_100018782 | 194 |
| 412 | 3300025885 | Ga0207653_10062310 | Ga0207653_100623102 | 194 |
| 413 | 3300025893 | Ga0207682_10110724 | Ga0207682_101107242 | 194 |
| 414 | 3300025898 | Ga0207692_10009090 | Ga0207692_100090904 | 194 |
| 415 | 3300025900 | Ga0207710_10001835 | Ga0207710_100018353 | 194 |
| 416 | 3300025900 | Ga0207710_10002733 | Ga0207710_100027337 | 194 |
| 417 | 3300025900 | Ga0207710_10046541 | Ga0207710_100465412 | 194 |
| 418 | 3300025900 | Ga0207710_10203397 | Ga0207710_102033971 | 194 |
| 419 | 3300025901 | Ga0207688_10140724 | Ga0207688_101407242 | 194 |
| 420 | 3300025903 | Ga0207680_10070357 | Ga0207680_100703572 | 194 |
| 421 | 3300025903 | Ga0207680_10167778 | Ga0207680_101677782 | 194 |
| 422 | 3300025905 | Ga0207685_10188480 | Ga0207685_101884801 | 194 |
| 423 | 3300025906 | Ga0207699_10000032 | Ga0207699_1000003268 | 194 |
| 424 | 3300025907 | Ga0207645_10001806 | Ga0207645_100018066 | 194 |
| 425 | 3300025907 | Ga0207645_10024477 | Ga0207645_100244772 | 194 |
| 426 | 3300025908 | Ga0207643_10003293 | Ga0207643_100032932 | 194 |
| 427 | 3300025908 | Ga0207643_10142433 | Ga0207643_101424332 | 194 |
| 428 | 3300025908 | Ga0207643_10302606 | Ga0207643_103026062 | 194 |
| 429 | 3300025909 | Ga0207705_10032167 | Ga0207705_100321672 | 194 |
| 430 | 3300025910 | Ga0207684_10015141 | Ga0207684_100151416 | 194 |
| 431 | 3300025910 | Ga0207684_10023721 | Ga0207684_100237215 | 194 |
| 432 | 3300025910 | Ga0207684_10068409 | Ga0207684_100684093 | 194 |
| 433 | 3300025910 | Ga0207684_10455147 | Ga0207684_104551472 | 194 |
| 434 | 3300025911 | Ga0207654_10008756 | Ga0207654_100087566 | 194 |
| 435 | 3300025911 | Ga0207654_10009448 | Ga0207654_100094485 | 194 |
| 436 | 3300025912 | Ga0207707_10004696 | Ga0207707_100046969 | 194 |
| 437 | 3300025914 | Ga0207671_10006096 | Ga0207671_100060967 | 194 |
| 438 | 3300025914 | Ga0207671_10064278 | Ga0207671_100642782 | 194 |
| 439 | 3300025917 | Ga0207660_10028839 | Ga0207660_100288395 | 194 |
| 440 | 3300025917 | Ga0207660_10140624 | Ga0207660_101406242 | 194 |
| 441 | 3300025917 | Ga0207660_10472524 | Ga0207660_104725242 | 194 |
| 442 | 3300025918 | Ga0207662_10074356 | Ga0207662_100743562 | 194 |
| 443 | 3300025918 | Ga0207662_10206742 | Ga0207662_102067422 | 194 |
| 444 | 3300025919 | Ga0207657_10000869 | Ga0207657_1000086914 | 194 |
| 445 | 3300025919 | Ga0207657_10662685 | Ga0207657_106626852 | 194 |
| 446 | 3300025920 | Ga0207649_10007930 | Ga0207649_100079302 | 194 |
| 447 | 3300025921 | Ga0207652_10003687 | Ga0207652_1000368711 | 194 |
| 448 | 3300025921 | Ga0207652_10017916 | Ga0207652_100179164 | 194 |
| 449 | 3300025921 | Ga0207652_10024161 | Ga0207652_100241612 | 194 |
| 450 | 3300025922 | Ga0207646_10002690 | Ga0207646_100026902 | 194 |
| 451 | 3300025922 | Ga0207646_10010797 | Ga0207646_100107978 | 194 |
| 452 | 3300025922 | Ga0207646_10017494 | Ga0207646_100174942 | 194 |
| 453 | 3300025923 | Ga0207681_10000006 | Ga0207681_10000006286 | 194 |
| 454 | 3300025923 | Ga0207681_10291479 | Ga0207681_102914791 | 194 |
| 455 | 3300025923 | Ga0207681_10449942 | Ga0207681_104499422 | 194 |
| 456 | 3300025924 | Ga0207694_10121602 | Ga0207694_101216022 | 194 |
| 457 | 3300025924 | Ga0207694_10381457 | Ga0207694_103814572 | 194 |
| 458 | 3300025925 | Ga0207650_10000001 | Ga0207650_100000011163 | 194 |
| 459 | 3300025925 | Ga0207650_10021459 | Ga0207650_100214596 | 194 |
| 460 | 3300025925 | Ga0207650_10114118 | Ga0207650_101141182 | 194 |
| 461 | 3300025925 | Ga0207650_10181712 | Ga0207650_101817122 | 194 |
| 462 | 3300025925 | Ga0207650_10337678 | Ga0207650_103376782 | 194 |
| 463 | 3300025926 | Ga0207659_10213718 | Ga0207659_102137181 | 194 |
| 464 | 3300025927 | Ga0207687_10159312 | Ga0207687_101593122 | 194 |
| 465 | 3300025927 | Ga0207687_10315559 | Ga0207687_103155591 | 194 |
| 466 | 3300025928 | Ga0207700_10250206 | Ga0207700_102502061 | 194 |
| 467 | 3300025931 | Ga0207644_10000588 | Ga0207644_1000058813 | 194 |
| 468 | 3300025931 | Ga0207644_10062151 | Ga0207644_100621513 | 194 |
| 469 | 3300025931 | Ga0207644_10632233 | Ga0207644_106322331 | 194 |
| 470 | 3300025931 | Ga0207644_10845973 | Ga0207644_108459732 | 194 |
| 471 | 3300025932 | Ga0207690_10011627 | Ga0207690_100116276 | 194 |
| 472 | 3300025933 | Ga0207706_10001836 | Ga0207706_100018366 | 194 |
| 473 | 3300025934 | Ga0207686_10046819 | Ga0207686_100468193 | 194 |
| 474 | 3300025934 | Ga0207686_10347348 | Ga0207686_103473482 | 194 |
| 475 | 3300025935 | Ga0207709_10028978 | Ga0207709_100289783 | 194 |
| 476 | 3300025935 | Ga0207709_10191543 | Ga0207709_101915432 | 194 |
| 477 | 3300025935 | Ga0207709_10254613 | Ga0207709_102546131 | 194 |
| 478 | 3300025936 | Ga0207670_10000003 | Ga0207670_10000003408 | 194 |
| 479 | 3300025936 | Ga0207670_10011404 | Ga0207670_100114046 | 194 |
| 480 | 3300025936 | Ga0207670_10056731 | Ga0207670_100567312 | 194 |
| 481 | 3300025936 | Ga0207670_10057504 | Ga0207670_100575043 | 194 |
| 482 | 3300025936 | Ga0207670_10133043 | Ga0207670_101330432 | 194 |
| 483 | 3300025936 | Ga0207670_11061220 | Ga0207670_110612201 | 194 |
| 484 | 3300025937 | Ga0207669_10094462 | Ga0207669_100944623 | 194 |
| 485 | 3300025938 | Ga0207704_10155920 | Ga0207704_101559202 | 194 |
| 486 | 3300025939 | Ga0207665_10000918 | Ga0207665_1000091812 | 194 |
| 487 | 3300025939 | Ga0207665_10461065 | Ga0207665_104610651 | 194 |
| 488 | 3300025940 | Ga0207691_10073114 | Ga0207691_100731142 | 194 |
| 489 | 3300025940 | Ga0207691_10260398 | Ga0207691_102603982 | 194 |
| 490 | 3300025940 | Ga0207691_10875762 | Ga0207691_108757622 | 194 |
| 491 | 3300025940 | Ga0207691_10915505 | Ga0207691_109155052 | 194 |
| 492 | 3300025941 | Ga0207711_10123123 | Ga0207711_101231233 | 194 |
| 493 | 3300025941 | Ga0207711_10159900 | Ga0207711_101599003 | 194 |
| 494 | 3300025941 | Ga0207711_10209004 | Ga0207711_102090043 | 194 |
| 495 | 3300025941 | Ga0207711_10251832 | Ga0207711_102518322 | 194 |
| 496 | 3300025941 | Ga0207711_10677938 | Ga0207711_106779381 | 194 |
| 497 | 3300025941 | Ga0207711_10716374 | Ga0207711_107163741 | 194 |
| 498 | 3300025942 | Ga0207689_10000110 | Ga0207689_1000011047 | 194 |
| 499 | 3300025942 | Ga0207689_10003348 | Ga0207689_100033486 | 194 |
| 500 | 3300025942 | Ga0207689_10041955 | Ga0207689_100419553 | 194 |
| 501 | 3300025942 | Ga0207689_10122087 | Ga0207689_101220873 | 194 |
| 502 | 3300025942 | Ga0207689_10953625 | Ga0207689_109536251 | 194 |
| 503 | 3300025942 | Ga0207689_11073846 | Ga0207689_110738461 | 194 |
| 504 | 3300025945 | Ga0207679_10002898 | Ga0207679_100028986 | 194 |
| 505 | 3300025945 | Ga0207679_10136955 | Ga0207679_101369553 | 194 |
| 506 | 3300025949 | Ga0207667_10000088 | Ga0207667_1000008853 | 194 |
| 507 | 3300025949 | Ga0207667_10001835 | Ga0207667_100018355 | 194 |
| 508 | 3300025949 | Ga0207667_10020739 | Ga0207667_100207397 | 194 |
| 509 | 3300025949 | Ga0207667_10585350 | Ga0207667_105853502 | 194 |
| 510 | 3300025960 | Ga0207651_10232562 | Ga0207651_102325622 | 194 |
| 511 | 3300025960 | Ga0207651_10367386 | Ga0207651_103673861 | 194 |
| 512 | 3300025961 | Ga0207712_10003176 | Ga0207712_100031762 | 194 |
| 513 | 3300025961 | Ga0207712_10007574 | Ga0207712_100075746 | 194 |
| 514 | 3300025961 | Ga0207712_10057735 | Ga0207712_100577353 | 194 |
| 515 | 3300025961 | Ga0207712_10118073 | Ga0207712_101180733 | 194 |
| 516 | 3300025961 | Ga0207712_10124735 | Ga0207712_101247352 | 194 |
| 517 | 3300025961 | Ga0207712_10205234 | Ga0207712_102052341 | 194 |
| 518 | 3300025961 | Ga0207712_10458923 | Ga0207712_104589231 | 194 |
| 519 | 3300025961 | Ga0207712_10599535 | Ga0207712_105995352 | 194 |
| 520 | 3300025981 | Ga0207640_10007214 | Ga0207640_100072146 | 194 |
| 521 | 3300025986 | Ga0207658_10068101 | Ga0207658_100681013 | 194 |
| 522 | 3300026023 | Ga0207677_10016559 | Ga0207677_100165597 | 194 |
| 523 | 3300026023 | Ga0207677_10027695 | Ga0207677_100276953 | 194 |
| 524 | 3300026023 | Ga0207677_10588495 | Ga0207677_105884952 | 194 |
| 525 | 3300026023 | Ga0207677_11220261 | Ga0207677_112202611 | 194 |
| 526 | 3300026035 | Ga0207703_10050125 | Ga0207703_100501252 | 194 |
| 527 | 3300026035 | Ga0207703_10190554 | Ga0207703_101905543 | 194 |
| 528 | 3300026035 | Ga0207703_10286952 | Ga0207703_102869522 | 194 |
| 529 | 3300026035 | Ga0207703_10782568 | Ga0207703_107825682 | 194 |
| 530 | 3300026041 | Ga0207639_10008046 | Ga0207639_100080466 | 194 |
| 531 | 3300026041 | Ga0207639_10048141 | Ga0207639_100481412 | 194 |
| 532 | 3300026067 | Ga0207678_10000307 | Ga0207678_100003079 | 194 |
| 533 | 3300026075 | Ga0207708_10051505 | Ga0207708_100515054 | 194 |
| 534 | 3300026075 | Ga0207708_10113443 | Ga0207708_101134433 | 194 |
| 535 | 3300026075 | Ga0207708_10144672 | Ga0207708_101446723 | 194 |
| 536 | 3300026075 | Ga0207708_10165362 | Ga0207708_101653622 | 194 |
| 537 | 3300026075 | Ga0207708_10194037 | Ga0207708_101940371 | 194 |
| 538 | 3300026075 | Ga0207708_10587247 | Ga0207708_105872472 | 194 |
| 539 | 3300026078 | Ga0207702_10030507 | Ga0207702_100305075 | 194 |
| 540 | 3300026078 | Ga0207702_10080749 | Ga0207702_100807491 | 194 |
| 541 | 3300026078 | Ga0207702_10292056 | Ga0207702_102920562 | 194 |
| 542 | 3300026078 | Ga0207702_10644715 | Ga0207702_106447152 | 194 |
| 543 | 3300026088 | Ga0207641_10157056 | Ga0207641_101570563 | 194 |
| 544 | 3300026088 | Ga0207641_10621966 | Ga0207641_106219662 | 194 |
| 545 | 3300026088 | Ga0207641_11091688 | Ga0207641_110916882 | 194 |
| 546 | 3300026089 | Ga0207648_10009631 | Ga0207648_100096313 | 194 |
| 547 | 3300026089 | Ga0207648_10103166 | Ga0207648_101031662 | 194 |
| 548 | 3300026089 | Ga0207648_10104211 | Ga0207648_101042112 | 194 |
| 549 | 3300026089 | Ga0207648_10133891 | Ga0207648_101338911 | 194 |
| 550 | 3300026089 | Ga0207648_10144118 | Ga0207648_101441183 | 194 |
| 551 | 3300026089 | Ga0207648_10190493 | Ga0207648_101904933 | 194 |
| 552 | 3300026095 | Ga0207676_10007116 | Ga0207676_100071164 | 194 |
| 553 | 3300026116 | Ga0207674_10000181 | Ga0207674_1000018144 | 194 |
| 554 | 3300026116 | Ga0207674_10167742 | Ga0207674_101677422 | 194 |
| 555 | 3300026116 | Ga0207674_10305356 | Ga0207674_103053562 | 194 |
| 556 | 3300026116 | Ga0207674_10388083 | Ga0207674_103880832 | 194 |
| 557 | 3300026118 | Ga0207675_100029052 | Ga0207675_1000290524 | 194 |
| 558 | 3300026118 | Ga0207675_100054950 | Ga0207675_1000549506 | 194 |
| 559 | 3300026118 | Ga0207675_100082780 | Ga0207675_1000827805 | 194 |
| 560 | 3300026118 | Ga0207675_100088344 | Ga0207675_1000883443 | 194 |
| 561 | 3300026118 | Ga0207675_100219711 | Ga0207675_1002197112 | 194 |
| 562 | 3300026118 | Ga0207675_100269438 | Ga0207675_1002694382 | 194 |
| 563 | 3300026121 | Ga0207683_10006580 | Ga0207683_100065802 | 194 |
| 564 | 3300026121 | Ga0207683_10793317 | Ga0207683_107933171 | 194 |
| 565 | 3300026142 | Ga0207698_10010871 | Ga0207698_100108712 | 194 |
| 566 | 3300026142 | Ga0207698_10141744 | Ga0207698_101417442 | 194 |
| 567 | 3300026142 | Ga0207698_11323502 | Ga0207698_113235021 | 194 |
| 568 | 3300027360 | Ga0209969_1008892 | Ga0209969_10088922 | 194 |
| 569 | 3300027364 | Ga0209967_1009478 | Ga0209967_10094783 | 194 |
| 570 | 3300027378 | Ga0209981_1003950 | Ga0209981_10039502 | 194 |
| 571 | 3300027395 | Ga0209996_1001105 | Ga0209996_10011053 | 194 |
| 572 | 3300027424 | Ga0209984_1002122 | Ga0209984_10021223 | 194 |
| 573 | 3300027462 | Ga0210000_1007312 | Ga0210000_10073123 | 194 |
| 574 | 3300027471 | Ga0209995_1001050 | Ga0209995_10010503 | 194 |
| 575 | 3300027526 | Ga0209968_1003024 | Ga0209968_10030243 | 194 |
| 576 | 3300027543 | Ga0209999_1000025 | Ga0209999_10000255 | 194 |
| 577 | 3300027552 | Ga0209982_1001508 | Ga0209982_10015082 | 194 |
| 578 | 3300027614 | Ga0209970_1007998 | Ga0209970_10079983 | 194 |
| 579 | 3300027617 | Ga0210002_1003118 | Ga0210002_10031182 | 194 |
| 580 | 3300027665 | Ga0209983_1000033 | Ga0209983_10000333 | 194 |
| 581 | 3300027671 | Ga0209588_1000002 | Ga0209588_100000241 | 194 |
| 582 | 3300027682 | Ga0209971_1000127 | Ga0209971_100012718 | 194 |
| 583 | 3300027682 | Ga0209971_1021525 | Ga0209971_10215251 | 194 |
| 584 | 3300027695 | Ga0209966_1000147 | Ga0209966_10001478 | 194 |
| 585 | 3300027717 | Ga0209998_10000063 | Ga0209998_100000639 | 194 |
| 586 | 3300027717 | Ga0209998_10002609 | Ga0209998_100026095 | 194 |
| 587 | 3300027717 | Ga0209998_10064551 | Ga0209998_100645512 | 194 |
| 588 | 3300027876 | Ga0209974_10009869 | Ga0209974_100098693 | 194 |
| 589 | 3300027876 | Ga0209974_10024507 | Ga0209974_100245072 | 194 |
| 590 | 3300027876 | Ga0209974_10036896 | Ga0209974_100368962 | 194 |
| 591 | 3300027907 | Ga0207428_10071934 | Ga0207428_100719343 | 194 |
| 592 | 3300027907 | Ga0207428_10104750 | Ga0207428_101047502 | 194 |
| 593 | 3300027907 | Ga0207428_10205343 | Ga0207428_102053432 | 194 |
| 594 | 3300027907 | Ga0207428_10599782 | Ga0207428_105997821 | 194 |
| 595 | 3300028379 | Ga0268266_10001122 | Ga0268266_1000112215 | 194 |
| 596 | 3300028379 | Ga0268266_10338834 | Ga0268266_103388342 | 194 |
| 597 | 3300028379 | Ga0268266_10414700 | Ga0268266_104147002 | 194 |
| 598 | 3300028379 | Ga0268266_10866496 | Ga0268266_108664961 | 194 |
| 599 | 3300028380 | Ga0268265_10008184 | Ga0268265_100081842 | 194 |
| 600 | 3300028380 | Ga0268265_10010285 | Ga0268265_100102852 | 194 |
| 601 | 3300028380 | Ga0268265_10010902 | Ga0268265_100109022 | 194 |
| 602 | 3300028380 | Ga0268265_10016947 | Ga0268265_100169473 | 194 |
| 603 | 3300028380 | Ga0268265_10055261 | Ga0268265_100552611 | 194 |
| 604 | 3300028380 | Ga0268265_10549715 | Ga0268265_105497151 | 194 |
| 605 | 3300028380 | Ga0268265_11334530 | Ga0268265_113345301 | 194 |
| 606 | 3300028381 | Ga0268264_10012235 | Ga0268264_100122354 | 194 |
| 607 | 3300028381 | Ga0268264_10047256 | Ga0268264_100472561 | 194 |
| 608 | 3300028381 | Ga0268264_10190245 | Ga0268264_101902453 | 194 |
| 609 | 3300028381 | Ga0268264_10211988 | Ga0268264_102119882 | 194 |
| 610 | 3300028381 | Ga0268264_10313492 | Ga0268264_103134922 | 194 |
| 611 | 3300028381 | Ga0268264_10382123 | Ga0268264_103821232 | 194 |
| 612 | 3300028381 | Ga0268264_10464202 | Ga0268264_104642022 | 194 |
| 613 | 3300028381 | Ga0268264_10802402 | Ga0268264_108024022 | 194 |
| 614 | 3300028556 | Ga0265337_1001863 | Ga0265337_10018635 | 194 |
| 615 | 3300028556 | Ga0265337_1016100 | Ga0265337_10161003 | 194 |
| 616 | 3300028563 | Ga0265319_1000099 | Ga0265319_100009954 | 194 |
| 617 | 3300028573 | Ga0265334_10014627 | Ga0265334_100146274 | 194 |
| 618 | 3300028573 | Ga0265334_10046285 | Ga0265334_100462852 | 194 |
| 619 | 3300028577 | Ga0265318_10000029 | Ga0265318_1000002942 | 194 |
| 620 | 3300028577 | Ga0265318_10000030 | Ga0265318_1000003036 | 194 |
| 621 | 3300028577 | Ga0265318_10000475 | Ga0265318_100004758 | 194 |
| 622 | 3300028577 | Ga0265318_10004793 | Ga0265318_100047934 | 194 |
| 623 | 3300028577 | Ga0265318_10007653 | Ga0265318_100076532 | 194 |
| 624 | 3300028577 | Ga0265318_10061542 | Ga0265318_100615422 | 194 |
| 625 | 3300028653 | Ga0265323_10001946 | Ga0265323_100019465 | 194 |
| 626 | 3300028653 | Ga0265323_10004203 | Ga0265323_100042036 | 194 |
| 627 | 3300028653 | Ga0265323_10013094 | Ga0265323_100130944 | 194 |
| 628 | 3300028653 | Ga0265323_10014451 | Ga0265323_100144513 | 194 |
| 629 | 3300028653 | Ga0265323_10097669 | Ga0265323_100976692 | 194 |
| 630 | 3300028654 | Ga0265322_10002919 | Ga0265322_100029193 | 194 |
| 631 | 3300028654 | Ga0265322_10036956 | Ga0265322_100369562 | 194 |
| 632 | 3300028654 | Ga0265322_10125536 | Ga0265322_101255361 | 194 |
| 633 | 3300028794 | Ga0307515_10372973 | Ga0307515_103729731 | 194 |
| 634 | 3300028800 | Ga0265338_10014764 | Ga0265338_100147645 | 194 |
| 635 | 3300028800 | Ga0265338_10018298 | Ga0265338_100182984 | 194 |
| 636 | 3300028800 | Ga0265338_10096509 | Ga0265338_100965092 | 194 |
| 637 | 3300028800 | Ga0265338_10120824 | Ga0265338_101208242 | 194 |
| 638 | 3300029957 | Ga0265324_10000038 | Ga0265324_1000003890 | 194 |
| 639 | 3300029957 | Ga0265324_10015664 | Ga0265324_100156642 | 194 |
| 640 | 3300030521 | Ga0307511_10015383 | Ga0307511_100153833 | 194 |
| 641 | 3300031090 | Ga0265760_10083153 | Ga0265760_100831532 | 194 |
| 642 | 3300031090 | Ga0265760_10205980 | Ga0265760_102059801 | 194 |
| 643 | 3300031235 | Ga0265330_10000105 | Ga0265330_1000010525 | 194 |
| 644 | 3300031235 | Ga0265330_10000241 | Ga0265330_1000024143 | 194 |
| 645 | 3300031235 | Ga0265330_10000632 | Ga0265330_100006327 | 194 |
| 646 | 3300031235 | Ga0265330_10001005 | Ga0265330_100010052 | 194 |
| 647 | 3300031235 | Ga0265330_10002964 | Ga0265330_100029642 | 194 |
| 648 | 3300031235 | Ga0265330_10006503 | Ga0265330_100065031 | 194 |
| 649 | 3300031235 | Ga0265330_10025563 | Ga0265330_100255632 | 194 |
| 650 | 3300031235 | Ga0265330_10041190 | Ga0265330_100411903 | 194 |
| 651 | 3300031235 | Ga0265330_10073806 | Ga0265330_100738062 | 194 |
| 652 | 3300031238 | Ga0265332_10000032 | Ga0265332_1000003291 | 194 |
| 653 | 3300031238 | Ga0265332_10015705 | Ga0265332_100157052 | 194 |
| 654 | 3300031238 | Ga0265332_10042803 | Ga0265332_100428032 | 194 |
| 655 | 3300031239 | Ga0265328_10002510 | Ga0265328_100025107 | 194 |
| 656 | 3300031239 | Ga0265328_10051728 | Ga0265328_100517282 | 194 |
| 657 | 3300031240 | Ga0265320_10000017 | Ga0265320_1000001795 | 194 |
| 658 | 3300031240 | Ga0265320_10000044 | Ga0265320_1000004429 | 194 |
| 659 | 3300031240 | Ga0265320_10006167 | Ga0265320_100061673 | 194 |
| 660 | 3300031240 | Ga0265320_10072652 | Ga0265320_100726522 | 194 |
| 661 | 3300031241 | Ga0265325_10000206 | Ga0265325_100002061 | 194 |
| 662 | 3300031241 | Ga0265325_10008209 | Ga0265325_100082094 | 194 |
| 663 | 3300031241 | Ga0265325_10020686 | Ga0265325_100206864 | 194 |
| 664 | 3300031242 | Ga0265329_10000025 | Ga0265329_100000258 | 194 |
| 665 | 3300031242 | Ga0265329_10000043 | Ga0265329_1000004336 | 194 |
| 666 | 3300031242 | Ga0265329_10000299 | Ga0265329_1000029917 | 194 |
| 667 | 3300031242 | Ga0265329_10009972 | Ga0265329_100099722 | 194 |
| 668 | 3300031242 | Ga0265329_10010702 | Ga0265329_100107023 | 194 |
| 669 | 3300031242 | Ga0265329_10024535 | Ga0265329_100245351 | 194 |
| 670 | 3300031242 | Ga0265329_10035248 | Ga0265329_100352482 | 194 |
| 671 | 3300031247 | Ga0265340_10000434 | Ga0265340_100004345 | 194 |
| 672 | 3300031247 | Ga0265340_10002905 | Ga0265340_1000290510 | 194 |
| 673 | 3300031247 | Ga0265340_10010701 | Ga0265340_100107012 | 194 |
| 674 | 3300031249 | Ga0265339_10000039 | Ga0265339_1000003992 | 194 |
| 675 | 3300031249 | Ga0265339_10019068 | Ga0265339_100190682 | 194 |
| 676 | 3300031249 | Ga0265339_10031471 | Ga0265339_100314714 | 194 |
| 677 | 3300031250 | Ga0265331_10000027 | Ga0265331_1000002789 | 194 |
| 678 | 3300031250 | Ga0265331_10000451 | Ga0265331_100004517 | 194 |
| 679 | 3300031250 | Ga0265331_10001080 | Ga0265331_1000108010 | 194 |
| 680 | 3300031250 | Ga0265331_10007233 | Ga0265331_100072333 | 194 |
| 681 | 3300031250 | Ga0265331_10024917 | Ga0265331_100249172 | 194 |
| 682 | 3300031251 | Ga0265327_10175481 | Ga0265327_101754812 | 194 |
| 683 | 3300031344 | Ga0265316_10000065 | Ga0265316_1000006553 | 194 |
| 684 | 3300031344 | Ga0265316_10000149 | Ga0265316_1000014929 | 194 |
| 685 | 3300031344 | Ga0265316_10000295 | Ga0265316_1000029529 | 194 |
| 686 | 3300031344 | Ga0265316_10000335 | Ga0265316_1000033523 | 194 |
| 687 | 3300031344 | Ga0265316_10000357 | Ga0265316_1000035739 | 194 |
| 688 | 3300031344 | Ga0265316_10003769 | Ga0265316_100037699 | 194 |
| 689 | 3300031344 | Ga0265316_10005799 | Ga0265316_1000579912 | 194 |
| 690 | 3300031344 | Ga0265316_10006101 | Ga0265316_100061018 | 194 |
| 691 | 3300031344 | Ga0265316_10015302 | Ga0265316_100153027 | 194 |
| 692 | 3300031344 | Ga0265316_10030110 | Ga0265316_100301103 | 194 |
| 693 | 3300031344 | Ga0265316_10048454 | Ga0265316_100484544 | 194 |
| 694 | 3300031344 | Ga0265316_10049586 | Ga0265316_100495862 | 194 |
| 695 | 3300031344 | Ga0265316_10254787 | Ga0265316_102547872 | 194 |
| 696 | 3300031456 | Ga0307513_10368745 | Ga0307513_103687451 | 194 |
| 697 | 3300031595 | Ga0265313_10000002 | Ga0265313_1000000288 | 194 |
| 698 | 3300031595 | Ga0265313_10000236 | Ga0265313_1000023640 | 194 |
| 699 | 3300031595 | Ga0265313_10000738 | Ga0265313_1000073826 | 194 |
| 700 | 3300031595 | Ga0265313_10006604 | Ga0265313_100066048 | 194 |
| 701 | 3300031595 | Ga0265313_10016017 | Ga0265313_100160175 | 194 |
| 702 | 3300031595 | Ga0265313_10033854 | Ga0265313_100338542 | 194 |
| 703 | 3300031595 | Ga0265313_10035680 | Ga0265313_100356804 | 194 |
| 704 | 3300031595 | Ga0265313_10050459 | Ga0265313_100504593 | 194 |
| 705 | 3300031616 | Ga0307508_10000625 | Ga0307508_1000062513 | 194 |
| 706 | 3300031616 | Ga0307508_10036128 | Ga0307508_100361284 | 194 |
| 707 | 3300031711 | Ga0265314_10000015 | Ga0265314_10000015250 | 194 |
| 708 | 3300031711 | Ga0265314_10000069 | Ga0265314_1000006942 | 194 |
| 709 | 3300031711 | Ga0265314_10000701 | Ga0265314_100007014 | 194 |
| 710 | 3300031711 | Ga0265314_10001957 | Ga0265314_100019576 | 194 |
| 711 | 3300031711 | Ga0265314_10013250 | Ga0265314_100132507 | 194 |
| 712 | 3300031711 | Ga0265314_10014365 | Ga0265314_100143655 | 194 |
| 713 | 3300031711 | Ga0265314_10081691 | Ga0265314_100816912 | 194 |
| 714 | 3300031712 | Ga0265342_10000072 | Ga0265342_1000007240 | 194 |
| 715 | 3300031712 | Ga0265342_10000228 | Ga0265342_1000022823 | 194 |
| 716 | 3300031712 | Ga0265342_10000724 | Ga0265342_1000072426 | 194 |
| 717 | 3300031712 | Ga0265342_10002007 | Ga0265342_100020075 | 194 |
| 718 | 3300031712 | Ga0265342_10009882 | Ga0265342_100098827 | 194 |
| 719 | 3300031712 | Ga0265342_10009972 | Ga0265342_100099726 | 194 |
| 720 | 3300031712 | Ga0265342_10014161 | Ga0265342_100141614 | 194 |
| 721 | 3300031712 | Ga0265342_10017542 | Ga0265342_100175422 | 194 |
| 722 | 3300031712 | Ga0265342_10018406 | Ga0265342_100184062 | 194 |
| 723 | 3300031712 | Ga0265342_10019495 | Ga0265342_100194951 | 194 |
| 724 | 3300031712 | Ga0265342_10021206 | Ga0265342_100212062 | 194 |
| 725 | 3300031727 | Ga0316576_10037033 | Ga0316576_100370332 | 194 |
| 726 | 3300031727 | Ga0316576_10156263 | Ga0316576_101562632 | 194 |
| 727 | 3300031727 | Ga0316576_10194326 | Ga0316576_101943262 | 194 |
| 728 | 3300031727 | Ga0316576_10286860 | Ga0316576_102868601 | 194 |
| 729 | 3300031727 | Ga0316576_10777193 | Ga0316576_107771931 | 194 |
| 730 | 3300031728 | Ga0316578_10017309 | Ga0316578_100173092 | 194 |
| 731 | 3300031728 | Ga0316578_10058448 | Ga0316578_100584482 | 194 |
| 732 | 3300031728 | Ga0316578_10113217 | Ga0316578_101132173 | 194 |
| 733 | 3300031730 | Ga0307516_10076755 | Ga0307516_100767553 | 194 |
| 734 | 3300031731 | Ga0307405_10735750 | Ga0307405_107357502 | 194 |
| 735 | 3300031852 | Ga0307410_10338206 | Ga0307410_103382061 | 194 |
| 736 | 3300031901 | Ga0307406_10070939 | Ga0307406_100709393 | 194 |
| 737 | 3300031903 | Ga0307407_10084008 | Ga0307407_100840083 | 194 |
| 738 | 3300031903 | Ga0307407_10810146 | Ga0307407_108101461 | 194 |
| 739 | 3300031995 | Ga0307409_100133090 | Ga0307409_1001330902 | 194 |
| 740 | 3300031995 | Ga0307409_100280293 | Ga0307409_1002802932 | 194 |
| 741 | 3300031995 | Ga0307409_100609875 | Ga0307409_1006098752 | 194 |
| 742 | 3300033179 | Ga0307507_10026247 | Ga0307507_100262474 | 194 |
| 743 | 3300034817 | Ga0373948_0003013 | Ga0373948_0003013_1005_1622 | 194 |
| 744 | 3300034818 | Ga0373950_0000025 | Ga0373950_0000025_52600_53187 | 194 |
| 745 | 3300035085 | Ga0373929_0000003 | Ga0373929_0000003_185451_186035 | 194 |
| 746 | 3300035085 | Ga0373929_0054054 | Ga0373929_0054054_155_739 | 194 |
| 747 | 3300035091 | Ga0373951_0006119 | Ga0373951_0006119_568_1185 | 194 |
| 748 | 3300035115 | Ga0373941_0076371 | Ga0373941_0076371_410_1027 | 194 |
| 749 | 3300035115 | Ga0373941_0125926 | Ga0373941_0125926_307_891 | 194 |
| 750 | 3300035117 | Ga0373953_0031638 | Ga0373953_0031638_311_898 | 194 |
| 751 | 3300035170 | Ga0373943_0599808 | Ga0373943_0599808_14_601 | 194 |
| 752 | 3300035241 | Ga0373961_0001172 | Ga0373961_0001172_7539_8123 | 194 |
| 753 | 3300035241 | Ga0373961_0108842 | Ga0373961_0108842_296_883 | 194 |
| 754 | 3300035398 | Ga0316574_0005968 | Ga0316574_0005968_2238_2858 | 194 |
| 755 | 3300035398 | Ga0316574_0125277 | Ga0316574_0125277_509_1096 | 194 |
| 756 | 3300035692 | Ga0373935_0002532 | Ga0373935_0002532_5991_6605 | 194 |
| 757 | 3300035692 | Ga0373935_0812402 | Ga0373935_0812402_28_615 | 194 |
| 758 | 3300035695 | Ga0373927_0392351 | Ga0373927_0392351_120_710 | 194 |
| 759 | 3300035724 | Ga0373933_0056772 | Ga0373933_0056772_142_729 | 194 |
| 760 | 3300035724 | Ga0373933_0568646 | Ga0373933_0568646_76_666 | 194 |
| 761 | 3300036401 | Ga0373937_0051072 | Ga0373937_0051072_2688_3278 | 194 |
| 762 | 3300036401 | Ga0373937_0507409 | Ga0373937_0507409_488_1078 | 194 |
| 763 | 3300036647 | Ga0316582_0267449 | Ga0316582_0267449_463_1050 | 194 |
| 764 | 3300036712 | Ga0316584_0000540 | Ga0316584_0000540_379_966 | 194 |
| 765 | 3300036712 | Ga0316584_0032828 | Ga0316584_0032828_2890_3477 | 194 |
| 766 | 3300037068 | Ga0373925_0934834 | Ga0373925_0934834_82_669 | 194 |
| 767 | 3300037418 | Ga0395900_0021425 | Ga0395900_0021425_185_778 | 194 |
| 768 | 3300037471 | Ga0395905_0000007 | Ga0395905_0000007_364140_364733 | 194 |
| 769 | 3300037471 | Ga0395905_0040561 | Ga0395905_0040561_1393_1980 | 194 |
| 770 | 3300037471 | Ga0395905_0377252 | Ga0395905_0377252_630_1238 | 194 |
| 771 | 3300039093 | Ga0400489_22377 | Ga0400489_22377_1225_1812 | 194 |
| 772 | 3300039093 | Ga0400489_46890 | Ga0400489_46890_497_1084 | 194 |
| 773 | 3300039437 | Ga0436365_0236220 | Ga0436365_0236220_205_798 | 194 |
| 774 | 3300039437 | Ga0436365_0443710 | Ga0436365_0443710_271_855 | 194 |
| 775 | 3300039437 | Ga0436365_0746798 | Ga0436365_0746798_445_1029 | 194 |
| 776 | 3300039438 | Ga0436360_0270732 | Ga0436360_0270732_18_605 | 194 |
| 777 | 3300039438 | Ga0436360_1236090 | Ga0436360_1236090_197_787 | 194 |
| 778 | 3300039447 | Ga0436361_0457863 | Ga0436361_0457863_75_665 | 194 |
| 779 | 3300039453 | Ga0436362_0969985 | Ga0436362_0969985_153_743 | 194 |
| 780 | 3300041413 | Ga0439465_0006935 | Ga0439465_0006935_827_1417 | 194 |
| 781 | 3300041463 | Ga0451804_1112314 | Ga0451804_1112314_23_616 | 194 |
| 782 | 3300041486 | Ga0451807_0466492 | Ga0451807_0466492_93_677 | 194 |
| 783 | 3300041486 | Ga0451807_0748572 | Ga0451807_0748572_65_649 | 194 |
| 784 | 3300041486 | Ga0451807_2420813 | Ga0451807_2420813_53_640 | 194 |
| 785 | 3300041494 | Ga0451837_0432478 | Ga0451837_0432478_207_791 | 194 |
| 786 | 3300041494 | Ga0451837_1517064 | Ga0451837_1517064_36_629 | 194 |
| 787 | 3300041505 | Ga0451849_0266999 | Ga0451849_0266999_309_893 | 194 |
| 788 | 3300041512 | Ga0451853_2328441 | Ga0451853_2328441_6074_6661 | 194 |
| 789 | 3300042005 | Ga0439448_0057917 | Ga0439448_0057917_390_1007 | 194 |
| 790 | 3300042007 | Ga0439449_0126597 | Ga0439449_0126597_317_907 | 194 |
| 791 | 3300042118 | Ga0450914_015202 | Ga0450914_015202_131_748 | 194 |
| 792 | 3300042157 | Ga0439458_0002681 | Ga0439458_0002681_3109_3699 | 194 |
| 793 | 3300042461 | Ga0439460_0005362 | Ga0439460_0005362_904_1521 | 194 |
| 794 | 3300042876 | Ga0451577_0004861 | Ga0451577_0004861_11892_12476 | 194 |
| 795 | 3300042876 | Ga0451577_0060969 | Ga0451577_0060969_677_1294 | 194 |
| 796 | 3300042876 | Ga0451577_0187372 | Ga0451577_0187372_421_1014 | 194 |
| 797 | 3300042876 | Ga0451577_0187777 | Ga0451577_0187777_1236_1829 | 194 |
| 798 | 3300042876 | Ga0451577_0221684 | Ga0451577_0221684_1063_1680 | 194 |
| 799 | 3300042876 | Ga0451577_0300251 | Ga0451577_0300251_272_856 | 194 |
| 800 | 3300042876 | Ga0451577_0437455 | Ga0451577_0437455_246_863 | 194 |
| 801 | 3300042876 | Ga0451577_0648440 | Ga0451577_0648440_248_835 | 194 |
| 802 | 3300042876 | Ga0451577_0847925 | Ga0451577_0847925_73_690 | 194 |
| 803 | 3300044673 | Ga0453683_0005763 | Ga0453683_0005763_6272_6889 | 194 |
| 804 | 3300044673 | Ga0453683_0007604 | Ga0453683_0007604_1932_2519 | 194 |
| 805 | 3300044673 | Ga0453683_0084631 | Ga0453683_0084631_210_794 | 194 |
| 806 | 3300044673 | Ga0453683_0115539 | Ga0453683_0115539_782_1399 | 194 |
| 807 | 3300044673 | Ga0453683_0145449 | Ga0453683_0145449_198_785 | 194 |
| 808 | 3300044673 | Ga0453683_0157653 | Ga0453683_0157653_171_758 | 194 |
| 809 | 3300044673 | Ga0453683_0179694 | Ga0453683_0179694_277_870 | 194 |
| 810 | 3300044673 | Ga0453683_0191359 | Ga0453683_0191359_97_684 | 194 |
| 811 | 3300044683 | Ga0466965_0192703 | Ga0466965_0192703_161_751 | 194 |
| 812 | 3300044712 | Ga0453684_0000248 | Ga0453684_0000248_118457_119050 | 194 |
| 813 | 3300044712 | Ga0453684_0001332 | Ga0453684_0001332_7957_8544 | 194 |
| 814 | 3300044712 | Ga0453684_0022768 | Ga0453684_0022768_4953_5540 | 194 |
| 815 | 3300044712 | Ga0453684_0066745 | Ga0453684_0066745_3634_4218 | 194 |
| 816 | 3300044712 | Ga0453684_0070346 | Ga0453684_0070346_1993_2586 | 194 |
| 817 | 3300044712 | Ga0453684_0081014 | Ga0453684_0081014_1523_2116 | 194 |
| 818 | 3300044712 | Ga0453684_0085533 | Ga0453684_0085533_1276_1863 | 194 |
| 819 | 3300044712 | Ga0453684_0087813 | Ga0453684_0087813_21_608 | 194 |
| 820 | 3300044712 | Ga0453684_0089075 | Ga0453684_0089075_17_634 | 194 |
| 821 | 3300044712 | Ga0453684_0111758 | Ga0453684_0111758_1476_2060 | 194 |
| 822 | 3300044712 | Ga0453684_0117881 | Ga0453684_0117881_800_1387 | 194 |
| 823 | 3300044712 | Ga0453684_0236095 | Ga0453684_0236095_1403_1990 | 194 |
| 824 | 3300044712 | Ga0453684_0236534 | Ga0453684_0236534_696_1289 | 194 |
| 825 | 3300044712 | Ga0453684_0250322 | Ga0453684_0250322_615_1202 | 194 |
| 826 | 3300044712 | Ga0453684_0417920 | Ga0453684_0417920_532_1122 | 194 |
| 827 | 3300044712 | Ga0453684_0467878 | Ga0453684_0467878_642_1259 | 194 |
| 828 | 3300044712 | Ga0453684_1070516 | Ga0453684_1070516_36_653 | 194 |
| 829 | 3300044712 | Ga0453684_1100224 | Ga0453684_1100224_73_660 | 194 |
| 830 | 3300044842 | Ga0466957_0603979 | Ga0466957_0603979_57_644 | 194 |
| 831 | 3300044901 | Ga0466960_0058594 | Ga0466960_0058594_1129_1716 | 194 |
| 832 | 3300045049 | Ga0466959_0336449 | Ga0466959_0336449_413_1003 | 194 |
| 833 | 3300045051 | Ga0451576_0009882 | Ga0451576_0009882_2256_2873 | 194 |
| 834 | 3300045051 | Ga0451576_0021018 | Ga0451576_0021018_2991_3575 | 194 |
| 835 | 3300045051 | Ga0451576_0216876 | Ga0451576_0216876_1163_1771 | 194 |
| 836 | 3300045051 | Ga0451576_0330478 | Ga0451576_0330478_925_1542 | 194 |
| 837 | 3300045976 | Ga0466967_0184983 | Ga0466967_0184983_315_902 | 194 |
| 838 | 3300045976 | Ga0466967_0347253 | Ga0466967_0347253_49_633 | 194 |
| 839 | 3300046455 | Ga0495603_0186071 | Ga0495603_0186071_403_987 | 194 |
| 840 | 3300046455 | Ga0495603_0292366 | Ga0495603_0292366_219_806 | 194 |
| 841 | 3300046473 | Ga0495582_0153000 | Ga0495582_0153000_365_949 | 194 |
| 842 | 3300046491 | Ga0495584_0096153 | Ga0495584_0096153_133_750 | 194 |
| 843 | 3300046533 | Ga0495640_0196607 | Ga0495640_0196607_566_1156 | 194 |
| 844 | 3300046539 | Ga0495621_0007472 | Ga0495621_0007472_34_618 | 194 |
| 845 | 3300046557 | Ga0495622_0043156 | Ga0495622_0043156_964_1548 | 194 |
| 846 | 3300046557 | Ga0495622_0091996 | Ga0495622_0091996_375_965 | 194 |
| 847 | 3300046681 | Ga0495647_0096502 | Ga0495647_0096502_570_1154 | 194 |
| 848 | 3300046683 | Ga0495658_0245136 | Ga0495658_0245136_107_691 | 194 |
| 849 | 3300047315 | Ga0495581_0023218 | Ga0495581_0023218_1581_2165 | 194 |
| 850 | 3300047315 | Ga0495581_0080963 | Ga0495581_0080963_506_1093 | 194 |
| 851 | 3300047321 | Ga0495676_0130318 | Ga0495676_0130318_982_1566 | 194 |
| 852 | 3300047322 | Ga0495680_0142001 | Ga0495680_0142001_704_1291 | 194 |
| 853 | 3300047322 | Ga0495680_0288996 | Ga0495680_0288996_268_852 | 194 |
| 854 | 3300047673 | Ga0495593_0344461 | Ga0495593_0344461_91_678 | 194 |
| 855 | 3300048904 | Ga0496101_0548091 | Ga0496101_0548091_273_860 | 194 |
| 856 | 3300048905 | Ga0496102_0255886 | Ga0496102_0255886_18_635 | 194 |
| 857 | 3300048906 | Ga0496103_0424588 | Ga0496103_0424588_221_838 | 194 |
| 858 | 3300048907 | Ga0496104_0051995 | Ga0496104_0051995_3200_3787 | 194 |
| 859 | 3300048907 | Ga0496104_0091351 | Ga0496104_0091351_2234_2821 | 194 |
| 860 | 3300048909 | Ga0496106_0372597 | Ga0496106_0372597_314_931 | 194 |
| 861 | 3300048913 | Ga0496110_0530442 | Ga0496110_0530442_318_905 | 194 |
| 862 | 3300048915 | Ga0496112_0404731 | Ga0496112_0404731_245_862 | 194 |
| 863 | 3300048916 | Ga0496113_0382434 | Ga0496113_0382434_443_1060 | 194 |
| 864 | 3300048917 | Ga0496114_0000035 | Ga0496114_0000035_46375_46959 | 194 |
| 865 | 3300048917 | Ga0496114_0003291 | Ga0496114_0003291_8477_9064 | 194 |
| 866 | 3300048917 | Ga0496114_0509991 | Ga0496114_0509991_23_610 | 194 |
| 867 | 3300048918 | Ga0496115_0186239 | Ga0496115_0186239_1052_1639 | 194 |
| 868 | 3300049514 | Ga0501291_005747 | Ga0501291_005747_534_1118 | 194 |
| 869 | 3300049515 | Ga0501292_012292 | Ga0501292_012292_107_691 | 194 |
| 870 | 3300049520 | Ga0501297_011089 | Ga0501297_011089_152_736 | 194 |
| 871 | 3300049527 | Ga0501311_005612 | Ga0501311_005612_688_1278 | 194 |
| 872 | 3300049528 | Ga0501312_012397 | Ga0501312_012397_551_1141 | 194 |
| 873 | 3300049569 | Ga0501032_0296431 | Ga0501032_0296431_277_894 | 194 |
| 874 | 3300049571 | Ga0501034_0000120 | Ga0501034_0000120_129039_129626 | 194 |
| 875 | 3300049572 | Ga0501036_0008740 | Ga0501036_0008740_7524_8111 | 194 |
| 876 | 3300049572 | Ga0501036_0091021 | Ga0501036_0091021_527_1144 | 194 |
| 877 | 3300049574 | Ga0501038_0156688 | Ga0501038_0156688_74_691 | 194 |
| 878 | 3300049574 | Ga0501038_0308702 | Ga0501038_0308702_336_923 | 194 |
| 879 | 3300049574 | Ga0501038_0491170 | Ga0501038_0491170_179_796 | 194 |
| 880 | 3300049575 | Ga0501039_0247476 | Ga0501039_0247476_186_803 | 194 |
| 881 | 3300049576 | Ga0501040_0000236 | Ga0501040_0000236_19727_20344 | 194 |
| 882 | 3300049576 | Ga0501040_0757000 | Ga0501040_0757000_101_685 | 194 |
| 883 | 3300049577 | Ga0501041_0020874 | Ga0501041_0020874_1477_2094 | 194 |
| 884 | 3300049578 | Ga0501042_0023757 | Ga0501042_0023757_2100_2717 | 194 |
| 885 | 3300049578 | Ga0501042_0445260 | Ga0501042_0445260_286_903 | 194 |
| 886 | 3300049578 | Ga0501042_0837557 | Ga0501042_0837557_18_605 | 194 |
| 887 | 3300049579 | Ga0501043_0021008 | Ga0501043_0021008_3746_4333 | 194 |
| 888 | 3300049580 | Ga0501046_0000111 | Ga0501046_0000111_18818_19405 | 194 |
| 889 | 3300049580 | Ga0501046_0000355 | Ga0501046_0000355_26021_26638 | 194 |
| 890 | 3300049580 | Ga0501046_0334428 | Ga0501046_0334428_457_1041 | 194 |
| 891 | 3300049581 | Ga0501047_0000009 | Ga0501047_0000009_208934_209521 | 194 |
| 892 | 3300049581 | Ga0501047_0151956 | Ga0501047_0151956_618_1235 | 194 |
| 893 | 3300049582 | Ga0501048_0000918 | Ga0501048_0000918_13844_14431 | 194 |
| 894 | 3300049582 | Ga0501048_0001804 | Ga0501048_0001804_10288_10905 | 194 |
| 895 | 3300049582 | Ga0501048_0134910 | Ga0501048_0134910_1063_1680 | 194 |
| 896 | 3300049582 | Ga0501048_0479984 | Ga0501048_0479984_51_635 | 194 |
| 897 | 3300049583 | Ga0501067_0008110 | Ga0501067_0008110_3787_4371 | 194 |
| 898 | 3300049584 | Ga0501068_0004352 | Ga0501068_0004352_4960_5547 | 194 |
| 899 | 3300049584 | Ga0501068_0011942 | Ga0501068_0011942_2811_3395 | 194 |
| 900 | 3300049584 | Ga0501068_0018570 | Ga0501068_0018570_1273_1860 | 194 |
| 901 | 3300049584 | Ga0501068_0075130 | Ga0501068_0075130_365_982 | 194 |
| 902 | 3300049586 | Ga0501070_0000323 | Ga0501070_0000323_7155_7742 | 194 |
| 903 | 3300049586 | Ga0501070_0000423 | Ga0501070_0000423_11473_12060 | 194 |
| 904 | 3300049587 | Ga0501071_0044198 | Ga0501071_0044198_2077_2694 | 194 |
| 905 | 3300049587 | Ga0501071_0303557 | Ga0501071_0303557_31_648 | 194 |
| 906 | 3300049588 | Ga0501072_0000022 | Ga0501072_0000022_4992_5579 | 194 |
| 907 | 3300049588 | Ga0501072_0330581 | Ga0501072_0330581_369_986 | 194 |
| 908 | 3300049589 | Ga0501073_0002636 | Ga0501073_0002636_6561_7148 | 194 |
| 909 | 3300049589 | Ga0501073_0042906 | Ga0501073_0042906_2277_2864 | 194 |
| 910 | 3300049589 | Ga0501073_0056861 | Ga0501073_0056861_1565_2152 | 194 |
| 911 | 3300049589 | Ga0501073_0347834 | Ga0501073_0347834_149_736 | 194 |
| 912 | 3300049590 | Ga0501074_0001477 | Ga0501074_0001477_5598_6185 | 194 |
| 913 | 3300049590 | Ga0501074_0002458 | Ga0501074_0002458_7974_8591 | 194 |
| 914 | 3300049590 | Ga0501074_0031618 | Ga0501074_0031618_984_1571 | 194 |
| 915 | 3300049590 | Ga0501074_0101822 | Ga0501074_0101822_732_1349 | 194 |
| 916 | 3300049590 | Ga0501074_0206933 | Ga0501074_0206933_41_631 | 194 |
| 917 | 3300049591 | Ga0501075_0000724 | Ga0501075_0000724_8739_9323 | 194 |
| 918 | 3300049591 | Ga0501075_0037992 | Ga0501075_0037992_1142_1759 | 194 |
| 919 | 3300049591 | Ga0501075_0058006 | Ga0501075_0058006_169_786 | 194 |
| 920 | 3300049592 | Ga0501076_0025421 | Ga0501076_0025421_3165_3782 | 194 |
| 921 | 3300049592 | Ga0501076_0108973 | Ga0501076_0108973_483_1100 | 194 |
| 922 | 3300049592 | Ga0501076_0508250 | Ga0501076_0508250_56_673 | 194 |
| 923 | 3300049592 | Ga0501076_0662686 | Ga0501076_0662686_249_839 | 194 |
| 924 | 3300049593 | Ga0501077_0002509 | Ga0501077_0002509_7711_8328 | 194 |
| 925 | 3300049593 | Ga0501077_0004705 | Ga0501077_0004705_3372_3956 | 194 |
| 926 | 3300049593 | Ga0501077_0044847 | Ga0501077_0044847_1875_2492 | 194 |
| 927 | 3300049652 | Ga0501202_016474 | Ga0501202_016474_765_1349 | 194 |
| 928 | 3300049655 | Ga0501208_079349 | Ga0501208_079349_56_640 | 194 |
| 929 | 3300049663 | Ga0501223_028024 | Ga0501223_028024_70_654 | 194 |
| 930 | 3300049665 | Ga0501227_094889 | Ga0501227_094889_140_724 | 194 |
| 931 | 3300049669 | Ga0501235_020743 | Ga0501235_020743_66_650 | 194 |
| 932 | 3300049673 | Ga0501240_021439 | Ga0501240_021439_24_608 | 194 |
| 933 | 3300049675 | Ga0501243_029352 | Ga0501243_029352_32_616 | 194 |
| 934 | 3300049677 | Ga0501247_015130 | Ga0501247_015130_63_647 | 194 |
| 935 | 3300049679 | Ga0501249_006889 | Ga0501249_006889_1254_1838 | 194 |
| 936 | 3300049680 | Ga0501250_012425 | Ga0501250_012425_391_975 | 194 |
| 937 | 3300049686 | Ga0501257_014898 | Ga0501257_014898_328_912 | 194 |
| 938 | 3300049704 | Ga0501221_048864 | Ga0501221_048864_293_877 | 194 |
| 939 | 3300049705 | Ga0501225_0010653 | Ga0501225_0010653_755_1339 | 194 |
| 940 | 3300049741 | Ga0501079_0000167 | Ga0501079_0000167_23887_24474 | 194 |
| 941 | 3300049741 | Ga0501079_0000304 | Ga0501079_0000304_2040_2657 | 194 |
| 942 | 3300049741 | Ga0501079_0000923 | Ga0501079_0000923_17056_17673 | 194 |
| 943 | 3300049741 | Ga0501079_0014643 | Ga0501079_0014643_2867_3484 | 194 |
| 944 | 3300049741 | Ga0501079_0575125 | Ga0501079_0575125_77_661 | 194 |
| 945 | 3300049742 | Ga0501080_0004524 | Ga0501080_0004524_9403_9990 | 194 |
| 946 | 3300049742 | Ga0501080_0009716 | Ga0501080_0009716_4145_4729 | 194 |
| 947 | 3300049742 | Ga0501080_0157934 | Ga0501080_0157934_1214_1831 | 194 |
| 948 | 3300049742 | Ga0501080_0273341 | Ga0501080_0273341_757_1344 | 194 |
| 949 | 3300049742 | Ga0501080_0301843 | Ga0501080_0301843_337_927 | 194 |
| 950 | 3300049743 | Ga0501081_0006215 | Ga0501081_0006215_6277_6894 | 194 |
| 951 | 3300049743 | Ga0501081_0178347 | Ga0501081_0178347_678_1262 | 194 |
| 952 | 3300049744 | Ga0501083_0001196 | Ga0501083_0001196_10388_10975 | 194 |
| 953 | 3300049744 | Ga0501083_0003486 | Ga0501083_0003486_2158_2742 | 194 |
| 954 | 3300049744 | Ga0501083_0005690 | Ga0501083_0005690_6268_6885 | 194 |
| 955 | 3300049744 | Ga0501083_0012209 | Ga0501083_0012209_5402_5992 | 194 |
| 956 | 3300049744 | Ga0501083_0014052 | Ga0501083_0014052_4964_5551 | 194 |
| 957 | 3300049744 | Ga0501083_0035604 | Ga0501083_0035604_2123_2710 | 194 |
| 958 | 3300049744 | Ga0501083_0062049 | Ga0501083_0062049_13_600 | 194 |
| 959 | 3300049744 | Ga0501083_0327039 | Ga0501083_0327039_289_906 | 194 |
| 960 | 3300049760 | Ga0501263_010800 | Ga0501263_010800_114_704 | 194 |
| 961 | 3300049775 | Ga0501279_028159 | Ga0501279_028159_32_616 | 194 |
| 962 | 3300049822 | Ga0501035_0085866 | Ga0501035_0085866_1596_2183 | 194 |
| 963 | 3300049824 | Ga0501045_0002211 | Ga0501045_0002211_2355_2972 | 194 |
| 964 | 3300049824 | Ga0501045_0250658 | Ga0501045_0250658_556_1173 | 194 |
| 965 | 3300049824 | Ga0501045_0493330 | Ga0501045_0493330_43_660 | 194 |
| 966 | 3300050493 | nmdc:mga0k408_125463_c1 | nmdc:mga0k408_125463_c1_792_1379 | 194 |
| 967 | 3300050493 | nmdc:mga0k408_186480_c1 | nmdc:mga0k408_186480_c1_200_787 | 194 |
| 968 | 3300050507 | nmdc:mga05p37_1079265_c1 | nmdc:mga05p37_1079265_c1_74_661 | 194 |
| 969 | 3300050507 | nmdc:mga05p37_116972_c1 | nmdc:mga05p37_116972_c1_1928_2554 | 194 |
| 970 | 3300050507 | nmdc:mga05p37_14807_c1 | nmdc:mga05p37_14807_c1_6771_7388 | 194 |
| 971 | 3300050507 | nmdc:mga05p37_187641_c1 | nmdc:mga05p37_187641_c1_1550_2167 | 194 |
| 972 | 3300050507 | nmdc:mga05p37_223906_c1 | nmdc:mga05p37_223906_c1_779_1363 | 194 |
| 973 | 3300050507 | nmdc:mga05p37_327047_c1 | nmdc:mga05p37_327047_c1_67_651 | 194 |
| 974 | 3300050507 | nmdc:mga05p37_592770_c1 | nmdc:mga05p37_592770_c1_610_1194 | 194 |
| 975 | 3300050507 | nmdc:mga05p37_9153_c1 | nmdc:mga05p37_9153_c1_3314_3931 | 194 |
| 976 | 3300050508 | nmdc:mga09592_133433_c1 | nmdc:mga09592_133433_c1_813_1397 | 194 |
| 977 | 3300050509 | nmdc:mga0qj67_836651_c1 | nmdc:mga0qj67_836651_c1_26_619 | 194 |
| 978 | 3300050510 | nmdc:mga06r32_1032541_c1 | nmdc:mga06r32_1032541_c1_100_684 | 194 |
| 979 | 3300050510 | nmdc:mga06r32_3042_c1 | nmdc:mga06r32_3042_c1_10988_11572 | 194 |
| 980 | 3300050511 | nmdc:mga08y16_114999_c1 | nmdc:mga08y16_114999_c1_1635_2375 | 194 |
| 981 | 3300050511 | nmdc:mga08y16_171500_c1 | nmdc:mga08y16_171500_c1_88_672 | 194 |
| 982 | 3300050511 | nmdc:mga08y16_26576_c1 | nmdc:mga08y16_26576_c1_3834_4424 | 194 |
| 983 | 3300050511 | nmdc:mga08y16_408695_c1 | nmdc:mga08y16_408695_c1_17_607 | 194 |
| 984 | 3300050511 | nmdc:mga08y16_7505_c1 | nmdc:mga08y16_7505_c1_3267_3851 | 194 |
| 985 | 3300050511 | nmdc:mga08y16_963792_c1 | nmdc:mga08y16_963792_c1_126_716 | 194 |
| 986 | 3300050511 | nmdc:mga08y16_974359_c1 | nmdc:mga08y16_974359_c1_59_643 | 194 |
| 987 | 3300050512 | nmdc:mga0n895_12489_c1 | nmdc:mga0n895_12489_c1_779_1396 | 194 |
| 988 | 3300050512 | nmdc:mga0n895_149411_c1 | nmdc:mga0n895_149411_c1_1488_2072 | 194 |
| 989 | 3300050512 | nmdc:mga0n895_17952_c1 | nmdc:mga0n895_17952_c1_4682_5266 | 194 |
| 990 | 3300050512 | nmdc:mga0n895_389045_c1 | nmdc:mga0n895_389045_c1_186_803 | 194 |
| 991 | 3300050512 | nmdc:mga0n895_396895_c1 | nmdc:mga0n895_396895_c1_81_665 | 194 |
| 992 | 3300050512 | nmdc:mga0n895_548781_c1 | nmdc:mga0n895_548781_c1_70_654 | 194 |
| 993 | 3300050513 | nmdc:mga0rr50_30246_c1 | nmdc:mga0rr50_30246_c1_1675_2292 | 194 |
| 994 | 3300050514 | nmdc:mga08x19_38466_c1 | nmdc:mga08x19_38466_c1_614_1231 | 194 |
| 995 | 3300050514 | nmdc:mga08x19_80335_c1 | nmdc:mga08x19_80335_c1_88_672 | 194 |
| 996 | 3300050515 | nmdc:mga0a205_20046_c1 | nmdc:mga0a205_20046_c1_645_1262 | 194 |
| 997 | 3300050515 | nmdc:mga0a205_2044_c1 | nmdc:mga0a205_2044_c1_9697_10314 | 194 |
| 998 | 3300050515 | nmdc:mga0a205_38031_c1 | nmdc:mga0a205_38031_c1_1437_2021 | 194 |
| 999 | 3300050515 | nmdc:mga0a205_71511_c2 | nmdc:mga0a205_71511_c2_1386_1973 | 194 |
| 1000 | 3300053080 | Ga0500635_0033936 | Ga0500635_0033936_552_1139 | 194 |
| 1001 | 3300053084 | Ga0495595_0343583 | Ga0495595_0343583_115_705 | 194 |
| 1002 | 3300053088 | Ga0500644_0004509 | Ga0500644_0004509_843_1430 | 194 |
| 1003 | 3300053098 | Ga0500650_0135385 | Ga0500650_0135385_538_1125 | 194 |
| 1004 | 3300054114 | Ga0501084_0000006 | Ga0501084_0000006_208934_209521 | 194 |
| 1005 | 3300054114 | Ga0501084_0001672 | Ga0501084_0001672_5963_6550 | 194 |
| 1006 | 3300054114 | Ga0501084_0010675 | Ga0501084_0010675_4489_5079 | 194 |
| 1007 | 3300054114 | Ga0501084_0060806 | Ga0501084_0060806_1892_2509 | 194 |
| 1008 | 3300054114 | Ga0501084_0176906 | Ga0501084_0176906_1132_1719 | 194 |
| 1009 | 3300059493 | Ga0587077_104851 | Ga0587077_104851_51_641 | 194 |
| 1010 | 3300059506 | Ga0587085_012672 | Ga0587085_012672_75_665 | 194 |
| 1011 | 3300059605 | Ga0587106_027990 | Ga0587106_027990_244_840 | 194 |
| 1012 | 3300059623 | Ga0587101_006064 | Ga0587101_006064_166_756 | 194 |
| 1013 | 3300059624 | Ga0587109_015968 | Ga0587109_015968_10_600 | 194 |
| 1014 | 3300059624 | Ga0587109_020404 | Ga0587109_020404_412_1002 | 194 |
| 1015 | 3300059639 | Ga0587062_006709 | Ga0587062_006709_662_1252 | 194 |
| 1016 | 3300059639 | Ga0587062_059339 | Ga0587062_059339_50_640 | 194 |
| 1017 | 3300060353 | Ga0501082_0000081 | Ga0501082_0000081_10044_10628 | 194 |
| 1018 | 3300060353 | Ga0501082_0000280 | Ga0501082_0000280_28606_29223 | 194 |
| 1019 | 3300060353 | Ga0501082_0002810 | Ga0501082_0002810_2674_3261 | 194 |
| 1020 | 3300060353 | Ga0501082_0002975 | Ga0501082_0002975_6226_6813 | 194 |
| 1021 | 3300060353 | Ga0501082_0011756 | Ga0501082_0011756_6183_6773 | 194 |
| 1022 | 3300060353 | Ga0501082_0050770 | Ga0501082_0050770_329_946 | 194 |
| 1023 | 3300060353 | Ga0501082_0184224 | Ga0501082_0184224_421_1038 | 194 |
| 1024 | 3300060353 | Ga0501082_0265142 | Ga0501082_0265142_282_866 | 194 |
| 1025 | 3300060353 | Ga0501082_0345772 | Ga0501082_0345772_51_635 | 194 |
| 1026 | 3300061734 | Ga0530510_0045451 | Ga0530510_0045451_2372_2989 | 194 |
| 1027 | 3300061734 | Ga0530510_0134930 | Ga0530510_0134930_1150_1767 | 194 |
| 1028 | 3300061734 | Ga0530510_0233163 | Ga0530510_0233163_250_867 | 194 |
| 1029 | 3300061734 | Ga0530510_0551147 | Ga0530510_0551147_234_851 | 194 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ymx-assembly2.cif.gz_B | myxococcus xanthus mgla in gdp bound conformation | 0.9504 | 2 | 194 |
| 6h5b-assembly1.cif.gz_A | myxococcus xanthus mgla in complex with its gap mglb and gtpgammas | 0.9439 | 2 | 190 |
| 3t1q-assembly1.cif.gz_A | mgla bound to gppnhp in complex with mglb | 0.9432 | 10 | 190 |
| 5ymx-assembly1.cif.gz_A | myxococcus xanthus mgla in gdp bound conformation | 0.941 | 2 | 194 |
| 6hjo-assembly1.cif.gz_B | myxococcus xanthus mgla bound to gdp | 0.9391 | 2 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3t1oB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9195 | 3 | 190 | 3.40.50.300 |
| 3t1oB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9102 | 3 | 190 | 3.40.50.300 |
| af_P35292_16_212_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8196 | 12 | 191 | 3.40.50.300 |
| af_Q9SJZ5_48_162_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8145 | 90 | 193 | 3.40.50.300 |
| af_A4HUK3_2_208_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8122 | 12 | 187 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9Q7P6-F1-model_v4 | GTPase domain-containing protein | 1.003 | 98 | 194 |
|
| AF-A0A7V9Q7P6-F1-model_v4 | GTPase domain-containing protein | 0.9924 | 98 | 194 |
|
| AF-A0A6J4LAY2-F1-model_v4 | Mutual gliding-motility protein MglA | 0.9841 | 99 | 191 |
|
| AF-A0A6J4LNE9-F1-model_v4 | Mutual gliding-motility protein MglA | 0.9824 | 72 | 191 |
GO:0003924
GO:0005525 |
| AF-A0A7C4SRK4-F1-model_v4 | GTP-binding protein | 0.9818 | 1 | 193 |
GO:0003924
GO:0005525 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar