F488566

General Info

Members Datasets Scaffolds Average Seq Length
1029 398 1026 198

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100212983|Ga0070695_1002129832
Length 235
Sequence MPTVSHRKREVLLKIVYYGPGLGGKTTNLEYIHAHSRPEHRGKLLSLTSDNERTLFFDLLPIDLGEFKGYTIRLHLCTVPGQLAFDRTRRLILRGVDGVVFVVDSQPAQIDANVVSLENLATNLRVLGMDPDHIPVVVQYNKRDIDGVLETSELKFVLGIPQGVQELEASAKYGEGVFDTLKAIVRECLKIVGDPRRAPEGRTASILPALVGSATRNRAASEATSAPENRNPAER

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
219 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
220 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
254 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
255 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
258 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
259 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
260 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
281 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
282 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
283 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
284 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
288 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
289 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
290 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
291 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
292 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
293 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
294 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
295 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
311 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
328 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
329 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
330 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
355 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
356 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
357 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
358 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
359 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
360 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
361 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
362 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
363 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
364 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
365 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
366 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
367 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
373 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.55
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.85
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000053 3300000532 Bacteria 8226
2 JGI24737J22298_10042841 3300001990 Bacteria 1387
3 JGI24751J29686_10000040 3300002459 Bacteria 79191
4 JGI26128J50194_1000536 3300003347 Bacteria 2121
5 JGI26145J50221_1007769 3300003371 Bacteria 915
6 JGI26138J51218_101769 3300003504 Bacteria 856
7 JGI25405J52794_10006415 3300003911 Bacteria 2149
8 Ga0058859_11802859 3300004798 Bacteria 866
9 Ga0058862_11798388 3300004803 Bacteria 1313
10 Ga0065714_10236356 3300005288 Bacteria 779
11 Ga0065704_10070138 3300005289 Bacteria 546071
12 Ga0065704_10253889 3300005289 Bacteria 982
13 Ga0065712_10022016 3300005290 Bacteria 1520
14 Ga0065712_10116807 3300005290 Bacteria 1730
15 Ga0065712_10125065 3300005290 Bacteria 1618
16 Ga0065715_10013657 3300005293 Bacteria 2928
17 Ga0065715_10053092 3300005293 Bacteria 1080
18 Ga0065707_10018862 3300005295 Bacteria 1566
19 Ga0065707_10033643 3300005295 Bacteria 826
20 Ga0065707_10188570 3300005295 Bacteria 1374
21 Ga0065707_10318035 3300005295 Bacteria 972
22 Ga0065707_10395974 3300005295 Bacteria 812
23 Ga0065707_10459045 3300005295 Bacteria 793
24 Ga0070658_10003921 3300005327 Bacteria 12198
25 Ga0070658_10028262 3300005327 Bacteria 4501
26 Ga0070658_10049378 3300005327 Bacteria 3408
27 Ga0070658_10231757 3300005327 Bacteria 1564
28 Ga0070676_10000776 3300005328 Bacteria 15742
29 Ga0070676_10017341 3300005328 Bacteria 3986
30 Ga0070683_100432047 3300005329 Bacteria 1256
31 Ga0070690_100078482 3300005330 Bacteria 2157
32 Ga0070690_100122144 3300005330 Bacteria 1749
33 Ga0070690_100424206 3300005330 Bacteria 981
34 Ga0070670_100000676 3300005331 Bacteria 26494
35 Ga0070670_100004672 3300005331 Bacteria 11489
36 Ga0070670_101189389 3300005331 Bacteria 696
37 Ga0070677_10098142 3300005333 Bacteria 1287
38 Ga0068869_100001260 3300005334 Bacteria 14959
39 Ga0068869_100003281 3300005334 Bacteria 9876
40 Ga0068869_100010655 3300005334 Bacteria 6001
41 Ga0068869_100108807 3300005334 Bacteria 2106
42 Ga0068869_100296890 3300005334 Bacteria 1303
43 Ga0068869_100401364 3300005334 Bacteria 1128
44 Ga0068869_100693547 3300005334 Bacteria 868
45 Ga0070666_10008628 3300005335 Bacteria 6336
46 Ga0070666_10084913 3300005335 Bacteria 2168
47 Ga0070680_100000528 3300005336 Bacteria 26092
48 Ga0070680_100026974 3300005336 Bacteria 4598
49 Ga0070680_100247255 3300005336 Bacteria 1508
50 Ga0070680_100529036 3300005336 Bacteria 1010
51 Ga0070682_100002753 3300005337 Bacteria 9736
52 Ga0070682_100050043 3300005337 Bacteria 2607
53 Ga0070682_100074909 3300005337 Bacteria 2175
54 Ga0070682_100358479 3300005337 Bacteria 1089
55 Ga0068868_100043453 3300005338 Bacteria 3510
56 Ga0068868_100349035 3300005338 Bacteria 1267
57 Ga0068868_100527212 3300005338 Bacteria 1038
58 Ga0068868_100643200 3300005338 Bacteria 943
59 Ga0068868_100646692 3300005338 Bacteria 941
60 Ga0068868_100849815 3300005338 Bacteria 827
61 Ga0068868_101371715 3300005338 Bacteria 659
62 Ga0070660_100000426 3300005339 Bacteria 27900
63 Ga0070689_100000006 3300005340 Bacteria 332562
64 Ga0070689_100006524 3300005340 Bacteria 8089
65 Ga0070689_100053411 3300005340 Bacteria 3127
66 Ga0070689_100726877 3300005340 Bacteria 869
67 Ga0070691_10032656 3300005341 Bacteria 2447
68 Ga0070691_10118880 3300005341 Bacteria 1329
69 Ga0070687_100043723 3300005343 Bacteria 2278
70 Ga0070661_100003135 3300005344 Bacteria 11375
71 Ga0070692_10244994 3300005345 Bacteria 1070
72 Ga0070668_100105404 3300005347 Bacteria 2239
73 Ga0070669_100000101 3300005353 Bacteria 82365
74 Ga0070669_100064427 3300005353 Bacteria 2699
75 Ga0070669_100174558 3300005353 Bacteria 1678
76 Ga0070675_100168526 3300005354 Bacteria 1887
77 Ga0070675_100246739 3300005354 Bacteria 1561
78 Ga0070675_100339621 3300005354 Bacteria 1330
79 Ga0070671_100000754 3300005355 Bacteria 23220
80 Ga0070671_100011000 3300005355 Bacteria 7261
81 Ga0070671_100190950 3300005355 Bacteria 1736
82 Ga0070671_100216405 3300005355 Bacteria 1625
83 Ga0070671_100280035 3300005355 Bacteria 1418
84 Ga0070673_100172544 3300005364 Bacteria 1846
85 Ga0070673_100179567 3300005364 Bacteria 1811
86 Ga0070688_100169213 3300005365 Bacteria 1507
87 Ga0070688_100175465 3300005365 Bacteria 1483
88 Ga0070688_100304993 3300005365 Bacteria 1152
89 Ga0070659_100001410 3300005366 Bacteria 17337
90 Ga0070659_100267117 3300005366 Bacteria 1420
91 Ga0070659_100376844 3300005366 Bacteria 1194
92 Ga0070667_100045969 3300005367 Bacteria 3672
93 Ga0070667_100863394 3300005367 Bacteria 841
94 Ga0070703_10015428 3300005406 Bacteria 2185
95 Ga0070709_10000069 3300005434 Bacteria 79502
96 Ga0070713_100426348 3300005436 Bacteria 1242
97 Ga0070710_10007735 3300005437 Bacteria 5213
98 Ga0070701_10004224 3300005438 Bacteria 5789
99 Ga0070711_100043027 3300005439 Bacteria 3057
100 Ga0070705_100054346 3300005440 Bacteria 2348
101 Ga0070705_100346418 3300005440 Bacteria 1082
102 Ga0070700_100122581 3300005441 Bacteria 1744
103 Ga0070700_100131739 3300005441 Bacteria 1688
104 Ga0070700_100136942 3300005441 Bacteria 1659
105 Ga0070700_100235160 3300005441 Bacteria 1306
106 Ga0070694_100010732 3300005444 Bacteria 5663
107 Ga0070694_100012515 3300005444 Bacteria 5277
108 Ga0070694_100093735 3300005444 Bacteria 2111
109 Ga0070708_100000621 3300005445 Bacteria 26821
110 Ga0070708_100065834 3300005445 Bacteria 3250
111 Ga0070708_100131352 3300005445 Bacteria 2318
112 Ga0070708_100603563 3300005445 Bacteria 1035
113 Ga0070663_100012081 3300005455 Bacteria 5449
114 Ga0070678_100050349 3300005456 Bacteria 3013
115 Ga0070662_100266469 3300005457 Bacteria 1382
116 Ga0070662_100616214 3300005457 Bacteria 914
117 Ga0070681_10007431 3300005458 Bacteria 10713
118 Ga0068867_100011967 3300005459 Bacteria 6129
119 Ga0068867_100014424 3300005459 Bacteria 5600
120 Ga0068867_100042244 3300005459 Bacteria 3334
121 Ga0068867_100080215 3300005459 Bacteria 2457
122 Ga0068867_100083186 3300005459 Bacteria 2416
123 Ga0068867_101178989 3300005459 Bacteria 702
124 Ga0068867_101230599 3300005459 Bacteria 689
125 Ga0070685_10009467 3300005466 Bacteria 5037
126 Ga0070685_10223236 3300005466 Bacteria 1235
127 Ga0070706_100008802 3300005467 Bacteria 9406
128 Ga0070706_100017482 3300005467 Bacteria 6618
129 Ga0070706_100159195 3300005467 Bacteria 2108
130 Ga0070706_100467393 3300005467 Bacteria 1173
131 Ga0070707_100001880 3300005468 Bacteria 20147
132 Ga0070707_100003551 3300005468 Bacteria 14721
133 Ga0070707_100014668 3300005468 Bacteria 7342
134 Ga0070707_100027446 3300005468 Bacteria 5417
135 Ga0070698_100002838 3300005471 Bacteria 19064
136 Ga0070698_100006715 3300005471 Bacteria 12480
137 Ga0070698_100019650 3300005471 Bacteria 7086
138 Ga0070699_100001882 3300005518 Bacteria 18986
139 Ga0070699_100153937 3300005518 Bacteria 2034
140 Ga0070699_100235698 3300005518 Bacteria 1632
141 Ga0070699_100318279 3300005518 Bacteria 1398
142 Ga0070679_100006685 3300005530 Bacteria 10755
143 Ga0070679_100056145 3300005530 Bacteria 3923
144 Ga0070679_100707717 3300005530 Bacteria 950
145 Ga0070684_100009490 3300005535 Bacteria 7666
146 Ga0070684_100457829 3300005535 Bacteria 1179
147 Ga0070697_100001301 3300005536 Bacteria 18814
148 Ga0070697_100005940 3300005536 Bacteria 9433
149 Ga0070697_100059755 3300005536 Bacteria 3105
150 Ga0070697_100079164 3300005536 Bacteria 2705
151 Ga0070697_100143944 3300005536 Bacteria 2006
152 Ga0070697_100646549 3300005536 Unclassified 931
153 Ga0068853_100001027 3300005539 Bacteria 19664
154 Ga0068853_100007929 3300005539 Bacteria 8514
155 Ga0070672_100369788 3300005543 Bacteria 1225
156 Ga0070686_100250168 3300005544 Bacteria 1294
157 Ga0070686_100613463 3300005544 Bacteria 859
158 Ga0070686_100665735 3300005544 Bacteria 827
159 Ga0070695_100000929 3300005545 Bacteria 15797
160 Ga0070695_100001843 3300005545 Bacteria 11953
161 Ga0070695_100002584 3300005545 Bacteria 10448
162 Ga0070695_100181513 3300005545 Bacteria 1491
163 Ga0070695_100199301 3300005545 Bacteria 1430
164 Ga0070695_100212983 3300005545 Unclassified 1388
165 Ga0070695_101036855 3300005545 Bacteria 669
166 Ga0070696_100004929 3300005546 Bacteria 8911
167 Ga0070696_100089371 3300005546 Unclassified 2190
168 Ga0070696_100266438 3300005546 Bacteria 1301
169 Ga0070693_100000146 3300005547 Bacteria 32133
170 Ga0070693_100026273 3300005547 Bacteria 3142
171 Ga0070693_100029579 3300005547 Bacteria 2989
172 Ga0070693_100195444 3300005547 Bacteria 1311
173 Ga0070665_100000468 3300005548 Bacteria 58504
174 Ga0070665_100477260 3300005548 Bacteria 1258
175 Ga0070704_100002293 3300005549 Bacteria 10695
176 Ga0070704_100309548 3300005549 Bacteria 1319
177 Ga0070704_100325789 3300005549 Bacteria 1289
178 Ga0070704_100668278 3300005549 Bacteria 919
179 Ga0070704_101064703 3300005549 Bacteria 734
180 Ga0068855_100000008 3300005563 Bacteria 269155
181 Ga0068855_100004311 3300005563 Bacteria 17392
182 Ga0068855_100088555 3300005563 Bacteria 3575
183 Ga0068855_100105844 3300005563 Bacteria 3234
184 Ga0068855_100614019 3300005563 Bacteria 1171
185 Ga0070664_100038167 3300005564 Bacteria 4042
186 Ga0070664_100113499 3300005564 Bacteria 2367
187 Ga0068857_100042188 3300005577 Bacteria 4046
188 Ga0068857_100346116 3300005577 Bacteria 1376
189 Ga0068857_100792529 3300005577 Bacteria 905
190 Ga0068854_100023122 3300005578 Bacteria 4242
191 Ga0068854_100396325 3300005578 Bacteria 1141
192 Ga0068856_100003684 3300005614 Bacteria 15368
193 Ga0068856_100051817 3300005614 Bacteria 4046
194 Ga0068856_100079170 3300005614 Bacteria 3259
195 Ga0068856_100153581 3300005614 Bacteria 2312
196 Ga0068856_100838497 3300005614 Bacteria 938
197 Ga0070702_100109728 3300005615 Bacteria 1708
198 Ga0070702_100127848 3300005615 Bacteria 1601
199 Ga0068852_100097267 3300005616 Bacteria 2648
200 Ga0068852_100440316 3300005616 Bacteria 1288
201 Ga0068852_100579372 3300005616 Bacteria 1125
202 Ga0068859_100002098 3300005617 Bacteria 20297
203 Ga0068859_100006613 3300005617 Bacteria 11772
204 Ga0068859_100060025 3300005617 Bacteria 3832
205 Ga0068859_100063320 3300005617 Bacteria 3729
206 Ga0068859_100089358 3300005617 Bacteria 3131
207 Ga0068859_100114628 3300005617 Bacteria 2759
208 Ga0068859_100266656 3300005617 Bacteria 1804
209 Ga0068859_100316163 3300005617 Bacteria 1655
210 Ga0068859_100447648 3300005617 Bacteria 1388
211 Ga0068859_100498827 3300005617 Bacteria 1312
212 Ga0068864_100027908 3300005618 Bacteria 4770
213 Ga0068864_100064732 3300005618 Bacteria 3171
214 Ga0068866_10279337 3300005718 Bacteria 1034
215 Ga0068861_100005474 3300005719 Bacteria 8605
216 Ga0068861_100006238 3300005719 Bacteria 8111
217 Ga0068861_100028482 3300005719 Bacteria 4076
218 Ga0068861_100069556 3300005719 Bacteria 2723
219 Ga0068861_101240086 3300005719 Bacteria 723
220 Ga0068870_10001679 3300005840 Bacteria 9049
221 Ga0068870_10138939 3300005840 Bacteria 1419
222 Ga0068863_100103772 3300005841 Bacteria 2704
223 Ga0068863_100915485 3300005841 Bacteria 878
224 Ga0068858_100028938 3300005842 Bacteria 5145
225 Ga0068858_100034519 3300005842 Bacteria 4693
226 Ga0068858_100034572 3300005842 Bacteria 4688
227 Ga0068858_100242639 3300005842 Bacteria 1710
228 Ga0068858_100981203 3300005842 Bacteria 827
229 Ga0068860_100000731 3300005843 Bacteria 37386
230 Ga0068860_100023127 3300005843 Bacteria 6009
231 Ga0068860_100053835 3300005843 Bacteria 3825
232 Ga0068860_100069494 3300005843 Bacteria 3348
233 Ga0068860_100126643 3300005843 Bacteria 2448
234 Ga0068860_100147832 3300005843 Bacteria 2262
235 Ga0068860_100183978 3300005843 Bacteria 2020
236 Ga0068860_100247134 3300005843 Bacteria 1736
237 Ga0068860_100283547 3300005843 Bacteria 1619
238 Ga0068860_100468415 3300005843 Bacteria 1254
239 Ga0068860_100493520 3300005843 Bacteria 1222
240 Ga0068860_100901671 3300005843 Bacteria 900
241 Ga0068862_100002423 3300005844 Bacteria 16565
242 Ga0068862_100018123 3300005844 Bacteria 5862
243 Ga0068862_100058160 3300005844 Bacteria 3316
244 Ga0068862_100085623 3300005844 Bacteria 2739
245 Ga0081455_10001014 3300005937 Bacteria 35534
246 Ga0081455_10037749 3300005937 Bacteria 4285
247 Ga0081539_10011597 3300005985 Bacteria 6944
248 Ga0075363_100302046 3300006048 Bacteria 929
249 Ga0070716_100001417 3300006173 Bacteria 10648
250 Ga0075366_10129618 3300006195 Bacteria 1522
251 Ga0097621_100112150 3300006237 Bacteria 2305
252 Ga0097621_100401702 3300006237 Bacteria 1227
253 Ga0068871_100123063 3300006358 Bacteria 2193
254 Ga0068871_100145538 3300006358 Bacteria 2017
255 Ga0075428_100006662 3300006844 Bacteria 12849
256 Ga0075428_100052589 3300006844 Bacteria 4463
257 Ga0075428_100200965 3300006844 Bacteria 2155
258 Ga0075430_100195039 3300006846 Bacteria 1682
259 Ga0075431_100022715 3300006847 Bacteria 6411
260 Ga0075433_10000359 3300006852 Bacteria 28647
261 Ga0075433_10077553 3300006852 Bacteria 2927
262 Ga0075434_100005805 3300006871 Bacteria 11270
263 Ga0075434_100033813 3300006871 Bacteria 5047
264 Ga0075434_100066243 3300006871 Bacteria 3597
265 Ga0075434_100101803 3300006871 Bacteria 2879
266 Ga0075434_100139278 3300006871 Bacteria 2446
267 Ga0075434_100305050 3300006871 Bacteria 1612
268 Ga0075434_100414855 3300006871 Bacteria 1367
269 Ga0075429_100064624 3300006880 Bacteria 3187
270 Ga0075429_100213610 3300006880 Bacteria 1690
271 Ga0068865_100093495 3300006881 Bacteria 2187
272 Ga0068865_100257007 3300006881 Bacteria 1381
273 Ga0075436_100011613 3300006914 Bacteria 6043
274 Ga0075436_100076996 3300006914 Bacteria 2310
275 Ga0097620_100002098 3300006931 Bacteria 20297
276 Ga0097620_100006613 3300006931 Bacteria 11772
277 Ga0097620_100060026 3300006931 Bacteria 3832
278 Ga0097620_100063323 3300006931 Bacteria 3729
279 Ga0097620_100089354 3300006931 Bacteria 3131
280 Ga0097620_100114627 3300006931 Bacteria 2759
281 Ga0097620_100266646 3300006931 Bacteria 1804
282 Ga0097620_100316154 3300006931 Bacteria 1655
283 Ga0097620_100447629 3300006931 Bacteria 1388
284 Ga0097620_100498849 3300006931 Bacteria 1312
285 Ga0075435_100013015 3300007076 Bacteria 6175
286 Ga0075435_100051960 3300007076 Bacteria 3302
287 Ga0099794_10000473 3300007265 Bacteria 13477
288 Ga0099794_10439255 3300007265 Bacteria 684
289 Ga0105240_10003810 3300009093 Bacteria 23297
290 Ga0111539_10020642 3300009094 Bacteria 8113
291 Ga0111539_10022170 3300009094 Bacteria 7807
292 Ga0111539_10031784 3300009094 Bacteria 6413
293 Ga0111539_10138106 3300009094 Bacteria 2855
294 Ga0111539_10144756 3300009094 Bacteria 2782
295 Ga0111539_10180876 3300009094 Bacteria 2462
296 Ga0111539_10341252 3300009094 Bacteria 1744
297 Ga0111539_10395178 3300009094 Bacteria 1610
298 Ga0111539_10403280 3300009094 Bacteria 1592
299 Ga0111539_10897299 3300009094 Bacteria 1031
300 Ga0105245_10254118 3300009098 Bacteria 1708
301 Ga0105245_10827073 3300009098 Bacteria 965
302 Ga0105247_10005229 3300009101 Bacteria 8196
303 Ga0105247_10009646 3300009101 Bacteria 5856
304 Ga0105247_10083679 3300009101 Bacteria 2015
305 Ga0114129_10045507 3300009147 Bacteria 6170
306 Ga0114129_10107418 3300009147 Unclassified 3855
307 Ga0114129_10141275 3300009147 Bacteria 3300
308 Ga0114129_10179061 3300009147 Bacteria 2886
309 Ga0114129_10278763 3300009147 Bacteria 2234
310 Ga0105243_10013772 3300009148 Bacteria 6118
311 Ga0105243_10107048 3300009148 Bacteria 2331
312 Ga0105243_10169537 3300009148 Bacteria 1889
313 Ga0105243_10239279 3300009148 Bacteria 1614
314 Ga0105241_10001244 3300009174 Bacteria 19451
315 Ga0105241_10019852 3300009174 Bacteria 4960
316 Ga0105241_11213857 3300009174 Bacteria 715
317 Ga0105241_11304685 3300009174 Bacteria 691
318 Ga0105242_10058807 3300009176 Bacteria 3153
319 Ga0105242_10080837 3300009176 Bacteria 2716
320 Ga0105242_10741139 3300009176 Bacteria 966
321 Ga0105242_10802452 3300009176 Bacteria 932
322 Ga0105242_11315218 3300009176 Bacteria 747
323 Ga0105248_10034283 3300009177 Bacteria 5675
324 Ga0105248_10071591 3300009177 Unclassified 3895
325 Ga0105248_10092938 3300009177 Bacteria 3397
326 Ga0105248_10700745 3300009177 Bacteria 1142
327 Ga0105248_11245377 3300009177 Bacteria 841
328 Ga0105237_10025830 3300009545 Bacteria 6005
329 Ga0105237_10063412 3300009545 Bacteria 3693
330 Ga0105237_10090891 3300009545 Bacteria 3042
331 Ga0105237_10436219 3300009545 Bacteria 1315
332 Ga0105237_11368577 3300009545 Bacteria 714
333 Ga0105238_10012280 3300009551 Bacteria 8637
334 Ga0105238_10021367 3300009551 Bacteria 6594
335 Ga0105249_10016555 3300009553 Bacteria 6543
336 Ga0105249_10043997 3300009553 Bacteria 4061
337 Ga0105249_10061068 3300009553 Bacteria 3458
338 Ga0105249_10062638 3300009553 Bacteria 3415
339 Ga0105249_10148838 3300009553 Bacteria 2252
340 Ga0105249_10227386 3300009553 Bacteria 1839
341 Ga0105239_10143070 3300010375 Bacteria 2666
342 Ga0105246_10112952 3300011119 Bacteria 1999
343 Ga0105246_11218262 3300011119 Bacteria 694
344 Ga0157373_10000365 3300013100 Bacteria 36276
345 Ga0157373_10049691 3300013100 Bacteria 2988
346 Ga0157371_10136548 3300013102 Bacteria 1746
347 Ga0157370_10078508 3300013104 Bacteria 3109
348 Ga0157369_10042793 3300013105 Bacteria 4941
349 Ga0157374_10505737 3300013296 Bacteria 1213
350 Ga0157374_10861474 3300013296 Bacteria 923
351 Ga0157378_10602834 3300013297 Bacteria 1110
352 Ga0157378_11267619 3300013297 Bacteria 778
353 Ga0163162_10097139 3300013306 Bacteria 3034
354 Ga0163162_10292499 3300013306 Bacteria 1760
355 Ga0163162_10346842 3300013306 Bacteria 1617
356 Ga0163162_10517914 3300013306 Bacteria 1322
357 Ga0163162_10734787 3300013306 Bacteria 1107
358 Ga0163162_11302732 3300013306 Bacteria 825
359 Ga0157372_10000337 3300013307 Bacteria 51578
360 Ga0157372_10083849 3300013307 Bacteria 3610
361 Ga0157372_10579165 3300013307 Bacteria 1308
362 Ga0157375_10084173 3300013308 Bacteria 3228
363 Ga0157375_10142074 3300013308 Bacteria 2528
364 Ga0157375_10179993 3300013308 Bacteria 2265
365 Ga0157375_10342129 3300013308 Bacteria 1661
366 Ga0157375_11020151 3300013308 Bacteria 966
367 Ga0163163_10004457 3300014325 Bacteria 11940
368 Ga0163163_10084984 3300014325 Bacteria 3172
369 Ga0163163_10991655 3300014325 Bacteria 903
370 Ga0163163_11763240 3300014325 Bacteria 679
371 Ga0157380_10039465 3300014326 Bacteria 3672
372 Ga0157380_10152978 3300014326 Bacteria 1997
373 Ga0157380_10263923 3300014326 Bacteria 1566
374 Ga0157380_10292821 3300014326 Bacteria 1495
375 Ga0157380_10458909 3300014326 Bacteria 1226
376 Ga0182008_10222118 3300014497 Bacteria 967
377 Ga0157377_10137349 3300014745 Bacteria 1499
378 Ga0157379_10303007 3300014968 Bacteria 1457
379 Ga0157379_10568998 3300014968 Bacteria 1055
380 Ga0157376_10252572 3300014969 Bacteria 1648
381 Ga0157376_10816212 3300014969 Bacteria 946
382 Ga0163161_10310229 3300017792 Bacteria 1245
383 Ga0163161_10315658 3300017792 Bacteria 1234
384 Ga0163161_10654360 3300017792 Bacteria 871
385 Ga0213876_10055671 3300021384 Bacteria 2088
386 Ga0207653_10001878 3300025885 Bacteria 6727
387 Ga0207653_10062310 3300025885 Bacteria 1260
388 Ga0207682_10110724 3300025893 Bacteria 1209
389 Ga0207692_10009090 3300025898 Bacteria 4136
390 Ga0207710_10001835 3300025900 Bacteria 10234
391 Ga0207710_10002733 3300025900 Bacteria 8080
392 Ga0207710_10046541 3300025900 Bacteria 1937
393 Ga0207710_10203397 3300025900 Bacteria 979
394 Ga0207688_10140724 3300025901 Bacteria 1420
395 Ga0207680_10070357 3300025903 Bacteria 2165
396 Ga0207680_10167778 3300025903 Bacteria 1476
397 Ga0207685_10188480 3300025905 Bacteria 961
398 Ga0207699_10000032 3300025906 Bacteria 137608
399 Ga0207645_10001806 3300025907 Bacteria 17280
400 Ga0207645_10024477 3300025907 Bacteria 3913
401 Ga0207643_10003293 3300025908 Bacteria 8720
402 Ga0207643_10142433 3300025908 Bacteria 1433
403 Ga0207643_10302606 3300025908 Bacteria 995
404 Ga0207705_10032167 3300025909 Bacteria 3748
405 Ga0207684_10015141 3300025910 Bacteria 6641
406 Ga0207684_10023721 3300025910 Bacteria 5235
407 Ga0207684_10068409 3300025910 Bacteria 3018
408 Ga0207684_10455147 3300025910 Bacteria 1099
409 Ga0207654_10008756 3300025911 Bacteria 5130
410 Ga0207654_10009448 3300025911 Bacteria 4952
411 Ga0207707_10004696 3300025912 Bacteria 11991
412 Ga0207671_10006096 3300025914 Bacteria 10856
413 Ga0207671_10064278 3300025914 Bacteria 2728
414 Ga0207660_10028839 3300025917 Bacteria 3801
415 Ga0207660_10140624 3300025917 Bacteria 1845
416 Ga0207660_10472524 3300025917 Bacteria 1015
417 Ga0207662_10074356 3300025918 Bacteria 2062
418 Ga0207662_10206742 3300025918 Bacteria 1273
419 Ga0207657_10000869 3300025919 Bacteria 31879
420 Ga0207657_10662685 3300025919 Bacteria 812
421 Ga0207649_10007930 3300025920 Bacteria 5780
422 Ga0207652_10003687 3300025921 Bacteria 12594
423 Ga0207652_10017916 3300025921 Bacteria 5803
424 Ga0207652_10024161 3300025921 Bacteria 5040
425 Ga0207646_10002690 3300025922 Bacteria 20839
426 Ga0207646_10010797 3300025922 Bacteria 8880
427 Ga0207646_10017494 3300025922 Bacteria 6707
428 Ga0207681_10000006 3300025923 Bacteria 496979
429 Ga0207681_10291479 3300025923 Bacteria 1288
430 Ga0207681_10449942 3300025923 Bacteria 1048
431 Ga0207694_10121602 3300025924 Bacteria 2085
432 Ga0207694_10381457 3300025924 Bacteria 1170
433 Ga0207650_10000001 3300025925 Bacteria 1545726
434 Ga0207650_10021459 3300025925 Bacteria 4564
435 Ga0207650_10114118 3300025925 Bacteria 2095
436 Ga0207650_10181712 3300025925 Bacteria 1676
437 Ga0207650_10337678 3300025925 Bacteria 1237
438 Ga0207659_10213718 3300025926 Bacteria 1547
439 Ga0207687_10159312 3300025927 Bacteria 1730
440 Ga0207687_10315559 3300025927 Bacteria 1264
441 Ga0207700_10250206 3300025928 Bacteria 1514
442 Ga0207644_10000588 3300025931 Bacteria 23241
443 Ga0207644_10062151 3300025931 Bacteria 2707
444 Ga0207644_10632233 3300025931 Bacteria 890
445 Ga0207644_10845973 3300025931 Bacteria 766
446 Ga0207690_10011627 3300025932 Bacteria 5260
447 Ga0207706_10001836 3300025933 Bacteria 20828
448 Ga0207686_10046819 3300025934 Bacteria 2670
449 Ga0207686_10347348 3300025934 Bacteria 1116
450 Ga0207709_10028978 3300025935 Bacteria 3205
451 Ga0207709_10191543 3300025935 Bacteria 1453
452 Ga0207709_10254613 3300025935 Bacteria 1284
453 Ga0207670_10000003 3300025936 Bacteria 760449
454 Ga0207670_10011404 3300025936 Bacteria 5158
455 Ga0207670_10056731 3300025936 Bacteria 2653
456 Ga0207670_10057504 3300025936 Bacteria 2638
457 Ga0207670_10133043 3300025936 Bacteria 1825
458 Ga0207670_11061220 3300025936 Bacteria 683
459 Ga0207669_10094462 3300025937 Bacteria 1957
460 Ga0207704_10155920 3300025938 Bacteria 1618
461 Ga0207665_10000918 3300025939 Bacteria 19914
462 Ga0207665_10461065 3300025939 Bacteria 977
463 Ga0207691_10073114 3300025940 Bacteria 3092
464 Ga0207691_10260398 3300025940 Bacteria 1495
465 Ga0207691_10875762 3300025940 Bacteria 752
466 Ga0207691_10915505 3300025940 Bacteria 734
467 Ga0207711_10123123 3300025941 Bacteria 2317
468 Ga0207711_10159900 3300025941 Bacteria 2038
469 Ga0207711_10209004 3300025941 Bacteria 1782
470 Ga0207711_10251832 3300025941 Bacteria 1622
471 Ga0207711_10677938 3300025941 Bacteria 961
472 Ga0207711_10716374 3300025941 Bacteria 933
473 Ga0207689_10000110 3300025942 Bacteria 67347
474 Ga0207689_10003348 3300025942 Bacteria 14679
475 Ga0207689_10041955 3300025942 Bacteria 3786
476 Ga0207689_10122087 3300025942 Bacteria 2142
477 Ga0207689_10953625 3300025942 Bacteria 724
478 Ga0207689_11073846 3300025942 Bacteria 679
479 Ga0207679_10002898 3300025945 Bacteria 10642
480 Ga0207679_10136955 3300025945 Bacteria 1973
481 Ga0207667_10000088 3300025949 Bacteria 149413
482 Ga0207667_10001835 3300025949 Bacteria 26686
483 Ga0207667_10020739 3300025949 Bacteria 7301
484 Ga0207667_10585350 3300025949 Bacteria 1126
485 Ga0207651_10232562 3300025960 Bacteria 1497
486 Ga0207651_10367386 3300025960 Bacteria 1216
487 Ga0207712_10003176 3300025961 Bacteria 10463
488 Ga0207712_10007574 3300025961 Bacteria 6860
489 Ga0207712_10057735 3300025961 Bacteria 2740
490 Ga0207712_10118073 3300025961 Bacteria 2002
491 Ga0207712_10124735 3300025961 Bacteria 1954
492 Ga0207712_10205234 3300025961 Bacteria 1566
493 Ga0207712_10458923 3300025961 Bacteria 1082
494 Ga0207712_10599535 3300025961 Bacteria 953
495 Ga0207640_10007214 3300025981 Bacteria 6128
496 Ga0207658_10068101 3300025986 Bacteria 2684
497 Ga0207677_10016559 3300026023 Bacteria 4371
498 Ga0207677_10027695 3300026023 Bacteria 3574
499 Ga0207677_10588495 3300026023 Bacteria 975
500 Ga0207677_11220261 3300026023 Bacteria 689
501 Ga0207703_10050125 3300026035 Bacteria 3378
502 Ga0207703_10190554 3300026035 Bacteria 1816
503 Ga0207703_10286952 3300026035 Bacteria 1497
504 Ga0207703_10782568 3300026035 Bacteria 910
505 Ga0207639_10008046 3300026041 Bacteria 7207
506 Ga0207639_10048141 3300026041 Bacteria 3225
507 Ga0207678_10000307 3300026067 Bacteria 44046
508 Ga0207708_10051505 3300026075 Bacteria 3134
509 Ga0207708_10113443 3300026075 Bacteria 2106
510 Ga0207708_10144672 3300026075 Bacteria 1868
511 Ga0207708_10165362 3300026075 Bacteria 1749
512 Ga0207708_10194037 3300026075 Bacteria 1618
513 Ga0207708_10203007 3300026075 Bacteria 1582
514 Ga0207708_10587247 3300026075 Bacteria 942
515 Ga0207702_10030507 3300026078 Bacteria 4493
516 Ga0207702_10080749 3300026078 Bacteria 2822
517 Ga0207702_10292056 3300026078 Bacteria 1545
518 Ga0207702_10644715 3300026078 Bacteria 1041
519 Ga0207641_10157056 3300026088 Bacteria 2064
520 Ga0207641_10621966 3300026088 Bacteria 1059
521 Ga0207641_11091688 3300026088 Bacteria 796
522 Ga0207648_10009631 3300026089 Bacteria 9240
523 Ga0207648_10103166 3300026089 Bacteria 2501
524 Ga0207648_10104211 3300026089 Bacteria 2487
525 Ga0207648_10133891 3300026089 Bacteria 2182
526 Ga0207648_10144118 3300026089 Bacteria 2101
527 Ga0207648_10190493 3300026089 Bacteria 1817
528 Ga0207676_10007116 3300026095 Bacteria 7927
529 Ga0207674_10000181 3300026116 Bacteria 77248
530 Ga0207674_10167742 3300026116 Bacteria 2149
531 Ga0207674_10305356 3300026116 Bacteria 1540
532 Ga0207674_10388083 3300026116 Bacteria 1350
533 Ga0207675_100029052 3300026118 Bacteria 5152
534 Ga0207675_100054950 3300026118 Bacteria 3715
535 Ga0207675_100082780 3300026118 Bacteria 3010
536 Ga0207675_100088344 3300026118 Bacteria 2911
537 Ga0207675_100219711 3300026118 Bacteria 1831
538 Ga0207675_100269438 3300026118 Bacteria 1652
539 Ga0207683_10006580 3300026121 Bacteria 9946
540 Ga0207683_10793317 3300026121 Bacteria 879
541 Ga0207698_10010871 3300026142 Bacteria 5876
542 Ga0207698_10141744 3300026142 Bacteria 2072
543 Ga0207698_11323502 3300026142 Bacteria 735
544 Ga0209969_1008892 3300027360 Bacteria 1426
545 Ga0209967_1009478 3300027364 Bacteria 1350
546 Ga0209981_1003950 3300027378 Bacteria 1931
547 Ga0209996_1001105 3300027395 Bacteria 3217
548 Ga0209984_1002122 3300027424 Bacteria 2199
549 Ga0210000_1007312 3300027462 Bacteria 1615
550 Ga0209995_1001050 3300027471 Bacteria 4249
551 Ga0209968_1003024 3300027526 Bacteria 2522
552 Ga0209999_1000025 3300027543 Bacteria 15396
553 Ga0209982_1001508 3300027552 Bacteria 3195
554 Ga0209970_1007998 3300027614 Bacteria 1736
555 Ga0210002_1003118 3300027617 Bacteria 2434
556 Ga0209983_1000033 3300027665 Bacteria 19538
557 Ga0209588_1000002 3300027671 Bacteria 311181
558 Ga0209971_1000127 3300027682 Bacteria 22754
559 Ga0209971_1021525 3300027682 Bacteria 1534
560 Ga0209966_1000147 3300027695 Bacteria 30199
561 Ga0209998_10000063 3300027717 Bacteria 42726
562 Ga0209998_10002609 3300027717 Bacteria 4084
563 Ga0209998_10064551 3300027717 Bacteria 867
564 Ga0209974_10009869 3300027876 Bacteria 3229
565 Ga0209974_10024507 3300027876 Bacteria 1997
566 Ga0209974_10036896 3300027876 Bacteria 1623
567 Ga0207428_10071934 3300027907 Bacteria 2715
568 Ga0207428_10104750 3300027907 Bacteria 2182
569 Ga0207428_10205343 3300027907 Bacteria 1482
570 Ga0207428_10599782 3300027907 Bacteria 794
571 Ga0268266_10001122 3300028379 Bacteria 33408
572 Ga0268266_10338834 3300028379 Bacteria 1411
573 Ga0268266_10414700 3300028379 Bacteria 1275
574 Ga0268266_10866496 3300028379 Bacteria 873
575 Ga0268265_10008184 3300028380 Bacteria 7062
576 Ga0268265_10010285 3300028380 Bacteria 6319
577 Ga0268265_10010902 3300028380 Bacteria 6139
578 Ga0268265_10016947 3300028380 Bacteria 5016
579 Ga0268265_10055261 3300028380 Bacteria 3016
580 Ga0268265_10549715 3300028380 Bacteria 1096
581 Ga0268265_11334530 3300028380 Bacteria 718
582 Ga0268264_10012235 3300028381 Bacteria 7059
583 Ga0268264_10047256 3300028381 Bacteria 3578
584 Ga0268264_10190245 3300028381 Bacteria 1870
585 Ga0268264_10211988 3300028381 Bacteria 1779
586 Ga0268264_10313492 3300028381 Bacteria 1481
587 Ga0268264_10382123 3300028381 Bacteria 1349
588 Ga0268264_10464202 3300028381 Bacteria 1229
589 Ga0268264_10802402 3300028381 Bacteria 940
590 Ga0265337_1001863 3300028556 Bacteria 10066
591 Ga0265337_1016100 3300028556 Bacteria 2428
592 Ga0265319_1000099 3300028563 Bacteria 66865
593 Ga0265334_10014627 3300028573 Bacteria 3269
594 Ga0265334_10046285 3300028573 Bacteria 1682
595 Ga0265318_10000029 3300028577 Bacteria 147471
596 Ga0265318_10000030 3300028577 Bacteria 146681
597 Ga0265318_10000475 3300028577 Bacteria 29608
598 Ga0265318_10004793 3300028577 Bacteria 6477
599 Ga0265318_10007653 3300028577 Bacteria 4864
600 Ga0265318_10061542 3300028577 Bacteria 1398
601 Ga0265323_10001946 3300028653 Bacteria 9742
602 Ga0265323_10004203 3300028653 Bacteria 6229
603 Ga0265323_10013094 3300028653 Bacteria 3316
604 Ga0265323_10014451 3300028653 Bacteria 3127
605 Ga0265323_10097669 3300028653 Bacteria 975
606 Ga0265322_10002919 3300028654 Bacteria 5205
607 Ga0265322_10036956 3300028654 Bacteria 1391
608 Ga0265322_10125536 3300028654 Bacteria 731
609 Ga0307515_10372973 3300028794 Bacteria 1063
610 Ga0265338_10014764 3300028800 Bacteria 8650
611 Ga0265338_10018298 3300028800 Bacteria 7506
612 Ga0265338_10096509 3300028800 Bacteria 2425
613 Ga0265338_10120824 3300028800 Bacteria 2088
614 Ga0265324_10000038 3300029957 Bacteria 119212
615 Ga0265324_10015664 3300029957 Bacteria 2785
616 Ga0307511_10015383 3300030521 Bacteria 7412
617 Ga0265760_10083153 3300031090 Bacteria 994
618 Ga0265760_10205980 3300031090 Bacteria 666
619 Ga0265330_10000105 3300031235 Bacteria 69914
620 Ga0265330_10000241 3300031235 Bacteria 41254
621 Ga0265330_10000632 3300031235 Bacteria 22707
622 Ga0265330_10001005 3300031235 Bacteria 17146
623 Ga0265330_10002964 3300031235 Bacteria 9036
624 Ga0265330_10006503 3300031235 Bacteria 5780
625 Ga0265330_10025563 3300031235 Bacteria 2675
626 Ga0265330_10041190 3300031235 Bacteria 2048
627 Ga0265330_10073806 3300031235 Bacteria 1474
628 Ga0265330_10077872 3300031235 Bacteria 1430
629 Ga0265332_10000032 3300031238 Bacteria 154668
630 Ga0265332_10015705 3300031238 Bacteria 3342
631 Ga0265332_10042803 3300031238 Bacteria 1956
632 Ga0265328_10002510 3300031239 Bacteria 8229
633 Ga0265328_10051728 3300031239 Bacteria 1508
634 Ga0265320_10000017 3300031240 Bacteria 196688
635 Ga0265320_10000044 3300031240 Bacteria 121907
636 Ga0265320_10006167 3300031240 Bacteria 7587
637 Ga0265320_10072652 3300031240 Bacteria 1618
638 Ga0265325_10000206 3300031241 Bacteria 41713
639 Ga0265325_10008209 3300031241 Bacteria 6180
640 Ga0265325_10020686 3300031241 Bacteria 3624
641 Ga0265329_10000025 3300031242 Bacteria 61323
642 Ga0265329_10000043 3300031242 Bacteria 53348
643 Ga0265329_10000299 3300031242 Bacteria 26141
644 Ga0265329_10009972 3300031242 Bacteria 3513
645 Ga0265329_10010702 3300031242 Bacteria 3358
646 Ga0265329_10024535 3300031242 Bacteria 2002
647 Ga0265329_10035248 3300031242 Bacteria 1615
648 Ga0265340_10000434 3300031247 Bacteria 22478
649 Ga0265340_10002905 3300031247 Bacteria 9753
650 Ga0265340_10010701 3300031247 Bacteria 4902
651 Ga0265339_10000039 3300031249 Bacteria 120661
652 Ga0265339_10019068 3300031249 Bacteria 4031
653 Ga0265339_10031471 3300031249 Bacteria 2998
654 Ga0265331_10000027 3300031250 Bacteria 220058
655 Ga0265331_10000451 3300031250 Bacteria 39806
656 Ga0265331_10001080 3300031250 Bacteria 20991
657 Ga0265331_10007233 3300031250 Bacteria 6440
658 Ga0265331_10024917 3300031250 Bacteria 3022
659 Ga0265327_10175481 3300031251 Unclassified 982
660 Ga0265316_10000065 3300031344 Bacteria 111353
661 Ga0265316_10000149 3300031344 Bacteria 76775
662 Ga0265316_10000295 3300031344 Bacteria 56326
663 Ga0265316_10000335 3300031344 Bacteria 52689
664 Ga0265316_10000357 3300031344 Bacteria 51535
665 Ga0265316_10003769 3300031344 Bacteria 15247
666 Ga0265316_10005799 3300031344 Bacteria 11915
667 Ga0265316_10006101 3300031344 Bacteria 11562
668 Ga0265316_10015302 3300031344 Bacteria 6711
669 Ga0265316_10030110 3300031344 Bacteria 4455
670 Ga0265316_10048454 3300031344 Bacteria 3353
671 Ga0265316_10049586 3300031344 Bacteria 3306
672 Ga0265316_10254787 3300031344 Bacteria 1288
673 Ga0307513_10368745 3300031456 Bacteria 1179
674 Ga0265313_10000002 3300031595 Bacteria 205344
675 Ga0265313_10000236 3300031595 Bacteria 59962
676 Ga0265313_10000738 3300031595 Bacteria 33542
677 Ga0265313_10006604 3300031595 Bacteria 8151
678 Ga0265313_10016017 3300031595 Bacteria 4334
679 Ga0265313_10033854 3300031595 Bacteria 2591
680 Ga0265313_10035680 3300031595 Bacteria 2502
681 Ga0265313_10050459 3300031595 Bacteria 1996
682 Ga0307508_10000625 3300031616 Bacteria 42514
683 Ga0307508_10036128 3300031616 Bacteria 4450
684 Ga0265314_10000015 3300031711 Bacteria 397180
685 Ga0265314_10000069 3300031711 Bacteria 153728
686 Ga0265314_10000701 3300031711 Bacteria 40596
687 Ga0265314_10001957 3300031711 Bacteria 21929
688 Ga0265314_10013250 3300031711 Bacteria 6673
689 Ga0265314_10014365 3300031711 Bacteria 6342
690 Ga0265314_10081691 3300031711 Bacteria 2128
691 Ga0265342_10000072 3300031712 Bacteria 106658
692 Ga0265342_10000228 3300031712 Bacteria 63409
693 Ga0265342_10000724 3300031712 Bacteria 34052
694 Ga0265342_10002007 3300031712 Bacteria 18103
695 Ga0265342_10009882 3300031712 Bacteria 6674
696 Ga0265342_10009972 3300031712 Bacteria 6638
697 Ga0265342_10014161 3300031712 Bacteria 5305
698 Ga0265342_10017542 3300031712 Bacteria 4652
699 Ga0265342_10018406 3300031712 Bacteria 4526
700 Ga0265342_10019495 3300031712 Bacteria 4369
701 Ga0265342_10021206 3300031712 Bacteria 4153
702 Ga0316576_10037033 3300031727 Bacteria 3490
703 Ga0316576_10156263 3300031727 Bacteria 1719
704 Ga0316576_10194326 3300031727 Bacteria 1529
705 Ga0316576_10232406 3300031727 Bacteria 1386
706 Ga0316576_10286860 3300031727 Bacteria 1232
707 Ga0316576_10777193 3300031727 Bacteria 690
708 Ga0316578_10017309 3300031728 Bacteria 3919
709 Ga0316578_10058448 3300031728 Bacteria 2267
710 Ga0316578_10113217 3300031728 Bacteria 1630
711 Ga0307516_10076755 3300031730 Bacteria 3192
712 Ga0307405_10735750 3300031731 Bacteria 820
713 Ga0307410_10338206 3300031852 Bacteria 1199
714 Ga0307406_10070939 3300031901 Bacteria 2282
715 Ga0307407_10084008 3300031903 Bacteria 1933
716 Ga0307407_10810146 3300031903 Bacteria 713
717 Ga0307409_100133090 3300031995 Bacteria 2129
718 Ga0307409_100280293 3300031995 Bacteria 1540
719 Ga0307409_100609875 3300031995 Bacteria 1080
720 Ga0316583_10104212 3300032133 Bacteria 989
721 Ga0307507_10026247 3300033179 Bacteria 6287
722 Ga0316588_1089920 3300033528 Bacteria 764
723 Ga0316596_1128160 3300033541 Bacteria 692
724 Ga0373948_0003013 3300034817 Bacteria 2549
725 Ga0373950_0000025 3300034818 Bacteria 177524
726 Ga0373929_0000003 3300035085 Bacteria 575058
727 Ga0373929_0054054 3300035085 Bacteria 924
728 Ga0373951_0006119 3300035091 Bacteria 2764
729 Ga0373941_0076371 3300035115 Bacteria 1123
730 Ga0373941_0125926 3300035115 Bacteria 918
731 Ga0373953_0031638 3300035117 Bacteria 2059
732 Ga0373943_0599808 3300035170 Bacteria 649
733 Ga0373961_0001172 3300035241 Bacteria 8187
734 Ga0373961_0108842 3300035241 Bacteria 906
735 Ga0373961_0184894 3300035241 Unclassified 728
736 Ga0316574_0005968 3300035398 Bacteria 6536
737 Ga0316574_0125277 3300035398 Bacteria 1651
738 Ga0373935_0002532 3300035692 Bacteria 10467
739 Ga0373935_0812402 3300035692 Bacteria 691
740 Ga0373927_0392351 3300035695 Bacteria 916
741 Ga0373933_0056772 3300035724 Bacteria 2351
742 Ga0373933_0568646 3300035724 Bacteria 744
743 Ga0373937_0051072 3300036401 Bacteria 3790
744 Ga0373937_0507409 3300036401 Bacteria 1146
745 Ga0316582_0105272 3300036647 Bacteria 1873
746 Ga0316582_0267449 3300036647 Bacteria 1173
747 Ga0316584_0000540 3300036712 Bacteria 20258
748 Ga0316584_0032828 3300036712 Bacteria 3842
749 Ga0373925_0934834 3300037068 Bacteria 714
750 Ga0395900_0021425 3300037418 Bacteria 6608
751 Ga0395905_0000007 3300037471 Bacteria 521849
752 Ga0395905_0040561 3300037471 Bacteria 4368
753 Ga0395905_0377252 3300037471 Bacteria 1312
754 Ga0400489_22377 3300039093 Bacteria 2187
755 Ga0400489_46890 3300039093 Bacteria 1504
756 Ga0436365_0236220 3300039437 Bacteria 841
757 Ga0436365_0443710 3300039437 Bacteria 1398
758 Ga0436365_0746798 3300039437 Bacteria 1272
759 Ga0436360_0270732 3300039438 Bacteria 1049
760 Ga0436360_1236090 3300039438 Bacteria 800
761 Ga0436361_0457863 3300039447 Bacteria 688
762 Ga0436362_0969985 3300039453 Bacteria 929
763 Ga0439465_0006935 3300041413 Bacteria 3597
764 Ga0451804_1112314 3300041463 Bacteria 683
765 Ga0451807_0466492 3300041486 Bacteria 841
766 Ga0451807_0748572 3300041486 Bacteria 793
767 Ga0451807_2420813 3300041486 Bacteria 684
768 Ga0451837_0432478 3300041494 Bacteria 1908
769 Ga0451837_1517064 3300041494 Bacteria 675
770 Ga0451849_0266999 3300041505 Bacteria 1973
771 Ga0451853_2328441 3300041512 Bacteria 8190
772 Ga0439448_0057917 3300042005 Bacteria 1277
773 Ga0439449_0126597 3300042007 Bacteria 949
774 Ga0450914_015202 3300042118 Bacteria 802
775 Ga0439458_0002681 3300042157 Bacteria 4297
776 Ga0439459_0003940 3300042438 Bacteria 2376
777 Ga0439460_0005362 3300042461 Unclassified 3144
778 Ga0451577_0004861 3300042876 Bacteria 14000
779 Ga0451577_0060969 3300042876 Bacteria 3363
780 Ga0451577_0068708 3300042876 Bacteria 3159
781 Ga0451577_0187372 3300042876 Bacteria 1866
782 Ga0451577_0187777 3300042876 Bacteria 1864
783 Ga0451577_0221684 3300042876 Bacteria 1709
784 Ga0451577_0300251 3300042876 Bacteria 1455
785 Ga0451577_0437455 3300042876 Bacteria 1187
786 Ga0451577_0648440 3300042876 Bacteria 957
787 Ga0451577_0847925 3300042876 Bacteria 824
788 Ga0439440_0157996 3300042993 Bacteria 653
789 Ga0453683_0005763 3300044673 Bacteria 8587
790 Ga0453683_0007604 3300044673 Bacteria 7342
791 Ga0453683_0084631 3300044673 Bacteria 1987
792 Ga0453683_0115539 3300044673 Bacteria 1688
793 Ga0453683_0145449 3300044673 Bacteria 1496
794 Ga0453683_0157653 3300044673 Bacteria 1435
795 Ga0453683_0179694 3300044673 Bacteria 1342
796 Ga0453683_0191359 3300044673 Bacteria 1298
797 Ga0466965_0192703 3300044683 Bacteria 1079
798 Ga0453684_0000248 3300044712 Bacteria 232277
799 Ga0453684_0001332 3300044712 Bacteria 72577
800 Ga0453684_0022768 3300044712 Bacteria 9277
801 Ga0453684_0066745 3300044712 Bacteria 4579
802 Ga0453684_0070346 3300044712 Bacteria 4432
803 Ga0453684_0071348 3300044712 Bacteria 4392
804 Ga0453684_0081014 3300044712 Bacteria 4050
805 Ga0453684_0085533 3300044712 Bacteria 3917
806 Ga0453684_0087813 3300044712 Bacteria 3852
807 Ga0453684_0089075 3300044712 Bacteria 3818
808 Ga0453684_0111758 3300044712 Bacteria 3318
809 Ga0453684_0117881 3300044712 Bacteria 3212
810 Ga0453684_0236095 3300044712 Bacteria 2108
811 Ga0453684_0236534 3300044712 Bacteria 2105
812 Ga0453684_0250322 3300044712 Bacteria 2035
813 Ga0453684_0417920 3300044712 Bacteria 1498
814 Ga0453684_0467878 3300044712 Bacteria 1401
815 Ga0453684_1070516 3300044712 Bacteria 854
816 Ga0453684_1100224 3300044712 Bacteria 839
817 Ga0466957_0603979 3300044842 Bacteria 768
818 Ga0466960_0058594 3300044901 Bacteria 1881
819 Ga0466959_0336449 3300045049 Bacteria 1030
820 Ga0451576_0009882 3300045051 Bacteria 11020
821 Ga0451576_0021018 3300045051 Bacteria 7100
822 Ga0451576_0216876 3300045051 Bacteria 1998
823 Ga0451576_0330478 3300045051 Bacteria 1595
824 Ga0466967_0184983 3300045976 Bacteria 1967
825 Ga0466967_0347253 3300045976 Bacteria 1436
826 Ga0495603_0186071 3300046455 Bacteria 1201
827 Ga0495603_0292366 3300046455 Bacteria 936
828 Ga0495582_0153000 3300046473 Bacteria 1310
829 Ga0495584_0096153 3300046491 Bacteria 1496
830 Ga0495644_0076239 3300046523 Bacteria 1263
831 Ga0495640_0196607 3300046533 Bacteria 1280
832 Ga0495598_0038431 3300046537 Bacteria 1386
833 Ga0495621_0007472 3300046539 Bacteria 3238
834 Ga0495622_0043156 3300046557 Bacteria 2097
835 Ga0495622_0091996 3300046557 Bacteria 1393
836 Ga0495661_0369374 3300046665 Bacteria 703
837 Ga0495647_0096502 3300046681 Bacteria 1219
838 Ga0495658_0245136 3300046683 Bacteria 1126
839 Ga0495581_0023218 3300047315 Bacteria 3594
840 Ga0495581_0080963 3300047315 Bacteria 1880
841 Ga0495676_0130318 3300047321 Bacteria 1816
842 Ga0495680_0142001 3300047322 Bacteria 1756
843 Ga0495680_0288996 3300047322 Bacteria 1154
844 Ga0495593_0344461 3300047673 Bacteria 745
845 Ga0496101_0548091 3300048904 Bacteria 914
846 Ga0496102_0255886 3300048905 Bacteria 1651
847 Ga0496103_0424588 3300048906 Bacteria 853
848 Ga0496104_0051995 3300048907 Bacteria 3869
849 Ga0496104_0091351 3300048907 Bacteria 2910
850 Ga0496106_0372597 3300048909 Bacteria 1147
851 Ga0496110_0530442 3300048913 Bacteria 1071
852 Ga0496112_0404731 3300048915 Bacteria 1304
853 Ga0496112_0977681 3300048915 Unclassified 767
854 Ga0496113_0382434 3300048916 Bacteria 1130
855 Ga0496113_0819229 3300048916 Bacteria 739
856 Ga0496114_0000035 3300048917 Bacteria 160029
857 Ga0496114_0003291 3300048917 Bacteria 12403
858 Ga0496114_0509991 3300048917 Bacteria 1064
859 Ga0496115_0186239 3300048918 Bacteria 1715
860 Ga0501291_005747 3300049514 Bacteria 1634
861 Ga0501292_012292 3300049515 Bacteria 1305
862 Ga0501297_011089 3300049520 Bacteria 1029
863 Ga0501311_005612 3300049527 Bacteria 1382
864 Ga0501312_012397 3300049528 Bacteria 1172
865 Ga0501032_0296431 3300049569 Bacteria 1046
866 Ga0501034_0000120 3300049571 Bacteria 144382
867 Ga0501034_1067182 3300049571 Bacteria 690
868 Ga0501036_0008740 3300049572 Bacteria 8310
869 Ga0501036_0091021 3300049572 Bacteria 2577
870 Ga0501038_0156688 3300049574 Bacteria 1854
871 Ga0501038_0308702 3300049574 Bacteria 1240
872 Ga0501038_0491170 3300049574 Bacteria 940
873 Ga0501039_0247476 3300049575 Bacteria 1402
874 Ga0501040_0000236 3300049576 Bacteria 32441
875 Ga0501040_0757000 3300049576 Bacteria 703
876 Ga0501041_0020874 3300049577 Bacteria 3921
877 Ga0501042_0023757 3300049578 Bacteria 4293
878 Ga0501042_0445260 3300049578 Bacteria 939
879 Ga0501042_0837557 3300049578 Bacteria 670
880 Ga0501043_0021008 3300049579 Bacteria 5118
881 Ga0501046_0000111 3300049580 Bacteria 86335
882 Ga0501046_0000355 3300049580 Bacteria 46138
883 Ga0501046_0334428 3300049580 Bacteria 1102
884 Ga0501047_0000009 3300049581 Bacteria 436619
885 Ga0501047_0151956 3300049581 Bacteria 2191
886 Ga0501048_0000918 3300049582 Bacteria 21704
887 Ga0501048_0001804 3300049582 Bacteria 16275
888 Ga0501048_0134910 3300049582 Bacteria 1744
889 Ga0501048_0479984 3300049582 Bacteria 891
890 Ga0501067_0008110 3300049583 Bacteria 5833
891 Ga0501068_0004352 3300049584 Bacteria 7697
892 Ga0501068_0011942 3300049584 Bacteria 4912
893 Ga0501068_0018570 3300049584 Bacteria 4026
894 Ga0501068_0075130 3300049584 Bacteria 2067
895 Ga0501070_0000323 3300049586 Bacteria 43475
896 Ga0501070_0000423 3300049586 Bacteria 38429
897 Ga0501071_0044198 3300049587 Bacteria 3195
898 Ga0501071_0303557 3300049587 Bacteria 1210
899 Ga0501072_0000022 3300049588 Bacteria 152450
900 Ga0501072_0330581 3300049588 Bacteria 1211
901 Ga0501073_0002636 3300049589 Bacteria 13444
902 Ga0501073_0042906 3300049589 Bacteria 3191
903 Ga0501073_0056861 3300049589 Bacteria 2735
904 Ga0501073_0347834 3300049589 Bacteria 1023
905 Ga0501074_0001477 3300049590 Bacteria 15806
906 Ga0501074_0002458 3300049590 Bacteria 12912
907 Ga0501074_0031618 3300049590 Bacteria 3834
908 Ga0501074_0101822 3300049590 Bacteria 2056
909 Ga0501074_0206933 3300049590 Bacteria 1398
910 Ga0501075_0000724 3300049591 Bacteria 20473
911 Ga0501075_0037992 3300049591 Bacteria 3599
912 Ga0501075_0058006 3300049591 Bacteria 2915
913 Ga0501076_0025421 3300049592 Bacteria 4582
914 Ga0501076_0108973 3300049592 Bacteria 2237
915 Ga0501076_0508250 3300049592 Bacteria 993
916 Ga0501076_0662686 3300049592 Bacteria 861
917 Ga0501077_0002509 3300049593 Bacteria 10986
918 Ga0501077_0004705 3300049593 Bacteria 8295
919 Ga0501077_0044847 3300049593 Bacteria 2808
920 Ga0501202_016474 3300049652 Bacteria 1435
921 Ga0501208_079349 3300049655 Bacteria 673
922 Ga0501217_117222 3300049661 Bacteria 770
923 Ga0501223_028024 3300049663 Bacteria 1096
924 Ga0501227_094889 3300049665 Bacteria 789
925 Ga0501235_020743 3300049669 Bacteria 1459
926 Ga0501240_021439 3300049673 Bacteria 976
927 Ga0501243_029352 3300049675 Bacteria 934
928 Ga0501247_015130 3300049677 Bacteria 961
929 Ga0501249_006889 3300049679 Bacteria 2343
930 Ga0501250_012425 3300049680 Bacteria 1007
931 Ga0501257_014898 3300049686 Bacteria 1793
932 Ga0501221_048864 3300049704 Bacteria 947
933 Ga0501225_0010653 3300049705 Bacteria 2602
934 Ga0501079_0000167 3300049741 Bacteria 36490
935 Ga0501079_0000304 3300049741 Bacteria 30512
936 Ga0501079_0000923 3300049741 Bacteria 20166
937 Ga0501079_0014643 3300049741 Bacteria 5981
938 Ga0501079_0575125 3300049741 Bacteria 886
939 Ga0501080_0004524 3300049742 Bacteria 12393
940 Ga0501080_0009716 3300049742 Bacteria 8786
941 Ga0501080_0157934 3300049742 Bacteria 2095
942 Ga0501080_0273341 3300049742 Bacteria 1537
943 Ga0501080_0301843 3300049742 Bacteria 1452
944 Ga0501081_0006215 3300049743 Bacteria 7740
945 Ga0501081_0178347 3300049743 Bacteria 1536
946 Ga0501083_0001196 3300049744 Bacteria 17535
947 Ga0501083_0003486 3300049744 Bacteria 11005
948 Ga0501083_0005690 3300049744 Bacteria 8822
949 Ga0501083_0012209 3300049744 Bacteria 6012
950 Ga0501083_0014052 3300049744 Bacteria 5597
951 Ga0501083_0035604 3300049744 Bacteria 3399
952 Ga0501083_0062049 3300049744 Bacteria 2495
953 Ga0501083_0327039 3300049744 Bacteria 997
954 Ga0501263_010800 3300049760 Bacteria 1126
955 Ga0501279_028159 3300049775 Bacteria 825
956 Ga0501035_0085866 3300049822 Bacteria 2773
957 Ga0501045_0002211 3300049824 Bacteria 13196
958 Ga0501045_0250658 3300049824 Bacteria 1318
959 Ga0501045_0493330 3300049824 Bacteria 909
960 nmdc:mga0k408_125463_c1 3300050493 Bacteria 1522
961 nmdc:mga0k408_186480_c1 3300050493 Bacteria 1237
962 nmdc:mga05p37_1079265_c1 3300050507 Bacteria 843
963 nmdc:mga05p37_116972_c1 3300050507 Bacteria 3276
964 nmdc:mga05p37_1364638_c1 3300050507 Bacteria 717
965 nmdc:mga05p37_14807_c1 3300050507 Bacteria 9365
966 nmdc:mga05p37_187641_c1 3300050507 Bacteria 2513
967 nmdc:mga05p37_223906_c1 3300050507 Bacteria 2269
968 nmdc:mga05p37_327047_c1 3300050507 Bacteria 1812
969 nmdc:mga05p37_592770_c1 3300050507 Bacteria 1252
970 nmdc:mga05p37_9153_c1 3300050507 Bacteria 11707
971 nmdc:mga09592_133433_c1 3300050508 Bacteria 2138
972 nmdc:mga0qj67_836651_c1 3300050509 Bacteria 727
973 nmdc:mga06r32_1032541_c1 3300050510 Bacteria 773
974 nmdc:mga06r32_3042_c1 3300050510 Bacteria 15014
975 nmdc:mga08y16_114999_c1 3300050511 Bacteria 2801
976 nmdc:mga08y16_171500_c1 3300050511 Bacteria 2253
977 nmdc:mga08y16_26576_c1 3300050511 Bacteria 6101
978 nmdc:mga08y16_408695_c1 3300050511 Bacteria 1388
979 nmdc:mga08y16_7505_c1 3300050511 Bacteria 11420
980 nmdc:mga08y16_963792_c1 3300050511 Bacteria 835
981 nmdc:mga08y16_974359_c1 3300050511 Bacteria 829
982 nmdc:mga0n895_12489_c1 3300050512 Bacteria 7622
983 nmdc:mga0n895_149411_c1 3300050512 Bacteria 2366
984 nmdc:mga0n895_17952_c1 3300050512 Bacteria 6539
985 nmdc:mga0n895_389045_c1 3300050512 Bacteria 1411
986 nmdc:mga0n895_396895_c1 3300050512 Bacteria 1395
987 nmdc:mga0n895_548781_c1 3300050512 Bacteria 1162
988 nmdc:mga0rr50_30246_c1 3300050513 Bacteria 3832
989 nmdc:mga0rr50_94434_c1 3300050513 Bacteria 2336
990 nmdc:mga08x19_38466_c1 3300050514 Bacteria 3040
991 nmdc:mga08x19_80335_c1 3300050514 Bacteria 2140
992 nmdc:mga0a205_13556_c2 3300050515 Bacteria 6192
993 nmdc:mga0a205_20046_c1 3300050515 Bacteria 6309
994 nmdc:mga0a205_2044_c1 3300050515 Bacteria 17626
995 nmdc:mga0a205_38031_c1 3300050515 Bacteria 4628
996 nmdc:mga0a205_71511_c2 3300050515 Bacteria 1991
997 Ga0500635_0033936 3300053080 Bacteria 1668
998 Ga0495595_0343583 3300053084 Bacteria 753
999 Ga0500644_0004509 3300053088 Bacteria 3489
1000 Ga0500650_0135385 3300053098 Bacteria 1144
1001 Ga0501084_0000006 3300054114 Bacteria 234041
1002 Ga0501084_0001672 3300054114 Bacteria 17630
1003 Ga0501084_0010675 3300054114 Bacteria 7602
1004 Ga0501084_0060806 3300054114 Bacteria 3162
1005 Ga0501084_0176906 3300054114 Bacteria 1801
1006 Ga0587077_104851 3300059493 Bacteria 684
1007 Ga0587085_012672 3300059506 Bacteria 1161
1008 Ga0587106_027990 3300059605 Bacteria 886
1009 Ga0587101_006064 3300059623 Bacteria 1369
1010 Ga0587109_015968 3300059624 Bacteria 1282
1011 Ga0587109_020404 3300059624 Bacteria 1176
1012 Ga0587062_006709 3300059639 Bacteria 1318
1013 Ga0587062_059339 3300059639 Bacteria 667
1014 Ga0501082_0000081 3300060353 Bacteria 71114
1015 Ga0501082_0000280 3300060353 Bacteria 45085
1016 Ga0501082_0002810 3300060353 Bacteria 15194
1017 Ga0501082_0002975 3300060353 Bacteria 14800
1018 Ga0501082_0011756 3300060353 Bacteria 7524
1019 Ga0501082_0050770 3300060353 Bacteria 3577
1020 Ga0501082_0184224 3300060353 Bacteria 1816
1021 Ga0501082_0265142 3300060353 Bacteria 1495
1022 Ga0501082_0345772 3300060353 Bacteria 1296
1023 Ga0530510_0045451 3300061734 Bacteria 3173
1024 Ga0530510_0134930 3300061734 Bacteria 1817
1025 Ga0530510_0233163 3300061734 Bacteria 1369
1026 Ga0530510_0551147 3300061734 Bacteria 876

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035241 Ga0373961_0184894 Ga0373961_0184894_179_679 166
2 3300042993 Ga0439440_0157996 Ga0439440_0157996_116_616 166
3 3300048915 Ga0496112_0977681 Ga0496112_0977681_35_535 166
4 3300048916 Ga0496113_0819229 Ga0496113_0819229_171_671 166
5 3300049661 Ga0501217_117222 Ga0501217_117222_33_533 166
6 3300031727 Ga0316576_10232406 Ga0316576_102324062 173
7 3300042876 Ga0451577_0068708 Ga0451577_0068708_2613_3143 173
8 3300050507 nmdc:mga05p37_1364638_c1 nmdc:mga05p37_1364638_c1_148_702 173
9 3300050515 nmdc:mga0a205_13556_c2 nmdc:mga0a205_13556_c2_69_590 173
10 3300006844 Ga0075428_100052589 Ga0075428_1000525894 175
11 3300033528 Ga0316588_1089920 Ga0316588_10899201 175
12 3300033541 Ga0316596_1128160 Ga0316596_11281601 175
13 3300050513 nmdc:mga0rr50_94434_c1 nmdc:mga0rr50_94434_c1_1753_2325 179
14 3300006844 Ga0075428_100006662 Ga0075428_1000066627 183
15 3300044712 Ga0453684_0071348 Ga0453684_0071348_3785_4372 187
16 iso_pu_bacteria 2524614857 2526062343 189
17 iso_pu_bacteria 2739367875 2740063690 189
18 iso_pu_bacteria 2524614857 2526061933 190
19 3300005719 Ga0068861_101240086 Ga0068861_1012400861 191
20 3300005290 Ga0065712_10125065 Ga0065712_101250651 192
21 3300005336 Ga0070680_100026974 Ga0070680_1000269745 192
22 3300005340 Ga0070689_100726877 Ga0070689_1007268771 192
23 3300005536 Ga0070697_100059755 Ga0070697_1000597552 192
24 3300005536 Ga0070697_100143944 Ga0070697_1001439442 192
25 3300013296 Ga0157374_10505737 Ga0157374_105057372 192
26 3300026075 Ga0207708_10203007 Ga0207708_102030072 192
27 3300031235 Ga0265330_10077872 Ga0265330_100778722 192
28 3300036647 Ga0316582_0105272 Ga0316582_0105272_1180_1758 192
29 3300046523 Ga0495644_0076239 Ga0495644_0076239_50_628 192
30 3300046537 Ga0495598_0038431 Ga0495598_0038431_315_893 192
31 3300046665 Ga0495661_0369374 Ga0495661_0369374_80_658 192
32 3300009176 Ga0105242_10741139 Ga0105242_107411392 193
33 3300032133 Ga0316583_10104212 Ga0316583_101042122 193
34 3300042438 Ga0439459_0003940 Ga0439459_0003940_687_1280 193
35 3300049571 Ga0501034_1067182 Ga0501034_1067182_71_658 193
36 3300000532 CNAas_1000053 CNAas_10000533 194
37 3300001990 JGI24737J22298_10042841 JGI24737J22298_100428413 194
38 3300002459 JGI24751J29686_10000040 JGI24751J29686_1000004055 194
39 3300003347 JGI26128J50194_1000536 JGI26128J50194_10005362 194
40 3300003371 JGI26145J50221_1007769 JGI26145J50221_10077692 194
41 3300003504 JGI26138J51218_101769 JGI26138J51218_1017692 194
42 3300003911 JGI25405J52794_10006415 JGI25405J52794_100064152 194
43 3300004798 Ga0058859_11802859 Ga0058859_118028592 194
44 3300004803 Ga0058862_11798388 Ga0058862_117983882 194
45 3300005288 Ga0065714_10236356 Ga0065714_102363561 194
46 3300005289 Ga0065704_10070138 Ga0065704_1007013812 194
47 3300005289 Ga0065704_10253889 Ga0065704_102538892 194
48 3300005290 Ga0065712_10022016 Ga0065712_100220161 194
49 3300005290 Ga0065712_10116807 Ga0065712_101168073 194
50 3300005293 Ga0065715_10013657 Ga0065715_100136572 194
51 3300005293 Ga0065715_10053092 Ga0065715_100530922 194
52 3300005295 Ga0065707_10018862 Ga0065707_100188622 194
53 3300005295 Ga0065707_10033643 Ga0065707_100336432 194
54 3300005295 Ga0065707_10188570 Ga0065707_101885702 194
55 3300005295 Ga0065707_10318035 Ga0065707_103180352 194
56 3300005295 Ga0065707_10395974 Ga0065707_103959741 194
57 3300005295 Ga0065707_10459045 Ga0065707_104590452 194
58 3300005327 Ga0070658_10003921 Ga0070658_100039217 194
59 3300005327 Ga0070658_10028262 Ga0070658_100282622 194
60 3300005327 Ga0070658_10049378 Ga0070658_100493785 194
61 3300005327 Ga0070658_10231757 Ga0070658_102317572 194
62 3300005328 Ga0070676_10000776 Ga0070676_100007766 194
63 3300005328 Ga0070676_10017341 Ga0070676_100173413 194
64 3300005329 Ga0070683_100432047 Ga0070683_1004320472 194
65 3300005330 Ga0070690_100078482 Ga0070690_1000784824 194
66 3300005330 Ga0070690_100122144 Ga0070690_1001221443 194
67 3300005330 Ga0070690_100424206 Ga0070690_1004242061 194
68 3300005331 Ga0070670_100000676 Ga0070670_10000067613 194
69 3300005331 Ga0070670_100004672 Ga0070670_1000046722 194
70 3300005331 Ga0070670_101189389 Ga0070670_1011893891 194
71 3300005333 Ga0070677_10098142 Ga0070677_100981422 194
72 3300005334 Ga0068869_100001260 Ga0068869_1000012604 194
73 3300005334 Ga0068869_100003281 Ga0068869_1000032812 194
74 3300005334 Ga0068869_100010655 Ga0068869_1000106556 194
75 3300005334 Ga0068869_100108807 Ga0068869_1001088073 194
76 3300005334 Ga0068869_100296890 Ga0068869_1002968902 194
77 3300005334 Ga0068869_100401364 Ga0068869_1004013642 194
78 3300005334 Ga0068869_100693547 Ga0068869_1006935472 194
79 3300005335 Ga0070666_10008628 Ga0070666_100086284 194
80 3300005335 Ga0070666_10084913 Ga0070666_100849133 194
81 3300005336 Ga0070680_100000528 Ga0070680_1000005281 194
82 3300005336 Ga0070680_100247255 Ga0070680_1002472552 194
83 3300005336 Ga0070680_100529036 Ga0070680_1005290361 194
84 3300005337 Ga0070682_100002753 Ga0070682_1000027531 194
85 3300005337 Ga0070682_100050043 Ga0070682_1000500433 194
86 3300005337 Ga0070682_100074909 Ga0070682_1000749092 194
87 3300005337 Ga0070682_100358479 Ga0070682_1003584792 194
88 3300005338 Ga0068868_100043453 Ga0068868_1000434532 194
89 3300005338 Ga0068868_100349035 Ga0068868_1003490352 194
90 3300005338 Ga0068868_100527212 Ga0068868_1005272122 194
91 3300005338 Ga0068868_100643200 Ga0068868_1006432002 194
92 3300005338 Ga0068868_100646692 Ga0068868_1006466922 194
93 3300005338 Ga0068868_100849815 Ga0068868_1008498152 194
94 3300005338 Ga0068868_101371715 Ga0068868_1013717151 194
95 3300005339 Ga0070660_100000426 Ga0070660_10000042611 194
96 3300005340 Ga0070689_100000006 Ga0070689_10000000632 194
97 3300005340 Ga0070689_100006524 Ga0070689_1000065245 194
98 3300005340 Ga0070689_100053411 Ga0070689_1000534116 194
99 3300005341 Ga0070691_10032656 Ga0070691_100326562 194
100 3300005341 Ga0070691_10118880 Ga0070691_101188802 194
101 3300005343 Ga0070687_100043723 Ga0070687_1000437232 194
102 3300005344 Ga0070661_100003135 Ga0070661_1000031355 194
103 3300005345 Ga0070692_10244994 Ga0070692_102449941 194
104 3300005347 Ga0070668_100105404 Ga0070668_1001054042 194
105 3300005353 Ga0070669_100000101 Ga0070669_10000010132 194
106 3300005353 Ga0070669_100064427 Ga0070669_1000644273 194
107 3300005353 Ga0070669_100174558 Ga0070669_1001745582 194
108 3300005354 Ga0070675_100168526 Ga0070675_1001685264 194
109 3300005354 Ga0070675_100246739 Ga0070675_1002467392 194
110 3300005354 Ga0070675_100339621 Ga0070675_1003396212 194
111 3300005355 Ga0070671_100000754 Ga0070671_10000075410 194
112 3300005355 Ga0070671_100011000 Ga0070671_1000110006 194
113 3300005355 Ga0070671_100190950 Ga0070671_1001909501 194
114 3300005355 Ga0070671_100216405 Ga0070671_1002164053 194
115 3300005355 Ga0070671_100280035 Ga0070671_1002800352 194
116 3300005364 Ga0070673_100172544 Ga0070673_1001725442 194
117 3300005364 Ga0070673_100179567 Ga0070673_1001795673 194
118 3300005365 Ga0070688_100169213 Ga0070688_1001692131 194
119 3300005365 Ga0070688_100175465 Ga0070688_1001754652 194
120 3300005365 Ga0070688_100304993 Ga0070688_1003049932 194
121 3300005366 Ga0070659_100001410 Ga0070659_1000014109 194
122 3300005366 Ga0070659_100267117 Ga0070659_1002671172 194
123 3300005366 Ga0070659_100376844 Ga0070659_1003768443 194
124 3300005367 Ga0070667_100045969 Ga0070667_1000459693 194
125 3300005367 Ga0070667_100863394 Ga0070667_1008633941 194
126 3300005406 Ga0070703_10015428 Ga0070703_100154283 194
127 3300005434 Ga0070709_10000069 Ga0070709_1000006961 194
128 3300005436 Ga0070713_100426348 Ga0070713_1004263482 194
129 3300005437 Ga0070710_10007735 Ga0070710_100077354 194
130 3300005438 Ga0070701_10004224 Ga0070701_100042244 194
131 3300005439 Ga0070711_100043027 Ga0070711_1000430272 194
132 3300005440 Ga0070705_100054346 Ga0070705_1000543462 194
133 3300005440 Ga0070705_100346418 Ga0070705_1003464182 194
134 3300005441 Ga0070700_100122581 Ga0070700_1001225812 194
135 3300005441 Ga0070700_100131739 Ga0070700_1001317393 194
136 3300005441 Ga0070700_100136942 Ga0070700_1001369423 194
137 3300005441 Ga0070700_100235160 Ga0070700_1002351603 194
138 3300005444 Ga0070694_100010732 Ga0070694_1000107326 194
139 3300005444 Ga0070694_100012515 Ga0070694_1000125152 194
140 3300005444 Ga0070694_100093735 Ga0070694_1000937352 194
141 3300005445 Ga0070708_100000621 Ga0070708_1000006217 194
142 3300005445 Ga0070708_100065834 Ga0070708_1000658343 194
143 3300005445 Ga0070708_100131352 Ga0070708_1001313522 194
144 3300005445 Ga0070708_100603563 Ga0070708_1006035632 194
145 3300005455 Ga0070663_100012081 Ga0070663_1000120816 194
146 3300005456 Ga0070678_100050349 Ga0070678_1000503491 194
147 3300005457 Ga0070662_100266469 Ga0070662_1002664692 194
148 3300005457 Ga0070662_100616214 Ga0070662_1006162141 194
149 3300005458 Ga0070681_10007431 Ga0070681_100074315 194
150 3300005459 Ga0068867_100011967 Ga0068867_1000119676 194
151 3300005459 Ga0068867_100014424 Ga0068867_1000144246 194
152 3300005459 Ga0068867_100042244 Ga0068867_1000422441 194
153 3300005459 Ga0068867_100080215 Ga0068867_1000802152 194
154 3300005459 Ga0068867_100083186 Ga0068867_1000831862 194
155 3300005459 Ga0068867_101178989 Ga0068867_1011789891 194
156 3300005459 Ga0068867_101230599 Ga0068867_1012305991 194
157 3300005466 Ga0070685_10009467 Ga0070685_100094673 194
158 3300005466 Ga0070685_10223236 Ga0070685_102232362 194
159 3300005467 Ga0070706_100008802 Ga0070706_1000088026 194
160 3300005467 Ga0070706_100017482 Ga0070706_1000174823 194
161 3300005467 Ga0070706_100159195 Ga0070706_1001591952 194
162 3300005467 Ga0070706_100467393 Ga0070706_1004673932 194
163 3300005468 Ga0070707_100001880 Ga0070707_10000188020 194
164 3300005468 Ga0070707_100003551 Ga0070707_1000035516 194
165 3300005468 Ga0070707_100014668 Ga0070707_1000146687 194
166 3300005468 Ga0070707_100027446 Ga0070707_1000274463 194
167 3300005471 Ga0070698_100002838 Ga0070698_10000283813 194
168 3300005471 Ga0070698_100006715 Ga0070698_1000067152 194
169 3300005471 Ga0070698_100019650 Ga0070698_1000196508 194
170 3300005518 Ga0070699_100001882 Ga0070699_10000188218 194
171 3300005518 Ga0070699_100153937 Ga0070699_1001539373 194
172 3300005518 Ga0070699_100235698 Ga0070699_1002356983 194
173 3300005518 Ga0070699_100318279 Ga0070699_1003182792 194
174 3300005530 Ga0070679_100006685 Ga0070679_1000066856 194
175 3300005530 Ga0070679_100056145 Ga0070679_1000561455 194
176 3300005530 Ga0070679_100707717 Ga0070679_1007077172 194
177 3300005535 Ga0070684_100009490 Ga0070684_1000094906 194
178 3300005535 Ga0070684_100457829 Ga0070684_1004578292 194
179 3300005536 Ga0070697_100001301 Ga0070697_1000013015 194
180 3300005536 Ga0070697_100005940 Ga0070697_1000059407 194
181 3300005536 Ga0070697_100079164 Ga0070697_1000791643 194
182 3300005536 Ga0070697_100646549 Ga0070697_1006465492 194
183 3300005539 Ga0068853_100001027 Ga0068853_10000102710 194
184 3300005539 Ga0068853_100007929 Ga0068853_1000079296 194
185 3300005543 Ga0070672_100369788 Ga0070672_1003697882 194
186 3300005544 Ga0070686_100250168 Ga0070686_1002501682 194
187 3300005544 Ga0070686_100613463 Ga0070686_1006134631 194
188 3300005544 Ga0070686_100665735 Ga0070686_1006657351 194
189 3300005545 Ga0070695_100000929 Ga0070695_1000009297 194
190 3300005545 Ga0070695_100001843 Ga0070695_1000018432 194
191 3300005545 Ga0070695_100002584 Ga0070695_1000025846 194
192 3300005545 Ga0070695_100181513 Ga0070695_1001815132 194
193 3300005545 Ga0070695_100199301 Ga0070695_1001993012 194
194 3300005545 Ga0070695_100212983 Ga0070695_1002129832 194
195 3300005545 Ga0070695_101036855 Ga0070695_1010368551 194
196 3300005546 Ga0070696_100004929 Ga0070696_1000049298 194
197 3300005546 Ga0070696_100089371 Ga0070696_1000893712 194
198 3300005546 Ga0070696_100266438 Ga0070696_1002664382 194
199 3300005547 Ga0070693_100000146 Ga0070693_10000014611 194
200 3300005547 Ga0070693_100026273 Ga0070693_1000262732 194
201 3300005547 Ga0070693_100029579 Ga0070693_1000295792 194
202 3300005547 Ga0070693_100195444 Ga0070693_1001954442 194
203 3300005548 Ga0070665_100000468 Ga0070665_10000046812 194
204 3300005548 Ga0070665_100477260 Ga0070665_1004772602 194
205 3300005549 Ga0070704_100002293 Ga0070704_1000022931 194
206 3300005549 Ga0070704_100309548 Ga0070704_1003095482 194
207 3300005549 Ga0070704_100325789 Ga0070704_1003257891 194
208 3300005549 Ga0070704_100668278 Ga0070704_1006682782 194
209 3300005549 Ga0070704_101064703 Ga0070704_1010647031 194
210 3300005563 Ga0068855_100000008 Ga0068855_10000000872 194
211 3300005563 Ga0068855_100004311 Ga0068855_1000043115 194
212 3300005563 Ga0068855_100088555 Ga0068855_1000885553 194
213 3300005563 Ga0068855_100105844 Ga0068855_1001058443 194
214 3300005563 Ga0068855_100614019 Ga0068855_1006140192 194
215 3300005564 Ga0070664_100038167 Ga0070664_1000381675 194
216 3300005564 Ga0070664_100113499 Ga0070664_1001134994 194
217 3300005577 Ga0068857_100042188 Ga0068857_1000421885 194
218 3300005577 Ga0068857_100346116 Ga0068857_1003461162 194
219 3300005577 Ga0068857_100792529 Ga0068857_1007925291 194
220 3300005578 Ga0068854_100023122 Ga0068854_1000231222 194
221 3300005578 Ga0068854_100396325 Ga0068854_1003963251 194
222 3300005614 Ga0068856_100003684 Ga0068856_10000368412 194
223 3300005614 Ga0068856_100051817 Ga0068856_1000518171 194
224 3300005614 Ga0068856_100079170 Ga0068856_1000791703 194
225 3300005614 Ga0068856_100153581 Ga0068856_1001535811 194
226 3300005614 Ga0068856_100838497 Ga0068856_1008384972 194
227 3300005615 Ga0070702_100109728 Ga0070702_1001097282 194
228 3300005615 Ga0070702_100127848 Ga0070702_1001278482 194
229 3300005616 Ga0068852_100097267 Ga0068852_1000972673 194
230 3300005616 Ga0068852_100440316 Ga0068852_1004403161 194
231 3300005616 Ga0068852_100579372 Ga0068852_1005793722 194
232 3300005617 Ga0068859_100002098 Ga0068859_1000020985 194
233 3300005617 Ga0068859_100006613 Ga0068859_1000066136 194
234 3300005617 Ga0068859_100060025 Ga0068859_1000600251 194
235 3300005617 Ga0068859_100063320 Ga0068859_1000633205 194
236 3300005617 Ga0068859_100089358 Ga0068859_1000893584 194
237 3300005617 Ga0068859_100114628 Ga0068859_1001146282 194
238 3300005617 Ga0068859_100266656 Ga0068859_1002666563 194
239 3300005617 Ga0068859_100316163 Ga0068859_1003161632 194
240 3300005617 Ga0068859_100447648 Ga0068859_1004476482 194
241 3300005617 Ga0068859_100498827 Ga0068859_1004988272 194
242 3300005618 Ga0068864_100027908 Ga0068864_1000279083 194
243 3300005618 Ga0068864_100064732 Ga0068864_1000647324 194
244 3300005718 Ga0068866_10279337 Ga0068866_102793372 194
245 3300005719 Ga0068861_100005474 Ga0068861_1000054748 194
246 3300005719 Ga0068861_100006238 Ga0068861_1000062383 194
247 3300005719 Ga0068861_100028482 Ga0068861_1000284826 194
248 3300005719 Ga0068861_100069556 Ga0068861_1000695562 194
249 3300005840 Ga0068870_10001679 Ga0068870_100016796 194
250 3300005840 Ga0068870_10138939 Ga0068870_101389392 194
251 3300005841 Ga0068863_100103772 Ga0068863_1001037723 194
252 3300005841 Ga0068863_100915485 Ga0068863_1009154852 194
253 3300005842 Ga0068858_100028938 Ga0068858_1000289382 194
254 3300005842 Ga0068858_100034519 Ga0068858_1000345193 194
255 3300005842 Ga0068858_100034572 Ga0068858_1000345722 194
256 3300005842 Ga0068858_100242639 Ga0068858_1002426393 194
257 3300005842 Ga0068858_100981203 Ga0068858_1009812032 194
258 3300005843 Ga0068860_100000731 Ga0068860_10000073120 194
259 3300005843 Ga0068860_100023127 Ga0068860_1000231275 194
260 3300005843 Ga0068860_100053835 Ga0068860_1000538352 194
261 3300005843 Ga0068860_100069494 Ga0068860_1000694942 194
262 3300005843 Ga0068860_100126643 Ga0068860_1001266434 194
263 3300005843 Ga0068860_100147832 Ga0068860_1001478324 194
264 3300005843 Ga0068860_100183978 Ga0068860_1001839783 194
265 3300005843 Ga0068860_100247134 Ga0068860_1002471342 194
266 3300005843 Ga0068860_100283547 Ga0068860_1002835472 194
267 3300005843 Ga0068860_100468415 Ga0068860_1004684152 194
268 3300005843 Ga0068860_100493520 Ga0068860_1004935202 194
269 3300005843 Ga0068860_100901671 Ga0068860_1009016712 194
270 3300005844 Ga0068862_100002423 Ga0068862_10000242318 194
271 3300005844 Ga0068862_100018123 Ga0068862_1000181232 194
272 3300005844 Ga0068862_100058160 Ga0068862_1000581603 194
273 3300005844 Ga0068862_100085623 Ga0068862_1000856233 194
274 3300005937 Ga0081455_10001014 Ga0081455_1000101430 194
275 3300005937 Ga0081455_10037749 Ga0081455_100377492 194
276 3300005985 Ga0081539_10011597 Ga0081539_100115974 194
277 3300006048 Ga0075363_100302046 Ga0075363_1003020461 194
278 3300006173 Ga0070716_100001417 Ga0070716_1000014172 194
279 3300006195 Ga0075366_10129618 Ga0075366_101296184 194
280 3300006237 Ga0097621_100112150 Ga0097621_1001121501 194
281 3300006237 Ga0097621_100401702 Ga0097621_1004017022 194
282 3300006358 Ga0068871_100123063 Ga0068871_1001230633 194
283 3300006358 Ga0068871_100145538 Ga0068871_1001455383 194
284 3300006844 Ga0075428_100200965 Ga0075428_1002009654 194
285 3300006846 Ga0075430_100195039 Ga0075430_1001950393 194
286 3300006847 Ga0075431_100022715 Ga0075431_1000227153 194
287 3300006852 Ga0075433_10000359 Ga0075433_1000035921 194
288 3300006852 Ga0075433_10077553 Ga0075433_100775535 194
289 3300006871 Ga0075434_100005805 Ga0075434_1000058055 194
290 3300006871 Ga0075434_100033813 Ga0075434_1000338131 194
291 3300006871 Ga0075434_100066243 Ga0075434_1000662432 194
292 3300006871 Ga0075434_100101803 Ga0075434_1001018033 194
293 3300006871 Ga0075434_100139278 Ga0075434_1001392782 194
294 3300006871 Ga0075434_100305050 Ga0075434_1003050502 194
295 3300006871 Ga0075434_100414855 Ga0075434_1004148552 194
296 3300006880 Ga0075429_100064624 Ga0075429_1000646243 194
297 3300006880 Ga0075429_100213610 Ga0075429_1002136104 194
298 3300006881 Ga0068865_100093495 Ga0068865_1000934952 194
299 3300006881 Ga0068865_100257007 Ga0068865_1002570072 194
300 3300006914 Ga0075436_100011613 Ga0075436_1000116133 194
301 3300006914 Ga0075436_100076996 Ga0075436_1000769962 194
302 3300006931 Ga0097620_100002098 Ga0097620_10000209813 194
303 3300006931 Ga0097620_100006613 Ga0097620_1000066135 194
304 3300006931 Ga0097620_100060026 Ga0097620_1000600261 194
305 3300006931 Ga0097620_100063323 Ga0097620_1000633234 194
306 3300006931 Ga0097620_100089354 Ga0097620_1000893544 194
307 3300006931 Ga0097620_100114627 Ga0097620_1001146272 194
308 3300006931 Ga0097620_100266646 Ga0097620_1002666462 194
309 3300006931 Ga0097620_100316154 Ga0097620_1003161542 194
310 3300006931 Ga0097620_100447629 Ga0097620_1004476292 194
311 3300006931 Ga0097620_100498849 Ga0097620_1004988492 194
312 3300007076 Ga0075435_100013015 Ga0075435_1000130153 194
313 3300007076 Ga0075435_100051960 Ga0075435_1000519603 194
314 3300007265 Ga0099794_10000473 Ga0099794_1000047316 194
315 3300007265 Ga0099794_10439255 Ga0099794_104392551 194
316 3300009093 Ga0105240_10003810 Ga0105240_1000381013 194
317 3300009094 Ga0111539_10020642 Ga0111539_100206429 194
318 3300009094 Ga0111539_10022170 Ga0111539_100221701 194
319 3300009094 Ga0111539_10031784 Ga0111539_100317843 194
320 3300009094 Ga0111539_10138106 Ga0111539_101381064 194
321 3300009094 Ga0111539_10144756 Ga0111539_101447562 194
322 3300009094 Ga0111539_10180876 Ga0111539_101808763 194
323 3300009094 Ga0111539_10341252 Ga0111539_103412521 194
324 3300009094 Ga0111539_10395178 Ga0111539_103951782 194
325 3300009094 Ga0111539_10403280 Ga0111539_104032802 194
326 3300009094 Ga0111539_10897299 Ga0111539_108972992 194
327 3300009098 Ga0105245_10254118 Ga0105245_102541183 194
328 3300009098 Ga0105245_10827073 Ga0105245_108270732 194
329 3300009101 Ga0105247_10005229 Ga0105247_100052297 194
330 3300009101 Ga0105247_10009646 Ga0105247_100096467 194
331 3300009101 Ga0105247_10083679 Ga0105247_100836792 194
332 3300009147 Ga0114129_10045507 Ga0114129_100455072 194
333 3300009147 Ga0114129_10107418 Ga0114129_101074184 194
334 3300009147 Ga0114129_10141275 Ga0114129_101412753 194
335 3300009147 Ga0114129_10179061 Ga0114129_101790612 194
336 3300009147 Ga0114129_10278763 Ga0114129_102787632 194
337 3300009148 Ga0105243_10013772 Ga0105243_100137723 194
338 3300009148 Ga0105243_10107048 Ga0105243_101070483 194
339 3300009148 Ga0105243_10169537 Ga0105243_101695372 194
340 3300009148 Ga0105243_10239279 Ga0105243_102392792 194
341 3300009174 Ga0105241_10001244 Ga0105241_1000124416 194
342 3300009174 Ga0105241_10019852 Ga0105241_100198526 194
343 3300009174 Ga0105241_11213857 Ga0105241_112138572 194
344 3300009174 Ga0105241_11304685 Ga0105241_113046851 194
345 3300009176 Ga0105242_10058807 Ga0105242_100588072 194
346 3300009176 Ga0105242_10080837 Ga0105242_100808371 194
347 3300009176 Ga0105242_10802452 Ga0105242_108024522 194
348 3300009176 Ga0105242_11315218 Ga0105242_113152182 194
349 3300009177 Ga0105248_10034283 Ga0105248_100342835 194
350 3300009177 Ga0105248_10071591 Ga0105248_100715912 194
351 3300009177 Ga0105248_10092938 Ga0105248_100929383 194
352 3300009177 Ga0105248_10700745 Ga0105248_107007452 194
353 3300009177 Ga0105248_11245377 Ga0105248_112453772 194
354 3300009545 Ga0105237_10025830 Ga0105237_100258304 194
355 3300009545 Ga0105237_10063412 Ga0105237_100634122 194
356 3300009545 Ga0105237_10090891 Ga0105237_100908911 194
357 3300009545 Ga0105237_10436219 Ga0105237_104362192 194
358 3300009545 Ga0105237_11368577 Ga0105237_113685771 194
359 3300009551 Ga0105238_10012280 Ga0105238_100122805 194
360 3300009551 Ga0105238_10021367 Ga0105238_100213673 194
361 3300009553 Ga0105249_10016555 Ga0105249_100165553 194
362 3300009553 Ga0105249_10043997 Ga0105249_100439972 194
363 3300009553 Ga0105249_10061068 Ga0105249_100610683 194
364 3300009553 Ga0105249_10062638 Ga0105249_100626384 194
365 3300009553 Ga0105249_10148838 Ga0105249_101488382 194
366 3300009553 Ga0105249_10227386 Ga0105249_102273862 194
367 3300010375 Ga0105239_10143070 Ga0105239_101430701 194
368 3300011119 Ga0105246_10112952 Ga0105246_101129522 194
369 3300011119 Ga0105246_11218262 Ga0105246_112182621 194
370 3300013100 Ga0157373_10000365 Ga0157373_1000036516 194
371 3300013100 Ga0157373_10049691 Ga0157373_100496912 194
372 3300013102 Ga0157371_10136548 Ga0157371_101365482 194
373 3300013104 Ga0157370_10078508 Ga0157370_100785082 194
374 3300013105 Ga0157369_10042793 Ga0157369_100427932 194
375 3300013296 Ga0157374_10861474 Ga0157374_108614742 194
376 3300013297 Ga0157378_10602834 Ga0157378_106028342 194
377 3300013297 Ga0157378_11267619 Ga0157378_112676191 194
378 3300013306 Ga0163162_10097139 Ga0163162_100971394 194
379 3300013306 Ga0163162_10292499 Ga0163162_102924992 194
380 3300013306 Ga0163162_10346842 Ga0163162_103468422 194
381 3300013306 Ga0163162_10517914 Ga0163162_105179143 194
382 3300013306 Ga0163162_10734787 Ga0163162_107347872 194
383 3300013306 Ga0163162_11302732 Ga0163162_113027321 194
384 3300013307 Ga0157372_10000337 Ga0157372_1000033727 194
385 3300013307 Ga0157372_10083849 Ga0157372_100838492 194
386 3300013307 Ga0157372_10579165 Ga0157372_105791652 194
387 3300013308 Ga0157375_10084173 Ga0157375_100841735 194
388 3300013308 Ga0157375_10142074 Ga0157375_101420742 194
389 3300013308 Ga0157375_10179993 Ga0157375_101799932 194
390 3300013308 Ga0157375_10342129 Ga0157375_103421292 194
391 3300013308 Ga0157375_11020151 Ga0157375_110201512 194
392 3300014325 Ga0163163_10004457 Ga0163163_1000445718 194
393 3300014325 Ga0163163_10084984 Ga0163163_100849841 194
394 3300014325 Ga0163163_10991655 Ga0163163_109916552 194
395 3300014325 Ga0163163_11763240 Ga0163163_117632401 194
396 3300014326 Ga0157380_10039465 Ga0157380_100394654 194
397 3300014326 Ga0157380_10152978 Ga0157380_101529783 194
398 3300014326 Ga0157380_10263923 Ga0157380_102639232 194
399 3300014326 Ga0157380_10292821 Ga0157380_102928212 194
400 3300014326 Ga0157380_10458909 Ga0157380_104589092 194
401 3300014497 Ga0182008_10222118 Ga0182008_102221182 194
402 3300014745 Ga0157377_10137349 Ga0157377_101373492 194
403 3300014968 Ga0157379_10303007 Ga0157379_103030073 194
404 3300014968 Ga0157379_10568998 Ga0157379_105689982 194
405 3300014969 Ga0157376_10252572 Ga0157376_102525723 194
406 3300014969 Ga0157376_10816212 Ga0157376_108162122 194
407 3300017792 Ga0163161_10310229 Ga0163161_103102291 194
408 3300017792 Ga0163161_10315658 Ga0163161_103156581 194
409 3300017792 Ga0163161_10654360 Ga0163161_106543602 194
410 3300021384 Ga0213876_10055671 Ga0213876_100556711 194
411 3300025885 Ga0207653_10001878 Ga0207653_100018782 194
412 3300025885 Ga0207653_10062310 Ga0207653_100623102 194
413 3300025893 Ga0207682_10110724 Ga0207682_101107242 194
414 3300025898 Ga0207692_10009090 Ga0207692_100090904 194
415 3300025900 Ga0207710_10001835 Ga0207710_100018353 194
416 3300025900 Ga0207710_10002733 Ga0207710_100027337 194
417 3300025900 Ga0207710_10046541 Ga0207710_100465412 194
418 3300025900 Ga0207710_10203397 Ga0207710_102033971 194
419 3300025901 Ga0207688_10140724 Ga0207688_101407242 194
420 3300025903 Ga0207680_10070357 Ga0207680_100703572 194
421 3300025903 Ga0207680_10167778 Ga0207680_101677782 194
422 3300025905 Ga0207685_10188480 Ga0207685_101884801 194
423 3300025906 Ga0207699_10000032 Ga0207699_1000003268 194
424 3300025907 Ga0207645_10001806 Ga0207645_100018066 194
425 3300025907 Ga0207645_10024477 Ga0207645_100244772 194
426 3300025908 Ga0207643_10003293 Ga0207643_100032932 194
427 3300025908 Ga0207643_10142433 Ga0207643_101424332 194
428 3300025908 Ga0207643_10302606 Ga0207643_103026062 194
429 3300025909 Ga0207705_10032167 Ga0207705_100321672 194
430 3300025910 Ga0207684_10015141 Ga0207684_100151416 194
431 3300025910 Ga0207684_10023721 Ga0207684_100237215 194
432 3300025910 Ga0207684_10068409 Ga0207684_100684093 194
433 3300025910 Ga0207684_10455147 Ga0207684_104551472 194
434 3300025911 Ga0207654_10008756 Ga0207654_100087566 194
435 3300025911 Ga0207654_10009448 Ga0207654_100094485 194
436 3300025912 Ga0207707_10004696 Ga0207707_100046969 194
437 3300025914 Ga0207671_10006096 Ga0207671_100060967 194
438 3300025914 Ga0207671_10064278 Ga0207671_100642782 194
439 3300025917 Ga0207660_10028839 Ga0207660_100288395 194
440 3300025917 Ga0207660_10140624 Ga0207660_101406242 194
441 3300025917 Ga0207660_10472524 Ga0207660_104725242 194
442 3300025918 Ga0207662_10074356 Ga0207662_100743562 194
443 3300025918 Ga0207662_10206742 Ga0207662_102067422 194
444 3300025919 Ga0207657_10000869 Ga0207657_1000086914 194
445 3300025919 Ga0207657_10662685 Ga0207657_106626852 194
446 3300025920 Ga0207649_10007930 Ga0207649_100079302 194
447 3300025921 Ga0207652_10003687 Ga0207652_1000368711 194
448 3300025921 Ga0207652_10017916 Ga0207652_100179164 194
449 3300025921 Ga0207652_10024161 Ga0207652_100241612 194
450 3300025922 Ga0207646_10002690 Ga0207646_100026902 194
451 3300025922 Ga0207646_10010797 Ga0207646_100107978 194
452 3300025922 Ga0207646_10017494 Ga0207646_100174942 194
453 3300025923 Ga0207681_10000006 Ga0207681_10000006286 194
454 3300025923 Ga0207681_10291479 Ga0207681_102914791 194
455 3300025923 Ga0207681_10449942 Ga0207681_104499422 194
456 3300025924 Ga0207694_10121602 Ga0207694_101216022 194
457 3300025924 Ga0207694_10381457 Ga0207694_103814572 194
458 3300025925 Ga0207650_10000001 Ga0207650_100000011163 194
459 3300025925 Ga0207650_10021459 Ga0207650_100214596 194
460 3300025925 Ga0207650_10114118 Ga0207650_101141182 194
461 3300025925 Ga0207650_10181712 Ga0207650_101817122 194
462 3300025925 Ga0207650_10337678 Ga0207650_103376782 194
463 3300025926 Ga0207659_10213718 Ga0207659_102137181 194
464 3300025927 Ga0207687_10159312 Ga0207687_101593122 194
465 3300025927 Ga0207687_10315559 Ga0207687_103155591 194
466 3300025928 Ga0207700_10250206 Ga0207700_102502061 194
467 3300025931 Ga0207644_10000588 Ga0207644_1000058813 194
468 3300025931 Ga0207644_10062151 Ga0207644_100621513 194
469 3300025931 Ga0207644_10632233 Ga0207644_106322331 194
470 3300025931 Ga0207644_10845973 Ga0207644_108459732 194
471 3300025932 Ga0207690_10011627 Ga0207690_100116276 194
472 3300025933 Ga0207706_10001836 Ga0207706_100018366 194
473 3300025934 Ga0207686_10046819 Ga0207686_100468193 194
474 3300025934 Ga0207686_10347348 Ga0207686_103473482 194
475 3300025935 Ga0207709_10028978 Ga0207709_100289783 194
476 3300025935 Ga0207709_10191543 Ga0207709_101915432 194
477 3300025935 Ga0207709_10254613 Ga0207709_102546131 194
478 3300025936 Ga0207670_10000003 Ga0207670_10000003408 194
479 3300025936 Ga0207670_10011404 Ga0207670_100114046 194
480 3300025936 Ga0207670_10056731 Ga0207670_100567312 194
481 3300025936 Ga0207670_10057504 Ga0207670_100575043 194
482 3300025936 Ga0207670_10133043 Ga0207670_101330432 194
483 3300025936 Ga0207670_11061220 Ga0207670_110612201 194
484 3300025937 Ga0207669_10094462 Ga0207669_100944623 194
485 3300025938 Ga0207704_10155920 Ga0207704_101559202 194
486 3300025939 Ga0207665_10000918 Ga0207665_1000091812 194
487 3300025939 Ga0207665_10461065 Ga0207665_104610651 194
488 3300025940 Ga0207691_10073114 Ga0207691_100731142 194
489 3300025940 Ga0207691_10260398 Ga0207691_102603982 194
490 3300025940 Ga0207691_10875762 Ga0207691_108757622 194
491 3300025940 Ga0207691_10915505 Ga0207691_109155052 194
492 3300025941 Ga0207711_10123123 Ga0207711_101231233 194
493 3300025941 Ga0207711_10159900 Ga0207711_101599003 194
494 3300025941 Ga0207711_10209004 Ga0207711_102090043 194
495 3300025941 Ga0207711_10251832 Ga0207711_102518322 194
496 3300025941 Ga0207711_10677938 Ga0207711_106779381 194
497 3300025941 Ga0207711_10716374 Ga0207711_107163741 194
498 3300025942 Ga0207689_10000110 Ga0207689_1000011047 194
499 3300025942 Ga0207689_10003348 Ga0207689_100033486 194
500 3300025942 Ga0207689_10041955 Ga0207689_100419553 194
501 3300025942 Ga0207689_10122087 Ga0207689_101220873 194
502 3300025942 Ga0207689_10953625 Ga0207689_109536251 194
503 3300025942 Ga0207689_11073846 Ga0207689_110738461 194
504 3300025945 Ga0207679_10002898 Ga0207679_100028986 194
505 3300025945 Ga0207679_10136955 Ga0207679_101369553 194
506 3300025949 Ga0207667_10000088 Ga0207667_1000008853 194
507 3300025949 Ga0207667_10001835 Ga0207667_100018355 194
508 3300025949 Ga0207667_10020739 Ga0207667_100207397 194
509 3300025949 Ga0207667_10585350 Ga0207667_105853502 194
510 3300025960 Ga0207651_10232562 Ga0207651_102325622 194
511 3300025960 Ga0207651_10367386 Ga0207651_103673861 194
512 3300025961 Ga0207712_10003176 Ga0207712_100031762 194
513 3300025961 Ga0207712_10007574 Ga0207712_100075746 194
514 3300025961 Ga0207712_10057735 Ga0207712_100577353 194
515 3300025961 Ga0207712_10118073 Ga0207712_101180733 194
516 3300025961 Ga0207712_10124735 Ga0207712_101247352 194
517 3300025961 Ga0207712_10205234 Ga0207712_102052341 194
518 3300025961 Ga0207712_10458923 Ga0207712_104589231 194
519 3300025961 Ga0207712_10599535 Ga0207712_105995352 194
520 3300025981 Ga0207640_10007214 Ga0207640_100072146 194
521 3300025986 Ga0207658_10068101 Ga0207658_100681013 194
522 3300026023 Ga0207677_10016559 Ga0207677_100165597 194
523 3300026023 Ga0207677_10027695 Ga0207677_100276953 194
524 3300026023 Ga0207677_10588495 Ga0207677_105884952 194
525 3300026023 Ga0207677_11220261 Ga0207677_112202611 194
526 3300026035 Ga0207703_10050125 Ga0207703_100501252 194
527 3300026035 Ga0207703_10190554 Ga0207703_101905543 194
528 3300026035 Ga0207703_10286952 Ga0207703_102869522 194
529 3300026035 Ga0207703_10782568 Ga0207703_107825682 194
530 3300026041 Ga0207639_10008046 Ga0207639_100080466 194
531 3300026041 Ga0207639_10048141 Ga0207639_100481412 194
532 3300026067 Ga0207678_10000307 Ga0207678_100003079 194
533 3300026075 Ga0207708_10051505 Ga0207708_100515054 194
534 3300026075 Ga0207708_10113443 Ga0207708_101134433 194
535 3300026075 Ga0207708_10144672 Ga0207708_101446723 194
536 3300026075 Ga0207708_10165362 Ga0207708_101653622 194
537 3300026075 Ga0207708_10194037 Ga0207708_101940371 194
538 3300026075 Ga0207708_10587247 Ga0207708_105872472 194
539 3300026078 Ga0207702_10030507 Ga0207702_100305075 194
540 3300026078 Ga0207702_10080749 Ga0207702_100807491 194
541 3300026078 Ga0207702_10292056 Ga0207702_102920562 194
542 3300026078 Ga0207702_10644715 Ga0207702_106447152 194
543 3300026088 Ga0207641_10157056 Ga0207641_101570563 194
544 3300026088 Ga0207641_10621966 Ga0207641_106219662 194
545 3300026088 Ga0207641_11091688 Ga0207641_110916882 194
546 3300026089 Ga0207648_10009631 Ga0207648_100096313 194
547 3300026089 Ga0207648_10103166 Ga0207648_101031662 194
548 3300026089 Ga0207648_10104211 Ga0207648_101042112 194
549 3300026089 Ga0207648_10133891 Ga0207648_101338911 194
550 3300026089 Ga0207648_10144118 Ga0207648_101441183 194
551 3300026089 Ga0207648_10190493 Ga0207648_101904933 194
552 3300026095 Ga0207676_10007116 Ga0207676_100071164 194
553 3300026116 Ga0207674_10000181 Ga0207674_1000018144 194
554 3300026116 Ga0207674_10167742 Ga0207674_101677422 194
555 3300026116 Ga0207674_10305356 Ga0207674_103053562 194
556 3300026116 Ga0207674_10388083 Ga0207674_103880832 194
557 3300026118 Ga0207675_100029052 Ga0207675_1000290524 194
558 3300026118 Ga0207675_100054950 Ga0207675_1000549506 194
559 3300026118 Ga0207675_100082780 Ga0207675_1000827805 194
560 3300026118 Ga0207675_100088344 Ga0207675_1000883443 194
561 3300026118 Ga0207675_100219711 Ga0207675_1002197112 194
562 3300026118 Ga0207675_100269438 Ga0207675_1002694382 194
563 3300026121 Ga0207683_10006580 Ga0207683_100065802 194
564 3300026121 Ga0207683_10793317 Ga0207683_107933171 194
565 3300026142 Ga0207698_10010871 Ga0207698_100108712 194
566 3300026142 Ga0207698_10141744 Ga0207698_101417442 194
567 3300026142 Ga0207698_11323502 Ga0207698_113235021 194
568 3300027360 Ga0209969_1008892 Ga0209969_10088922 194
569 3300027364 Ga0209967_1009478 Ga0209967_10094783 194
570 3300027378 Ga0209981_1003950 Ga0209981_10039502 194
571 3300027395 Ga0209996_1001105 Ga0209996_10011053 194
572 3300027424 Ga0209984_1002122 Ga0209984_10021223 194
573 3300027462 Ga0210000_1007312 Ga0210000_10073123 194
574 3300027471 Ga0209995_1001050 Ga0209995_10010503 194
575 3300027526 Ga0209968_1003024 Ga0209968_10030243 194
576 3300027543 Ga0209999_1000025 Ga0209999_10000255 194
577 3300027552 Ga0209982_1001508 Ga0209982_10015082 194
578 3300027614 Ga0209970_1007998 Ga0209970_10079983 194
579 3300027617 Ga0210002_1003118 Ga0210002_10031182 194
580 3300027665 Ga0209983_1000033 Ga0209983_10000333 194
581 3300027671 Ga0209588_1000002 Ga0209588_100000241 194
582 3300027682 Ga0209971_1000127 Ga0209971_100012718 194
583 3300027682 Ga0209971_1021525 Ga0209971_10215251 194
584 3300027695 Ga0209966_1000147 Ga0209966_10001478 194
585 3300027717 Ga0209998_10000063 Ga0209998_100000639 194
586 3300027717 Ga0209998_10002609 Ga0209998_100026095 194
587 3300027717 Ga0209998_10064551 Ga0209998_100645512 194
588 3300027876 Ga0209974_10009869 Ga0209974_100098693 194
589 3300027876 Ga0209974_10024507 Ga0209974_100245072 194
590 3300027876 Ga0209974_10036896 Ga0209974_100368962 194
591 3300027907 Ga0207428_10071934 Ga0207428_100719343 194
592 3300027907 Ga0207428_10104750 Ga0207428_101047502 194
593 3300027907 Ga0207428_10205343 Ga0207428_102053432 194
594 3300027907 Ga0207428_10599782 Ga0207428_105997821 194
595 3300028379 Ga0268266_10001122 Ga0268266_1000112215 194
596 3300028379 Ga0268266_10338834 Ga0268266_103388342 194
597 3300028379 Ga0268266_10414700 Ga0268266_104147002 194
598 3300028379 Ga0268266_10866496 Ga0268266_108664961 194
599 3300028380 Ga0268265_10008184 Ga0268265_100081842 194
600 3300028380 Ga0268265_10010285 Ga0268265_100102852 194
601 3300028380 Ga0268265_10010902 Ga0268265_100109022 194
602 3300028380 Ga0268265_10016947 Ga0268265_100169473 194
603 3300028380 Ga0268265_10055261 Ga0268265_100552611 194
604 3300028380 Ga0268265_10549715 Ga0268265_105497151 194
605 3300028380 Ga0268265_11334530 Ga0268265_113345301 194
606 3300028381 Ga0268264_10012235 Ga0268264_100122354 194
607 3300028381 Ga0268264_10047256 Ga0268264_100472561 194
608 3300028381 Ga0268264_10190245 Ga0268264_101902453 194
609 3300028381 Ga0268264_10211988 Ga0268264_102119882 194
610 3300028381 Ga0268264_10313492 Ga0268264_103134922 194
611 3300028381 Ga0268264_10382123 Ga0268264_103821232 194
612 3300028381 Ga0268264_10464202 Ga0268264_104642022 194
613 3300028381 Ga0268264_10802402 Ga0268264_108024022 194
614 3300028556 Ga0265337_1001863 Ga0265337_10018635 194
615 3300028556 Ga0265337_1016100 Ga0265337_10161003 194
616 3300028563 Ga0265319_1000099 Ga0265319_100009954 194
617 3300028573 Ga0265334_10014627 Ga0265334_100146274 194
618 3300028573 Ga0265334_10046285 Ga0265334_100462852 194
619 3300028577 Ga0265318_10000029 Ga0265318_1000002942 194
620 3300028577 Ga0265318_10000030 Ga0265318_1000003036 194
621 3300028577 Ga0265318_10000475 Ga0265318_100004758 194
622 3300028577 Ga0265318_10004793 Ga0265318_100047934 194
623 3300028577 Ga0265318_10007653 Ga0265318_100076532 194
624 3300028577 Ga0265318_10061542 Ga0265318_100615422 194
625 3300028653 Ga0265323_10001946 Ga0265323_100019465 194
626 3300028653 Ga0265323_10004203 Ga0265323_100042036 194
627 3300028653 Ga0265323_10013094 Ga0265323_100130944 194
628 3300028653 Ga0265323_10014451 Ga0265323_100144513 194
629 3300028653 Ga0265323_10097669 Ga0265323_100976692 194
630 3300028654 Ga0265322_10002919 Ga0265322_100029193 194
631 3300028654 Ga0265322_10036956 Ga0265322_100369562 194
632 3300028654 Ga0265322_10125536 Ga0265322_101255361 194
633 3300028794 Ga0307515_10372973 Ga0307515_103729731 194
634 3300028800 Ga0265338_10014764 Ga0265338_100147645 194
635 3300028800 Ga0265338_10018298 Ga0265338_100182984 194
636 3300028800 Ga0265338_10096509 Ga0265338_100965092 194
637 3300028800 Ga0265338_10120824 Ga0265338_101208242 194
638 3300029957 Ga0265324_10000038 Ga0265324_1000003890 194
639 3300029957 Ga0265324_10015664 Ga0265324_100156642 194
640 3300030521 Ga0307511_10015383 Ga0307511_100153833 194
641 3300031090 Ga0265760_10083153 Ga0265760_100831532 194
642 3300031090 Ga0265760_10205980 Ga0265760_102059801 194
643 3300031235 Ga0265330_10000105 Ga0265330_1000010525 194
644 3300031235 Ga0265330_10000241 Ga0265330_1000024143 194
645 3300031235 Ga0265330_10000632 Ga0265330_100006327 194
646 3300031235 Ga0265330_10001005 Ga0265330_100010052 194
647 3300031235 Ga0265330_10002964 Ga0265330_100029642 194
648 3300031235 Ga0265330_10006503 Ga0265330_100065031 194
649 3300031235 Ga0265330_10025563 Ga0265330_100255632 194
650 3300031235 Ga0265330_10041190 Ga0265330_100411903 194
651 3300031235 Ga0265330_10073806 Ga0265330_100738062 194
652 3300031238 Ga0265332_10000032 Ga0265332_1000003291 194
653 3300031238 Ga0265332_10015705 Ga0265332_100157052 194
654 3300031238 Ga0265332_10042803 Ga0265332_100428032 194
655 3300031239 Ga0265328_10002510 Ga0265328_100025107 194
656 3300031239 Ga0265328_10051728 Ga0265328_100517282 194
657 3300031240 Ga0265320_10000017 Ga0265320_1000001795 194
658 3300031240 Ga0265320_10000044 Ga0265320_1000004429 194
659 3300031240 Ga0265320_10006167 Ga0265320_100061673 194
660 3300031240 Ga0265320_10072652 Ga0265320_100726522 194
661 3300031241 Ga0265325_10000206 Ga0265325_100002061 194
662 3300031241 Ga0265325_10008209 Ga0265325_100082094 194
663 3300031241 Ga0265325_10020686 Ga0265325_100206864 194
664 3300031242 Ga0265329_10000025 Ga0265329_100000258 194
665 3300031242 Ga0265329_10000043 Ga0265329_1000004336 194
666 3300031242 Ga0265329_10000299 Ga0265329_1000029917 194
667 3300031242 Ga0265329_10009972 Ga0265329_100099722 194
668 3300031242 Ga0265329_10010702 Ga0265329_100107023 194
669 3300031242 Ga0265329_10024535 Ga0265329_100245351 194
670 3300031242 Ga0265329_10035248 Ga0265329_100352482 194
671 3300031247 Ga0265340_10000434 Ga0265340_100004345 194
672 3300031247 Ga0265340_10002905 Ga0265340_1000290510 194
673 3300031247 Ga0265340_10010701 Ga0265340_100107012 194
674 3300031249 Ga0265339_10000039 Ga0265339_1000003992 194
675 3300031249 Ga0265339_10019068 Ga0265339_100190682 194
676 3300031249 Ga0265339_10031471 Ga0265339_100314714 194
677 3300031250 Ga0265331_10000027 Ga0265331_1000002789 194
678 3300031250 Ga0265331_10000451 Ga0265331_100004517 194
679 3300031250 Ga0265331_10001080 Ga0265331_1000108010 194
680 3300031250 Ga0265331_10007233 Ga0265331_100072333 194
681 3300031250 Ga0265331_10024917 Ga0265331_100249172 194
682 3300031251 Ga0265327_10175481 Ga0265327_101754812 194
683 3300031344 Ga0265316_10000065 Ga0265316_1000006553 194
684 3300031344 Ga0265316_10000149 Ga0265316_1000014929 194
685 3300031344 Ga0265316_10000295 Ga0265316_1000029529 194
686 3300031344 Ga0265316_10000335 Ga0265316_1000033523 194
687 3300031344 Ga0265316_10000357 Ga0265316_1000035739 194
688 3300031344 Ga0265316_10003769 Ga0265316_100037699 194
689 3300031344 Ga0265316_10005799 Ga0265316_1000579912 194
690 3300031344 Ga0265316_10006101 Ga0265316_100061018 194
691 3300031344 Ga0265316_10015302 Ga0265316_100153027 194
692 3300031344 Ga0265316_10030110 Ga0265316_100301103 194
693 3300031344 Ga0265316_10048454 Ga0265316_100484544 194
694 3300031344 Ga0265316_10049586 Ga0265316_100495862 194
695 3300031344 Ga0265316_10254787 Ga0265316_102547872 194
696 3300031456 Ga0307513_10368745 Ga0307513_103687451 194
697 3300031595 Ga0265313_10000002 Ga0265313_1000000288 194
698 3300031595 Ga0265313_10000236 Ga0265313_1000023640 194
699 3300031595 Ga0265313_10000738 Ga0265313_1000073826 194
700 3300031595 Ga0265313_10006604 Ga0265313_100066048 194
701 3300031595 Ga0265313_10016017 Ga0265313_100160175 194
702 3300031595 Ga0265313_10033854 Ga0265313_100338542 194
703 3300031595 Ga0265313_10035680 Ga0265313_100356804 194
704 3300031595 Ga0265313_10050459 Ga0265313_100504593 194
705 3300031616 Ga0307508_10000625 Ga0307508_1000062513 194
706 3300031616 Ga0307508_10036128 Ga0307508_100361284 194
707 3300031711 Ga0265314_10000015 Ga0265314_10000015250 194
708 3300031711 Ga0265314_10000069 Ga0265314_1000006942 194
709 3300031711 Ga0265314_10000701 Ga0265314_100007014 194
710 3300031711 Ga0265314_10001957 Ga0265314_100019576 194
711 3300031711 Ga0265314_10013250 Ga0265314_100132507 194
712 3300031711 Ga0265314_10014365 Ga0265314_100143655 194
713 3300031711 Ga0265314_10081691 Ga0265314_100816912 194
714 3300031712 Ga0265342_10000072 Ga0265342_1000007240 194
715 3300031712 Ga0265342_10000228 Ga0265342_1000022823 194
716 3300031712 Ga0265342_10000724 Ga0265342_1000072426 194
717 3300031712 Ga0265342_10002007 Ga0265342_100020075 194
718 3300031712 Ga0265342_10009882 Ga0265342_100098827 194
719 3300031712 Ga0265342_10009972 Ga0265342_100099726 194
720 3300031712 Ga0265342_10014161 Ga0265342_100141614 194
721 3300031712 Ga0265342_10017542 Ga0265342_100175422 194
722 3300031712 Ga0265342_10018406 Ga0265342_100184062 194
723 3300031712 Ga0265342_10019495 Ga0265342_100194951 194
724 3300031712 Ga0265342_10021206 Ga0265342_100212062 194
725 3300031727 Ga0316576_10037033 Ga0316576_100370332 194
726 3300031727 Ga0316576_10156263 Ga0316576_101562632 194
727 3300031727 Ga0316576_10194326 Ga0316576_101943262 194
728 3300031727 Ga0316576_10286860 Ga0316576_102868601 194
729 3300031727 Ga0316576_10777193 Ga0316576_107771931 194
730 3300031728 Ga0316578_10017309 Ga0316578_100173092 194
731 3300031728 Ga0316578_10058448 Ga0316578_100584482 194
732 3300031728 Ga0316578_10113217 Ga0316578_101132173 194
733 3300031730 Ga0307516_10076755 Ga0307516_100767553 194
734 3300031731 Ga0307405_10735750 Ga0307405_107357502 194
735 3300031852 Ga0307410_10338206 Ga0307410_103382061 194
736 3300031901 Ga0307406_10070939 Ga0307406_100709393 194
737 3300031903 Ga0307407_10084008 Ga0307407_100840083 194
738 3300031903 Ga0307407_10810146 Ga0307407_108101461 194
739 3300031995 Ga0307409_100133090 Ga0307409_1001330902 194
740 3300031995 Ga0307409_100280293 Ga0307409_1002802932 194
741 3300031995 Ga0307409_100609875 Ga0307409_1006098752 194
742 3300033179 Ga0307507_10026247 Ga0307507_100262474 194
743 3300034817 Ga0373948_0003013 Ga0373948_0003013_1005_1622 194
744 3300034818 Ga0373950_0000025 Ga0373950_0000025_52600_53187 194
745 3300035085 Ga0373929_0000003 Ga0373929_0000003_185451_186035 194
746 3300035085 Ga0373929_0054054 Ga0373929_0054054_155_739 194
747 3300035091 Ga0373951_0006119 Ga0373951_0006119_568_1185 194
748 3300035115 Ga0373941_0076371 Ga0373941_0076371_410_1027 194
749 3300035115 Ga0373941_0125926 Ga0373941_0125926_307_891 194
750 3300035117 Ga0373953_0031638 Ga0373953_0031638_311_898 194
751 3300035170 Ga0373943_0599808 Ga0373943_0599808_14_601 194
752 3300035241 Ga0373961_0001172 Ga0373961_0001172_7539_8123 194
753 3300035241 Ga0373961_0108842 Ga0373961_0108842_296_883 194
754 3300035398 Ga0316574_0005968 Ga0316574_0005968_2238_2858 194
755 3300035398 Ga0316574_0125277 Ga0316574_0125277_509_1096 194
756 3300035692 Ga0373935_0002532 Ga0373935_0002532_5991_6605 194
757 3300035692 Ga0373935_0812402 Ga0373935_0812402_28_615 194
758 3300035695 Ga0373927_0392351 Ga0373927_0392351_120_710 194
759 3300035724 Ga0373933_0056772 Ga0373933_0056772_142_729 194
760 3300035724 Ga0373933_0568646 Ga0373933_0568646_76_666 194
761 3300036401 Ga0373937_0051072 Ga0373937_0051072_2688_3278 194
762 3300036401 Ga0373937_0507409 Ga0373937_0507409_488_1078 194
763 3300036647 Ga0316582_0267449 Ga0316582_0267449_463_1050 194
764 3300036712 Ga0316584_0000540 Ga0316584_0000540_379_966 194
765 3300036712 Ga0316584_0032828 Ga0316584_0032828_2890_3477 194
766 3300037068 Ga0373925_0934834 Ga0373925_0934834_82_669 194
767 3300037418 Ga0395900_0021425 Ga0395900_0021425_185_778 194
768 3300037471 Ga0395905_0000007 Ga0395905_0000007_364140_364733 194
769 3300037471 Ga0395905_0040561 Ga0395905_0040561_1393_1980 194
770 3300037471 Ga0395905_0377252 Ga0395905_0377252_630_1238 194
771 3300039093 Ga0400489_22377 Ga0400489_22377_1225_1812 194
772 3300039093 Ga0400489_46890 Ga0400489_46890_497_1084 194
773 3300039437 Ga0436365_0236220 Ga0436365_0236220_205_798 194
774 3300039437 Ga0436365_0443710 Ga0436365_0443710_271_855 194
775 3300039437 Ga0436365_0746798 Ga0436365_0746798_445_1029 194
776 3300039438 Ga0436360_0270732 Ga0436360_0270732_18_605 194
777 3300039438 Ga0436360_1236090 Ga0436360_1236090_197_787 194
778 3300039447 Ga0436361_0457863 Ga0436361_0457863_75_665 194
779 3300039453 Ga0436362_0969985 Ga0436362_0969985_153_743 194
780 3300041413 Ga0439465_0006935 Ga0439465_0006935_827_1417 194
781 3300041463 Ga0451804_1112314 Ga0451804_1112314_23_616 194
782 3300041486 Ga0451807_0466492 Ga0451807_0466492_93_677 194
783 3300041486 Ga0451807_0748572 Ga0451807_0748572_65_649 194
784 3300041486 Ga0451807_2420813 Ga0451807_2420813_53_640 194
785 3300041494 Ga0451837_0432478 Ga0451837_0432478_207_791 194
786 3300041494 Ga0451837_1517064 Ga0451837_1517064_36_629 194
787 3300041505 Ga0451849_0266999 Ga0451849_0266999_309_893 194
788 3300041512 Ga0451853_2328441 Ga0451853_2328441_6074_6661 194
789 3300042005 Ga0439448_0057917 Ga0439448_0057917_390_1007 194
790 3300042007 Ga0439449_0126597 Ga0439449_0126597_317_907 194
791 3300042118 Ga0450914_015202 Ga0450914_015202_131_748 194
792 3300042157 Ga0439458_0002681 Ga0439458_0002681_3109_3699 194
793 3300042461 Ga0439460_0005362 Ga0439460_0005362_904_1521 194
794 3300042876 Ga0451577_0004861 Ga0451577_0004861_11892_12476 194
795 3300042876 Ga0451577_0060969 Ga0451577_0060969_677_1294 194
796 3300042876 Ga0451577_0187372 Ga0451577_0187372_421_1014 194
797 3300042876 Ga0451577_0187777 Ga0451577_0187777_1236_1829 194
798 3300042876 Ga0451577_0221684 Ga0451577_0221684_1063_1680 194
799 3300042876 Ga0451577_0300251 Ga0451577_0300251_272_856 194
800 3300042876 Ga0451577_0437455 Ga0451577_0437455_246_863 194
801 3300042876 Ga0451577_0648440 Ga0451577_0648440_248_835 194
802 3300042876 Ga0451577_0847925 Ga0451577_0847925_73_690 194
803 3300044673 Ga0453683_0005763 Ga0453683_0005763_6272_6889 194
804 3300044673 Ga0453683_0007604 Ga0453683_0007604_1932_2519 194
805 3300044673 Ga0453683_0084631 Ga0453683_0084631_210_794 194
806 3300044673 Ga0453683_0115539 Ga0453683_0115539_782_1399 194
807 3300044673 Ga0453683_0145449 Ga0453683_0145449_198_785 194
808 3300044673 Ga0453683_0157653 Ga0453683_0157653_171_758 194
809 3300044673 Ga0453683_0179694 Ga0453683_0179694_277_870 194
810 3300044673 Ga0453683_0191359 Ga0453683_0191359_97_684 194
811 3300044683 Ga0466965_0192703 Ga0466965_0192703_161_751 194
812 3300044712 Ga0453684_0000248 Ga0453684_0000248_118457_119050 194
813 3300044712 Ga0453684_0001332 Ga0453684_0001332_7957_8544 194
814 3300044712 Ga0453684_0022768 Ga0453684_0022768_4953_5540 194
815 3300044712 Ga0453684_0066745 Ga0453684_0066745_3634_4218 194
816 3300044712 Ga0453684_0070346 Ga0453684_0070346_1993_2586 194
817 3300044712 Ga0453684_0081014 Ga0453684_0081014_1523_2116 194
818 3300044712 Ga0453684_0085533 Ga0453684_0085533_1276_1863 194
819 3300044712 Ga0453684_0087813 Ga0453684_0087813_21_608 194
820 3300044712 Ga0453684_0089075 Ga0453684_0089075_17_634 194
821 3300044712 Ga0453684_0111758 Ga0453684_0111758_1476_2060 194
822 3300044712 Ga0453684_0117881 Ga0453684_0117881_800_1387 194
823 3300044712 Ga0453684_0236095 Ga0453684_0236095_1403_1990 194
824 3300044712 Ga0453684_0236534 Ga0453684_0236534_696_1289 194
825 3300044712 Ga0453684_0250322 Ga0453684_0250322_615_1202 194
826 3300044712 Ga0453684_0417920 Ga0453684_0417920_532_1122 194
827 3300044712 Ga0453684_0467878 Ga0453684_0467878_642_1259 194
828 3300044712 Ga0453684_1070516 Ga0453684_1070516_36_653 194
829 3300044712 Ga0453684_1100224 Ga0453684_1100224_73_660 194
830 3300044842 Ga0466957_0603979 Ga0466957_0603979_57_644 194
831 3300044901 Ga0466960_0058594 Ga0466960_0058594_1129_1716 194
832 3300045049 Ga0466959_0336449 Ga0466959_0336449_413_1003 194
833 3300045051 Ga0451576_0009882 Ga0451576_0009882_2256_2873 194
834 3300045051 Ga0451576_0021018 Ga0451576_0021018_2991_3575 194
835 3300045051 Ga0451576_0216876 Ga0451576_0216876_1163_1771 194
836 3300045051 Ga0451576_0330478 Ga0451576_0330478_925_1542 194
837 3300045976 Ga0466967_0184983 Ga0466967_0184983_315_902 194
838 3300045976 Ga0466967_0347253 Ga0466967_0347253_49_633 194
839 3300046455 Ga0495603_0186071 Ga0495603_0186071_403_987 194
840 3300046455 Ga0495603_0292366 Ga0495603_0292366_219_806 194
841 3300046473 Ga0495582_0153000 Ga0495582_0153000_365_949 194
842 3300046491 Ga0495584_0096153 Ga0495584_0096153_133_750 194
843 3300046533 Ga0495640_0196607 Ga0495640_0196607_566_1156 194
844 3300046539 Ga0495621_0007472 Ga0495621_0007472_34_618 194
845 3300046557 Ga0495622_0043156 Ga0495622_0043156_964_1548 194
846 3300046557 Ga0495622_0091996 Ga0495622_0091996_375_965 194
847 3300046681 Ga0495647_0096502 Ga0495647_0096502_570_1154 194
848 3300046683 Ga0495658_0245136 Ga0495658_0245136_107_691 194
849 3300047315 Ga0495581_0023218 Ga0495581_0023218_1581_2165 194
850 3300047315 Ga0495581_0080963 Ga0495581_0080963_506_1093 194
851 3300047321 Ga0495676_0130318 Ga0495676_0130318_982_1566 194
852 3300047322 Ga0495680_0142001 Ga0495680_0142001_704_1291 194
853 3300047322 Ga0495680_0288996 Ga0495680_0288996_268_852 194
854 3300047673 Ga0495593_0344461 Ga0495593_0344461_91_678 194
855 3300048904 Ga0496101_0548091 Ga0496101_0548091_273_860 194
856 3300048905 Ga0496102_0255886 Ga0496102_0255886_18_635 194
857 3300048906 Ga0496103_0424588 Ga0496103_0424588_221_838 194
858 3300048907 Ga0496104_0051995 Ga0496104_0051995_3200_3787 194
859 3300048907 Ga0496104_0091351 Ga0496104_0091351_2234_2821 194
860 3300048909 Ga0496106_0372597 Ga0496106_0372597_314_931 194
861 3300048913 Ga0496110_0530442 Ga0496110_0530442_318_905 194
862 3300048915 Ga0496112_0404731 Ga0496112_0404731_245_862 194
863 3300048916 Ga0496113_0382434 Ga0496113_0382434_443_1060 194
864 3300048917 Ga0496114_0000035 Ga0496114_0000035_46375_46959 194
865 3300048917 Ga0496114_0003291 Ga0496114_0003291_8477_9064 194
866 3300048917 Ga0496114_0509991 Ga0496114_0509991_23_610 194
867 3300048918 Ga0496115_0186239 Ga0496115_0186239_1052_1639 194
868 3300049514 Ga0501291_005747 Ga0501291_005747_534_1118 194
869 3300049515 Ga0501292_012292 Ga0501292_012292_107_691 194
870 3300049520 Ga0501297_011089 Ga0501297_011089_152_736 194
871 3300049527 Ga0501311_005612 Ga0501311_005612_688_1278 194
872 3300049528 Ga0501312_012397 Ga0501312_012397_551_1141 194
873 3300049569 Ga0501032_0296431 Ga0501032_0296431_277_894 194
874 3300049571 Ga0501034_0000120 Ga0501034_0000120_129039_129626 194
875 3300049572 Ga0501036_0008740 Ga0501036_0008740_7524_8111 194
876 3300049572 Ga0501036_0091021 Ga0501036_0091021_527_1144 194
877 3300049574 Ga0501038_0156688 Ga0501038_0156688_74_691 194
878 3300049574 Ga0501038_0308702 Ga0501038_0308702_336_923 194
879 3300049574 Ga0501038_0491170 Ga0501038_0491170_179_796 194
880 3300049575 Ga0501039_0247476 Ga0501039_0247476_186_803 194
881 3300049576 Ga0501040_0000236 Ga0501040_0000236_19727_20344 194
882 3300049576 Ga0501040_0757000 Ga0501040_0757000_101_685 194
883 3300049577 Ga0501041_0020874 Ga0501041_0020874_1477_2094 194
884 3300049578 Ga0501042_0023757 Ga0501042_0023757_2100_2717 194
885 3300049578 Ga0501042_0445260 Ga0501042_0445260_286_903 194
886 3300049578 Ga0501042_0837557 Ga0501042_0837557_18_605 194
887 3300049579 Ga0501043_0021008 Ga0501043_0021008_3746_4333 194
888 3300049580 Ga0501046_0000111 Ga0501046_0000111_18818_19405 194
889 3300049580 Ga0501046_0000355 Ga0501046_0000355_26021_26638 194
890 3300049580 Ga0501046_0334428 Ga0501046_0334428_457_1041 194
891 3300049581 Ga0501047_0000009 Ga0501047_0000009_208934_209521 194
892 3300049581 Ga0501047_0151956 Ga0501047_0151956_618_1235 194
893 3300049582 Ga0501048_0000918 Ga0501048_0000918_13844_14431 194
894 3300049582 Ga0501048_0001804 Ga0501048_0001804_10288_10905 194
895 3300049582 Ga0501048_0134910 Ga0501048_0134910_1063_1680 194
896 3300049582 Ga0501048_0479984 Ga0501048_0479984_51_635 194
897 3300049583 Ga0501067_0008110 Ga0501067_0008110_3787_4371 194
898 3300049584 Ga0501068_0004352 Ga0501068_0004352_4960_5547 194
899 3300049584 Ga0501068_0011942 Ga0501068_0011942_2811_3395 194
900 3300049584 Ga0501068_0018570 Ga0501068_0018570_1273_1860 194
901 3300049584 Ga0501068_0075130 Ga0501068_0075130_365_982 194
902 3300049586 Ga0501070_0000323 Ga0501070_0000323_7155_7742 194
903 3300049586 Ga0501070_0000423 Ga0501070_0000423_11473_12060 194
904 3300049587 Ga0501071_0044198 Ga0501071_0044198_2077_2694 194
905 3300049587 Ga0501071_0303557 Ga0501071_0303557_31_648 194
906 3300049588 Ga0501072_0000022 Ga0501072_0000022_4992_5579 194
907 3300049588 Ga0501072_0330581 Ga0501072_0330581_369_986 194
908 3300049589 Ga0501073_0002636 Ga0501073_0002636_6561_7148 194
909 3300049589 Ga0501073_0042906 Ga0501073_0042906_2277_2864 194
910 3300049589 Ga0501073_0056861 Ga0501073_0056861_1565_2152 194
911 3300049589 Ga0501073_0347834 Ga0501073_0347834_149_736 194
912 3300049590 Ga0501074_0001477 Ga0501074_0001477_5598_6185 194
913 3300049590 Ga0501074_0002458 Ga0501074_0002458_7974_8591 194
914 3300049590 Ga0501074_0031618 Ga0501074_0031618_984_1571 194
915 3300049590 Ga0501074_0101822 Ga0501074_0101822_732_1349 194
916 3300049590 Ga0501074_0206933 Ga0501074_0206933_41_631 194
917 3300049591 Ga0501075_0000724 Ga0501075_0000724_8739_9323 194
918 3300049591 Ga0501075_0037992 Ga0501075_0037992_1142_1759 194
919 3300049591 Ga0501075_0058006 Ga0501075_0058006_169_786 194
920 3300049592 Ga0501076_0025421 Ga0501076_0025421_3165_3782 194
921 3300049592 Ga0501076_0108973 Ga0501076_0108973_483_1100 194
922 3300049592 Ga0501076_0508250 Ga0501076_0508250_56_673 194
923 3300049592 Ga0501076_0662686 Ga0501076_0662686_249_839 194
924 3300049593 Ga0501077_0002509 Ga0501077_0002509_7711_8328 194
925 3300049593 Ga0501077_0004705 Ga0501077_0004705_3372_3956 194
926 3300049593 Ga0501077_0044847 Ga0501077_0044847_1875_2492 194
927 3300049652 Ga0501202_016474 Ga0501202_016474_765_1349 194
928 3300049655 Ga0501208_079349 Ga0501208_079349_56_640 194
929 3300049663 Ga0501223_028024 Ga0501223_028024_70_654 194
930 3300049665 Ga0501227_094889 Ga0501227_094889_140_724 194
931 3300049669 Ga0501235_020743 Ga0501235_020743_66_650 194
932 3300049673 Ga0501240_021439 Ga0501240_021439_24_608 194
933 3300049675 Ga0501243_029352 Ga0501243_029352_32_616 194
934 3300049677 Ga0501247_015130 Ga0501247_015130_63_647 194
935 3300049679 Ga0501249_006889 Ga0501249_006889_1254_1838 194
936 3300049680 Ga0501250_012425 Ga0501250_012425_391_975 194
937 3300049686 Ga0501257_014898 Ga0501257_014898_328_912 194
938 3300049704 Ga0501221_048864 Ga0501221_048864_293_877 194
939 3300049705 Ga0501225_0010653 Ga0501225_0010653_755_1339 194
940 3300049741 Ga0501079_0000167 Ga0501079_0000167_23887_24474 194
941 3300049741 Ga0501079_0000304 Ga0501079_0000304_2040_2657 194
942 3300049741 Ga0501079_0000923 Ga0501079_0000923_17056_17673 194
943 3300049741 Ga0501079_0014643 Ga0501079_0014643_2867_3484 194
944 3300049741 Ga0501079_0575125 Ga0501079_0575125_77_661 194
945 3300049742 Ga0501080_0004524 Ga0501080_0004524_9403_9990 194
946 3300049742 Ga0501080_0009716 Ga0501080_0009716_4145_4729 194
947 3300049742 Ga0501080_0157934 Ga0501080_0157934_1214_1831 194
948 3300049742 Ga0501080_0273341 Ga0501080_0273341_757_1344 194
949 3300049742 Ga0501080_0301843 Ga0501080_0301843_337_927 194
950 3300049743 Ga0501081_0006215 Ga0501081_0006215_6277_6894 194
951 3300049743 Ga0501081_0178347 Ga0501081_0178347_678_1262 194
952 3300049744 Ga0501083_0001196 Ga0501083_0001196_10388_10975 194
953 3300049744 Ga0501083_0003486 Ga0501083_0003486_2158_2742 194
954 3300049744 Ga0501083_0005690 Ga0501083_0005690_6268_6885 194
955 3300049744 Ga0501083_0012209 Ga0501083_0012209_5402_5992 194
956 3300049744 Ga0501083_0014052 Ga0501083_0014052_4964_5551 194
957 3300049744 Ga0501083_0035604 Ga0501083_0035604_2123_2710 194
958 3300049744 Ga0501083_0062049 Ga0501083_0062049_13_600 194
959 3300049744 Ga0501083_0327039 Ga0501083_0327039_289_906 194
960 3300049760 Ga0501263_010800 Ga0501263_010800_114_704 194
961 3300049775 Ga0501279_028159 Ga0501279_028159_32_616 194
962 3300049822 Ga0501035_0085866 Ga0501035_0085866_1596_2183 194
963 3300049824 Ga0501045_0002211 Ga0501045_0002211_2355_2972 194
964 3300049824 Ga0501045_0250658 Ga0501045_0250658_556_1173 194
965 3300049824 Ga0501045_0493330 Ga0501045_0493330_43_660 194
966 3300050493 nmdc:mga0k408_125463_c1 nmdc:mga0k408_125463_c1_792_1379 194
967 3300050493 nmdc:mga0k408_186480_c1 nmdc:mga0k408_186480_c1_200_787 194
968 3300050507 nmdc:mga05p37_1079265_c1 nmdc:mga05p37_1079265_c1_74_661 194
969 3300050507 nmdc:mga05p37_116972_c1 nmdc:mga05p37_116972_c1_1928_2554 194
970 3300050507 nmdc:mga05p37_14807_c1 nmdc:mga05p37_14807_c1_6771_7388 194
971 3300050507 nmdc:mga05p37_187641_c1 nmdc:mga05p37_187641_c1_1550_2167 194
972 3300050507 nmdc:mga05p37_223906_c1 nmdc:mga05p37_223906_c1_779_1363 194
973 3300050507 nmdc:mga05p37_327047_c1 nmdc:mga05p37_327047_c1_67_651 194
974 3300050507 nmdc:mga05p37_592770_c1 nmdc:mga05p37_592770_c1_610_1194 194
975 3300050507 nmdc:mga05p37_9153_c1 nmdc:mga05p37_9153_c1_3314_3931 194
976 3300050508 nmdc:mga09592_133433_c1 nmdc:mga09592_133433_c1_813_1397 194
977 3300050509 nmdc:mga0qj67_836651_c1 nmdc:mga0qj67_836651_c1_26_619 194
978 3300050510 nmdc:mga06r32_1032541_c1 nmdc:mga06r32_1032541_c1_100_684 194
979 3300050510 nmdc:mga06r32_3042_c1 nmdc:mga06r32_3042_c1_10988_11572 194
980 3300050511 nmdc:mga08y16_114999_c1 nmdc:mga08y16_114999_c1_1635_2375 194
981 3300050511 nmdc:mga08y16_171500_c1 nmdc:mga08y16_171500_c1_88_672 194
982 3300050511 nmdc:mga08y16_26576_c1 nmdc:mga08y16_26576_c1_3834_4424 194
983 3300050511 nmdc:mga08y16_408695_c1 nmdc:mga08y16_408695_c1_17_607 194
984 3300050511 nmdc:mga08y16_7505_c1 nmdc:mga08y16_7505_c1_3267_3851 194
985 3300050511 nmdc:mga08y16_963792_c1 nmdc:mga08y16_963792_c1_126_716 194
986 3300050511 nmdc:mga08y16_974359_c1 nmdc:mga08y16_974359_c1_59_643 194
987 3300050512 nmdc:mga0n895_12489_c1 nmdc:mga0n895_12489_c1_779_1396 194
988 3300050512 nmdc:mga0n895_149411_c1 nmdc:mga0n895_149411_c1_1488_2072 194
989 3300050512 nmdc:mga0n895_17952_c1 nmdc:mga0n895_17952_c1_4682_5266 194
990 3300050512 nmdc:mga0n895_389045_c1 nmdc:mga0n895_389045_c1_186_803 194
991 3300050512 nmdc:mga0n895_396895_c1 nmdc:mga0n895_396895_c1_81_665 194
992 3300050512 nmdc:mga0n895_548781_c1 nmdc:mga0n895_548781_c1_70_654 194
993 3300050513 nmdc:mga0rr50_30246_c1 nmdc:mga0rr50_30246_c1_1675_2292 194
994 3300050514 nmdc:mga08x19_38466_c1 nmdc:mga08x19_38466_c1_614_1231 194
995 3300050514 nmdc:mga08x19_80335_c1 nmdc:mga08x19_80335_c1_88_672 194
996 3300050515 nmdc:mga0a205_20046_c1 nmdc:mga0a205_20046_c1_645_1262 194
997 3300050515 nmdc:mga0a205_2044_c1 nmdc:mga0a205_2044_c1_9697_10314 194
998 3300050515 nmdc:mga0a205_38031_c1 nmdc:mga0a205_38031_c1_1437_2021 194
999 3300050515 nmdc:mga0a205_71511_c2 nmdc:mga0a205_71511_c2_1386_1973 194
1000 3300053080 Ga0500635_0033936 Ga0500635_0033936_552_1139 194
1001 3300053084 Ga0495595_0343583 Ga0495595_0343583_115_705 194
1002 3300053088 Ga0500644_0004509 Ga0500644_0004509_843_1430 194
1003 3300053098 Ga0500650_0135385 Ga0500650_0135385_538_1125 194
1004 3300054114 Ga0501084_0000006 Ga0501084_0000006_208934_209521 194
1005 3300054114 Ga0501084_0001672 Ga0501084_0001672_5963_6550 194
1006 3300054114 Ga0501084_0010675 Ga0501084_0010675_4489_5079 194
1007 3300054114 Ga0501084_0060806 Ga0501084_0060806_1892_2509 194
1008 3300054114 Ga0501084_0176906 Ga0501084_0176906_1132_1719 194
1009 3300059493 Ga0587077_104851 Ga0587077_104851_51_641 194
1010 3300059506 Ga0587085_012672 Ga0587085_012672_75_665 194
1011 3300059605 Ga0587106_027990 Ga0587106_027990_244_840 194
1012 3300059623 Ga0587101_006064 Ga0587101_006064_166_756 194
1013 3300059624 Ga0587109_015968 Ga0587109_015968_10_600 194
1014 3300059624 Ga0587109_020404 Ga0587109_020404_412_1002 194
1015 3300059639 Ga0587062_006709 Ga0587062_006709_662_1252 194
1016 3300059639 Ga0587062_059339 Ga0587062_059339_50_640 194
1017 3300060353 Ga0501082_0000081 Ga0501082_0000081_10044_10628 194
1018 3300060353 Ga0501082_0000280 Ga0501082_0000280_28606_29223 194
1019 3300060353 Ga0501082_0002810 Ga0501082_0002810_2674_3261 194
1020 3300060353 Ga0501082_0002975 Ga0501082_0002975_6226_6813 194
1021 3300060353 Ga0501082_0011756 Ga0501082_0011756_6183_6773 194
1022 3300060353 Ga0501082_0050770 Ga0501082_0050770_329_946 194
1023 3300060353 Ga0501082_0184224 Ga0501082_0184224_421_1038 194
1024 3300060353 Ga0501082_0265142 Ga0501082_0265142_282_866 194
1025 3300060353 Ga0501082_0345772 Ga0501082_0345772_51_635 194
1026 3300061734 Ga0530510_0045451 Ga0530510_0045451_2372_2989 194
1027 3300061734 Ga0530510_0134930 Ga0530510_0134930_1150_1767 194
1028 3300061734 Ga0530510_0233163 Ga0530510_0233163_250_867 194
1029 3300061734 Ga0530510_0551147 Ga0530510_0551147_234_851 194

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ymx-assembly2.cif.gz_B myxococcus xanthus mgla in gdp bound conformation 0.9504 2 194
6h5b-assembly1.cif.gz_A myxococcus xanthus mgla in complex with its gap mglb and gtpgammas 0.9439 2 190
3t1q-assembly1.cif.gz_A mgla bound to gppnhp in complex with mglb 0.9432 10 190
5ymx-assembly1.cif.gz_A myxococcus xanthus mgla in gdp bound conformation 0.941 2 194
6hjo-assembly1.cif.gz_B myxococcus xanthus mgla bound to gdp 0.9391 2 191
ID Description Score Start End Superfamily
3t1oB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9195 3 190 3.40.50.300
3t1oB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9102 3 190 3.40.50.300
af_P35292_16_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8196 12 191 3.40.50.300
af_Q9SJZ5_48_162_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8145 90 193 3.40.50.300
af_A4HUK3_2_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8122 12 187 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9Q7P6-F1-model_v4 GTPase domain-containing protein 1.003 98 194
AF-A0A7V9Q7P6-F1-model_v4 GTPase domain-containing protein 0.9924 98 194
AF-A0A6J4LAY2-F1-model_v4 Mutual gliding-motility protein MglA 0.9841 99 191
AF-A0A6J4LNE9-F1-model_v4 Mutual gliding-motility protein MglA 0.9824 72 191 GO:0003924
GO:0005525
AF-A0A7C4SRK4-F1-model_v4 GTP-binding protein 0.9818 1 193 GO:0003924
GO:0005525

Feature Viewer

pLDDT pTM Quality
89.71 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map