F488484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1025 | 488 | 1003 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100144299|Ga0068853_1001442994 |
| Length | 140 |
| Sequence | MSENSSQSEEDAMAAEWAAALAESKPENEVQTDTVAPAAFQNFSPTTGGGAGNDINMILDIPVQLTVELGRTRIPIKHILQLAQGSVVELDALAGEPMDVLVNGYLIAQGEVVVVNDKFGIRLTDIVTPSERMRRLSKAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 12 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 13 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 14 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 15 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 16 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 17 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 18 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 19 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 20 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 21 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 22 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 23 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 131 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 132 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 133 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 135 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 153 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 246 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 249 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 255 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 256 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 260 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 261 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 262 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 270 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 271 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 275 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 288 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 313 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 314 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 315 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 316 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 317 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 318 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 319 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 320 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 321 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 322 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 323 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 324 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 325 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 326 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 327 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 328 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 329 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 330 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 331 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 332 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 333 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 334 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 335 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 336 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 337 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 338 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 339 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 340 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 341 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 342 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 343 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 344 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 345 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 411 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 414 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 415 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 416 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 417 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 418 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 419 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 420 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 428 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 437 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 438 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 439 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 441 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 452 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 454 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 455 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 456 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 457 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 459 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 461 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 463 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 464 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 465 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 468 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 470 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 472 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 473 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 474 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.8 |
| Metatranscriptomes | 2.05 |
| Isolates | 2.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.93 |
| Nodule | 0.29 |
| Rhizoplane | 3.71 |
| Rhizosphere | 74.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_337291 | 2162886007 | Bacteria | 943 |
| 2 | JGI25156J39149_1000250 | 3300002705 | Bacteria | 37027 |
| 3 | JGI25156J39149_1004359 | 3300002705 | Bacteria | 4338 |
| 4 | JGI25154J39366_1000831 | 3300002738 | Bacteria | 13419 |
| 5 | JGI25154J39366_1001425 | 3300002738 | Bacteria | 8516 |
| 6 | JGI25157J39369_1000027 | 3300002741 | Bacteria | 147448 |
| 7 | Ga0055538_1003953 | 3300003751 | Bacteria | 1769 |
| 8 | Ga0055539_1000213 | 3300003752 | Bacteria | 42508 |
| 9 | Ga0055539_1008866 | 3300003752 | Bacteria | 1254 |
| 10 | Ga0055539_1015643 | 3300003752 | Bacteria | 922 |
| 11 | Ga0055533_1000073 | 3300003756 | Bacteria | 142476 |
| 12 | Ga0055533_1004066 | 3300003756 | Bacteria | 2743 |
| 13 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 14 | Ga0055525_1001549 | 3300003759 | Bacteria | 3824 |
| 15 | Ga0055535_1000231 | 3300003761 | Bacteria | 58583 |
| 16 | Ga0055542_1001267 | 3300003762 | Bacteria | 13722 |
| 17 | Ga0055529_1000385 | 3300003763 | Bacteria | 47717 |
| 18 | Ga0055529_1000410 | 3300003763 | Bacteria | 45041 |
| 19 | Ga0055540_1036520 | 3300003792 | Bacteria | 1090 |
| 20 | Ga0055541_1000163 | 3300003841 | Bacteria | 32746 |
| 21 | Ga0065704_10072289 | 3300005289 | Bacteria | 8798 |
| 22 | Ga0070658_10082474 | 3300005327 | Bacteria | 2642 |
| 23 | Ga0070658_10107787 | 3300005327 | Bacteria | 2305 |
| 24 | Ga0070658_10293181 | 3300005327 | Bacteria | 1386 |
| 25 | Ga0070658_10309199 | 3300005327 | Bacteria | 1348 |
| 26 | Ga0070658_10416578 | 3300005327 | Bacteria | 1155 |
| 27 | Ga0070658_10505972 | 3300005327 | Bacteria | 1044 |
| 28 | Ga0070683_100091520 | 3300005329 | Bacteria | 2856 |
| 29 | Ga0070690_100017913 | 3300005330 | Bacteria | 4269 |
| 30 | Ga0070690_101121428 | 3300005330 | Bacteria | 625 |
| 31 | Ga0070670_100161505 | 3300005331 | Bacteria | 1942 |
| 32 | Ga0070670_100255309 | 3300005331 | Bacteria | 1528 |
| 33 | Ga0070677_10058730 | 3300005333 | Bacteria | 1580 |
| 34 | Ga0068869_100013993 | 3300005334 | Bacteria | 5351 |
| 35 | Ga0068869_100076053 | 3300005334 | Bacteria | 2495 |
| 36 | Ga0068869_100129683 | 3300005334 | Bacteria | 1937 |
| 37 | Ga0068869_100140779 | 3300005334 | Bacteria | 1862 |
| 38 | Ga0070666_10071419 | 3300005335 | Bacteria | 2362 |
| 39 | Ga0070666_10157695 | 3300005335 | Bacteria | 1585 |
| 40 | Ga0070666_10172595 | 3300005335 | Bacteria | 1514 |
| 41 | Ga0068868_100003711 | 3300005338 | Bacteria | 10664 |
| 42 | Ga0068868_100059788 | 3300005338 | Bacteria | 3015 |
| 43 | Ga0068868_100142665 | 3300005338 | Bacteria | 1968 |
| 44 | Ga0068868_100210069 | 3300005338 | Bacteria | 1626 |
| 45 | Ga0068868_100240485 | 3300005338 | Bacteria | 1521 |
| 46 | Ga0068868_100725912 | 3300005338 | Bacteria | 891 |
| 47 | Ga0070660_100090730 | 3300005339 | Bacteria | 2409 |
| 48 | Ga0070660_100335039 | 3300005339 | Bacteria | 1244 |
| 49 | Ga0070689_100704961 | 3300005340 | Bacteria | 881 |
| 50 | Ga0070689_100989469 | 3300005340 | Bacteria | 748 |
| 51 | Ga0070691_10600060 | 3300005341 | Bacteria | 650 |
| 52 | Ga0070687_100025858 | 3300005343 | Bacteria | 2820 |
| 53 | Ga0070687_100111393 | 3300005343 | Bacteria | 1549 |
| 54 | Ga0070661_100130158 | 3300005344 | Bacteria | 1889 |
| 55 | Ga0070668_100013101 | 3300005347 | Bacteria | 6179 |
| 56 | Ga0070668_100019903 | 3300005347 | Bacteria | 5057 |
| 57 | Ga0070669_100004781 | 3300005353 | Bacteria | 9772 |
| 58 | Ga0070669_100080511 | 3300005353 | Bacteria | 2424 |
| 59 | Ga0070669_100557682 | 3300005353 | Bacteria | 956 |
| 60 | Ga0070675_100003213 | 3300005354 | Bacteria | 12380 |
| 61 | Ga0070671_100006682 | 3300005355 | Bacteria | 9222 |
| 62 | Ga0070671_100023685 | 3300005355 | Bacteria | 5026 |
| 63 | Ga0070671_100037342 | 3300005355 | Bacteria | 4028 |
| 64 | Ga0070671_100512187 | 3300005355 | Bacteria | 1033 |
| 65 | Ga0070674_100064407 | 3300005356 | Bacteria | 2568 |
| 66 | Ga0070674_100573828 | 3300005356 | Bacteria | 949 |
| 67 | Ga0070673_100252094 | 3300005364 | Bacteria | 1539 |
| 68 | Ga0070673_100299411 | 3300005364 | Bacteria | 1415 |
| 69 | Ga0070688_100069655 | 3300005365 | Bacteria | 2247 |
| 70 | Ga0070688_100617013 | 3300005365 | Bacteria | 832 |
| 71 | Ga0070688_101477344 | 3300005365 | Bacteria | 552 |
| 72 | Ga0070659_100103195 | 3300005366 | Bacteria | 2296 |
| 73 | Ga0070659_100154317 | 3300005366 | Bacteria | 1874 |
| 74 | Ga0070659_100404027 | 3300005366 | Bacteria | 1153 |
| 75 | Ga0070667_100001219 | 3300005367 | Bacteria | 23401 |
| 76 | Ga0070667_100010682 | 3300005367 | Bacteria | 7585 |
| 77 | Ga0070667_100027116 | 3300005367 | Bacteria | 4767 |
| 78 | Ga0070667_100165619 | 3300005367 | Bacteria | 1949 |
| 79 | Ga0070667_100505867 | 3300005367 | Bacteria | 1108 |
| 80 | Ga0070667_100753752 | 3300005367 | Bacteria | 902 |
| 81 | Ga0070713_101231270 | 3300005436 | Bacteria | 725 |
| 82 | Ga0070701_10173078 | 3300005438 | Bacteria | 1258 |
| 83 | Ga0070701_10253011 | 3300005438 | Bacteria | 1065 |
| 84 | Ga0070700_100408758 | 3300005441 | Bacteria | 1023 |
| 85 | Ga0070700_100649848 | 3300005441 | Bacteria | 833 |
| 86 | Ga0070694_100331235 | 3300005444 | Bacteria | 1174 |
| 87 | Ga0070708_100063831 | 3300005445 | Bacteria | 3298 |
| 88 | Ga0070708_100967280 | 3300005445 | Bacteria | 799 |
| 89 | Ga0070663_100003281 | 3300005455 | Bacteria | 9317 |
| 90 | Ga0070663_100412935 | 3300005455 | Bacteria | 1106 |
| 91 | Ga0070678_100093252 | 3300005456 | Bacteria | 2315 |
| 92 | Ga0070678_100348480 | 3300005456 | Bacteria | 1272 |
| 93 | Ga0070678_100422332 | 3300005456 | Bacteria | 1162 |
| 94 | Ga0070662_100008348 | 3300005457 | Bacteria | 6748 |
| 95 | Ga0070662_100008670 | 3300005457 | Bacteria | 6634 |
| 96 | Ga0070662_100014538 | 3300005457 | Bacteria | 5262 |
| 97 | Ga0070662_100158527 | 3300005457 | Bacteria | 1768 |
| 98 | Ga0070662_100348048 | 3300005457 | Bacteria | 1213 |
| 99 | Ga0070662_100815651 | 3300005457 | Bacteria | 794 |
| 100 | Ga0070681_10099116 | 3300005458 | Bacteria | 2860 |
| 101 | Ga0070681_11005679 | 3300005458 | Bacteria | 754 |
| 102 | Ga0068867_100150509 | 3300005459 | Bacteria | 1827 |
| 103 | Ga0068867_100532558 | 3300005459 | Bacteria | 1015 |
| 104 | Ga0068867_100625785 | 3300005459 | Bacteria | 942 |
| 105 | Ga0068867_100783942 | 3300005459 | Bacteria | 848 |
| 106 | Ga0070685_10028648 | 3300005466 | Bacteria | 3088 |
| 107 | Ga0070685_10546974 | 3300005466 | Bacteria | 826 |
| 108 | Ga0070706_100004486 | 3300005467 | Bacteria | 13456 |
| 109 | Ga0070707_100168314 | 3300005468 | Bacteria | 2135 |
| 110 | Ga0070707_100771912 | 3300005468 | Bacteria | 925 |
| 111 | Ga0070698_100138790 | 3300005471 | Bacteria | 2384 |
| 112 | Ga0070679_100043614 | 3300005530 | Bacteria | 4466 |
| 113 | Ga0070679_100238522 | 3300005530 | Bacteria | 1776 |
| 114 | Ga0070684_100189437 | 3300005535 | Bacteria | 1871 |
| 115 | Ga0070684_100462816 | 3300005535 | Bacteria | 1173 |
| 116 | Ga0068853_100089752 | 3300005539 | Bacteria | 2700 |
| 117 | Ga0068853_100144299 | 3300005539 | Bacteria | 2138 |
| 118 | Ga0068853_100282685 | 3300005539 | Bacteria | 1530 |
| 119 | Ga0068853_100378525 | 3300005539 | Bacteria | 1321 |
| 120 | Ga0070672_100046096 | 3300005543 | Bacteria | 3376 |
| 121 | Ga0070672_100614549 | 3300005543 | Bacteria | 947 |
| 122 | Ga0070686_100271624 | 3300005544 | Bacteria | 1247 |
| 123 | Ga0070693_100104913 | 3300005547 | Bacteria | 1728 |
| 124 | Ga0070693_100117118 | 3300005547 | Bacteria | 1648 |
| 125 | Ga0070665_100135161 | 3300005548 | Bacteria | 2468 |
| 126 | Ga0070665_100188616 | 3300005548 | Bacteria | 2063 |
| 127 | Ga0068855_100472735 | 3300005563 | Bacteria | 1365 |
| 128 | Ga0068855_100637779 | 3300005563 | Bacteria | 1145 |
| 129 | Ga0070664_100121932 | 3300005564 | Bacteria | 2283 |
| 130 | Ga0068857_100114500 | 3300005577 | Bacteria | 2425 |
| 131 | Ga0068857_100169087 | 3300005577 | Bacteria | 1986 |
| 132 | Ga0068857_100262457 | 3300005577 | Bacteria | 1585 |
| 133 | Ga0068857_100707434 | 3300005577 | Bacteria | 957 |
| 134 | Ga0068854_100143670 | 3300005578 | Bacteria | 1834 |
| 135 | Ga0068854_100199615 | 3300005578 | Bacteria | 1572 |
| 136 | Ga0068854_100371822 | 3300005578 | Bacteria | 1176 |
| 137 | Ga0068856_100006466 | 3300005614 | Bacteria | 11493 |
| 138 | Ga0068856_100218424 | 3300005614 | Bacteria | 1921 |
| 139 | Ga0070702_100451528 | 3300005615 | Bacteria | 932 |
| 140 | Ga0068852_100050955 | 3300005616 | Bacteria | 3550 |
| 141 | Ga0068852_100069007 | 3300005616 | Bacteria | 3096 |
| 142 | Ga0068852_100135132 | 3300005616 | Bacteria | 2276 |
| 143 | Ga0068852_100190849 | 3300005616 | Bacteria | 1933 |
| 144 | Ga0068852_100551033 | 3300005616 | Bacteria | 1153 |
| 145 | Ga0068852_101134046 | 3300005616 | Bacteria | 802 |
| 146 | Ga0068859_100178882 | 3300005617 | Bacteria | 2203 |
| 147 | Ga0068859_100291228 | 3300005617 | Bacteria | 1726 |
| 148 | Ga0068859_100704282 | 3300005617 | Bacteria | 1100 |
| 149 | Ga0068859_100980946 | 3300005617 | Bacteria | 927 |
| 150 | Ga0068859_101161779 | 3300005617 | Bacteria | 850 |
| 151 | Ga0068864_100008283 | 3300005618 | Bacteria | 8574 |
| 152 | Ga0068864_100591991 | 3300005618 | Bacteria | 1075 |
| 153 | Ga0068864_101070383 | 3300005618 | Bacteria | 802 |
| 154 | Ga0068866_10022876 | 3300005718 | Bacteria | 2899 |
| 155 | Ga0068866_10520103 | 3300005718 | Bacteria | 791 |
| 156 | Ga0068861_100007969 | 3300005719 | Bacteria | 7292 |
| 157 | Ga0068861_100128984 | 3300005719 | Bacteria | 2050 |
| 158 | Ga0068861_100169480 | 3300005719 | Bacteria | 1808 |
| 159 | Ga0068861_101125370 | 3300005719 | Bacteria | 756 |
| 160 | Ga0068861_101397726 | 3300005719 | Bacteria | 683 |
| 161 | Ga0068851_10023499 | 3300005834 | Bacteria | 3014 |
| 162 | Ga0068851_10518759 | 3300005834 | Bacteria | 716 |
| 163 | Ga0068870_10227233 | 3300005840 | Bacteria | 1145 |
| 164 | Ga0068870_10297558 | 3300005840 | Bacteria | 1017 |
| 165 | Ga0068863_100024285 | 3300005841 | Bacteria | 5781 |
| 166 | Ga0068863_100372012 | 3300005841 | Bacteria | 1394 |
| 167 | Ga0068863_100377215 | 3300005841 | Bacteria | 1384 |
| 168 | Ga0068858_100001818 | 3300005842 | Bacteria | 21717 |
| 169 | Ga0068858_100009355 | 3300005842 | Bacteria | 9357 |
| 170 | Ga0068858_100425093 | 3300005842 | Bacteria | 1278 |
| 171 | Ga0068860_100001009 | 3300005843 | Bacteria | 31175 |
| 172 | Ga0068860_100057253 | 3300005843 | Bacteria | 3705 |
| 173 | Ga0068860_100317511 | 3300005843 | Bacteria | 1529 |
| 174 | Ga0068860_100537904 | 3300005843 | Bacteria | 1169 |
| 175 | Ga0068860_100878965 | 3300005843 | Bacteria | 912 |
| 176 | Ga0068860_101969729 | 3300005843 | Bacteria | 606 |
| 177 | Ga0068862_100016575 | 3300005844 | Bacteria | 6136 |
| 178 | Ga0068862_100028605 | 3300005844 | Bacteria | 4695 |
| 179 | Ga0068862_100234000 | 3300005844 | Bacteria | 1668 |
| 180 | Ga0068862_101144648 | 3300005844 | Bacteria | 775 |
| 181 | Ga0068862_102487988 | 3300005844 | Bacteria | 529 |
| 182 | Ga0075365_10315211 | 3300006038 | Bacteria | 1101 |
| 183 | Ga0075363_100073012 | 3300006048 | Bacteria | 1866 |
| 184 | Ga0075363_100354009 | 3300006048 | Bacteria | 858 |
| 185 | Ga0075364_10567811 | 3300006051 | Bacteria | 775 |
| 186 | Ga0075432_10262376 | 3300006058 | Bacteria | 705 |
| 187 | Ga0070715_10030856 | 3300006163 | Bacteria | 2171 |
| 188 | Ga0070716_100426462 | 3300006173 | Bacteria | 960 |
| 189 | Ga0075362_10107294 | 3300006177 | Bacteria | 1312 |
| 190 | Ga0075362_10111955 | 3300006177 | Bacteria | 1285 |
| 191 | Ga0075367_10015588 | 3300006178 | Bacteria | 4137 |
| 192 | Ga0075367_10051425 | 3300006178 | Bacteria | 2435 |
| 193 | Ga0075369_10013367 | 3300006186 | Bacteria | 3258 |
| 194 | Ga0075369_10273240 | 3300006186 | Bacteria | 786 |
| 195 | Ga0075366_10002085 | 3300006195 | Bacteria | 10151 |
| 196 | Ga0075366_10005265 | 3300006195 | Bacteria | 7007 |
| 197 | Ga0075366_10025896 | 3300006195 | Bacteria | 3431 |
| 198 | Ga0075366_10111259 | 3300006195 | Bacteria | 1647 |
| 199 | Ga0075366_10114569 | 3300006195 | Bacteria | 1623 |
| 200 | Ga0075366_10134099 | 3300006195 | Bacteria | 1495 |
| 201 | Ga0075366_10178739 | 3300006195 | Bacteria | 1289 |
| 202 | Ga0075366_10722505 | 3300006195 | Bacteria | 619 |
| 203 | Ga0097621_100901532 | 3300006237 | Bacteria | 823 |
| 204 | Ga0075370_10000524 | 3300006353 | Bacteria | 14643 |
| 205 | Ga0075370_10015599 | 3300006353 | Bacteria | 4070 |
| 206 | Ga0075370_10046189 | 3300006353 | Bacteria | 2464 |
| 207 | Ga0075370_10072039 | 3300006353 | Bacteria | 1978 |
| 208 | Ga0075370_10080520 | 3300006353 | Bacteria | 1871 |
| 209 | Ga0075370_10131310 | 3300006353 | Bacteria | 1461 |
| 210 | Ga0075370_10154210 | 3300006353 | Bacteria | 1346 |
| 211 | Ga0075370_10185102 | 3300006353 | Bacteria | 1226 |
| 212 | Ga0075370_10531865 | 3300006353 | Bacteria | 710 |
| 213 | Ga0075370_10553542 | 3300006353 | Bacteria | 696 |
| 214 | Ga0068871_100692803 | 3300006358 | Bacteria | 933 |
| 215 | Ga0068871_100888264 | 3300006358 | Bacteria | 825 |
| 216 | Ga0075430_100023009 | 3300006846 | Bacteria | 5300 |
| 217 | Ga0075429_100008966 | 3300006880 | Bacteria | 8689 |
| 218 | Ga0068865_100458277 | 3300006881 | Bacteria | 1056 |
| 219 | Ga0068865_101393966 | 3300006881 | Bacteria | 626 |
| 220 | Ga0097620_100178887 | 3300006931 | Bacteria | 2203 |
| 221 | Ga0097620_100291221 | 3300006931 | Bacteria | 1726 |
| 222 | Ga0097620_100704274 | 3300006931 | Bacteria | 1100 |
| 223 | Ga0097620_100980990 | 3300006931 | Bacteria | 927 |
| 224 | Ga0097620_101161493 | 3300006931 | Bacteria | 850 |
| 225 | Ga0079104_1000530 | 3300006946 | Bacteria | 40514 |
| 226 | Ga0075435_100518518 | 3300007076 | Bacteria | 1031 |
| 227 | Ga0105244_10242759 | 3300009036 | Bacteria | 841 |
| 228 | Ga0105244_10333384 | 3300009036 | Bacteria | 700 |
| 229 | Ga0105240_10002903 | 3300009093 | Bacteria | 27043 |
| 230 | Ga0105240_10039246 | 3300009093 | Bacteria | 6065 |
| 231 | Ga0105240_10221428 | 3300009093 | Bacteria | 2204 |
| 232 | Ga0105240_10303100 | 3300009093 | Bacteria | 1827 |
| 233 | Ga0105240_10456133 | 3300009093 | Bacteria | 1429 |
| 234 | Ga0111539_11293384 | 3300009094 | Bacteria | 846 |
| 235 | Ga0105245_10008631 | 3300009098 | Bacteria | 8888 |
| 236 | Ga0105245_10281211 | 3300009098 | Bacteria | 1626 |
| 237 | Ga0105245_10295690 | 3300009098 | Bacteria | 1587 |
| 238 | Ga0114129_11533893 | 3300009147 | Bacteria | 818 |
| 239 | Ga0114129_13059471 | 3300009147 | Bacteria | 548 |
| 240 | Ga0105243_10008894 | 3300009148 | Bacteria | 7680 |
| 241 | Ga0105243_10083870 | 3300009148 | Bacteria | 2608 |
| 242 | Ga0105243_10098021 | 3300009148 | Bacteria | 2427 |
| 243 | Ga0105243_10195115 | 3300009148 | Bacteria | 1772 |
| 244 | Ga0105243_12100113 | 3300009148 | Bacteria | 601 |
| 245 | Ga0105241_10165192 | 3300009174 | Bacteria | 1823 |
| 246 | Ga0105241_10254402 | 3300009174 | Bacteria | 1490 |
| 247 | Ga0105241_10858465 | 3300009174 | Bacteria | 840 |
| 248 | Ga0105241_11123466 | 3300009174 | Bacteria | 741 |
| 249 | Ga0105242_10002491 | 3300009176 | Bacteria | 14439 |
| 250 | Ga0105242_10246410 | 3300009176 | Bacteria | 1608 |
| 251 | Ga0105242_10670637 | 3300009176 | Bacteria | 1011 |
| 252 | Ga0105242_10714194 | 3300009176 | Bacteria | 982 |
| 253 | Ga0105242_11873087 | 3300009176 | Bacteria | 640 |
| 254 | Ga0105248_10119484 | 3300009177 | Bacteria | 2973 |
| 255 | Ga0105248_10176473 | 3300009177 | Bacteria | 2407 |
| 256 | Ga0105237_10000605 | 3300009545 | Bacteria | 50037 |
| 257 | Ga0105237_10014977 | 3300009545 | Bacteria | 8082 |
| 258 | Ga0105237_10024647 | 3300009545 | Bacteria | 6153 |
| 259 | Ga0105237_10359953 | 3300009545 | Bacteria | 1459 |
| 260 | Ga0105237_10436478 | 3300009545 | Bacteria | 1315 |
| 261 | Ga0105238_10131727 | 3300009551 | Bacteria | 2479 |
| 262 | Ga0105238_10209691 | 3300009551 | Bacteria | 1924 |
| 263 | Ga0105238_10259041 | 3300009551 | Bacteria | 1718 |
| 264 | Ga0105238_10270280 | 3300009551 | Bacteria | 1681 |
| 265 | Ga0105249_10034828 | 3300009553 | Bacteria | 4564 |
| 266 | Ga0105249_10325198 | 3300009553 | Bacteria | 1550 |
| 267 | Ga0105239_10000328 | 3300010375 | Bacteria | 70165 |
| 268 | Ga0105239_10114097 | 3300010375 | Bacteria | 2997 |
| 269 | Ga0105239_10192752 | 3300010375 | Bacteria | 2281 |
| 270 | Ga0105246_10180369 | 3300011119 | Bacteria | 1625 |
| 271 | Ga0157317_1007403 | 3300012475 | Bacteria | 787 |
| 272 | Ga0157328_1012916 | 3300012478 | Bacteria | 613 |
| 273 | Ga0157318_1003919 | 3300012482 | Bacteria | 885 |
| 274 | Ga0157342_1031791 | 3300012507 | Bacteria | 668 |
| 275 | Ga0157316_1016460 | 3300012510 | Bacteria | 760 |
| 276 | Ga0157327_1006028 | 3300012512 | Bacteria | 1006 |
| 277 | Ga0157371_10119053 | 3300013102 | Bacteria | 1877 |
| 278 | Ga0157371_10161212 | 3300013102 | Bacteria | 1602 |
| 279 | Ga0157369_10066867 | 3300013105 | Bacteria | 3866 |
| 280 | Ga0157369_10106282 | 3300013105 | Bacteria | 2987 |
| 281 | Ga0157369_10255279 | 3300013105 | Bacteria | 1829 |
| 282 | Ga0157374_10007375 | 3300013296 | Bacteria | 9379 |
| 283 | Ga0157374_10047442 | 3300013296 | Bacteria | 3983 |
| 284 | Ga0157374_10423933 | 3300013296 | Bacteria | 1329 |
| 285 | Ga0157374_10945256 | 3300013296 | Bacteria | 880 |
| 286 | Ga0157378_10438143 | 3300013297 | Bacteria | 1295 |
| 287 | Ga0163162_10244035 | 3300013306 | Bacteria | 1928 |
| 288 | Ga0163162_10317266 | 3300013306 | Bacteria | 1691 |
| 289 | Ga0163162_10361146 | 3300013306 | Bacteria | 1585 |
| 290 | Ga0163162_10550524 | 3300013306 | Bacteria | 1282 |
| 291 | Ga0163162_11193545 | 3300013306 | Bacteria | 863 |
| 292 | Ga0157372_10010263 | 3300013307 | Bacteria | 9948 |
| 293 | Ga0157372_10052780 | 3300013307 | Bacteria | 4528 |
| 294 | Ga0157372_10371558 | 3300013307 | Bacteria | 1666 |
| 295 | Ga0157375_10024076 | 3300013308 | Bacteria | 5629 |
| 296 | Ga0157375_10163285 | 3300013308 | Bacteria | 2371 |
| 297 | Ga0157375_10275572 | 3300013308 | Bacteria | 1845 |
| 298 | Ga0157375_10387116 | 3300013308 | Bacteria | 1565 |
| 299 | Ga0157375_12202274 | 3300013308 | Bacteria | 657 |
| 300 | Ga0157380_10110834 | 3300014326 | Bacteria | 2306 |
| 301 | Ga0157380_10116060 | 3300014326 | Bacteria | 2259 |
| 302 | Ga0157380_10961560 | 3300014326 | Bacteria | 885 |
| 303 | Ga0157380_11770187 | 3300014326 | Bacteria | 676 |
| 304 | Ga0182008_10446782 | 3300014497 | Bacteria | 702 |
| 305 | Ga0157377_10053913 | 3300014745 | Bacteria | 2275 |
| 306 | Ga0157377_10480155 | 3300014745 | Bacteria | 864 |
| 307 | Ga0157379_10031084 | 3300014968 | Bacteria | 4757 |
| 308 | Ga0157379_10297734 | 3300014968 | Bacteria | 1470 |
| 309 | Ga0157379_10331511 | 3300014968 | Bacteria | 1391 |
| 310 | Ga0157376_10029275 | 3300014969 | Bacteria | 4387 |
| 311 | Ga0157376_10100852 | 3300014969 | Bacteria | 2522 |
| 312 | Ga0157376_10119790 | 3300014969 | Bacteria | 2331 |
| 313 | Ga0157376_10249929 | 3300014969 | Bacteria | 1656 |
| 314 | Ga0157376_10428805 | 3300014969 | Bacteria | 1285 |
| 315 | Ga0157376_11694049 | 3300014969 | Bacteria | 667 |
| 316 | Ga0182006_1179880 | 3300015261 | Bacteria | 706 |
| 317 | Ga0182005_1099118 | 3300015265 | Bacteria | 815 |
| 318 | Ga0163161_10234871 | 3300017792 | Bacteria | 1424 |
| 319 | Ga0163161_10569870 | 3300017792 | Bacteria | 930 |
| 320 | Ga0163161_11004975 | 3300017792 | Bacteria | 712 |
| 321 | Ga0163161_11226008 | 3300017792 | Bacteria | 649 |
| 322 | Ga0206353_11133087 | 3300020082 | Bacteria | 1345 |
| 323 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 324 | Ga0213872_10000161 | 3300021361 | Bacteria | 61406 |
| 325 | Ga0213872_10009666 | 3300021361 | Bacteria | 4617 |
| 326 | Ga0213874_10208777 | 3300021377 | Bacteria | 705 |
| 327 | Ga0213876_10032219 | 3300021384 | Bacteria | 2765 |
| 328 | Ga0209784_100284 | 3300025224 | Bacteria | 28522 |
| 329 | Ga0209566_100262 | 3300025225 | Bacteria | 49481 |
| 330 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 331 | Ga0209674_100200 | 3300025226 | Bacteria | 61971 |
| 332 | Ga0209674_110264 | 3300025226 | Bacteria | 1004 |
| 333 | Ga0209672_102750 | 3300025228 | Bacteria | 4055 |
| 334 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 335 | Ga0209563_100110 | 3300025230 | Bacteria | 142518 |
| 336 | Ga0209563_113405 | 3300025230 | Bacteria | 1082 |
| 337 | Ga0207427_100388 | 3300025231 | Bacteria | 26461 |
| 338 | Ga0209258_100305 | 3300025242 | Bacteria | 78801 |
| 339 | Ga0209258_100567 | 3300025242 | Bacteria | 31694 |
| 340 | Ga0209646_1000046 | 3300025246 | Bacteria | 332737 |
| 341 | Ga0209646_1000231 | 3300025246 | Bacteria | 59119 |
| 342 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 343 | Ga0209026_1006887 | 3300025250 | Bacteria | 2677 |
| 344 | Ga0209677_100246 | 3300025253 | Bacteria | 37119 |
| 345 | Ga0209677_103365 | 3300025253 | Bacteria | 5246 |
| 346 | Ga0209677_109922 | 3300025253 | Bacteria | 1647 |
| 347 | Ga0209148_1000110 | 3300025254 | Bacteria | 203536 |
| 348 | Ga0209148_1012339 | 3300025254 | Bacteria | 1565 |
| 349 | Ga0209759_1000107 | 3300025256 | Bacteria | 147025 |
| 350 | Ga0209759_1001067 | 3300025256 | Bacteria | 18006 |
| 351 | Ga0209759_1004020 | 3300025256 | Bacteria | 5635 |
| 352 | Ga0209759_1006693 | 3300025256 | Bacteria | 3829 |
| 353 | Ga0209759_1021621 | 3300025256 | Bacteria | 1458 |
| 354 | Ga0207666_1025448 | 3300025271 | Bacteria | 887 |
| 355 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 356 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 357 | Ga0209051_1002180 | 3300025303 | Bacteria | 14504 |
| 358 | Ga0209051_1004175 | 3300025303 | Bacteria | 9023 |
| 359 | Ga0209051_1007173 | 3300025303 | Bacteria | 6139 |
| 360 | Ga0209257_1000182 | 3300025304 | Bacteria | 156672 |
| 361 | Ga0207697_10158672 | 3300025315 | Bacteria | 986 |
| 362 | Ga0207656_10008176 | 3300025321 | Bacteria | 3839 |
| 363 | Ga0207656_10027048 | 3300025321 | Bacteria | 2343 |
| 364 | Ga0207656_10051038 | 3300025321 | Bacteria | 1788 |
| 365 | Ga0207656_10077488 | 3300025321 | Bacteria | 1488 |
| 366 | Ga0207682_10008487 | 3300025893 | Bacteria | 4061 |
| 367 | Ga0207682_10014215 | 3300025893 | Bacteria | 3101 |
| 368 | Ga0207682_10067933 | 3300025893 | Bacteria | 1505 |
| 369 | Ga0207642_10006194 | 3300025899 | Bacteria | 3963 |
| 370 | Ga0207642_10097420 | 3300025899 | Bacteria | 1468 |
| 371 | Ga0207642_10444082 | 3300025899 | Bacteria | 785 |
| 372 | Ga0207710_10016404 | 3300025900 | Bacteria | 3132 |
| 373 | Ga0207680_10002216 | 3300025903 | Bacteria | 9082 |
| 374 | Ga0207647_10678529 | 3300025904 | Bacteria | 563 |
| 375 | Ga0207643_10137116 | 3300025908 | Bacteria | 1459 |
| 376 | Ga0207705_10253094 | 3300025909 | Bacteria | 1343 |
| 377 | Ga0207705_10303962 | 3300025909 | Bacteria | 1224 |
| 378 | Ga0207705_11273526 | 3300025909 | Bacteria | 562 |
| 379 | Ga0207684_10005949 | 3300025910 | Bacteria | 11169 |
| 380 | Ga0207654_10079428 | 3300025911 | Bacteria | 1971 |
| 381 | Ga0207654_10151752 | 3300025911 | Bacteria | 1488 |
| 382 | Ga0207707_10517732 | 3300025912 | Bacteria | 1016 |
| 383 | Ga0207707_10658507 | 3300025912 | Bacteria | 882 |
| 384 | Ga0207695_10002543 | 3300025913 | Bacteria | 26790 |
| 385 | Ga0207695_10061905 | 3300025913 | Bacteria | 3866 |
| 386 | Ga0207695_10088943 | 3300025913 | Bacteria | 3107 |
| 387 | Ga0207671_10006429 | 3300025914 | Bacteria | 10462 |
| 388 | Ga0207671_10035144 | 3300025914 | Bacteria | 3721 |
| 389 | Ga0207671_10074449 | 3300025914 | Bacteria | 2538 |
| 390 | Ga0207671_10074506 | 3300025914 | Bacteria | 2537 |
| 391 | Ga0207671_10125132 | 3300025914 | Bacteria | 1968 |
| 392 | Ga0207657_10012263 | 3300025919 | Bacteria | 8467 |
| 393 | Ga0207657_10135699 | 3300025919 | Bacteria | 2014 |
| 394 | Ga0207657_10258321 | 3300025919 | Bacteria | 1387 |
| 395 | Ga0207649_10061744 | 3300025920 | Bacteria | 2360 |
| 396 | Ga0207649_10063794 | 3300025920 | Bacteria | 2327 |
| 397 | Ga0207652_10068430 | 3300025921 | Bacteria | 3081 |
| 398 | Ga0207646_10067554 | 3300025922 | Bacteria | 3191 |
| 399 | Ga0207681_10000795 | 3300025923 | Bacteria | 20798 |
| 400 | Ga0207681_10109921 | 3300025923 | Bacteria | 2003 |
| 401 | Ga0207694_10014757 | 3300025924 | Bacteria | 5890 |
| 402 | Ga0207694_10072140 | 3300025924 | Bacteria | 2699 |
| 403 | Ga0207694_10177669 | 3300025924 | Bacteria | 1725 |
| 404 | Ga0207694_10256685 | 3300025924 | Bacteria | 1431 |
| 405 | Ga0207694_10923096 | 3300025924 | Bacteria | 738 |
| 406 | Ga0207650_10004501 | 3300025925 | Bacteria | 9532 |
| 407 | Ga0207650_10102612 | 3300025925 | Bacteria | 2204 |
| 408 | Ga0207659_10032887 | 3300025926 | Bacteria | 3563 |
| 409 | Ga0207659_10104518 | 3300025926 | Bacteria | 2142 |
| 410 | Ga0207659_10168680 | 3300025926 | Bacteria | 1725 |
| 411 | Ga0207687_10360110 | 3300025927 | Bacteria | 1187 |
| 412 | Ga0207687_10444166 | 3300025927 | Bacteria | 1075 |
| 413 | Ga0207687_11180693 | 3300025927 | Bacteria | 658 |
| 414 | Ga0207700_10933047 | 3300025928 | Bacteria | 777 |
| 415 | Ga0207644_10024225 | 3300025931 | Bacteria | 4164 |
| 416 | Ga0207644_10041723 | 3300025931 | Bacteria | 3248 |
| 417 | Ga0207644_10866837 | 3300025931 | Bacteria | 756 |
| 418 | Ga0207644_11044440 | 3300025931 | Bacteria | 686 |
| 419 | Ga0207690_10201068 | 3300025932 | Bacteria | 1513 |
| 420 | Ga0207690_10620346 | 3300025932 | Bacteria | 884 |
| 421 | Ga0207690_10713146 | 3300025932 | Bacteria | 825 |
| 422 | Ga0207706_10007829 | 3300025933 | Bacteria | 9862 |
| 423 | Ga0207706_10014450 | 3300025933 | Bacteria | 7156 |
| 424 | Ga0207706_10212182 | 3300025933 | Bacteria | 1697 |
| 425 | Ga0207706_10502664 | 3300025933 | Bacteria | 1046 |
| 426 | Ga0207706_10531508 | 3300025933 | Bacteria | 1013 |
| 427 | Ga0207686_10015629 | 3300025934 | Bacteria | 4246 |
| 428 | Ga0207686_10047390 | 3300025934 | Bacteria | 2657 |
| 429 | Ga0207686_10252318 | 3300025934 | Bacteria | 1290 |
| 430 | Ga0207709_10000622 | 3300025935 | Bacteria | 29028 |
| 431 | Ga0207709_10030033 | 3300025935 | Bacteria | 3158 |
| 432 | Ga0207709_10150093 | 3300025935 | Bacteria | 1613 |
| 433 | Ga0207709_10301342 | 3300025935 | Bacteria | 1192 |
| 434 | Ga0207709_10895454 | 3300025935 | Bacteria | 721 |
| 435 | Ga0207709_10963796 | 3300025935 | Bacteria | 696 |
| 436 | Ga0207670_10038375 | 3300025936 | Bacteria | 3128 |
| 437 | Ga0207669_10245980 | 3300025937 | Bacteria | 1328 |
| 438 | Ga0207704_10087739 | 3300025938 | Bacteria | 2033 |
| 439 | Ga0207704_10192902 | 3300025938 | Bacteria | 1483 |
| 440 | Ga0207704_10763262 | 3300025938 | Bacteria | 805 |
| 441 | Ga0207704_10777717 | 3300025938 | Bacteria | 798 |
| 442 | Ga0207704_11009317 | 3300025938 | Bacteria | 704 |
| 443 | Ga0207665_10082203 | 3300025939 | Bacteria | 2219 |
| 444 | Ga0207691_10012093 | 3300025940 | Bacteria | 8276 |
| 445 | Ga0207691_10026402 | 3300025940 | Bacteria | 5449 |
| 446 | Ga0207691_10032397 | 3300025940 | Bacteria | 4872 |
| 447 | Ga0207711_10064486 | 3300025941 | Bacteria | 3164 |
| 448 | Ga0207711_10280431 | 3300025941 | Bacteria | 1535 |
| 449 | Ga0207711_10674490 | 3300025941 | Bacteria | 964 |
| 450 | Ga0207711_11641883 | 3300025941 | Bacteria | 586 |
| 451 | Ga0207689_10016046 | 3300025942 | Bacteria | 6341 |
| 452 | Ga0207689_10050658 | 3300025942 | Bacteria | 3423 |
| 453 | Ga0207689_10515849 | 3300025942 | Bacteria | 1002 |
| 454 | Ga0207689_10530271 | 3300025942 | Bacteria | 988 |
| 455 | Ga0207661_10140288 | 3300025944 | Bacteria | 2079 |
| 456 | Ga0207661_11211799 | 3300025944 | Bacteria | 694 |
| 457 | Ga0207679_10213629 | 3300025945 | Bacteria | 1619 |
| 458 | Ga0207679_10869504 | 3300025945 | Bacteria | 824 |
| 459 | Ga0207679_10898806 | 3300025945 | Bacteria | 810 |
| 460 | Ga0207679_11210253 | 3300025945 | Bacteria | 693 |
| 461 | Ga0207667_10578190 | 3300025949 | Bacteria | 1134 |
| 462 | Ga0207667_11566063 | 3300025949 | Bacteria | 628 |
| 463 | Ga0207651_10006629 | 3300025960 | Bacteria | 6085 |
| 464 | Ga0207651_10029434 | 3300025960 | Bacteria | 3479 |
| 465 | Ga0207651_10032300 | 3300025960 | Bacteria | 3360 |
| 466 | Ga0207668_10017712 | 3300025972 | Bacteria | 4469 |
| 467 | Ga0207668_10117687 | 3300025972 | Bacteria | 2006 |
| 468 | Ga0207668_10126010 | 3300025972 | Bacteria | 1947 |
| 469 | Ga0207640_10300170 | 3300025981 | Bacteria | 1270 |
| 470 | Ga0207658_10001151 | 3300025986 | Bacteria | 21193 |
| 471 | Ga0207658_10005593 | 3300025986 | Bacteria | 8597 |
| 472 | Ga0207658_10015284 | 3300025986 | Bacteria | 5266 |
| 473 | Ga0207658_10270165 | 3300025986 | Bacteria | 1453 |
| 474 | Ga0207658_10280466 | 3300025986 | Bacteria | 1428 |
| 475 | Ga0207658_10431244 | 3300025986 | Bacteria | 1164 |
| 476 | Ga0207658_10442197 | 3300025986 | Bacteria | 1150 |
| 477 | Ga0207658_11917371 | 3300025986 | Bacteria | 540 |
| 478 | Ga0207677_10000452 | 3300026023 | Bacteria | 27626 |
| 479 | Ga0207677_10060276 | 3300026023 | Bacteria | 2622 |
| 480 | Ga0207677_10076815 | 3300026023 | Bacteria | 2379 |
| 481 | Ga0207677_10161657 | 3300026023 | Bacteria | 1741 |
| 482 | Ga0207677_10316529 | 3300026023 | Bacteria | 1295 |
| 483 | Ga0207703_10001999 | 3300026035 | Bacteria | 17992 |
| 484 | Ga0207703_10003262 | 3300026035 | Bacteria | 13624 |
| 485 | Ga0207703_10988454 | 3300026035 | Bacteria | 807 |
| 486 | Ga0207639_10117039 | 3300026041 | Bacteria | 2183 |
| 487 | Ga0207639_10321962 | 3300026041 | Bacteria | 1373 |
| 488 | Ga0207639_10634287 | 3300026041 | Bacteria | 988 |
| 489 | Ga0207639_11591719 | 3300026041 | Bacteria | 613 |
| 490 | Ga0207678_10002363 | 3300026067 | Bacteria | 17106 |
| 491 | Ga0207678_10969347 | 3300026067 | Bacteria | 752 |
| 492 | Ga0207708_10098042 | 3300026075 | Bacteria | 2266 |
| 493 | Ga0207708_10785822 | 3300026075 | Bacteria | 819 |
| 494 | Ga0207702_10001232 | 3300026078 | Bacteria | 25871 |
| 495 | Ga0207702_10044080 | 3300026078 | Bacteria | 3748 |
| 496 | Ga0207702_10212232 | 3300026078 | Bacteria | 1800 |
| 497 | Ga0207641_10026325 | 3300026088 | Bacteria | 4799 |
| 498 | Ga0207641_10038644 | 3300026088 | Bacteria | 3990 |
| 499 | Ga0207641_10259863 | 3300026088 | Bacteria | 1625 |
| 500 | Ga0207648_10039788 | 3300026089 | Bacteria | 4133 |
| 501 | Ga0207648_10135139 | 3300026089 | Bacteria | 2172 |
| 502 | Ga0207648_10554081 | 3300026089 | Bacteria | 1056 |
| 503 | Ga0207648_10571403 | 3300026089 | Bacteria | 1040 |
| 504 | Ga0207676_10042218 | 3300026095 | Bacteria | 3506 |
| 505 | Ga0207676_10047914 | 3300026095 | Bacteria | 3314 |
| 506 | Ga0207676_10131378 | 3300026095 | Bacteria | 2129 |
| 507 | Ga0207676_10803623 | 3300026095 | Bacteria | 918 |
| 508 | Ga0207676_11149406 | 3300026095 | Bacteria | 768 |
| 509 | Ga0207674_10009428 | 3300026116 | Bacteria | 11151 |
| 510 | Ga0207674_10018142 | 3300026116 | Bacteria | 7656 |
| 511 | Ga0207674_10078389 | 3300026116 | Bacteria | 3309 |
| 512 | Ga0207674_10164152 | 3300026116 | Bacteria | 2175 |
| 513 | Ga0207674_10403467 | 3300026116 | Bacteria | 1321 |
| 514 | Ga0207675_100059119 | 3300026118 | Bacteria | 3577 |
| 515 | Ga0207675_100105634 | 3300026118 | Bacteria | 2655 |
| 516 | Ga0207675_100289505 | 3300026118 | Bacteria | 1593 |
| 517 | Ga0207683_10058177 | 3300026121 | Bacteria | 3394 |
| 518 | Ga0207683_10112158 | 3300026121 | Bacteria | 2442 |
| 519 | Ga0207683_10114109 | 3300026121 | Bacteria | 2420 |
| 520 | Ga0207683_10228875 | 3300026121 | Bacteria | 1695 |
| 521 | Ga0207683_10408580 | 3300026121 | Bacteria | 1249 |
| 522 | Ga0207683_10420167 | 3300026121 | Bacteria | 1231 |
| 523 | Ga0207683_11252312 | 3300026121 | Bacteria | 687 |
| 524 | Ga0207698_10138978 | 3300026142 | Bacteria | 2089 |
| 525 | Ga0207698_10185317 | 3300026142 | Bacteria | 1848 |
| 526 | Ga0207698_10238217 | 3300026142 | Bacteria | 1656 |
| 527 | Ga0207698_10293860 | 3300026142 | Bacteria | 1509 |
| 528 | Ga0207698_11727152 | 3300026142 | Bacteria | 641 |
| 529 | Ga0209281_1000599 | 3300027111 | Bacteria | 41033 |
| 530 | Ga0209996_1018868 | 3300027395 | Bacteria | 960 |
| 531 | Ga0209984_1008262 | 3300027424 | Bacteria | 1307 |
| 532 | Ga0209995_1003267 | 3300027471 | Bacteria | 2583 |
| 533 | Ga0209968_1000140 | 3300027526 | Bacteria | 12794 |
| 534 | Ga0209971_1008084 | 3300027682 | Bacteria | 2497 |
| 535 | Ga0209971_1073590 | 3300027682 | Bacteria | 830 |
| 536 | Ga0209966_1000388 | 3300027695 | Bacteria | 13148 |
| 537 | Ga0209998_10112518 | 3300027717 | Bacteria | 681 |
| 538 | Ga0209974_10000798 | 3300027876 | Bacteria | 10761 |
| 539 | Ga0209974_10006661 | 3300027876 | Bacteria | 4017 |
| 540 | Ga0268266_10037082 | 3300028379 | Bacteria | 4153 |
| 541 | Ga0268266_10114139 | 3300028379 | Bacteria | 2397 |
| 542 | Ga0268266_10264699 | 3300028379 | Bacteria | 1594 |
| 543 | Ga0268266_11420590 | 3300028379 | Bacteria | 669 |
| 544 | Ga0268265_10013319 | 3300028380 | Bacteria | 5587 |
| 545 | Ga0268265_10020524 | 3300028380 | Bacteria | 4611 |
| 546 | Ga0268265_10344464 | 3300028380 | Bacteria | 1358 |
| 547 | Ga0268265_10545046 | 3300028380 | Bacteria | 1100 |
| 548 | Ga0268265_12584540 | 3300028380 | Bacteria | 513 |
| 549 | Ga0268264_10003920 | 3300028381 | Bacteria | 12743 |
| 550 | Ga0268264_10248183 | 3300028381 | Bacteria | 1652 |
| 551 | Ga0268264_10357684 | 3300028381 | Bacteria | 1392 |
| 552 | Ga0268264_10371900 | 3300028381 | Bacteria | 1366 |
| 553 | Ga0265334_10167671 | 3300028573 | Bacteria | 770 |
| 554 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 555 | Ga0307517_10026165 | 3300028786 | Bacteria | 7086 |
| 556 | Ga0307517_10182036 | 3300028786 | Bacteria | 1354 |
| 557 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 558 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 559 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 560 | Ga0307515_10003451 | 3300028794 | Bacteria | 33263 |
| 561 | Ga0307515_10007649 | 3300028794 | Bacteria | 21312 |
| 562 | Ga0307515_10009711 | 3300028794 | Bacteria | 18549 |
| 563 | Ga0307515_10049534 | 3300028794 | Bacteria | 6315 |
| 564 | Ga0307515_10208140 | 3300028794 | Bacteria | 1809 |
| 565 | Ga0265324_10000645 | 3300029957 | Bacteria | 23682 |
| 566 | Ga0307512_10030983 | 3300030522 | Bacteria | 4642 |
| 567 | Ga0307512_10166710 | 3300030522 | Bacteria | 1274 |
| 568 | Ga0265330_10000045 | 3300031235 | Bacteria | 109977 |
| 569 | Ga0265332_10000031 | 3300031238 | Bacteria | 162330 |
| 570 | Ga0265332_10000187 | 3300031238 | Bacteria | 50563 |
| 571 | Ga0265325_10003774 | 3300031241 | Bacteria | 9777 |
| 572 | Ga0265340_10137053 | 3300031247 | Bacteria | 1120 |
| 573 | Ga0265316_10000181 | 3300031344 | Bacteria | 71764 |
| 574 | Ga0307513_10043401 | 3300031456 | Bacteria | 4938 |
| 575 | Ga0307513_10065125 | 3300031456 | Bacteria | 3835 |
| 576 | Ga0307513_10070103 | 3300031456 | Bacteria | 3666 |
| 577 | Ga0307513_10074895 | 3300031456 | Bacteria | 3518 |
| 578 | Ga0307513_10285307 | 3300031456 | Bacteria | 1426 |
| 579 | Ga0307513_10365268 | 3300031456 | Bacteria | 1187 |
| 580 | Ga0307513_10513456 | 3300031456 | Bacteria | 914 |
| 581 | Ga0307513_10646326 | 3300031456 | Bacteria | 765 |
| 582 | Ga0307513_10708444 | 3300031456 | Bacteria | 712 |
| 583 | Ga0307509_10003083 | 3300031507 | Bacteria | 25889 |
| 584 | Ga0307509_10125033 | 3300031507 | Bacteria | 2540 |
| 585 | Ga0307509_10162846 | 3300031507 | Bacteria | 2124 |
| 586 | Ga0307509_10165756 | 3300031507 | Bacteria | 2099 |
| 587 | Ga0307509_10717002 | 3300031507 | Bacteria | 666 |
| 588 | Ga0307408_100000096 | 3300031548 | Bacteria | 97068 |
| 589 | Ga0307408_100008311 | 3300031548 | Bacteria | 6853 |
| 590 | Ga0307408_100039931 | 3300031548 | Bacteria | 3321 |
| 591 | Ga0307408_100278466 | 3300031548 | Bacteria | 1392 |
| 592 | Ga0307408_101739835 | 3300031548 | Bacteria | 595 |
| 593 | Ga0307508_10000016 | 3300031616 | Bacteria | 206976 |
| 594 | Ga0307508_10001467 | 3300031616 | Bacteria | 26444 |
| 595 | Ga0307508_10273389 | 3300031616 | Bacteria | 1283 |
| 596 | Ga0307508_10743441 | 3300031616 | Bacteria | 593 |
| 597 | Ga0307514_10000711 | 3300031649 | Bacteria | 57628 |
| 598 | Ga0307514_10037190 | 3300031649 | Bacteria | 3862 |
| 599 | Ga0307514_10106657 | 3300031649 | Bacteria | 1997 |
| 600 | Ga0307514_10119814 | 3300031649 | Bacteria | 1839 |
| 601 | Ga0307514_10183502 | 3300031649 | Bacteria | 1345 |
| 602 | Ga0265314_10001461 | 3300031711 | Bacteria | 26354 |
| 603 | Ga0307516_10004400 | 3300031730 | Bacteria | 17413 |
| 604 | Ga0307516_10005959 | 3300031730 | Bacteria | 14408 |
| 605 | Ga0307516_10024129 | 3300031730 | Bacteria | 6216 |
| 606 | Ga0307516_10074947 | 3300031730 | Bacteria | 3238 |
| 607 | Ga0307516_10128425 | 3300031730 | Bacteria | 2317 |
| 608 | Ga0307516_10422311 | 3300031730 | Bacteria | 991 |
| 609 | Ga0307516_10600477 | 3300031730 | Bacteria | 755 |
| 610 | Ga0307405_10021832 | 3300031731 | Bacteria | 3606 |
| 611 | Ga0307405_10027461 | 3300031731 | Bacteria | 3300 |
| 612 | Ga0307405_11375715 | 3300031731 | Bacteria | 616 |
| 613 | Ga0307413_10699676 | 3300031824 | Bacteria | 842 |
| 614 | Ga0307410_10980208 | 3300031852 | Bacteria | 728 |
| 615 | Ga0307406_10000669 | 3300031901 | Bacteria | 19388 |
| 616 | Ga0307406_10125933 | 3300031901 | Bacteria | 1790 |
| 617 | Ga0307406_10208539 | 3300031901 | Bacteria | 1444 |
| 618 | Ga0307406_10998736 | 3300031901 | Bacteria | 718 |
| 619 | Ga0307407_10680368 | 3300031903 | Bacteria | 773 |
| 620 | Ga0307412_10118366 | 3300031911 | Bacteria | 1903 |
| 621 | Ga0307412_11546777 | 3300031911 | Bacteria | 604 |
| 622 | Ga0307409_100001314 | 3300031995 | Bacteria | 12044 |
| 623 | Ga0307409_100049671 | 3300031995 | Bacteria | 3200 |
| 624 | Ga0307409_102495383 | 3300031995 | Bacteria | 546 |
| 625 | Ga0307416_100087114 | 3300032002 | Bacteria | 2665 |
| 626 | Ga0307416_100430129 | 3300032002 | Bacteria | 1367 |
| 627 | Ga0307416_101239349 | 3300032002 | Bacteria | 852 |
| 628 | Ga0307416_102567805 | 3300032002 | Bacteria | 607 |
| 629 | Ga0307414_10195884 | 3300032004 | Bacteria | 1639 |
| 630 | Ga0307414_10557851 | 3300032004 | Bacteria | 1022 |
| 631 | Ga0307411_10108135 | 3300032005 | Bacteria | 1983 |
| 632 | Ga0307415_100105962 | 3300032126 | Bacteria | 2074 |
| 633 | Ga0307507_10177933 | 3300033179 | Bacteria | 1527 |
| 634 | Ga0307507_10423621 | 3300033179 | Bacteria | 746 |
| 635 | Ga0307510_10076751 | 3300033180 | Bacteria | 3283 |
| 636 | Ga0373948_0056722 | 3300034817 | Bacteria | 852 |
| 637 | Ga0373959_0026264 | 3300034820 | Bacteria | 1150 |
| 638 | Ga0373938_0044718 | 3300034957 | Bacteria | 995 |
| 639 | Ga0373928_0028805 | 3300035084 | Bacteria | 1217 |
| 640 | Ga0373944_0118979 | 3300035089 | Bacteria | 909 |
| 641 | Ga0373944_0154759 | 3300035089 | Bacteria | 810 |
| 642 | Ga0373951_0274210 | 3300035091 | Bacteria | 513 |
| 643 | Ga0373952_0028043 | 3300035092 | Bacteria | 1233 |
| 644 | Ga0373932_0107511 | 3300035112 | Bacteria | 915 |
| 645 | Ga0373939_0146702 | 3300035114 | Bacteria | 855 |
| 646 | Ga0373939_0193460 | 3300035114 | Bacteria | 765 |
| 647 | Ga0373939_0422373 | 3300035114 | Bacteria | 556 |
| 648 | Ga0373953_0358069 | 3300035117 | Bacteria | 640 |
| 649 | Ga0373956_0359184 | 3300035119 | Bacteria | 695 |
| 650 | Ga0373957_0379102 | 3300035120 | Bacteria | 607 |
| 651 | Ga0373943_0040156 | 3300035170 | Bacteria | 2259 |
| 652 | Ga0373946_0108813 | 3300035171 | Bacteria | 1252 |
| 653 | Ga0373946_0270935 | 3300035171 | Bacteria | 833 |
| 654 | Ga0373946_0402877 | 3300035171 | Bacteria | 691 |
| 655 | Ga0373955_0193714 | 3300035172 | Bacteria | 1209 |
| 656 | Ga0373942_0063294 | 3300035207 | Bacteria | 1065 |
| 657 | Ga0373942_0068303 | 3300035207 | Bacteria | 1032 |
| 658 | Ga0373962_0249575 | 3300035242 | Bacteria | 616 |
| 659 | Ga0373924_0544435 | 3300035410 | Bacteria | 522 |
| 660 | Ga0373931_0015184 | 3300035691 | Bacteria | 3775 |
| 661 | Ga0373931_0062197 | 3300035691 | Bacteria | 2015 |
| 662 | Ga0373931_0223677 | 3300035691 | Bacteria | 1134 |
| 663 | Ga0373931_0723441 | 3300035691 | Bacteria | 659 |
| 664 | Ga0373927_0076004 | 3300035695 | Bacteria | 2175 |
| 665 | Ga0373927_0359500 | 3300035695 | Bacteria | 960 |
| 666 | Ga0373927_0741036 | 3300035695 | Bacteria | 649 |
| 667 | Ga0373933_0295202 | 3300035724 | Bacteria | 1049 |
| 668 | Ga0373947_0184495 | 3300035725 | Bacteria | 1359 |
| 669 | Ga0373947_0363442 | 3300035725 | Bacteria | 972 |
| 670 | Ga0373937_0270688 | 3300036401 | Bacteria | 1603 |
| 671 | Ga0373937_0538404 | 3300036401 | Bacteria | 1109 |
| 672 | Ga0373925_0015098 | 3300037068 | Bacteria | 5582 |
| 673 | Ga0373925_0112972 | 3300037068 | Bacteria | 2100 |
| 674 | Ga0373925_0206197 | 3300037068 | Bacteria | 1565 |
| 675 | Ga0373925_0567951 | 3300037068 | Bacteria | 933 |
| 676 | Ga0395899_0210560 | 3300037312 | Bacteria | 1351 |
| 677 | Ga0395900_0000234 | 3300037418 | Bacteria | 87083 |
| 678 | Ga0395900_0760243 | 3300037418 | Bacteria | 899 |
| 679 | Ga0395898_0002077 | 3300037466 | Bacteria | 24918 |
| 680 | Ga0395898_0008225 | 3300037466 | Bacteria | 11030 |
| 681 | Ga0395905_0002001 | 3300037471 | Bacteria | 23293 |
| 682 | Ga0395905_0011653 | 3300037471 | Bacteria | 8490 |
| 683 | Ga0395905_0297020 | 3300037471 | Bacteria | 1502 |
| 684 | Ga0436364_1272445 | 3300037853 | Bacteria | 682 |
| 685 | Ga0436365_0514532 | 3300039437 | Bacteria | 3258 |
| 686 | Ga0436365_0569739 | 3300039437 | Bacteria | 1626 |
| 687 | Ga0436365_1170591 | 3300039437 | Bacteria | 2191 |
| 688 | Ga0436361_0086324 | 3300039447 | Bacteria | 39001 |
| 689 | Ga0436361_0154722 | 3300039447 | Bacteria | 21603 |
| 690 | Ga0436361_0381246 | 3300039447 | Bacteria | 2077 |
| 691 | Ga0436361_0481133 | 3300039447 | Bacteria | 61506 |
| 692 | Ga0436363_1612144 | 3300039450 | Bacteria | 2536 |
| 693 | Ga0439439_0100189 | 3300041406 | Bacteria | 797 |
| 694 | Ga0439465_0131814 | 3300041413 | Bacteria | 883 |
| 695 | Ga0451787_055325 | 3300041441 | Bacteria | 1443 |
| 696 | Ga0451789_0302159 | 3300041443 | Bacteria | 649 |
| 697 | Ga0451793_1056955 | 3300041452 | Bacteria | 1796 |
| 698 | Ga0451795_0667820 | 3300041456 | Bacteria | 797 |
| 699 | Ga0451800_0542404 | 3300041459 | Bacteria | 1181 |
| 700 | Ga0451802_0517703 | 3300041460 | Bacteria | 2677 |
| 701 | Ga0451807_0187731 | 3300041486 | Bacteria | 1533 |
| 702 | Ga0451837_1086989 | 3300041494 | Bacteria | 659 |
| 703 | Ga0451839_0443244 | 3300041496 | Bacteria | 1170 |
| 704 | Ga0451849_0824555 | 3300041505 | Bacteria | 1294 |
| 705 | Ga0451851_0900736 | 3300041507 | Bacteria | 1590 |
| 706 | Ga0451843_0161326 | 3300041509 | Bacteria | 867 |
| 707 | Ga0451843_0373713 | 3300041509 | Bacteria | 1728 |
| 708 | Ga0451843_0845768 | 3300041509 | Bacteria | 780 |
| 709 | Ga0451855_1365320 | 3300041511 | Bacteria | 644 |
| 710 | Ga0451853_0229046 | 3300041512 | Bacteria | 744 |
| 711 | Ga0451853_2156438 | 3300041512 | Bacteria | 1006 |
| 712 | Ga0451853_3367089 | 3300041512 | Bacteria | 1657 |
| 713 | Ga0439431_0073332 | 3300041997 | Bacteria | 915 |
| 714 | Ga0439450_170667 | 3300042008 | Bacteria | 575 |
| 715 | Ga0450923_024293 | 3300042125 | Bacteria | 1201 |
| 716 | Ga0450890_024208 | 3300042127 | Bacteria | 837 |
| 717 | Ga0450898_014883 | 3300042134 | Bacteria | 1312 |
| 718 | Ga0450898_031288 | 3300042134 | Bacteria | 978 |
| 719 | Ga0450900_022422 | 3300042136 | Bacteria | 887 |
| 720 | Ga0450904_008783 | 3300042139 | Bacteria | 997 |
| 721 | Ga0439446_0117296 | 3300042156 | Bacteria | 854 |
| 722 | Ga0439458_0091746 | 3300042157 | Bacteria | 782 |
| 723 | Ga0451577_0007214 | 3300042876 | Bacteria | 10951 |
| 724 | Ga0451577_0033031 | 3300042876 | Bacteria | 4663 |
| 725 | Ga0451577_0291388 | 3300042876 | Bacteria | 1479 |
| 726 | Ga0451577_0833937 | 3300042876 | Bacteria | 832 |
| 727 | Ga0466969_0009692 | 3300044656 | Bacteria | 5106 |
| 728 | Ga0466969_0037790 | 3300044656 | Bacteria | 2433 |
| 729 | Ga0466969_0058897 | 3300044656 | Bacteria | 1868 |
| 730 | Ga0466972_0001344 | 3300044658 | Bacteria | 11923 |
| 731 | Ga0466965_0017660 | 3300044683 | Bacteria | 3413 |
| 732 | Ga0466965_0074067 | 3300044683 | Bacteria | 1715 |
| 733 | Ga0466965_0262502 | 3300044683 | Bacteria | 928 |
| 734 | Ga0466966_0000754 | 3300044684 | Bacteria | 20539 |
| 735 | Ga0466966_0015315 | 3300044684 | Bacteria | 5070 |
| 736 | Ga0466966_0020475 | 3300044684 | Bacteria | 4349 |
| 737 | Ga0466961_0006410 | 3300044693 | Bacteria | 7472 |
| 738 | Ga0466961_0051128 | 3300044693 | Bacteria | 2639 |
| 739 | Ga0466963_0000935 | 3300044694 | Bacteria | 14918 |
| 740 | Ga0466963_0472979 | 3300044694 | Bacteria | 884 |
| 741 | Ga0466963_0867798 | 3300044694 | Bacteria | 636 |
| 742 | Ga0466964_0003021 | 3300044706 | Bacteria | 6099 |
| 743 | Ga0466964_0011333 | 3300044706 | Bacteria | 3366 |
| 744 | Ga0466964_0056316 | 3300044706 | Bacteria | 1625 |
| 745 | Ga0466964_0293986 | 3300044706 | Bacteria | 816 |
| 746 | Ga0453684_0007748 | 3300044712 | Bacteria | 19588 |
| 747 | Ga0453684_0051049 | 3300044712 | Bacteria | 5429 |
| 748 | Ga0453684_0059811 | 3300044712 | Bacteria | 4907 |
| 749 | Ga0453684_0124246 | 3300044712 | Bacteria | 3109 |
| 750 | Ga0453684_0131943 | 3300044712 | Bacteria | 2996 |
| 751 | Ga0453684_0213283 | 3300044712 | Bacteria | 2242 |
| 752 | Ga0453684_0214562 | 3300044712 | Bacteria | 2234 |
| 753 | Ga0453684_0283535 | 3300044712 | Bacteria | 1888 |
| 754 | Ga0453684_0308719 | 3300044712 | Bacteria | 1796 |
| 755 | Ga0466971_0015912 | 3300044719 | Bacteria | 3314 |
| 756 | Ga0466971_0020029 | 3300044719 | Bacteria | 2973 |
| 757 | Ga0466971_0022228 | 3300044719 | Bacteria | 2824 |
| 758 | Ga0466970_0020698 | 3300044765 | Bacteria | 3420 |
| 759 | Ga0466970_0035508 | 3300044765 | Bacteria | 2640 |
| 760 | Ga0466970_0221817 | 3300044765 | Bacteria | 1055 |
| 761 | Ga0466957_0029903 | 3300044842 | Bacteria | 3250 |
| 762 | Ga0466957_0055711 | 3300044842 | Bacteria | 2416 |
| 763 | Ga0466957_0264742 | 3300044842 | Bacteria | 1146 |
| 764 | Ga0466957_0399742 | 3300044842 | Bacteria | 939 |
| 765 | Ga0466960_0196164 | 3300044901 | Bacteria | 1101 |
| 766 | Ga0466959_0013106 | 3300045049 | Bacteria | 6003 |
| 767 | Ga0466959_0015936 | 3300045049 | Bacteria | 5483 |
| 768 | Ga0466959_0028505 | 3300045049 | Bacteria | 4140 |
| 769 | Ga0451576_0003317 | 3300045051 | Bacteria | 22316 |
| 770 | Ga0451576_0016908 | 3300045051 | Bacteria | 8033 |
| 771 | Ga0451576_0034152 | 3300045051 | Bacteria | 5402 |
| 772 | Ga0451576_0152761 | 3300045051 | Bacteria | 2408 |
| 773 | Ga0451576_0437696 | 3300045051 | Bacteria | 1372 |
| 774 | Ga0451576_0653811 | 3300045051 | Bacteria | 1104 |
| 775 | Ga0451576_0670885 | 3300045051 | Bacteria | 1089 |
| 776 | Ga0451576_1839157 | 3300045051 | Bacteria | 625 |
| 777 | Ga0466958_0043317 | 3300045836 | Bacteria | 2710 |
| 778 | Ga0466958_0080601 | 3300045836 | Bacteria | 2002 |
| 779 | Ga0466967_0021184 | 3300045976 | Bacteria | 5272 |
| 780 | Ga0466967_0333618 | 3300045976 | Bacteria | 1465 |
| 781 | Ga0466967_0501233 | 3300045976 | Bacteria | 1191 |
| 782 | Ga0495592_0000213 | 3300046454 | Bacteria | 49631 |
| 783 | Ga0495603_0211836 | 3300046455 | Bacteria | 1119 |
| 784 | Ga0495590_0084021 | 3300046457 | Bacteria | 1122 |
| 785 | Ga0495629_0040968 | 3300046459 | Bacteria | 3259 |
| 786 | Ga0495638_0224989 | 3300046460 | Bacteria | 1047 |
| 787 | Ga0495641_0082809 | 3300046461 | Bacteria | 1437 |
| 788 | Ga0495650_0002988 | 3300046471 | Bacteria | 12804 |
| 789 | Ga0495650_0030296 | 3300046471 | Bacteria | 2453 |
| 790 | Ga0495650_0103274 | 3300046471 | Bacteria | 1068 |
| 791 | Ga0495582_0335482 | 3300046473 | Bacteria | 870 |
| 792 | Ga0495582_0434731 | 3300046473 | Bacteria | 757 |
| 793 | Ga0495582_0490898 | 3300046473 | Bacteria | 710 |
| 794 | Ga0495639_0054839 | 3300046475 | Bacteria | 1817 |
| 795 | Ga0495639_0185617 | 3300046475 | Bacteria | 1014 |
| 796 | Ga0495584_0352193 | 3300046491 | Bacteria | 748 |
| 797 | Ga0495585_0160372 | 3300046492 | Bacteria | 1167 |
| 798 | Ga0495607_0419577 | 3300046501 | Bacteria | 606 |
| 799 | Ga0495608_0091668 | 3300046511 | Bacteria | 1965 |
| 800 | Ga0495610_0093618 | 3300046512 | Bacteria | 1357 |
| 801 | Ga0495618_0101195 | 3300046514 | Bacteria | 1845 |
| 802 | Ga0495620_0010669 | 3300046515 | Bacteria | 4837 |
| 803 | Ga0495628_0370048 | 3300046516 | Bacteria | 1051 |
| 804 | Ga0495628_0568213 | 3300046516 | Bacteria | 813 |
| 805 | Ga0495630_0104877 | 3300046517 | Bacteria | 2140 |
| 806 | Ga0495630_0227592 | 3300046517 | Bacteria | 1424 |
| 807 | Ga0495632_0010962 | 3300046519 | Bacteria | 5318 |
| 808 | Ga0495632_0386400 | 3300046519 | Bacteria | 612 |
| 809 | Ga0495643_0107067 | 3300046522 | Bacteria | 1426 |
| 810 | Ga0495642_0137448 | 3300046528 | Bacteria | 1054 |
| 811 | Ga0495654_0002282 | 3300046530 | Bacteria | 12409 |
| 812 | Ga0495586_0298009 | 3300046535 | Bacteria | 924 |
| 813 | Ga0495598_0019933 | 3300046537 | Bacteria | 1764 |
| 814 | Ga0495598_0071363 | 3300046537 | Bacteria | 1094 |
| 815 | Ga0495621_0030161 | 3300046539 | Bacteria | 1852 |
| 816 | Ga0495621_0030596 | 3300046539 | Bacteria | 1841 |
| 817 | Ga0495597_0000077 | 3300046542 | Bacteria | 85280 |
| 818 | Ga0495645_0236725 | 3300046543 | Bacteria | 1220 |
| 819 | Ga0495645_0393481 | 3300046543 | Bacteria | 884 |
| 820 | Ga0495645_0402573 | 3300046543 | Bacteria | 872 |
| 821 | Ga0495622_0049976 | 3300046557 | Bacteria | 1941 |
| 822 | Ga0495667_0247823 | 3300046559 | Bacteria | 1134 |
| 823 | Ga0495668_0060772 | 3300046616 | Bacteria | 2084 |
| 824 | Ga0495668_0086062 | 3300046616 | Bacteria | 1724 |
| 825 | Ga0495634_0149197 | 3300046642 | Bacteria | 1480 |
| 826 | Ga0495634_0844929 | 3300046642 | Bacteria | 520 |
| 827 | Ga0495611_0571555 | 3300046648 | Bacteria | 511 |
| 828 | Ga0495625_0002387 | 3300046660 | Bacteria | 20399 |
| 829 | Ga0495625_0021963 | 3300046660 | Bacteria | 4900 |
| 830 | Ga0495659_0329924 | 3300046664 | Bacteria | 649 |
| 831 | Ga0495599_0141643 | 3300046678 | Bacteria | 1492 |
| 832 | Ga0495647_0190483 | 3300046681 | Bacteria | 896 |
| 833 | Ga0495658_0014926 | 3300046683 | Bacteria | 3979 |
| 834 | Ga0495658_0044987 | 3300046683 | Bacteria | 2476 |
| 835 | Ga0495658_0118906 | 3300046683 | Bacteria | 1596 |
| 836 | Ga0495658_0206479 | 3300046683 | Bacteria | 1226 |
| 837 | Ga0495613_0150194 | 3300046689 | Bacteria | 1662 |
| 838 | Ga0495624_0377780 | 3300046690 | Bacteria | 851 |
| 839 | Ga0495670_0027835 | 3300046691 | Bacteria | 2802 |
| 840 | Ga0495670_0193492 | 3300046691 | Bacteria | 1076 |
| 841 | Ga0495670_0401785 | 3300046691 | Bacteria | 740 |
| 842 | Ga0495649_0001371 | 3300046694 | Bacteria | 18487 |
| 843 | Ga0495649_0188822 | 3300046694 | Bacteria | 1073 |
| 844 | Ga0495600_0207944 | 3300046809 | Bacteria | 1255 |
| 845 | Ga0495660_0035861 | 3300046810 | Bacteria | 2768 |
| 846 | Ga0495581_0523836 | 3300047315 | Bacteria | 689 |
| 847 | Ga0495604_0379136 | 3300047317 | Bacteria | 935 |
| 848 | Ga0495674_0161840 | 3300047319 | Bacteria | 1872 |
| 849 | Ga0495676_0078953 | 3300047321 | Bacteria | 2504 |
| 850 | Ga0495680_0048736 | 3300047322 | Bacteria | 3325 |
| 851 | Ga0495687_002064 | 3300047443 | Bacteria | 16886 |
| 852 | Ga0495687_005696 | 3300047443 | Bacteria | 7855 |
| 853 | Ga0495677_0047753 | 3300047445 | Bacteria | 1572 |
| 854 | Ga0495685_234545 | 3300047447 | Bacteria | 584 |
| 855 | Ga0495673_0101795 | 3300047469 | Bacteria | 1160 |
| 856 | Ga0495684_0103716 | 3300047471 | Bacteria | 2149 |
| 857 | Ga0495686_0003802 | 3300047472 | Bacteria | 12817 |
| 858 | Ga0495686_0032063 | 3300047472 | Bacteria | 3403 |
| 859 | Ga0495593_0023044 | 3300047673 | Bacteria | 3464 |
| 860 | Ga0495593_0107975 | 3300047673 | Bacteria | 1423 |
| 861 | Ga0495602_0484990 | 3300048088 | Bacteria | 867 |
| 862 | Ga0495614_0052657 | 3300048089 | Bacteria | 1745 |
| 863 | Ga0495615_0205635 | 3300048090 | Bacteria | 609 |
| 864 | Ga0495626_0048720 | 3300048091 | Bacteria | 1965 |
| 865 | Ga0495626_0228171 | 3300048091 | Bacteria | 754 |
| 866 | Ga0496100_0190731 | 3300048903 | Bacteria | 1488 |
| 867 | Ga0496100_0469849 | 3300048903 | Bacteria | 966 |
| 868 | Ga0496100_0731449 | 3300048903 | Bacteria | 773 |
| 869 | Ga0496101_0008869 | 3300048904 | Bacteria | 6584 |
| 870 | Ga0496101_0771316 | 3300048904 | Bacteria | 759 |
| 871 | Ga0496102_0001355 | 3300048905 | Bacteria | 21922 |
| 872 | Ga0496104_0210094 | 3300048907 | Bacteria | 1858 |
| 873 | Ga0496104_0691302 | 3300048907 | Bacteria | 928 |
| 874 | Ga0496104_0694182 | 3300048907 | Bacteria | 926 |
| 875 | Ga0496105_0170201 | 3300048908 | Bacteria | 1786 |
| 876 | Ga0496105_1059980 | 3300048908 | Bacteria | 604 |
| 877 | Ga0496106_0004162 | 3300048909 | Bacteria | 10783 |
| 878 | Ga0496106_0012991 | 3300048909 | Bacteria | 6144 |
| 879 | Ga0496106_0268153 | 3300048909 | Bacteria | 1367 |
| 880 | Ga0496107_0012377 | 3300048910 | Bacteria | 5954 |
| 881 | Ga0496108_0057165 | 3300048911 | Bacteria | 3278 |
| 882 | Ga0496108_0059614 | 3300048911 | Bacteria | 3209 |
| 883 | Ga0496108_0642548 | 3300048911 | Bacteria | 923 |
| 884 | Ga0496109_0092481 | 3300048912 | Bacteria | 2798 |
| 885 | Ga0496109_0928429 | 3300048912 | Bacteria | 808 |
| 886 | Ga0496110_0147708 | 3300048913 | Bacteria | 2127 |
| 887 | Ga0496110_0227769 | 3300048913 | Bacteria | 1695 |
| 888 | Ga0496110_0244564 | 3300048913 | Bacteria | 1633 |
| 889 | Ga0496111_0302090 | 3300048914 | Bacteria | 1186 |
| 890 | Ga0496112_0063967 | 3300048915 | Bacteria | 3629 |
| 891 | Ga0496113_0191649 | 3300048916 | Bacteria | 1623 |
| 892 | Ga0496114_0000303 | 3300048917 | Bacteria | 36267 |
| 893 | Ga0496114_0165229 | 3300048917 | Bacteria | 1927 |
| 894 | Ga0496114_0286169 | 3300048917 | Bacteria | 1454 |
| 895 | Ga0496115_0002077 | 3300048918 | Bacteria | 14341 |
| 896 | Ga0496115_0487713 | 3300048918 | Bacteria | 992 |
| 897 | Ga0496123_0020213 | 3300048926 | Bacteria | 5215 |
| 898 | Ga0496124_0001253 | 3300048927 | Bacteria | 38792 |
| 899 | Ga0496124_0024540 | 3300048927 | Bacteria | 5478 |
| 900 | Ga0496124_0039147 | 3300048927 | Bacteria | 4112 |
| 901 | Ga0496125_0000542 | 3300048928 | Bacteria | 64978 |
| 902 | Ga0496125_0007690 | 3300048928 | Bacteria | 11424 |
| 903 | Ga0496125_0026412 | 3300048928 | Bacteria | 5292 |
| 904 | Ga0496125_0221799 | 3300048928 | Bacteria | 1217 |
| 905 | Ga0496125_0311165 | 3300048928 | Bacteria | 960 |
| 906 | Ga0496125_0370834 | 3300048928 | Bacteria | 847 |
| 907 | Ga0496126_0007499 | 3300048929 | Bacteria | 11950 |
| 908 | Ga0496126_0164097 | 3300048929 | Bacteria | 1897 |
| 909 | Ga0496126_0424535 | 3300048929 | Bacteria | 1074 |
| 910 | Ga0496126_0628469 | 3300048929 | Bacteria | 843 |
| 911 | Ga0501306_026251 | 3300049127 | Bacteria | 842 |
| 912 | Ga0501310_011608 | 3300049130 | Bacteria | 999 |
| 913 | Ga0501305_032163 | 3300049161 | Bacteria | 822 |
| 914 | Ga0495682_0165290 | 3300049460 | Bacteria | 788 |
| 915 | Ga0501295_024439 | 3300049518 | Bacteria | 1138 |
| 916 | Ga0501312_007415 | 3300049528 | Bacteria | 1397 |
| 917 | Ga0501031_0003670 | 3300049568 | Bacteria | 9880 |
| 918 | Ga0501032_0419365 | 3300049569 | Bacteria | 859 |
| 919 | Ga0501033_0313121 | 3300049570 | Bacteria | 1103 |
| 920 | Ga0501036_0692126 | 3300049572 | Bacteria | 843 |
| 921 | Ga0501037_0214749 | 3300049573 | Bacteria | 1355 |
| 922 | Ga0501039_1299034 | 3300049575 | Bacteria | 561 |
| 923 | Ga0501068_0523170 | 3300049584 | Bacteria | 770 |
| 924 | Ga0501199_025333 | 3300049650 | Bacteria | 708 |
| 925 | Ga0501263_048478 | 3300049760 | Bacteria | 641 |
| 926 | Ga0501266_000043 | 3300049763 | Bacteria | 22384 |
| 927 | Ga0501035_0068336 | 3300049822 | Bacteria | 3151 |
| 928 | Ga0501035_0493179 | 3300049822 | Bacteria | 1009 |
| 929 | nmdc:mga03683_12587_c1 | 3300050489 | Bacteria | 3095 |
| 930 | nmdc:mga0yw44_364058_c1 | 3300050492 | Bacteria | 975 |
| 931 | nmdc:mga0k408_139278_c1 | 3300050493 | Bacteria | 1443 |
| 932 | nmdc:mga0k408_18200_c2 | 3300050493 | Bacteria | 3187 |
| 933 | nmdc:mga0k408_209775_c1 | 3300050493 | Bacteria | 1163 |
| 934 | nmdc:mga0k408_219125_c1 | 3300050493 | Bacteria | 1136 |
| 935 | nmdc:mga0k408_250930_c1 | 3300050493 | Bacteria | 1057 |
| 936 | nmdc:mga0k408_26610_c1 | 3300050493 | Bacteria | 3281 |
| 937 | nmdc:mga0k408_271462_c1 | 3300050493 | Bacteria | 1013 |
| 938 | nmdc:mga0k408_40302_c1 | 3300050493 | Bacteria | 2687 |
| 939 | nmdc:mga0k408_46145_c1 | 3300050493 | Bacteria | 2516 |
| 940 | nmdc:mga0k408_506_c1 | 3300050493 | Bacteria | 21412 |
| 941 | nmdc:mga0k408_6644_c1 | 3300050493 | Bacteria | 6167 |
| 942 | nmdc:mga0k408_97084_c1 | 3300050493 | Bacteria | 1735 |
| 943 | nmdc:mga06z11_14427_c1 | 3300050494 | Bacteria | 3500 |
| 944 | nmdc:mga06z11_214599_c1 | 3300050494 | Bacteria | 1122 |
| 945 | nmdc:mga06z11_37405_c1 | 3300050494 | Bacteria | 2403 |
| 946 | nmdc:mga07m45_18856_c1 | 3300050496 | Bacteria | 3732 |
| 947 | nmdc:mga07m45_249277_c1 | 3300050496 | Bacteria | 1033 |
| 948 | nmdc:mga07m45_25851_c1 | 3300050496 | Bacteria | 3224 |
| 949 | nmdc:mga07m45_4213_c1 | 3300050496 | Bacteria | 7032 |
| 950 | nmdc:mga07m45_48072_c1 | 3300050496 | Bacteria | 2399 |
| 951 | nmdc:mga07m45_58967_c1 | 3300050496 | Bacteria | 2172 |
| 952 | nmdc:mga07m45_76504_c1 | 3300050496 | Bacteria | 1908 |
| 953 | nmdc:mga07m45_9233_c1 | 3300050496 | Bacteria | 5106 |
| 954 | nmdc:mga09592_14154_c1 | 3300050508 | Bacteria | 6507 |
| 955 | nmdc:mga0qj67_47140_c1 | 3300050509 | Bacteria | 3404 |
| 956 | nmdc:mga08y16_505851_c1 | 3300050511 | Bacteria | 1227 |
| 957 | nmdc:mga0n895_625855_c1 | 3300050512 | Bacteria | 1077 |
| 958 | nmdc:mga0sz30_5056_c1 | 3300050516 | Bacteria | 4821 |
| 959 | Ga0495601_0089083 | 3300053077 | Bacteria | 1984 |
| 960 | Ga0495601_0694390 | 3300053077 | Bacteria | 649 |
| 961 | Ga0500635_0000289 | 3300053080 | Bacteria | 18489 |
| 962 | Ga0495655_0074053 | 3300053083 | Bacteria | 959 |
| 963 | Ga0500578_0169449 | 3300053086 | Bacteria | 1351 |
| 964 | Ga0500578_0287913 | 3300053086 | Bacteria | 978 |
| 965 | Ga0500583_0247630 | 3300053092 | Bacteria | 880 |
| 966 | Ga0500651_0127767 | 3300053093 | Bacteria | 1539 |
| 967 | Ga0500562_026437 | 3300053108 | Bacteria | 1521 |
| 968 | Ga0500572_198351 | 3300053111 | Bacteria | 658 |
| 969 | Ga0500608_018865 | 3300053122 | Bacteria | 3154 |
| 970 | Ga0500658_0006983 | 3300053134 | Bacteria | 4179 |
| 971 | Ga0500559_0154079 | 3300053136 | Bacteria | 1079 |
| 972 | Ga0500564_096406 | 3300053138 | Bacteria | 1312 |
| 973 | Ga0500586_279206 | 3300053145 | Bacteria | 511 |
| 974 | Ga0500589_110194 | 3300053147 | Bacteria | 1182 |
| 975 | Ga0500590_056793 | 3300053148 | Bacteria | 1976 |
| 976 | Ga0500616_0129967 | 3300053153 | Bacteria | 1191 |
| 977 | Ga0500619_000073 | 3300053154 | Bacteria | 28363 |
| 978 | Ga0500622_0003844 | 3300053156 | Bacteria | 9770 |
| 979 | Ga0500627_0076259 | 3300053158 | Bacteria | 1491 |
| 980 | Ga0500634_0005385 | 3300053161 | Bacteria | 6066 |
| 981 | Ga0500636_0177401 | 3300053177 | Bacteria | 1147 |
| 982 | Ga0500645_007607 | 3300053730 | Bacteria | 3758 |
| 983 | Ga0590071_019067 | 3300059421 | Bacteria | 1614 |
| 984 | Ga0590075_036240 | 3300059424 | Bacteria | 1257 |
| 985 | Ga0587084_008625 | 3300059477 | Bacteria | 1296 |
| 986 | Ga0587093_017088 | 3300059478 | Bacteria | 932 |
| 987 | Ga0587077_015148 | 3300059493 | Bacteria | 1279 |
| 988 | Ga0587080_038820 | 3300059503 | Bacteria | 860 |
| 989 | Ga0587082_043019 | 3300059504 | Bacteria | 835 |
| 990 | Ga0587083_0027171 | 3300059505 | Bacteria | 1110 |
| 991 | Ga0587062_030232 | 3300059639 | Bacteria | 825 |
| 992 | Ga0587068_006413 | 3300059641 | Bacteria | 1647 |
| 993 | Ga0587069_041970 | 3300059642 | Bacteria | 784 |
| 994 | Ga0587076_025679 | 3300059645 | Bacteria | 1009 |
| 995 | Ga0587076_073087 | 3300059645 | Bacteria | 716 |
| 996 | Ga0587118_00497 | 3300059657 | Bacteria | 2000 |
| 997 | Ga0587124_003541 | 3300059660 | Bacteria | 1165 |
| 998 | Ga0587071_046243 | 3300060344 | Bacteria | 887 |
| 999 | Ga0587111_0017584 | 3300060346 | Bacteria | 1334 |
| 1000 | Ga0587111_0132451 | 3300060346 | Bacteria | 653 |
| 1001 | Ga0466962_0008120 | 3300061719 | Bacteria | 5033 |
| 1002 | Ga0466962_0052497 | 3300061719 | Bacteria | 1948 |
| 1003 | Ga0466962_0055459 | 3300061719 | Bacteria | 1893 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10134099 | Ga0075366_101340992 | 125 |
| 2 | 3300050493 | nmdc:mga0k408_506_c1 | nmdc:mga0k408_506_c1_8172_8603 | 125 |
| 3 | 3300037471 | Ga0395905_0002001 | Ga0395905_0002001_10401_10883 | 126 |
| 4 | 3300048908 | Ga0496105_1059980 | Ga0496105_1059980_58_486 | 126 |
| 5 | iso_pu_bacteria | 2858688981 | 2858691201 | 126 |
| 6 | 3300013105 | Ga0157369_10066867 | Ga0157369_100668674 | 127 |
| 7 | 3300013296 | Ga0157374_10423933 | Ga0157374_104239331 | 127 |
| 8 | 3300025935 | Ga0207709_10150093 | Ga0207709_101500933 | 127 |
| 9 | 3300034817 | Ga0373948_0056722 | Ga0373948_0056722_172_612 | 127 |
| 10 | 3300035084 | Ga0373928_0028805 | Ga0373928_0028805_358_834 | 127 |
| 11 | 3300039447 | Ga0436361_0381246 | Ga0436361_0381246_1559_1987 | 127 |
| 12 | 3300044656 | Ga0466969_0037790 | Ga0466969_0037790_263_688 | 127 |
| 13 | 3300044683 | Ga0466965_0074067 | Ga0466965_0074067_483_908 | 127 |
| 14 | 3300044683 | Ga0466965_0262502 | Ga0466965_0262502_319_747 | 127 |
| 15 | 3300044684 | Ga0466966_0020475 | Ga0466966_0020475_3087_3512 | 127 |
| 16 | 3300044693 | Ga0466961_0006410 | Ga0466961_0006410_4663_5088 | 127 |
| 17 | 3300044694 | Ga0466963_0867798 | Ga0466963_0867798_181_606 | 127 |
| 18 | 3300044706 | Ga0466964_0293986 | Ga0466964_0293986_141_566 | 127 |
| 19 | 3300044712 | Ga0453684_0213283 | Ga0453684_0213283_1479_1919 | 127 |
| 20 | 3300044719 | Ga0466971_0015912 | Ga0466971_0015912_848_1273 | 127 |
| 21 | 3300044765 | Ga0466970_0221817 | Ga0466970_0221817_126_551 | 127 |
| 22 | 3300044842 | Ga0466957_0399742 | Ga0466957_0399742_275_700 | 127 |
| 23 | 3300044901 | Ga0466960_0196164 | Ga0466960_0196164_37_465 | 127 |
| 24 | 3300045049 | Ga0466959_0015936 | Ga0466959_0015936_1141_1566 | 127 |
| 25 | 3300045051 | Ga0451576_0034152 | Ga0451576_0034152_247_687 | 127 |
| 26 | 3300045976 | Ga0466967_0333618 | Ga0466967_0333618_109_534 | 127 |
| 27 | 3300046528 | Ga0495642_0137448 | Ga0495642_0137448_150_575 | 127 |
| 28 | 3300046616 | Ga0495668_0086062 | Ga0495668_0086062_890_1315 | 127 |
| 29 | 3300048905 | Ga0496102_0001355 | Ga0496102_0001355_10036_10494 | 127 |
| 30 | 3300053147 | Ga0500589_110194 | Ga0500589_110194_329_754 | 127 |
| 31 | 3300061719 | Ga0466962_0052497 | Ga0466962_0052497_361_786 | 127 |
| 32 | iso_pu_bacteria | 2831864461 | 2831866105 | 127 |
| 33 | 3300006058 | Ga0075432_10262376 | Ga0075432_102623762 | 128 |
| 34 | 3300037068 | Ga0373925_0206197 | Ga0373925_0206197_420_863 | 128 |
| 35 | 3300037471 | Ga0395905_0297020 | Ga0395905_0297020_757_1185 | 128 |
| 36 | 3300042134 | Ga0450898_031288 | Ga0450898_031288_52_477 | 128 |
| 37 | 3300042876 | Ga0451577_0007214 | Ga0451577_0007214_10304_10732 | 128 |
| 38 | 3300044712 | Ga0453684_0214562 | Ga0453684_0214562_489_935 | 128 |
| 39 | 3300045051 | Ga0451576_0437696 | Ga0451576_0437696_417_860 | 128 |
| 40 | 3300049650 | Ga0501199_025333 | Ga0501199_025333_53_478 | 128 |
| 41 | iso_pu_bacteria | 2526164512 | 2526213794 | 128 |
| 42 | iso_pu_bacteria | 2643221544 | 2643743910 | 128 |
| 43 | 3300005333 | Ga0070677_10058730 | Ga0070677_100587303 | 129 |
| 44 | 3300005335 | Ga0070666_10157695 | Ga0070666_101576952 | 129 |
| 45 | 3300005340 | Ga0070689_100704961 | Ga0070689_1007049611 | 129 |
| 46 | 3300005343 | Ga0070687_100111393 | Ga0070687_1001113933 | 129 |
| 47 | 3300005347 | Ga0070668_100013101 | Ga0070668_1000131019 | 129 |
| 48 | 3300005353 | Ga0070669_100004781 | Ga0070669_1000047819 | 129 |
| 49 | 3300005365 | Ga0070688_101477344 | Ga0070688_1014773441 | 129 |
| 50 | 3300005367 | Ga0070667_100001219 | Ga0070667_1000012192 | 129 |
| 51 | 3300005436 | Ga0070713_101231270 | Ga0070713_1012312702 | 129 |
| 52 | 3300005438 | Ga0070701_10173078 | Ga0070701_101730781 | 129 |
| 53 | 3300005547 | Ga0070693_100104913 | Ga0070693_1001049132 | 129 |
| 54 | 3300005719 | Ga0068861_100169480 | Ga0068861_1001694803 | 129 |
| 55 | 3300005834 | Ga0068851_10518759 | Ga0068851_105187592 | 129 |
| 56 | 3300005840 | Ga0068870_10227233 | Ga0068870_102272332 | 129 |
| 57 | 3300005840 | Ga0068870_10297558 | Ga0068870_102975582 | 129 |
| 58 | 3300005842 | Ga0068858_100009355 | Ga0068858_1000093553 | 129 |
| 59 | 3300005843 | Ga0068860_100001009 | Ga0068860_10000100915 | 129 |
| 60 | 3300006173 | Ga0070716_100426462 | Ga0070716_1004264622 | 129 |
| 61 | 3300006353 | Ga0075370_10072039 | Ga0075370_100720392 | 129 |
| 62 | 3300009098 | Ga0105245_10008631 | Ga0105245_100086313 | 129 |
| 63 | 3300009148 | Ga0105243_10098021 | Ga0105243_100980213 | 129 |
| 64 | 3300009176 | Ga0105242_10670637 | Ga0105242_106706372 | 129 |
| 65 | 3300009553 | Ga0105249_10034828 | Ga0105249_100348286 | 129 |
| 66 | 3300010375 | Ga0105239_10192752 | Ga0105239_101927523 | 129 |
| 67 | 3300013306 | Ga0163162_10361146 | Ga0163162_103611463 | 129 |
| 68 | 3300013306 | Ga0163162_11193545 | Ga0163162_111935452 | 129 |
| 69 | 3300013308 | Ga0157375_10387116 | Ga0157375_103871162 | 129 |
| 70 | 3300014326 | Ga0157380_10961560 | Ga0157380_109615602 | 129 |
| 71 | 3300017792 | Ga0163161_10234871 | Ga0163161_102348713 | 129 |
| 72 | 3300025315 | Ga0207697_10158672 | Ga0207697_101586722 | 129 |
| 73 | 3300025321 | Ga0207656_10077488 | Ga0207656_100774883 | 129 |
| 74 | 3300025900 | Ga0207710_10016404 | Ga0207710_100164042 | 129 |
| 75 | 3300025909 | Ga0207705_10303962 | Ga0207705_103039622 | 129 |
| 76 | 3300025909 | Ga0207705_11273526 | Ga0207705_112735261 | 129 |
| 77 | 3300025923 | Ga0207681_10000795 | Ga0207681_1000079513 | 129 |
| 78 | 3300025925 | Ga0207650_10004501 | Ga0207650_100045015 | 129 |
| 79 | 3300025926 | Ga0207659_10168680 | Ga0207659_101686802 | 129 |
| 80 | 3300025927 | Ga0207687_10444166 | Ga0207687_104441662 | 129 |
| 81 | 3300025928 | Ga0207700_10933047 | Ga0207700_109330472 | 129 |
| 82 | 3300025939 | Ga0207665_10082203 | Ga0207665_100822033 | 129 |
| 83 | 3300025972 | Ga0207668_10017712 | Ga0207668_100177122 | 129 |
| 84 | 3300025986 | Ga0207658_10001151 | Ga0207658_100011517 | 129 |
| 85 | 3300026023 | Ga0207677_10161657 | Ga0207677_101616572 | 129 |
| 86 | 3300026035 | Ga0207703_10001999 | Ga0207703_100019997 | 129 |
| 87 | 3300026075 | Ga0207708_10098042 | Ga0207708_100980423 | 129 |
| 88 | 3300026088 | Ga0207641_10026325 | Ga0207641_100263257 | 129 |
| 89 | 3300026095 | Ga0207676_10131378 | Ga0207676_101313782 | 129 |
| 90 | 3300028381 | Ga0268264_10003920 | Ga0268264_100039207 | 129 |
| 91 | 3300035089 | Ga0373944_0154759 | Ga0373944_0154759_43_468 | 129 |
| 92 | 3300035119 | Ga0373956_0359184 | Ga0373956_0359184_31_456 | 129 |
| 93 | 3300035170 | Ga0373943_0040156 | Ga0373943_0040156_456_881 | 129 |
| 94 | 3300035172 | Ga0373955_0193714 | Ga0373955_0193714_613_1038 | 129 |
| 95 | 3300035410 | Ga0373924_0544435 | Ga0373924_0544435_17_442 | 129 |
| 96 | 3300035691 | Ga0373931_0723441 | Ga0373931_0723441_28_462 | 129 |
| 97 | 3300035695 | Ga0373927_0359500 | Ga0373927_0359500_12_437 | 129 |
| 98 | 3300039437 | Ga0436365_1170591 | Ga0436365_1170591_1271_1696 | 129 |
| 99 | 3300044712 | Ga0453684_0308719 | Ga0453684_0308719_689_1126 | 129 |
| 100 | 3300045051 | Ga0451576_0670885 | Ga0451576_0670885_113_550 | 129 |
| 101 | 3300046473 | Ga0495582_0335482 | Ga0495582_0335482_18_443 | 129 |
| 102 | 3300046543 | Ga0495645_0402573 | Ga0495645_0402573_411_836 | 129 |
| 103 | 3300046559 | Ga0495667_0247823 | Ga0495667_0247823_23_448 | 129 |
| 104 | 3300046642 | Ga0495634_0844929 | Ga0495634_0844929_83_508 | 129 |
| 105 | 3300046683 | Ga0495658_0118906 | Ga0495658_0118906_912_1337 | 129 |
| 106 | 3300046691 | Ga0495670_0193492 | Ga0495670_0193492_216_641 | 129 |
| 107 | 3300047315 | Ga0495581_0523836 | Ga0495581_0523836_120_545 | 129 |
| 108 | 3300048911 | Ga0496108_0059614 | Ga0496108_0059614_358_783 | 129 |
| 109 | 3300050496 | nmdc:mga07m45_249277_c1 | nmdc:mga07m45_249277_c1_538_969 | 129 |
| 110 | 3300050511 | nmdc:mga08y16_505851_c1 | nmdc:mga08y16_505851_c1_339_764 | 129 |
| 111 | 3300053077 | Ga0495601_0694390 | Ga0495601_0694390_111_536 | 129 |
| 112 | 3300053083 | Ga0495655_0074053 | Ga0495655_0074053_104_532 | 129 |
| 113 | iso_pu_bacteria | 2643221639 | 2644217213 | 129 |
| 114 | iso_pu_bacteria | 2643221646 | 2644259019 | 129 |
| 115 | iso_pu_bacteria | 2738541337 | 2739055756 | 129 |
| 116 | 3300005355 | Ga0070671_100006682 | Ga0070671_10000668212 | 130 |
| 117 | 3300005364 | Ga0070673_100252094 | Ga0070673_1002520942 | 130 |
| 118 | 3300005458 | Ga0070681_10099116 | Ga0070681_100991163 | 130 |
| 119 | 3300005466 | Ga0070685_10546974 | Ga0070685_105469742 | 130 |
| 120 | 3300005530 | Ga0070679_100043614 | Ga0070679_1000436144 | 130 |
| 121 | 3300005539 | Ga0068853_100144299 | Ga0068853_1001442994 | 130 |
| 122 | 3300005543 | Ga0070672_100046096 | Ga0070672_1000460963 | 130 |
| 123 | 3300005617 | Ga0068859_100291228 | Ga0068859_1002912282 | 130 |
| 124 | 3300005719 | Ga0068861_101125370 | Ga0068861_1011253702 | 130 |
| 125 | 3300005844 | Ga0068862_101144648 | Ga0068862_1011446482 | 130 |
| 126 | 3300006881 | Ga0068865_100458277 | Ga0068865_1004582773 | 130 |
| 127 | 3300006931 | Ga0097620_100291221 | Ga0097620_1002912212 | 130 |
| 128 | 3300009093 | Ga0105240_10002903 | Ga0105240_1000290315 | 130 |
| 129 | 3300009094 | Ga0111539_11293384 | Ga0111539_112933842 | 130 |
| 130 | 3300009176 | Ga0105242_10246410 | Ga0105242_102464102 | 130 |
| 131 | 3300009545 | Ga0105237_10000605 | Ga0105237_1000060521 | 130 |
| 132 | 3300010375 | Ga0105239_10000328 | Ga0105239_1000032840 | 130 |
| 133 | 3300012512 | Ga0157327_1006028 | Ga0157327_10060282 | 130 |
| 134 | 3300014969 | Ga0157376_10119790 | Ga0157376_101197904 | 130 |
| 135 | 3300025295 | Ga0209564_1000051 | Ga0209564_1000051119 | 130 |
| 136 | 3300025893 | Ga0207682_10008487 | Ga0207682_100084876 | 130 |
| 137 | 3300025904 | Ga0207647_10678529 | Ga0207647_106785292 | 130 |
| 138 | 3300025911 | Ga0207654_10151752 | Ga0207654_101517522 | 130 |
| 139 | 3300025913 | Ga0207695_10002543 | Ga0207695_1000254315 | 130 |
| 140 | 3300025914 | Ga0207671_10006429 | Ga0207671_100064296 | 130 |
| 141 | 3300025921 | Ga0207652_10068430 | Ga0207652_100684304 | 130 |
| 142 | 3300025924 | Ga0207694_10072140 | Ga0207694_100721403 | 130 |
| 143 | 3300025926 | Ga0207659_10104518 | Ga0207659_101045183 | 130 |
| 144 | 3300025931 | Ga0207644_11044440 | Ga0207644_110444402 | 130 |
| 145 | 3300025935 | Ga0207709_10895454 | Ga0207709_108954542 | 130 |
| 146 | 3300025940 | Ga0207691_10026402 | Ga0207691_100264026 | 130 |
| 147 | 3300025972 | Ga0207668_10117687 | Ga0207668_101176872 | 130 |
| 148 | 3300026041 | Ga0207639_10321962 | Ga0207639_103219622 | 130 |
| 149 | 3300026118 | Ga0207675_100289505 | Ga0207675_1002895052 | 130 |
| 150 | 3300026121 | Ga0207683_10408580 | Ga0207683_104085802 | 130 |
| 151 | 3300028380 | Ga0268265_10545046 | Ga0268265_105450462 | 130 |
| 152 | 3300031344 | Ga0265316_10000181 | Ga0265316_1000018142 | 130 |
| 153 | 3300031731 | Ga0307405_10021832 | Ga0307405_100218323 | 130 |
| 154 | 3300031911 | Ga0307412_10118366 | Ga0307412_101183662 | 130 |
| 155 | 3300031995 | Ga0307409_100001314 | Ga0307409_10000131413 | 130 |
| 156 | 3300032004 | Ga0307414_10195884 | Ga0307414_101958842 | 130 |
| 157 | 3300032126 | Ga0307415_100105962 | Ga0307415_1001059623 | 130 |
| 158 | 3300041406 | Ga0439439_0100189 | Ga0439439_0100189_187_621 | 130 |
| 159 | 3300044712 | Ga0453684_0059811 | Ga0453684_0059811_2337_2798 | 130 |
| 160 | 3300045051 | Ga0451576_0003317 | Ga0451576_0003317_18361_18822 | 130 |
| 161 | 3300046537 | Ga0495598_0071363 | Ga0495598_0071363_97_522 | 130 |
| 162 | 3300046539 | Ga0495621_0030596 | Ga0495621_0030596_523_948 | 130 |
| 163 | 3300048903 | Ga0496100_0469849 | Ga0496100_0469849_191_643 | 130 |
| 164 | 3300048917 | Ga0496114_0000303 | Ga0496114_0000303_24991_25443 | 130 |
| 165 | 3300048928 | Ga0496125_0311165 | Ga0496125_0311165_92_517 | 130 |
| 166 | 3300048929 | Ga0496126_0424535 | Ga0496126_0424535_475_918 | 130 |
| 167 | iso_pu_bacteria | 2585428062 | 2587756188 | 130 |
| 168 | iso_pu_bacteria | 2643221585 | 2643933070 | 130 |
| 169 | iso_pu_bacteria | 2643221654 | 2644301598 | 130 |
| 170 | iso_pu_bacteria | 2643221656 | 2644314319 | 130 |
| 171 | 3300005327 | Ga0070658_10082474 | Ga0070658_100824743 | 131 |
| 172 | 3300005327 | Ga0070658_10293181 | Ga0070658_102931813 | 131 |
| 173 | 3300005327 | Ga0070658_10505972 | Ga0070658_105059722 | 131 |
| 174 | 3300005335 | Ga0070666_10172595 | Ga0070666_101725952 | 131 |
| 175 | 3300005343 | Ga0070687_100025858 | Ga0070687_1000258583 | 131 |
| 176 | 3300005364 | Ga0070673_100299411 | Ga0070673_1002994112 | 131 |
| 177 | 3300005366 | Ga0070659_100404027 | Ga0070659_1004040271 | 131 |
| 178 | 3300005367 | Ga0070667_100010682 | Ga0070667_1000106823 | 131 |
| 179 | 3300005455 | Ga0070663_100412935 | Ga0070663_1004129352 | 131 |
| 180 | 3300005616 | Ga0068852_100551033 | Ga0068852_1005510332 | 131 |
| 181 | 3300009093 | Ga0105240_10456133 | Ga0105240_104561333 | 131 |
| 182 | 3300009545 | Ga0105237_10359953 | Ga0105237_103599532 | 131 |
| 183 | 3300012475 | Ga0157317_1007403 | Ga0157317_10074031 | 131 |
| 184 | 3300012478 | Ga0157328_1012916 | Ga0157328_10129161 | 131 |
| 185 | 3300012482 | Ga0157318_1003919 | Ga0157318_10039191 | 131 |
| 186 | 3300012507 | Ga0157342_1031791 | Ga0157342_10317911 | 131 |
| 187 | 3300012510 | Ga0157316_1016460 | Ga0157316_10164602 | 131 |
| 188 | 3300013296 | Ga0157374_10945256 | Ga0157374_109452561 | 131 |
| 189 | 3300013308 | Ga0157375_12202274 | Ga0157375_122022741 | 131 |
| 190 | 3300014326 | Ga0157380_10110834 | Ga0157380_101108342 | 131 |
| 191 | 3300014497 | Ga0182008_10446782 | Ga0182008_104467822 | 131 |
| 192 | 3300020082 | Ga0206353_11133087 | Ga0206353_111330872 | 131 |
| 193 | 3300021361 | Ga0213872_10000161 | Ga0213872_100001616 | 131 |
| 194 | 3300021384 | Ga0213876_10032219 | Ga0213876_100322193 | 131 |
| 195 | 3300025256 | Ga0209759_1004020 | Ga0209759_10040206 | 131 |
| 196 | 3300025893 | Ga0207682_10014215 | Ga0207682_100142153 | 131 |
| 197 | 3300025919 | Ga0207657_10012263 | Ga0207657_100122635 | 131 |
| 198 | 3300025932 | Ga0207690_10713146 | Ga0207690_107131462 | 131 |
| 199 | 3300025941 | Ga0207711_10064486 | Ga0207711_100644863 | 131 |
| 200 | 3300025945 | Ga0207679_10869504 | Ga0207679_108695041 | 131 |
| 201 | 3300025945 | Ga0207679_11210253 | Ga0207679_112102532 | 131 |
| 202 | 3300025960 | Ga0207651_10032300 | Ga0207651_100323006 | 131 |
| 203 | 3300025986 | Ga0207658_10005593 | Ga0207658_100055939 | 131 |
| 204 | 3300026035 | Ga0207703_10988454 | Ga0207703_109884542 | 131 |
| 205 | 3300026067 | Ga0207678_10969347 | Ga0207678_109693471 | 131 |
| 206 | 3300026121 | Ga0207683_10420167 | Ga0207683_104201673 | 131 |
| 207 | 3300031238 | Ga0265332_10000187 | Ga0265332_1000018718 | 131 |
| 208 | 3300031456 | Ga0307513_10285307 | Ga0307513_102853072 | 131 |
| 209 | 3300031548 | Ga0307408_100278466 | Ga0307408_1002784663 | 131 |
| 210 | 3300031616 | Ga0307508_10743441 | Ga0307508_107434411 | 131 |
| 211 | 3300031901 | Ga0307406_10998736 | Ga0307406_109987361 | 131 |
| 212 | 3300032002 | Ga0307416_102567805 | Ga0307416_1025678051 | 131 |
| 213 | 3300035120 | Ga0373957_0379102 | Ga0373957_0379102_19_450 | 131 |
| 214 | 3300035171 | Ga0373946_0270935 | Ga0373946_0270935_182_613 | 131 |
| 215 | 3300035724 | Ga0373933_0295202 | Ga0373933_0295202_455_886 | 131 |
| 216 | 3300035725 | Ga0373947_0363442 | Ga0373947_0363442_84_515 | 131 |
| 217 | 3300037312 | Ga0395899_0210560 | Ga0395899_0210560_346_780 | 131 |
| 218 | 3300039437 | Ga0436365_0514532 | Ga0436365_0514532_1562_1993 | 131 |
| 219 | 3300039447 | Ga0436361_0481133 | Ga0436361_0481133_58284_58733 | 131 |
| 220 | 3300041509 | Ga0451843_0161326 | Ga0451843_0161326_34_459 | 131 |
| 221 | 3300042127 | Ga0450890_024208 | Ga0450890_024208_104_538 | 131 |
| 222 | 3300042139 | Ga0450904_008783 | Ga0450904_008783_281_715 | 131 |
| 223 | 3300044656 | Ga0466969_0009692 | Ga0466969_0009692_460_894 | 131 |
| 224 | 3300044683 | Ga0466965_0017660 | Ga0466965_0017660_372_806 | 131 |
| 225 | 3300044684 | Ga0466966_0000754 | Ga0466966_0000754_16151_16585 | 131 |
| 226 | 3300044694 | Ga0466963_0472979 | Ga0466963_0472979_371_805 | 131 |
| 227 | 3300044706 | Ga0466964_0011333 | Ga0466964_0011333_444_878 | 131 |
| 228 | 3300044719 | Ga0466971_0022228 | Ga0466971_0022228_520_954 | 131 |
| 229 | 3300044765 | Ga0466970_0035508 | Ga0466970_0035508_1842_2276 | 131 |
| 230 | 3300044842 | Ga0466957_0029903 | Ga0466957_0029903_204_638 | 131 |
| 231 | 3300045049 | Ga0466959_0028505 | Ga0466959_0028505_674_1108 | 131 |
| 232 | 3300045836 | Ga0466958_0043317 | Ga0466958_0043317_467_901 | 131 |
| 233 | 3300046459 | Ga0495629_0040968 | Ga0495629_0040968_300_731 | 131 |
| 234 | 3300046471 | Ga0495650_0030296 | Ga0495650_0030296_1225_1659 | 131 |
| 235 | 3300046511 | Ga0495608_0091668 | Ga0495608_0091668_1168_1599 | 131 |
| 236 | 3300046514 | Ga0495618_0101195 | Ga0495618_0101195_84_515 | 131 |
| 237 | 3300046516 | Ga0495628_0370048 | Ga0495628_0370048_373_804 | 131 |
| 238 | 3300046517 | Ga0495630_0104877 | Ga0495630_0104877_710_1141 | 131 |
| 239 | 3300046543 | Ga0495645_0236725 | Ga0495645_0236725_344_775 | 131 |
| 240 | 3300046543 | Ga0495645_0393481 | Ga0495645_0393481_254_685 | 131 |
| 241 | 3300046678 | Ga0495599_0141643 | Ga0495599_0141643_910_1341 | 131 |
| 242 | 3300046683 | Ga0495658_0014926 | Ga0495658_0014926_1869_2300 | 131 |
| 243 | 3300046689 | Ga0495613_0150194 | Ga0495613_0150194_1035_1466 | 131 |
| 244 | 3300046691 | Ga0495670_0027835 | Ga0495670_0027835_2061_2501 | 131 |
| 245 | 3300046809 | Ga0495600_0207944 | Ga0495600_0207944_590_1021 | 131 |
| 246 | 3300047319 | Ga0495674_0161840 | Ga0495674_0161840_102_533 | 131 |
| 247 | 3300047322 | Ga0495680_0048736 | Ga0495680_0048736_1751_2182 | 131 |
| 248 | 3300047471 | Ga0495684_0103716 | Ga0495684_0103716_631_1062 | 131 |
| 249 | 3300047673 | Ga0495593_0107975 | Ga0495593_0107975_44_475 | 131 |
| 250 | 3300048909 | Ga0496106_0268153 | Ga0496106_0268153_155_592 | 131 |
| 251 | 3300049130 | Ga0501310_011608 | Ga0501310_011608_83_517 | 131 |
| 252 | 3300049161 | Ga0501305_032163 | Ga0501305_032163_33_467 | 131 |
| 253 | 3300049528 | Ga0501312_007415 | Ga0501312_007415_494_928 | 131 |
| 254 | 3300050512 | nmdc:mga0n895_625855_c1 | nmdc:mga0n895_625855_c1_244_675 | 131 |
| 255 | 3300053077 | Ga0495601_0089083 | Ga0495601_0089083_1003_1434 | 131 |
| 256 | 3300053156 | Ga0500622_0003844 | Ga0500622_0003844_5004_5444 | 131 |
| 257 | 3300061719 | Ga0466962_0008120 | Ga0466962_0008120_2021_2455 | 131 |
| 258 | 3300002705 | JGI25156J39149_1000250 | JGI25156J39149_10002502 | 132 |
| 259 | 3300002738 | JGI25154J39366_1000831 | JGI25154J39366_100083110 | 132 |
| 260 | 3300002741 | JGI25157J39369_1000027 | JGI25157J39369_100002721 | 132 |
| 261 | 3300003752 | Ga0055539_1000213 | Ga0055539_10002132 | 132 |
| 262 | 3300003752 | Ga0055539_1015643 | Ga0055539_10156432 | 132 |
| 263 | 3300003756 | Ga0055533_1000073 | Ga0055533_100007320 | 132 |
| 264 | 3300003759 | Ga0055525_1001549 | Ga0055525_10015491 | 132 |
| 265 | 3300003761 | Ga0055535_1000231 | Ga0055535_100023117 | 132 |
| 266 | 3300003763 | Ga0055529_1000385 | Ga0055529_10003853 | 132 |
| 267 | 3300003763 | Ga0055529_1000410 | Ga0055529_100041030 | 132 |
| 268 | 3300003792 | Ga0055540_1036520 | Ga0055540_10365202 | 132 |
| 269 | 3300005327 | Ga0070658_10107787 | Ga0070658_101077873 | 132 |
| 270 | 3300005327 | Ga0070658_10309199 | Ga0070658_103091992 | 132 |
| 271 | 3300005329 | Ga0070683_100091520 | Ga0070683_1000915203 | 132 |
| 272 | 3300005330 | Ga0070690_100017913 | Ga0070690_1000179135 | 132 |
| 273 | 3300005334 | Ga0068869_100013993 | Ga0068869_1000139934 | 132 |
| 274 | 3300005334 | Ga0068869_100076053 | Ga0068869_1000760533 | 132 |
| 275 | 3300005338 | Ga0068868_100210069 | Ga0068868_1002100692 | 132 |
| 276 | 3300005338 | Ga0068868_100240485 | Ga0068868_1002404852 | 132 |
| 277 | 3300005338 | Ga0068868_100725912 | Ga0068868_1007259121 | 132 |
| 278 | 3300005339 | Ga0070660_100090730 | Ga0070660_1000907302 | 132 |
| 279 | 3300005339 | Ga0070660_100335039 | Ga0070660_1003350392 | 132 |
| 280 | 3300005340 | Ga0070689_100989469 | Ga0070689_1009894691 | 132 |
| 281 | 3300005344 | Ga0070661_100130158 | Ga0070661_1001301583 | 132 |
| 282 | 3300005347 | Ga0070668_100019903 | Ga0070668_1000199034 | 132 |
| 283 | 3300005353 | Ga0070669_100080511 | Ga0070669_1000805113 | 132 |
| 284 | 3300005355 | Ga0070671_100023685 | Ga0070671_1000236852 | 132 |
| 285 | 3300005356 | Ga0070674_100064407 | Ga0070674_1000644073 | 132 |
| 286 | 3300005356 | Ga0070674_100573828 | Ga0070674_1005738282 | 132 |
| 287 | 3300005366 | Ga0070659_100103195 | Ga0070659_1001031953 | 132 |
| 288 | 3300005366 | Ga0070659_100154317 | Ga0070659_1001543172 | 132 |
| 289 | 3300005441 | Ga0070700_100408758 | Ga0070700_1004087582 | 132 |
| 290 | 3300005444 | Ga0070694_100331235 | Ga0070694_1003312352 | 132 |
| 291 | 3300005445 | Ga0070708_100063831 | Ga0070708_1000638312 | 132 |
| 292 | 3300005445 | Ga0070708_100967280 | Ga0070708_1009672802 | 132 |
| 293 | 3300005456 | Ga0070678_100348480 | Ga0070678_1003484803 | 132 |
| 294 | 3300005457 | Ga0070662_100014538 | Ga0070662_1000145383 | 132 |
| 295 | 3300005457 | Ga0070662_100348048 | Ga0070662_1003480483 | 132 |
| 296 | 3300005458 | Ga0070681_11005679 | Ga0070681_110056792 | 132 |
| 297 | 3300005459 | Ga0068867_100532558 | Ga0068867_1005325582 | 132 |
| 298 | 3300005459 | Ga0068867_100783942 | Ga0068867_1007839421 | 132 |
| 299 | 3300005467 | Ga0070706_100004486 | Ga0070706_1000044866 | 132 |
| 300 | 3300005468 | Ga0070707_100168314 | Ga0070707_1001683144 | 132 |
| 301 | 3300005471 | Ga0070698_100138790 | Ga0070698_1001387902 | 132 |
| 302 | 3300005530 | Ga0070679_100238522 | Ga0070679_1002385223 | 132 |
| 303 | 3300005535 | Ga0070684_100189437 | Ga0070684_1001894372 | 132 |
| 304 | 3300005535 | Ga0070684_100462816 | Ga0070684_1004628162 | 132 |
| 305 | 3300005539 | Ga0068853_100378525 | Ga0068853_1003785252 | 132 |
| 306 | 3300005543 | Ga0070672_100614549 | Ga0070672_1006145492 | 132 |
| 307 | 3300005544 | Ga0070686_100271624 | Ga0070686_1002716242 | 132 |
| 308 | 3300005547 | Ga0070693_100117118 | Ga0070693_1001171183 | 132 |
| 309 | 3300005563 | Ga0068855_100472735 | Ga0068855_1004727352 | 132 |
| 310 | 3300005563 | Ga0068855_100637779 | Ga0068855_1006377793 | 132 |
| 311 | 3300005564 | Ga0070664_100121932 | Ga0070664_1001219323 | 132 |
| 312 | 3300005577 | Ga0068857_100114500 | Ga0068857_1001145003 | 132 |
| 313 | 3300005577 | Ga0068857_100169087 | Ga0068857_1001690873 | 132 |
| 314 | 3300005577 | Ga0068857_100262457 | Ga0068857_1002624573 | 132 |
| 315 | 3300005578 | Ga0068854_100143670 | Ga0068854_1001436704 | 132 |
| 316 | 3300005578 | Ga0068854_100199615 | Ga0068854_1001996152 | 132 |
| 317 | 3300005614 | Ga0068856_100006466 | Ga0068856_1000064668 | 132 |
| 318 | 3300005614 | Ga0068856_100218424 | Ga0068856_1002184242 | 132 |
| 319 | 3300005616 | Ga0068852_100050955 | Ga0068852_1000509553 | 132 |
| 320 | 3300005616 | Ga0068852_100135132 | Ga0068852_1001351322 | 132 |
| 321 | 3300005617 | Ga0068859_101161779 | Ga0068859_1011617792 | 132 |
| 322 | 3300005618 | Ga0068864_100591991 | Ga0068864_1005919913 | 132 |
| 323 | 3300005719 | Ga0068861_100007969 | Ga0068861_1000079693 | 132 |
| 324 | 3300005719 | Ga0068861_100128984 | Ga0068861_1001289843 | 132 |
| 325 | 3300005719 | Ga0068861_101397726 | Ga0068861_1013977262 | 132 |
| 326 | 3300005843 | Ga0068860_100537904 | Ga0068860_1005379042 | 132 |
| 327 | 3300005844 | Ga0068862_100234000 | Ga0068862_1002340002 | 132 |
| 328 | 3300005844 | Ga0068862_102487988 | Ga0068862_1024879881 | 132 |
| 329 | 3300006048 | Ga0075363_100354009 | Ga0075363_1003540092 | 132 |
| 330 | 3300006178 | Ga0075367_10015588 | Ga0075367_100155882 | 132 |
| 331 | 3300006195 | Ga0075366_10005265 | Ga0075366_100052655 | 132 |
| 332 | 3300006195 | Ga0075366_10114569 | Ga0075366_101145692 | 132 |
| 333 | 3300006353 | Ga0075370_10015599 | Ga0075370_100155993 | 132 |
| 334 | 3300006353 | Ga0075370_10046189 | Ga0075370_100461893 | 132 |
| 335 | 3300006881 | Ga0068865_101393966 | Ga0068865_1013939661 | 132 |
| 336 | 3300006931 | Ga0097620_101161493 | Ga0097620_1011614932 | 132 |
| 337 | 3300007076 | Ga0075435_100518518 | Ga0075435_1005185182 | 132 |
| 338 | 3300009093 | Ga0105240_10221428 | Ga0105240_102214285 | 132 |
| 339 | 3300009093 | Ga0105240_10303100 | Ga0105240_103031002 | 132 |
| 340 | 3300009147 | Ga0114129_13059471 | Ga0114129_130594712 | 132 |
| 341 | 3300009148 | Ga0105243_10083870 | Ga0105243_100838704 | 132 |
| 342 | 3300009174 | Ga0105241_10165192 | Ga0105241_101651923 | 132 |
| 343 | 3300009174 | Ga0105241_10254402 | Ga0105241_102544022 | 132 |
| 344 | 3300009174 | Ga0105241_11123466 | Ga0105241_111234662 | 132 |
| 345 | 3300009176 | Ga0105242_11873087 | Ga0105242_118730871 | 132 |
| 346 | 3300009545 | Ga0105237_10024647 | Ga0105237_100246473 | 132 |
| 347 | 3300009545 | Ga0105237_10436478 | Ga0105237_104364782 | 132 |
| 348 | 3300009551 | Ga0105238_10131727 | Ga0105238_101317273 | 132 |
| 349 | 3300009551 | Ga0105238_10259041 | Ga0105238_102590412 | 132 |
| 350 | 3300009551 | Ga0105238_10270280 | Ga0105238_102702802 | 132 |
| 351 | 3300011119 | Ga0105246_10180369 | Ga0105246_101803692 | 132 |
| 352 | 3300013102 | Ga0157371_10119053 | Ga0157371_101190533 | 132 |
| 353 | 3300013102 | Ga0157371_10161212 | Ga0157371_101612122 | 132 |
| 354 | 3300013105 | Ga0157369_10106282 | Ga0157369_101062825 | 132 |
| 355 | 3300013105 | Ga0157369_10255279 | Ga0157369_102552793 | 132 |
| 356 | 3300013296 | Ga0157374_10007375 | Ga0157374_100073752 | 132 |
| 357 | 3300013306 | Ga0163162_10317266 | Ga0163162_103172663 | 132 |
| 358 | 3300013306 | Ga0163162_10550524 | Ga0163162_105505242 | 132 |
| 359 | 3300013307 | Ga0157372_10010263 | Ga0157372_100102639 | 132 |
| 360 | 3300013307 | Ga0157372_10052780 | Ga0157372_100527804 | 132 |
| 361 | 3300013307 | Ga0157372_10371558 | Ga0157372_103715583 | 132 |
| 362 | 3300013308 | Ga0157375_10163285 | Ga0157375_101632853 | 132 |
| 363 | 3300014745 | Ga0157377_10053913 | Ga0157377_100539133 | 132 |
| 364 | 3300014968 | Ga0157379_10331511 | Ga0157379_103315113 | 132 |
| 365 | 3300014969 | Ga0157376_10029275 | Ga0157376_100292752 | 132 |
| 366 | 3300014969 | Ga0157376_10249929 | Ga0157376_102499292 | 132 |
| 367 | 3300014969 | Ga0157376_11694049 | Ga0157376_116940492 | 132 |
| 368 | 3300015261 | Ga0182006_1179880 | Ga0182006_11798802 | 132 |
| 369 | 3300015265 | Ga0182005_1099118 | Ga0182005_10991182 | 132 |
| 370 | 3300017792 | Ga0163161_10569870 | Ga0163161_105698702 | 132 |
| 371 | 3300017792 | Ga0163161_11004975 | Ga0163161_110049752 | 132 |
| 372 | 3300021377 | Ga0213874_10208777 | Ga0213874_102087772 | 132 |
| 373 | 3300025226 | Ga0209674_100039 | Ga0209674_100039212 | 132 |
| 374 | 3300025228 | Ga0209672_102750 | Ga0209672_1027506 | 132 |
| 375 | 3300025230 | Ga0209563_100110 | Ga0209563_100110118 | 132 |
| 376 | 3300025231 | Ga0207427_100388 | Ga0207427_10038826 | 132 |
| 377 | 3300025242 | Ga0209258_100305 | Ga0209258_10030548 | 132 |
| 378 | 3300025242 | Ga0209258_100567 | Ga0209258_1005673 | 132 |
| 379 | 3300025246 | Ga0209646_1000231 | Ga0209646_100023154 | 132 |
| 380 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011125 | 132 |
| 381 | 3300025253 | Ga0209677_100246 | Ga0209677_1002463 | 132 |
| 382 | 3300025253 | Ga0209677_109922 | Ga0209677_1099222 | 132 |
| 383 | 3300025254 | Ga0209148_1012339 | Ga0209148_10123392 | 132 |
| 384 | 3300025256 | Ga0209759_1000107 | Ga0209759_1000107125 | 132 |
| 385 | 3300025256 | Ga0209759_1001067 | Ga0209759_100106718 | 132 |
| 386 | 3300025256 | Ga0209759_1021621 | Ga0209759_10216212 | 132 |
| 387 | 3300025272 | Ga0209455_1000053 | Ga0209455_100005349 | 132 |
| 388 | 3300025303 | Ga0209051_1002180 | Ga0209051_10021809 | 132 |
| 389 | 3300025321 | Ga0207656_10008176 | Ga0207656_100081761 | 132 |
| 390 | 3300025321 | Ga0207656_10027048 | Ga0207656_100270482 | 132 |
| 391 | 3300025899 | Ga0207642_10097420 | Ga0207642_100974202 | 132 |
| 392 | 3300025909 | Ga0207705_10253094 | Ga0207705_102530941 | 132 |
| 393 | 3300025910 | Ga0207684_10005949 | Ga0207684_100059493 | 132 |
| 394 | 3300025911 | Ga0207654_10079428 | Ga0207654_100794282 | 132 |
| 395 | 3300025912 | Ga0207707_10517732 | Ga0207707_105177322 | 132 |
| 396 | 3300025912 | Ga0207707_10658507 | Ga0207707_106585071 | 132 |
| 397 | 3300025913 | Ga0207695_10061905 | Ga0207695_100619056 | 132 |
| 398 | 3300025913 | Ga0207695_10088943 | Ga0207695_100889432 | 132 |
| 399 | 3300025914 | Ga0207671_10035144 | Ga0207671_100351442 | 132 |
| 400 | 3300025914 | Ga0207671_10074506 | Ga0207671_100745063 | 132 |
| 401 | 3300025919 | Ga0207657_10135699 | Ga0207657_101356992 | 132 |
| 402 | 3300025919 | Ga0207657_10258321 | Ga0207657_102583212 | 132 |
| 403 | 3300025920 | Ga0207649_10063794 | Ga0207649_100637943 | 132 |
| 404 | 3300025922 | Ga0207646_10067554 | Ga0207646_100675543 | 132 |
| 405 | 3300025923 | Ga0207681_10109921 | Ga0207681_101099213 | 132 |
| 406 | 3300025924 | Ga0207694_10014757 | Ga0207694_100147571 | 132 |
| 407 | 3300025924 | Ga0207694_10177669 | Ga0207694_101776692 | 132 |
| 408 | 3300025924 | Ga0207694_10256685 | Ga0207694_102566852 | 132 |
| 409 | 3300025926 | Ga0207659_10032887 | Ga0207659_100328876 | 132 |
| 410 | 3300025927 | Ga0207687_11180693 | Ga0207687_111806932 | 132 |
| 411 | 3300025931 | Ga0207644_10866837 | Ga0207644_108668372 | 132 |
| 412 | 3300025932 | Ga0207690_10201068 | Ga0207690_102010681 | 132 |
| 413 | 3300025932 | Ga0207690_10620346 | Ga0207690_106203461 | 132 |
| 414 | 3300025933 | Ga0207706_10502664 | Ga0207706_105026642 | 132 |
| 415 | 3300025934 | Ga0207686_10047390 | Ga0207686_100473901 | 132 |
| 416 | 3300025934 | Ga0207686_10252318 | Ga0207686_102523182 | 132 |
| 417 | 3300025935 | Ga0207709_10030033 | Ga0207709_100300334 | 132 |
| 418 | 3300025935 | Ga0207709_10963796 | Ga0207709_109637962 | 132 |
| 419 | 3300025937 | Ga0207669_10245980 | Ga0207669_102459803 | 132 |
| 420 | 3300025938 | Ga0207704_10192902 | Ga0207704_101929022 | 132 |
| 421 | 3300025938 | Ga0207704_10763262 | Ga0207704_107632621 | 132 |
| 422 | 3300025938 | Ga0207704_11009317 | Ga0207704_110093171 | 132 |
| 423 | 3300025940 | Ga0207691_10032397 | Ga0207691_100323973 | 132 |
| 424 | 3300025941 | Ga0207711_11641883 | Ga0207711_116418831 | 132 |
| 425 | 3300025942 | Ga0207689_10016046 | Ga0207689_100160467 | 132 |
| 426 | 3300025944 | Ga0207661_10140288 | Ga0207661_101402882 | 132 |
| 427 | 3300025944 | Ga0207661_11211799 | Ga0207661_112117992 | 132 |
| 428 | 3300025945 | Ga0207679_10213629 | Ga0207679_102136292 | 132 |
| 429 | 3300025945 | Ga0207679_10898806 | Ga0207679_108988062 | 132 |
| 430 | 3300025949 | Ga0207667_10578190 | Ga0207667_105781901 | 132 |
| 431 | 3300025960 | Ga0207651_10006629 | Ga0207651_100066296 | 132 |
| 432 | 3300025972 | Ga0207668_10126010 | Ga0207668_101260104 | 132 |
| 433 | 3300025986 | Ga0207658_10442197 | Ga0207658_104421972 | 132 |
| 434 | 3300026023 | Ga0207677_10076815 | Ga0207677_100768153 | 132 |
| 435 | 3300026023 | Ga0207677_10316529 | Ga0207677_103165292 | 132 |
| 436 | 3300026041 | Ga0207639_10117039 | Ga0207639_101170392 | 132 |
| 437 | 3300026041 | Ga0207639_10634287 | Ga0207639_106342872 | 132 |
| 438 | 3300026075 | Ga0207708_10785822 | Ga0207708_107858222 | 132 |
| 439 | 3300026078 | Ga0207702_10001232 | Ga0207702_100012327 | 132 |
| 440 | 3300026078 | Ga0207702_10044080 | Ga0207702_100440803 | 132 |
| 441 | 3300026078 | Ga0207702_10212232 | Ga0207702_102122322 | 132 |
| 442 | 3300026089 | Ga0207648_10554081 | Ga0207648_105540812 | 132 |
| 443 | 3300026095 | Ga0207676_10047914 | Ga0207676_100479143 | 132 |
| 444 | 3300026116 | Ga0207674_10018142 | Ga0207674_100181429 | 132 |
| 445 | 3300026116 | Ga0207674_10078389 | Ga0207674_100783896 | 132 |
| 446 | 3300026116 | Ga0207674_10164152 | Ga0207674_101641522 | 132 |
| 447 | 3300026118 | Ga0207675_100059119 | Ga0207675_1000591195 | 132 |
| 448 | 3300026118 | Ga0207675_100105634 | Ga0207675_1001056342 | 132 |
| 449 | 3300026121 | Ga0207683_10058177 | Ga0207683_100581775 | 132 |
| 450 | 3300026142 | Ga0207698_10138978 | Ga0207698_101389782 | 132 |
| 451 | 3300026142 | Ga0207698_10238217 | Ga0207698_102382173 | 132 |
| 452 | 3300026142 | Ga0207698_10293860 | Ga0207698_102938602 | 132 |
| 453 | 3300026142 | Ga0207698_11727152 | Ga0207698_117271522 | 132 |
| 454 | 3300027395 | Ga0209996_1018868 | Ga0209996_10188682 | 132 |
| 455 | 3300027471 | Ga0209995_1003267 | Ga0209995_10032673 | 132 |
| 456 | 3300027526 | Ga0209968_1000140 | Ga0209968_100014013 | 132 |
| 457 | 3300027695 | Ga0209966_1000388 | Ga0209966_10003884 | 132 |
| 458 | 3300028379 | Ga0268266_10114139 | Ga0268266_101141393 | 132 |
| 459 | 3300028379 | Ga0268266_11420590 | Ga0268266_114205901 | 132 |
| 460 | 3300028380 | Ga0268265_10344464 | Ga0268265_103444642 | 132 |
| 461 | 3300028381 | Ga0268264_10248183 | Ga0268264_102481833 | 132 |
| 462 | 3300028573 | Ga0265334_10167671 | Ga0265334_101676711 | 132 |
| 463 | 3300028666 | Ga0265336_10000022 | Ga0265336_100000224 | 132 |
| 464 | 3300028794 | Ga0307515_10000165 | Ga0307515_1000016592 | 132 |
| 465 | 3300028794 | Ga0307515_10000188 | Ga0307515_10000188120 | 132 |
| 466 | 3300029957 | Ga0265324_10000645 | Ga0265324_100006459 | 132 |
| 467 | 3300031456 | Ga0307513_10646326 | Ga0307513_106463262 | 132 |
| 468 | 3300031730 | Ga0307516_10005959 | Ga0307516_100059598 | 132 |
| 469 | 3300031730 | Ga0307516_10422311 | Ga0307516_104223112 | 132 |
| 470 | 3300031901 | Ga0307406_10208539 | Ga0307406_102085392 | 132 |
| 471 | 3300031995 | Ga0307409_100049671 | Ga0307409_1000496712 | 132 |
| 472 | 3300032002 | Ga0307416_101239349 | Ga0307416_1012393492 | 132 |
| 473 | 3300034820 | Ga0373959_0026264 | Ga0373959_0026264_146_583 | 132 |
| 474 | 3300034957 | Ga0373938_0044718 | Ga0373938_0044718_31_465 | 132 |
| 475 | 3300035092 | Ga0373952_0028043 | Ga0373952_0028043_573_1007 | 132 |
| 476 | 3300035114 | Ga0373939_0193460 | Ga0373939_0193460_116_550 | 132 |
| 477 | 3300035207 | Ga0373942_0063294 | Ga0373942_0063294_383_829 | 132 |
| 478 | 3300035207 | Ga0373942_0068303 | Ga0373942_0068303_516_950 | 132 |
| 479 | 3300035691 | Ga0373931_0015184 | Ga0373931_0015184_2354_2788 | 132 |
| 480 | 3300035691 | Ga0373931_0223677 | Ga0373931_0223677_167_604 | 132 |
| 481 | 3300035695 | Ga0373927_0741036 | Ga0373927_0741036_80_517 | 132 |
| 482 | 3300037418 | Ga0395900_0760243 | Ga0395900_0760243_256_693 | 132 |
| 483 | 3300037466 | Ga0395898_0008225 | Ga0395898_0008225_2004_2441 | 132 |
| 484 | 3300039450 | Ga0436363_1612144 | Ga0436363_1612144_599_1033 | 132 |
| 485 | 3300041413 | Ga0439465_0131814 | Ga0439465_0131814_400_825 | 132 |
| 486 | 3300041486 | Ga0451807_0187731 | Ga0451807_0187731_945_1382 | 132 |
| 487 | 3300041512 | Ga0451853_0229046 | Ga0451853_0229046_221_661 | 132 |
| 488 | 3300042876 | Ga0451577_0033031 | Ga0451577_0033031_3130_3615 | 132 |
| 489 | 3300044712 | Ga0453684_0124246 | Ga0453684_0124246_1610_2095 | 132 |
| 490 | 3300044712 | Ga0453684_0283535 | Ga0453684_0283535_1297_1743 | 132 |
| 491 | 3300044842 | Ga0466957_0264742 | Ga0466957_0264742_111_548 | 132 |
| 492 | 3300045976 | Ga0466967_0501233 | Ga0466967_0501233_424_861 | 132 |
| 493 | 3300046475 | Ga0495639_0054839 | Ga0495639_0054839_855_1292 | 132 |
| 494 | 3300046537 | Ga0495598_0019933 | Ga0495598_0019933_796_1230 | 132 |
| 495 | 3300046539 | Ga0495621_0030161 | Ga0495621_0030161_560_994 | 132 |
| 496 | 3300046642 | Ga0495634_0149197 | Ga0495634_0149197_263_700 | 132 |
| 497 | 3300046691 | Ga0495670_0401785 | Ga0495670_0401785_34_468 | 132 |
| 498 | 3300047472 | Ga0495686_0003802 | Ga0495686_0003802_9232_9669 | 132 |
| 499 | 3300048088 | Ga0495602_0484990 | Ga0495602_0484990_209_646 | 132 |
| 500 | 3300048090 | Ga0495615_0205635 | Ga0495615_0205635_22_456 | 132 |
| 501 | 3300048903 | Ga0496100_0731449 | Ga0496100_0731449_295_729 | 132 |
| 502 | 3300048904 | Ga0496101_0008869 | Ga0496101_0008869_1472_1906 | 132 |
| 503 | 3300048904 | Ga0496101_0771316 | Ga0496101_0771316_286_723 | 132 |
| 504 | 3300048907 | Ga0496104_0210094 | Ga0496104_0210094_225_674 | 132 |
| 505 | 3300048907 | Ga0496104_0691302 | Ga0496104_0691302_297_734 | 132 |
| 506 | 3300048909 | Ga0496106_0004162 | Ga0496106_0004162_414_848 | 132 |
| 507 | 3300048910 | Ga0496107_0012377 | Ga0496107_0012377_4976_5410 | 132 |
| 508 | 3300048911 | Ga0496108_0057165 | Ga0496108_0057165_1735_2187 | 132 |
| 509 | 3300048911 | Ga0496108_0642548 | Ga0496108_0642548_315_752 | 132 |
| 510 | 3300048912 | Ga0496109_0092481 | Ga0496109_0092481_1739_2191 | 132 |
| 511 | 3300048913 | Ga0496110_0147708 | Ga0496110_0147708_1194_1628 | 132 |
| 512 | 3300048914 | Ga0496111_0302090 | Ga0496111_0302090_520_954 | 132 |
| 513 | 3300048915 | Ga0496112_0063967 | Ga0496112_0063967_1913_2347 | 132 |
| 514 | 3300048917 | Ga0496114_0286169 | Ga0496114_0286169_280_714 | 132 |
| 515 | 3300048918 | Ga0496115_0002077 | Ga0496115_0002077_13830_14264 | 132 |
| 516 | 3300048929 | Ga0496126_0628469 | Ga0496126_0628469_320_757 | 132 |
| 517 | 3300049569 | Ga0501032_0419365 | Ga0501032_0419365_292_720 | 132 |
| 518 | 3300050493 | nmdc:mga0k408_139278_c1 | nmdc:mga0k408_139278_c1_235_660 | 132 |
| 519 | 3300050493 | nmdc:mga0k408_97084_c1 | nmdc:mga0k408_97084_c1_595_1032 | 132 |
| 520 | 3300050494 | nmdc:mga06z11_37405_c1 | nmdc:mga06z11_37405_c1_564_989 | 132 |
| 521 | 3300050496 | nmdc:mga07m45_48072_c1 | nmdc:mga07m45_48072_c1_458_895 | 132 |
| 522 | 3300050496 | nmdc:mga07m45_58967_c1 | nmdc:mga07m45_58967_c1_1293_1718 | 132 |
| 523 | 3300053080 | Ga0500635_0000289 | Ga0500635_0000289_2084_2521 | 132 |
| 524 | 3300053111 | Ga0500572_198351 | Ga0500572_198351_118_555 | 132 |
| 525 | 3300053122 | Ga0500608_018865 | Ga0500608_018865_2292_2729 | 132 |
| 526 | 3300053136 | Ga0500559_0154079 | Ga0500559_0154079_471_908 | 132 |
| 527 | 3300053177 | Ga0500636_0177401 | Ga0500636_0177401_513_950 | 132 |
| 528 | 3300059477 | Ga0587084_008625 | Ga0587084_008625_183_620 | 132 |
| 529 | 3300059478 | Ga0587093_017088 | Ga0587093_017088_420_857 | 132 |
| 530 | 3300059493 | Ga0587077_015148 | Ga0587077_015148_508_945 | 132 |
| 531 | 3300059503 | Ga0587080_038820 | Ga0587080_038820_303_740 | 132 |
| 532 | 3300059504 | Ga0587082_043019 | Ga0587082_043019_70_507 | 132 |
| 533 | 3300059505 | Ga0587083_0027171 | Ga0587083_0027171_489_926 | 132 |
| 534 | 3300059639 | Ga0587062_030232 | Ga0587062_030232_145_582 | 132 |
| 535 | 3300059641 | Ga0587068_006413 | Ga0587068_006413_113_550 | 132 |
| 536 | 3300059642 | Ga0587069_041970 | Ga0587069_041970_248_685 | 132 |
| 537 | 3300059645 | Ga0587076_025679 | Ga0587076_025679_162_599 | 132 |
| 538 | 3300059645 | Ga0587076_073087 | Ga0587076_073087_225_668 | 132 |
| 539 | 3300059657 | Ga0587118_00497 | Ga0587118_00497_124_561 | 132 |
| 540 | 3300059660 | Ga0587124_003541 | Ga0587124_003541_644_1081 | 132 |
| 541 | 3300060344 | Ga0587071_046243 | Ga0587071_046243_318_755 | 132 |
| 542 | 3300060346 | Ga0587111_0017584 | Ga0587111_0017584_563_1000 | 132 |
| 543 | 3300060346 | Ga0587111_0132451 | Ga0587111_0132451_70_507 | 132 |
| 544 | 3300003759 | Ga0055525_1000038 | Ga0055525_100003840 | 133 |
| 545 | 3300005327 | Ga0070658_10416578 | Ga0070658_104165782 | 133 |
| 546 | 3300005330 | Ga0070690_101121428 | Ga0070690_1011214281 | 133 |
| 547 | 3300005331 | Ga0070670_100255309 | Ga0070670_1002553092 | 133 |
| 548 | 3300005334 | Ga0068869_100129683 | Ga0068869_1001296833 | 133 |
| 549 | 3300005334 | Ga0068869_100140779 | Ga0068869_1001407792 | 133 |
| 550 | 3300005335 | Ga0070666_10071419 | Ga0070666_100714192 | 133 |
| 551 | 3300005338 | Ga0068868_100003711 | Ga0068868_10000371112 | 133 |
| 552 | 3300005338 | Ga0068868_100142665 | Ga0068868_1001426653 | 133 |
| 553 | 3300005341 | Ga0070691_10600060 | Ga0070691_106000601 | 133 |
| 554 | 3300005353 | Ga0070669_100557682 | Ga0070669_1005576822 | 133 |
| 555 | 3300005354 | Ga0070675_100003213 | Ga0070675_1000032133 | 133 |
| 556 | 3300005355 | Ga0070671_100037342 | Ga0070671_1000373425 | 133 |
| 557 | 3300005355 | Ga0070671_100512187 | Ga0070671_1005121872 | 133 |
| 558 | 3300005365 | Ga0070688_100069655 | Ga0070688_1000696553 | 133 |
| 559 | 3300005367 | Ga0070667_100027116 | Ga0070667_1000271163 | 133 |
| 560 | 3300005367 | Ga0070667_100165619 | Ga0070667_1001656193 | 133 |
| 561 | 3300005367 | Ga0070667_100505867 | Ga0070667_1005058672 | 133 |
| 562 | 3300005367 | Ga0070667_100753752 | Ga0070667_1007537522 | 133 |
| 563 | 3300005438 | Ga0070701_10253011 | Ga0070701_102530112 | 133 |
| 564 | 3300005455 | Ga0070663_100003281 | Ga0070663_10000328110 | 133 |
| 565 | 3300005456 | Ga0070678_100093252 | Ga0070678_1000932524 | 133 |
| 566 | 3300005457 | Ga0070662_100008348 | Ga0070662_1000083482 | 133 |
| 567 | 3300005457 | Ga0070662_100158527 | Ga0070662_1001585271 | 133 |
| 568 | 3300005457 | Ga0070662_100815651 | Ga0070662_1008156512 | 133 |
| 569 | 3300005459 | Ga0068867_100150509 | Ga0068867_1001505092 | 133 |
| 570 | 3300005459 | Ga0068867_100625785 | Ga0068867_1006257852 | 133 |
| 571 | 3300005466 | Ga0070685_10028648 | Ga0070685_100286483 | 133 |
| 572 | 3300005548 | Ga0070665_100135161 | Ga0070665_1001351613 | 133 |
| 573 | 3300005577 | Ga0068857_100707434 | Ga0068857_1007074342 | 133 |
| 574 | 3300005578 | Ga0068854_100371822 | Ga0068854_1003718222 | 133 |
| 575 | 3300005615 | Ga0070702_100451528 | Ga0070702_1004515282 | 133 |
| 576 | 3300005616 | Ga0068852_100069007 | Ga0068852_1000690073 | 133 |
| 577 | 3300005616 | Ga0068852_100190849 | Ga0068852_1001908492 | 133 |
| 578 | 3300005617 | Ga0068859_100178882 | Ga0068859_1001788822 | 133 |
| 579 | 3300005617 | Ga0068859_100704282 | Ga0068859_1007042822 | 133 |
| 580 | 3300005618 | Ga0068864_100008283 | Ga0068864_1000082838 | 133 |
| 581 | 3300005718 | Ga0068866_10022876 | Ga0068866_100228764 | 133 |
| 582 | 3300005718 | Ga0068866_10520103 | Ga0068866_105201032 | 133 |
| 583 | 3300005834 | Ga0068851_10023499 | Ga0068851_100234994 | 133 |
| 584 | 3300005841 | Ga0068863_100024285 | Ga0068863_1000242856 | 133 |
| 585 | 3300005842 | Ga0068858_100001818 | Ga0068858_10000181813 | 133 |
| 586 | 3300005843 | Ga0068860_100057253 | Ga0068860_1000572535 | 133 |
| 587 | 3300005843 | Ga0068860_101969729 | Ga0068860_1019697292 | 133 |
| 588 | 3300006051 | Ga0075364_10567811 | Ga0075364_105678112 | 133 |
| 589 | 3300006163 | Ga0070715_10030856 | Ga0070715_100308563 | 133 |
| 590 | 3300006177 | Ga0075362_10107294 | Ga0075362_101072943 | 133 |
| 591 | 3300006177 | Ga0075362_10111955 | Ga0075362_101119552 | 133 |
| 592 | 3300006186 | Ga0075369_10273240 | Ga0075369_102732402 | 133 |
| 593 | 3300006195 | Ga0075366_10025896 | Ga0075366_100258966 | 133 |
| 594 | 3300006237 | Ga0097621_100901532 | Ga0097621_1009015322 | 133 |
| 595 | 3300006353 | Ga0075370_10000524 | Ga0075370_100005242 | 133 |
| 596 | 3300006353 | Ga0075370_10131310 | Ga0075370_101313101 | 133 |
| 597 | 3300006353 | Ga0075370_10185102 | Ga0075370_101851023 | 133 |
| 598 | 3300006353 | Ga0075370_10531865 | Ga0075370_105318651 | 133 |
| 599 | 3300006358 | Ga0068871_100888264 | Ga0068871_1008882642 | 133 |
| 600 | 3300006931 | Ga0097620_100178887 | Ga0097620_1001788872 | 133 |
| 601 | 3300006931 | Ga0097620_100704274 | Ga0097620_1007042742 | 133 |
| 602 | 3300009093 | Ga0105240_10039246 | Ga0105240_100392464 | 133 |
| 603 | 3300009098 | Ga0105245_10295690 | Ga0105245_102956902 | 133 |
| 604 | 3300009148 | Ga0105243_12100113 | Ga0105243_121001131 | 133 |
| 605 | 3300009174 | Ga0105241_10858465 | Ga0105241_108584652 | 133 |
| 606 | 3300009177 | Ga0105248_10119484 | Ga0105248_101194842 | 133 |
| 607 | 3300009177 | Ga0105248_10176473 | Ga0105248_101764733 | 133 |
| 608 | 3300009545 | Ga0105237_10014977 | Ga0105237_100149774 | 133 |
| 609 | 3300009551 | Ga0105238_10209691 | Ga0105238_102096912 | 133 |
| 610 | 3300010375 | Ga0105239_10114097 | Ga0105239_101140975 | 133 |
| 611 | 3300013296 | Ga0157374_10047442 | Ga0157374_100474422 | 133 |
| 612 | 3300013306 | Ga0163162_10244035 | Ga0163162_102440353 | 133 |
| 613 | 3300013308 | Ga0157375_10024076 | Ga0157375_100240765 | 133 |
| 614 | 3300014326 | Ga0157380_10116060 | Ga0157380_101160603 | 133 |
| 615 | 3300014326 | Ga0157380_11770187 | Ga0157380_117701871 | 133 |
| 616 | 3300014745 | Ga0157377_10480155 | Ga0157377_104801552 | 133 |
| 617 | 3300014968 | Ga0157379_10031084 | Ga0157379_100310845 | 133 |
| 618 | 3300014969 | Ga0157376_10100852 | Ga0157376_101008523 | 133 |
| 619 | 3300021361 | Ga0213872_10000070 | Ga0213872_1000007019 | 133 |
| 620 | 3300025226 | Ga0209674_110264 | Ga0209674_1102641 | 133 |
| 621 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051232 | 133 |
| 622 | 3300025271 | Ga0207666_1025448 | Ga0207666_10254482 | 133 |
| 623 | 3300025303 | Ga0209051_1004175 | Ga0209051_10041753 | 133 |
| 624 | 3300025303 | Ga0209051_1007173 | Ga0209051_10071737 | 133 |
| 625 | 3300025304 | Ga0209257_1000182 | Ga0209257_100018246 | 133 |
| 626 | 3300025321 | Ga0207656_10051038 | Ga0207656_100510383 | 133 |
| 627 | 3300025893 | Ga0207682_10067933 | Ga0207682_100679332 | 133 |
| 628 | 3300025899 | Ga0207642_10006194 | Ga0207642_100061943 | 133 |
| 629 | 3300025899 | Ga0207642_10444082 | Ga0207642_104440822 | 133 |
| 630 | 3300025903 | Ga0207680_10002216 | Ga0207680_100022163 | 133 |
| 631 | 3300025908 | Ga0207643_10137116 | Ga0207643_101371162 | 133 |
| 632 | 3300025914 | Ga0207671_10074449 | Ga0207671_100744494 | 133 |
| 633 | 3300025924 | Ga0207694_10923096 | Ga0207694_109230962 | 133 |
| 634 | 3300025925 | Ga0207650_10102612 | Ga0207650_101026123 | 133 |
| 635 | 3300025927 | Ga0207687_10360110 | Ga0207687_103601103 | 133 |
| 636 | 3300025931 | Ga0207644_10024225 | Ga0207644_100242255 | 133 |
| 637 | 3300025933 | Ga0207706_10007829 | Ga0207706_1000782910 | 133 |
| 638 | 3300025933 | Ga0207706_10212182 | Ga0207706_102121822 | 133 |
| 639 | 3300025936 | Ga0207670_10038375 | Ga0207670_100383753 | 133 |
| 640 | 3300025941 | Ga0207711_10674490 | Ga0207711_106744902 | 133 |
| 641 | 3300025942 | Ga0207689_10050658 | Ga0207689_100506585 | 133 |
| 642 | 3300025942 | Ga0207689_10530271 | Ga0207689_105302711 | 133 |
| 643 | 3300025981 | Ga0207640_10300170 | Ga0207640_103001703 | 133 |
| 644 | 3300025986 | Ga0207658_10015284 | Ga0207658_100152846 | 133 |
| 645 | 3300025986 | Ga0207658_10270165 | Ga0207658_102701652 | 133 |
| 646 | 3300025986 | Ga0207658_10431244 | Ga0207658_104312442 | 133 |
| 647 | 3300026023 | Ga0207677_10000452 | Ga0207677_100004523 | 133 |
| 648 | 3300026035 | Ga0207703_10003262 | Ga0207703_1000326213 | 133 |
| 649 | 3300026067 | Ga0207678_10002363 | Ga0207678_1000236313 | 133 |
| 650 | 3300026088 | Ga0207641_10038644 | Ga0207641_100386443 | 133 |
| 651 | 3300026095 | Ga0207676_10042218 | Ga0207676_100422184 | 133 |
| 652 | 3300026116 | Ga0207674_10403467 | Ga0207674_104034673 | 133 |
| 653 | 3300026121 | Ga0207683_10114109 | Ga0207683_101141093 | 133 |
| 654 | 3300026142 | Ga0207698_10185317 | Ga0207698_101853173 | 133 |
| 655 | 3300027682 | Ga0209971_1073590 | Ga0209971_10735902 | 133 |
| 656 | 3300028380 | Ga0268265_12584540 | Ga0268265_125845401 | 133 |
| 657 | 3300028381 | Ga0268264_10357684 | Ga0268264_103576841 | 133 |
| 658 | 3300031456 | Ga0307513_10074895 | Ga0307513_100748953 | 133 |
| 659 | 3300031616 | Ga0307508_10273389 | Ga0307508_102733892 | 133 |
| 660 | 3300031731 | Ga0307405_11375715 | Ga0307405_113757151 | 133 |
| 661 | 3300031903 | Ga0307407_10680368 | Ga0307407_106803681 | 133 |
| 662 | 3300031911 | Ga0307412_11546777 | Ga0307412_115467771 | 133 |
| 663 | 3300031995 | Ga0307409_102495383 | Ga0307409_1024953831 | 133 |
| 664 | 3300035089 | Ga0373944_0118979 | Ga0373944_0118979_50_487 | 133 |
| 665 | 3300035171 | Ga0373946_0402877 | Ga0373946_0402877_78_515 | 133 |
| 666 | 3300035725 | Ga0373947_0184495 | Ga0373947_0184495_356_793 | 133 |
| 667 | 3300036401 | Ga0373937_0538404 | Ga0373937_0538404_369_806 | 133 |
| 668 | 3300037068 | Ga0373925_0567951 | Ga0373925_0567951_53_490 | 133 |
| 669 | 3300037471 | Ga0395905_0011653 | Ga0395905_0011653_85_528 | 133 |
| 670 | 3300039447 | Ga0436361_0154722 | Ga0436361_0154722_1078_1518 | 133 |
| 671 | 3300041512 | Ga0451853_2156438 | Ga0451853_2156438_241_681 | 133 |
| 672 | 3300041997 | Ga0439431_0073332 | Ga0439431_0073332_340_768 | 133 |
| 673 | 3300042008 | Ga0439450_170667 | Ga0439450_170667_68_496 | 133 |
| 674 | 3300042134 | Ga0450898_014883 | Ga0450898_014883_137_565 | 133 |
| 675 | 3300042156 | Ga0439446_0117296 | Ga0439446_0117296_331_759 | 133 |
| 676 | 3300042157 | Ga0439458_0091746 | Ga0439458_0091746_177_605 | 133 |
| 677 | 3300042876 | Ga0451577_0291388 | Ga0451577_0291388_877_1305 | 133 |
| 678 | 3300042876 | Ga0451577_0833937 | Ga0451577_0833937_68_496 | 133 |
| 679 | 3300044712 | Ga0453684_0007748 | Ga0453684_0007748_7411_7836 | 133 |
| 680 | 3300044712 | Ga0453684_0051049 | Ga0453684_0051049_1047_1475 | 133 |
| 681 | 3300044712 | Ga0453684_0131943 | Ga0453684_0131943_2273_2698 | 133 |
| 682 | 3300045051 | Ga0451576_0016908 | Ga0451576_0016908_1865_2290 | 133 |
| 683 | 3300046455 | Ga0495603_0211836 | Ga0495603_0211836_183_620 | 133 |
| 684 | 3300046471 | Ga0495650_0103274 | Ga0495650_0103274_13_444 | 133 |
| 685 | 3300046473 | Ga0495582_0490898 | Ga0495582_0490898_183_620 | 133 |
| 686 | 3300046501 | Ga0495607_0419577 | Ga0495607_0419577_135_563 | 133 |
| 687 | 3300046522 | Ga0495643_0107067 | Ga0495643_0107067_392_820 | 133 |
| 688 | 3300046535 | Ga0495586_0298009 | Ga0495586_0298009_252_689 | 133 |
| 689 | 3300046648 | Ga0495611_0571555 | Ga0495611_0571555_63_491 | 133 |
| 690 | 3300046681 | Ga0495647_0190483 | Ga0495647_0190483_194_631 | 133 |
| 691 | 3300046683 | Ga0495658_0044987 | Ga0495658_0044987_1181_1618 | 133 |
| 692 | 3300047443 | Ga0495687_002064 | Ga0495687_002064_10081_10509 | 133 |
| 693 | 3300048091 | Ga0495626_0228171 | Ga0495626_0228171_299_727 | 133 |
| 694 | 3300048903 | Ga0496100_0190731 | Ga0496100_0190731_783_1220 | 133 |
| 695 | 3300048908 | Ga0496105_0170201 | Ga0496105_0170201_472_909 | 133 |
| 696 | 3300048912 | Ga0496109_0928429 | Ga0496109_0928429_296_733 | 133 |
| 697 | 3300048913 | Ga0496110_0244564 | Ga0496110_0244564_661_1098 | 133 |
| 698 | 3300048917 | Ga0496114_0165229 | Ga0496114_0165229_1203_1640 | 133 |
| 699 | 3300048918 | Ga0496115_0487713 | Ga0496115_0487713_527_964 | 133 |
| 700 | 3300048927 | Ga0496124_0001253 | Ga0496124_0001253_20179_20634 | 133 |
| 701 | 3300048928 | Ga0496125_0370834 | Ga0496125_0370834_275_730 | 133 |
| 702 | 3300049572 | Ga0501036_0692126 | Ga0501036_0692126_85_513 | 133 |
| 703 | 3300049760 | Ga0501263_048478 | Ga0501263_048478_66_503 | 133 |
| 704 | 3300050489 | nmdc:mga03683_12587_c1 | nmdc:mga03683_12587_c1_1988_2416 | 133 |
| 705 | 3300050493 | nmdc:mga0k408_18200_c2 | nmdc:mga0k408_18200_c2_695_1126 | 133 |
| 706 | 3300050493 | nmdc:mga0k408_209775_c1 | nmdc:mga0k408_209775_c1_684_1130 | 133 |
| 707 | 3300050493 | nmdc:mga0k408_26610_c1 | nmdc:mga0k408_26610_c1_1826_2254 | 133 |
| 708 | 3300050493 | nmdc:mga0k408_271462_c1 | nmdc:mga0k408_271462_c1_185_610 | 133 |
| 709 | 3300050493 | nmdc:mga0k408_40302_c1 | nmdc:mga0k408_40302_c1_2182_2610 | 133 |
| 710 | 3300050494 | nmdc:mga06z11_214599_c1 | nmdc:mga06z11_214599_c1_179_607 | 133 |
| 711 | 3300050496 | nmdc:mga07m45_18856_c1 | nmdc:mga07m45_18856_c1_1602_2045 | 133 |
| 712 | 3300050496 | nmdc:mga07m45_4213_c1 | nmdc:mga07m45_4213_c1_3332_3760 | 133 |
| 713 | 3300050496 | nmdc:mga07m45_76504_c1 | nmdc:mga07m45_76504_c1_789_1226 | 133 |
| 714 | 3300050496 | nmdc:mga07m45_9233_c1 | nmdc:mga07m45_9233_c1_4090_4518 | 133 |
| 715 | 3300002705 | JGI25156J39149_1004359 | JGI25156J39149_10043595 | 134 |
| 716 | 3300002738 | JGI25154J39366_1001425 | JGI25154J39366_10014257 | 134 |
| 717 | 3300003751 | Ga0055538_1003953 | Ga0055538_10039532 | 134 |
| 718 | 3300003752 | Ga0055539_1008866 | Ga0055539_10088662 | 134 |
| 719 | 3300003756 | Ga0055533_1004066 | Ga0055533_10040663 | 134 |
| 720 | 3300003762 | Ga0055542_1001267 | Ga0055542_10012678 | 134 |
| 721 | 3300003841 | Ga0055541_1000163 | Ga0055541_100016317 | 134 |
| 722 | 3300005331 | Ga0070670_100161505 | Ga0070670_1001615053 | 134 |
| 723 | 3300005338 | Ga0068868_100059788 | Ga0068868_1000597882 | 134 |
| 724 | 3300005456 | Ga0070678_100422332 | Ga0070678_1004223321 | 134 |
| 725 | 3300005457 | Ga0070662_100008670 | Ga0070662_1000086703 | 134 |
| 726 | 3300005468 | Ga0070707_100771912 | Ga0070707_1007719122 | 134 |
| 727 | 3300005548 | Ga0070665_100188616 | Ga0070665_1001886163 | 134 |
| 728 | 3300005616 | Ga0068852_101134046 | Ga0068852_1011340462 | 134 |
| 729 | 3300005618 | Ga0068864_101070383 | Ga0068864_1010703832 | 134 |
| 730 | 3300005841 | Ga0068863_100372012 | Ga0068863_1003720123 | 134 |
| 731 | 3300005841 | Ga0068863_100377215 | Ga0068863_1003772152 | 134 |
| 732 | 3300005843 | Ga0068860_100317511 | Ga0068860_1003175112 | 134 |
| 733 | 3300005843 | Ga0068860_100878965 | Ga0068860_1008789651 | 134 |
| 734 | 3300005844 | Ga0068862_100016575 | Ga0068862_1000165758 | 134 |
| 735 | 3300006038 | Ga0075365_10315211 | Ga0075365_103152112 | 134 |
| 736 | 3300006048 | Ga0075363_100073012 | Ga0075363_1000730122 | 134 |
| 737 | 3300006178 | Ga0075367_10051425 | Ga0075367_100514253 | 134 |
| 738 | 3300006186 | Ga0075369_10013367 | Ga0075369_100133676 | 134 |
| 739 | 3300006195 | Ga0075366_10002085 | Ga0075366_100020859 | 134 |
| 740 | 3300006195 | Ga0075366_10111259 | Ga0075366_101112593 | 134 |
| 741 | 3300006353 | Ga0075370_10080520 | Ga0075370_100805202 | 134 |
| 742 | 3300006353 | Ga0075370_10154210 | Ga0075370_101542103 | 134 |
| 743 | 3300006358 | Ga0068871_100692803 | Ga0068871_1006928031 | 134 |
| 744 | 3300009098 | Ga0105245_10281211 | Ga0105245_102812112 | 134 |
| 745 | 3300009553 | Ga0105249_10325198 | Ga0105249_103251982 | 134 |
| 746 | 3300013297 | Ga0157378_10438143 | Ga0157378_104381432 | 134 |
| 747 | 3300013308 | Ga0157375_10275572 | Ga0157375_102755722 | 134 |
| 748 | 3300014968 | Ga0157379_10297734 | Ga0157379_102977342 | 134 |
| 749 | 3300014969 | Ga0157376_10428805 | Ga0157376_104288052 | 134 |
| 750 | 3300025224 | Ga0209784_100284 | Ga0209784_10028412 | 134 |
| 751 | 3300025225 | Ga0209566_100262 | Ga0209566_10026229 | 134 |
| 752 | 3300025226 | Ga0209674_100200 | Ga0209674_10020044 | 134 |
| 753 | 3300025230 | Ga0209563_113405 | Ga0209563_1134052 | 134 |
| 754 | 3300025246 | Ga0209646_1000046 | Ga0209646_100004652 | 134 |
| 755 | 3300025250 | Ga0209026_1006887 | Ga0209026_10068873 | 134 |
| 756 | 3300025253 | Ga0209677_103365 | Ga0209677_1033655 | 134 |
| 757 | 3300025254 | Ga0209148_1000110 | Ga0209148_1000110157 | 134 |
| 758 | 3300025256 | Ga0209759_1006693 | Ga0209759_10066932 | 134 |
| 759 | 3300025920 | Ga0207649_10061744 | Ga0207649_100617443 | 134 |
| 760 | 3300025931 | Ga0207644_10041723 | Ga0207644_100417234 | 134 |
| 761 | 3300025933 | Ga0207706_10014450 | Ga0207706_100144506 | 134 |
| 762 | 3300025938 | Ga0207704_10087739 | Ga0207704_100877393 | 134 |
| 763 | 3300025941 | Ga0207711_10280431 | Ga0207711_102804313 | 134 |
| 764 | 3300025942 | Ga0207689_10515849 | Ga0207689_105158491 | 134 |
| 765 | 3300025986 | Ga0207658_11917371 | Ga0207658_119173711 | 134 |
| 766 | 3300026088 | Ga0207641_10259863 | Ga0207641_102598633 | 134 |
| 767 | 3300026095 | Ga0207676_10803623 | Ga0207676_108036232 | 134 |
| 768 | 3300026095 | Ga0207676_11149406 | Ga0207676_111494062 | 134 |
| 769 | 3300026121 | Ga0207683_11252312 | Ga0207683_112523122 | 134 |
| 770 | 3300027717 | Ga0209998_10112518 | Ga0209998_101125182 | 134 |
| 771 | 3300028379 | Ga0268266_10037082 | Ga0268266_100370824 | 134 |
| 772 | 3300028379 | Ga0268266_10264699 | Ga0268266_102646992 | 134 |
| 773 | 3300028380 | Ga0268265_10013319 | Ga0268265_100133194 | 134 |
| 774 | 3300028381 | Ga0268264_10371900 | Ga0268264_103719003 | 134 |
| 775 | 3300028786 | Ga0307517_10182036 | Ga0307517_101820362 | 134 |
| 776 | 3300028794 | Ga0307515_10000232 | Ga0307515_1000023254 | 134 |
| 777 | 3300028794 | Ga0307515_10007649 | Ga0307515_100076492 | 134 |
| 778 | 3300028794 | Ga0307515_10009711 | Ga0307515_1000971115 | 134 |
| 779 | 3300028794 | Ga0307515_10208140 | Ga0307515_102081401 | 134 |
| 780 | 3300030522 | Ga0307512_10030983 | Ga0307512_100309832 | 134 |
| 781 | 3300031456 | Ga0307513_10065125 | Ga0307513_100651254 | 134 |
| 782 | 3300031456 | Ga0307513_10070103 | Ga0307513_100701032 | 134 |
| 783 | 3300031507 | Ga0307509_10717002 | Ga0307509_107170022 | 134 |
| 784 | 3300031616 | Ga0307508_10001467 | Ga0307508_1000146727 | 134 |
| 785 | 3300031649 | Ga0307514_10119814 | Ga0307514_101198143 | 134 |
| 786 | 3300031730 | Ga0307516_10024129 | Ga0307516_100241292 | 134 |
| 787 | 3300031730 | Ga0307516_10128425 | Ga0307516_101284251 | 134 |
| 788 | 3300032004 | Ga0307414_10557851 | Ga0307414_105578512 | 134 |
| 789 | 3300033179 | Ga0307507_10177933 | Ga0307507_101779332 | 134 |
| 790 | 3300035117 | Ga0373953_0358069 | Ga0373953_0358069_183_614 | 134 |
| 791 | 3300035171 | Ga0373946_0108813 | Ga0373946_0108813_101_532 | 134 |
| 792 | 3300036401 | Ga0373937_0270688 | Ga0373937_0270688_487_918 | 134 |
| 793 | 3300037068 | Ga0373925_0112972 | Ga0373925_0112972_986_1423 | 134 |
| 794 | 3300037418 | Ga0395900_0000234 | Ga0395900_0000234_12030_12473 | 134 |
| 795 | 3300037466 | Ga0395898_0002077 | Ga0395898_0002077_12075_12518 | 134 |
| 796 | 3300037853 | Ga0436364_1272445 | Ga0436364_1272445_62_505 | 134 |
| 797 | 3300041441 | Ga0451787_055325 | Ga0451787_055325_967_1404 | 134 |
| 798 | 3300041443 | Ga0451789_0302159 | Ga0451789_0302159_110_547 | 134 |
| 799 | 3300041452 | Ga0451793_1056955 | Ga0451793_1056955_315_752 | 134 |
| 800 | 3300041494 | Ga0451837_1086989 | Ga0451837_1086989_10_450 | 134 |
| 801 | 3300041496 | Ga0451839_0443244 | Ga0451839_0443244_313_750 | 134 |
| 802 | 3300041505 | Ga0451849_0824555 | Ga0451849_0824555_532_969 | 134 |
| 803 | 3300041507 | Ga0451851_0900736 | Ga0451851_0900736_111_548 | 134 |
| 804 | 3300041509 | Ga0451843_0845768 | Ga0451843_0845768_201_638 | 134 |
| 805 | 3300041511 | Ga0451855_1365320 | Ga0451855_1365320_110_547 | 134 |
| 806 | 3300041512 | Ga0451853_3367089 | Ga0451853_3367089_171_608 | 134 |
| 807 | 3300044656 | Ga0466969_0058897 | Ga0466969_0058897_166_606 | 134 |
| 808 | 3300044658 | Ga0466972_0001344 | Ga0466972_0001344_500_949 | 134 |
| 809 | 3300044684 | Ga0466966_0015315 | Ga0466966_0015315_2983_3423 | 134 |
| 810 | 3300044693 | Ga0466961_0051128 | Ga0466961_0051128_1206_1646 | 134 |
| 811 | 3300044694 | Ga0466963_0000935 | Ga0466963_0000935_11620_12060 | 134 |
| 812 | 3300044706 | Ga0466964_0003021 | Ga0466964_0003021_3179_3619 | 134 |
| 813 | 3300044706 | Ga0466964_0056316 | Ga0466964_0056316_836_1285 | 134 |
| 814 | 3300044719 | Ga0466971_0020029 | Ga0466971_0020029_1200_1640 | 134 |
| 815 | 3300044765 | Ga0466970_0020698 | Ga0466970_0020698_2504_2944 | 134 |
| 816 | 3300044842 | Ga0466957_0055711 | Ga0466957_0055711_148_588 | 134 |
| 817 | 3300045049 | Ga0466959_0013106 | Ga0466959_0013106_3580_4020 | 134 |
| 818 | 3300045051 | Ga0451576_0152761 | Ga0451576_0152761_440_970 | 134 |
| 819 | 3300045836 | Ga0466958_0080601 | Ga0466958_0080601_477_917 | 134 |
| 820 | 3300045976 | Ga0466967_0021184 | Ga0466967_0021184_470_910 | 134 |
| 821 | 3300046457 | Ga0495590_0084021 | Ga0495590_0084021_172_603 | 134 |
| 822 | 3300046460 | Ga0495638_0224989 | Ga0495638_0224989_466_897 | 134 |
| 823 | 3300046471 | Ga0495650_0002988 | Ga0495650_0002988_3396_3833 | 134 |
| 824 | 3300046491 | Ga0495584_0352193 | Ga0495584_0352193_175_606 | 134 |
| 825 | 3300046512 | Ga0495610_0093618 | Ga0495610_0093618_156_593 | 134 |
| 826 | 3300046515 | Ga0495620_0010669 | Ga0495620_0010669_282_719 | 134 |
| 827 | 3300046519 | Ga0495632_0010962 | Ga0495632_0010962_3324_3755 | 134 |
| 828 | 3300046519 | Ga0495632_0386400 | Ga0495632_0386400_72_509 | 134 |
| 829 | 3300046616 | Ga0495668_0060772 | Ga0495668_0060772_685_1116 | 134 |
| 830 | 3300046660 | Ga0495625_0002387 | Ga0495625_0002387_356_793 | 134 |
| 831 | 3300046660 | Ga0495625_0021963 | Ga0495625_0021963_1934_2365 | 134 |
| 832 | 3300046664 | Ga0495659_0329924 | Ga0495659_0329924_74_505 | 134 |
| 833 | 3300046683 | Ga0495658_0206479 | Ga0495658_0206479_407_844 | 134 |
| 834 | 3300046694 | Ga0495649_0001371 | Ga0495649_0001371_963_1394 | 134 |
| 835 | 3300046810 | Ga0495660_0035861 | Ga0495660_0035861_1990_2421 | 134 |
| 836 | 3300047443 | Ga0495687_005696 | Ga0495687_005696_3914_4345 | 134 |
| 837 | 3300047445 | Ga0495677_0047753 | Ga0495677_0047753_1040_1471 | 134 |
| 838 | 3300047447 | Ga0495685_234545 | Ga0495685_234545_76_507 | 134 |
| 839 | 3300047472 | Ga0495686_0032063 | Ga0495686_0032063_762_1199 | 134 |
| 840 | 3300048091 | Ga0495626_0048720 | Ga0495626_0048720_865_1296 | 134 |
| 841 | 3300048916 | Ga0496113_0191649 | Ga0496113_0191649_608_1045 | 134 |
| 842 | 3300048927 | Ga0496124_0039147 | Ga0496124_0039147_931_1374 | 134 |
| 843 | 3300049460 | Ga0495682_0165290 | Ga0495682_0165290_308_739 | 134 |
| 844 | 3300049575 | Ga0501039_1299034 | Ga0501039_1299034_28_462 | 134 |
| 845 | 3300049822 | Ga0501035_0068336 | Ga0501035_0068336_1737_2186 | 134 |
| 846 | 3300049822 | Ga0501035_0493179 | Ga0501035_0493179_302_736 | 134 |
| 847 | 3300050492 | nmdc:mga0yw44_364058_c1 | nmdc:mga0yw44_364058_c1_137_568 | 134 |
| 848 | 3300050493 | nmdc:mga0k408_250930_c1 | nmdc:mga0k408_250930_c1_233_679 | 134 |
| 849 | 3300050493 | nmdc:mga0k408_46145_c1 | nmdc:mga0k408_46145_c1_992_1429 | 134 |
| 850 | 3300050493 | nmdc:mga0k408_6644_c1 | nmdc:mga0k408_6644_c1_2954_3385 | 134 |
| 851 | 3300050494 | nmdc:mga06z11_14427_c1 | nmdc:mga06z11_14427_c1_942_1373 | 134 |
| 852 | 3300050496 | nmdc:mga07m45_25851_c1 | nmdc:mga07m45_25851_c1_970_1401 | 134 |
| 853 | 3300050516 | nmdc:mga0sz30_5056_c1 | nmdc:mga0sz30_5056_c1_1832_2263 | 134 |
| 854 | 3300053086 | Ga0500578_0287913 | Ga0500578_0287913_509_940 | 134 |
| 855 | 3300053092 | Ga0500583_0247630 | Ga0500583_0247630_386_823 | 134 |
| 856 | 3300053134 | Ga0500658_0006983 | Ga0500658_0006983_1816_2247 | 134 |
| 857 | 3300059421 | Ga0590071_019067 | Ga0590071_019067_666_1106 | 134 |
| 858 | 3300059424 | Ga0590075_036240 | Ga0590075_036240_70_510 | 134 |
| 859 | 3300061719 | Ga0466962_0055459 | Ga0466962_0055459_977_1417 | 134 |
| 860 | 3300005539 | Ga0068853_100282685 | Ga0068853_1002826852 | 135 |
| 861 | 3300005617 | Ga0068859_100980946 | Ga0068859_1009809462 | 135 |
| 862 | 3300005844 | Ga0068862_100028605 | Ga0068862_1000286056 | 135 |
| 863 | 3300006931 | Ga0097620_100980990 | Ga0097620_1009809902 | 135 |
| 864 | 3300009148 | Ga0105243_10195115 | Ga0105243_101951152 | 135 |
| 865 | 3300025914 | Ga0207671_10125132 | Ga0207671_101251322 | 135 |
| 866 | 3300025933 | Ga0207706_10531508 | Ga0207706_105315082 | 135 |
| 867 | 3300025935 | Ga0207709_10301342 | Ga0207709_103013422 | 135 |
| 868 | 3300025938 | Ga0207704_10777717 | Ga0207704_107777171 | 135 |
| 869 | 3300025940 | Ga0207691_10012093 | Ga0207691_100120935 | 135 |
| 870 | 3300025949 | Ga0207667_11566063 | Ga0207667_115660631 | 135 |
| 871 | 3300025960 | Ga0207651_10029434 | Ga0207651_100294344 | 135 |
| 872 | 3300025986 | Ga0207658_10280466 | Ga0207658_102804663 | 135 |
| 873 | 3300026023 | Ga0207677_10060276 | Ga0207677_100602763 | 135 |
| 874 | 3300026089 | Ga0207648_10039788 | Ga0207648_100397883 | 135 |
| 875 | 3300026089 | Ga0207648_10135139 | Ga0207648_101351393 | 135 |
| 876 | 3300026116 | Ga0207674_10009428 | Ga0207674_100094288 | 135 |
| 877 | 3300026121 | Ga0207683_10228875 | Ga0207683_102288752 | 135 |
| 878 | 3300028380 | Ga0268265_10020524 | Ga0268265_100205246 | 135 |
| 879 | 3300028786 | Ga0307517_10026165 | Ga0307517_100261659 | 135 |
| 880 | 3300031456 | Ga0307513_10513456 | Ga0307513_105134562 | 135 |
| 881 | 3300031507 | Ga0307509_10003083 | Ga0307509_100030832 | 135 |
| 882 | 3300031507 | Ga0307509_10162846 | Ga0307509_101628462 | 135 |
| 883 | 3300031507 | Ga0307509_10165756 | Ga0307509_101657563 | 135 |
| 884 | 3300031616 | Ga0307508_10000016 | Ga0307508_1000001638 | 135 |
| 885 | 3300031649 | Ga0307514_10037190 | Ga0307514_100371904 | 135 |
| 886 | 3300031649 | Ga0307514_10106657 | Ga0307514_101066573 | 135 |
| 887 | 3300031649 | Ga0307514_10183502 | Ga0307514_101835022 | 135 |
| 888 | 3300031730 | Ga0307516_10004400 | Ga0307516_1000440017 | 135 |
| 889 | 3300031730 | Ga0307516_10074947 | Ga0307516_100749473 | 135 |
| 890 | 3300031730 | Ga0307516_10600477 | Ga0307516_106004772 | 135 |
| 891 | 3300031824 | Ga0307413_10699676 | Ga0307413_106996762 | 135 |
| 892 | 3300031852 | Ga0307410_10980208 | Ga0307410_109802082 | 135 |
| 893 | 3300031901 | Ga0307406_10125933 | Ga0307406_101259333 | 135 |
| 894 | 3300032002 | Ga0307416_100430129 | Ga0307416_1004301293 | 135 |
| 895 | 3300033179 | Ga0307507_10423621 | Ga0307507_104236211 | 135 |
| 896 | 3300035091 | Ga0373951_0274210 | Ga0373951_0274210_48_491 | 135 |
| 897 | 3300035112 | Ga0373932_0107511 | Ga0373932_0107511_194_637 | 135 |
| 898 | 3300035114 | Ga0373939_0146702 | Ga0373939_0146702_160_603 | 135 |
| 899 | 3300035242 | Ga0373962_0249575 | Ga0373962_0249575_10_453 | 135 |
| 900 | 3300035691 | Ga0373931_0062197 | Ga0373931_0062197_865_1308 | 135 |
| 901 | 3300035695 | Ga0373927_0076004 | Ga0373927_0076004_113_556 | 135 |
| 902 | 3300037068 | Ga0373925_0015098 | Ga0373925_0015098_4030_4473 | 135 |
| 903 | 3300039437 | Ga0436365_0569739 | Ga0436365_0569739_1014_1460 | 135 |
| 904 | 3300041456 | Ga0451795_0667820 | Ga0451795_0667820_258_701 | 135 |
| 905 | 3300045051 | Ga0451576_0653811 | Ga0451576_0653811_138_563 | 135 |
| 906 | 3300045051 | Ga0451576_1839157 | Ga0451576_1839157_138_563 | 135 |
| 907 | 3300046454 | Ga0495592_0000213 | Ga0495592_0000213_32585_33028 | 135 |
| 908 | 3300046461 | Ga0495641_0082809 | Ga0495641_0082809_186_629 | 135 |
| 909 | 3300046473 | Ga0495582_0434731 | Ga0495582_0434731_205_648 | 135 |
| 910 | 3300046475 | Ga0495639_0185617 | Ga0495639_0185617_161_604 | 135 |
| 911 | 3300046492 | Ga0495585_0160372 | Ga0495585_0160372_672_1112 | 135 |
| 912 | 3300046516 | Ga0495628_0568213 | Ga0495628_0568213_220_663 | 135 |
| 913 | 3300046517 | Ga0495630_0227592 | Ga0495630_0227592_488_931 | 135 |
| 914 | 3300046557 | Ga0495622_0049976 | Ga0495622_0049976_1317_1760 | 135 |
| 915 | 3300046690 | Ga0495624_0377780 | Ga0495624_0377780_220_663 | 135 |
| 916 | 3300046694 | Ga0495649_0188822 | Ga0495649_0188822_406_849 | 135 |
| 917 | 3300047317 | Ga0495604_0379136 | Ga0495604_0379136_89_532 | 135 |
| 918 | 3300047321 | Ga0495676_0078953 | Ga0495676_0078953_530_973 | 135 |
| 919 | 3300047469 | Ga0495673_0101795 | Ga0495673_0101795_513_953 | 135 |
| 920 | 3300047673 | Ga0495593_0023044 | Ga0495593_0023044_1253_1696 | 135 |
| 921 | 3300048089 | Ga0495614_0052657 | Ga0495614_0052657_788_1231 | 135 |
| 922 | 3300048907 | Ga0496104_0694182 | Ga0496104_0694182_73_516 | 135 |
| 923 | 3300048909 | Ga0496106_0012991 | Ga0496106_0012991_5104_5544 | 135 |
| 924 | 3300053093 | Ga0500651_0127767 | Ga0500651_0127767_394_837 | 135 |
| 925 | 3300053138 | Ga0500564_096406 | Ga0500564_096406_424_867 | 135 |
| 926 | 3300053154 | Ga0500619_000073 | Ga0500619_000073_2430_2867 | 135 |
| 927 | 3300006195 | Ga0075366_10722505 | Ga0075366_107225051 | 136 |
| 928 | 3300006846 | Ga0075430_100023009 | Ga0075430_1000230096 | 136 |
| 929 | 3300006880 | Ga0075429_100008966 | Ga0075429_1000089664 | 136 |
| 930 | 3300009147 | Ga0114129_11533893 | Ga0114129_115338932 | 136 |
| 931 | 3300031456 | Ga0307513_10365268 | Ga0307513_103652683 | 136 |
| 932 | 3300031507 | Ga0307509_10125033 | Ga0307509_101250332 | 136 |
| 933 | 3300031548 | Ga0307408_101739835 | Ga0307408_1017398352 | 136 |
| 934 | 3300035114 | Ga0373939_0422373 | Ga0373939_0422373_88_540 | 136 |
| 935 | 3300041459 | Ga0451800_0542404 | Ga0451800_0542404_122_559 | 136 |
| 936 | 3300041460 | Ga0451802_0517703 | Ga0451802_0517703_424_864 | 136 |
| 937 | 3300048913 | Ga0496110_0227769 | Ga0496110_0227769_674_1150 | 136 |
| 938 | 3300049570 | Ga0501033_0313121 | Ga0501033_0313121_122_622 | 136 |
| 939 | 3300050508 | nmdc:mga09592_14154_c1 | nmdc:mga09592_14154_c1_2286_2729 | 136 |
| 940 | 3300050509 | nmdc:mga0qj67_47140_c1 | nmdc:mga0qj67_47140_c1_2331_2774 | 136 |
| 941 | 3300053086 | Ga0500578_0169449 | Ga0500578_0169449_484_921 | 136 |
| 942 | 3300053145 | Ga0500586_279206 | Ga0500586_279206_37_462 | 136 |
| 943 | 3300053158 | Ga0500627_0076259 | Ga0500627_0076259_723_1163 | 136 |
| 944 | 3300053730 | Ga0500645_007607 | Ga0500645_007607_1635_2072 | 136 |
| 945 | 3300005539 | Ga0068853_100089752 | Ga0068853_1000897524 | 137 |
| 946 | 3300006195 | Ga0075366_10178739 | Ga0075366_101787392 | 137 |
| 947 | 3300006353 | Ga0075370_10553542 | Ga0075370_105535422 | 137 |
| 948 | 3300009176 | Ga0105242_10714194 | Ga0105242_107141942 | 137 |
| 949 | 3300026041 | Ga0207639_11591719 | Ga0207639_115917192 | 137 |
| 950 | 3300026089 | Ga0207648_10571403 | Ga0207648_105714032 | 137 |
| 951 | 3300026121 | Ga0207683_10112158 | Ga0207683_101121583 | 137 |
| 952 | 3300028794 | Ga0307515_10049534 | Ga0307515_100495347 | 137 |
| 953 | 3300031456 | Ga0307513_10708444 | Ga0307513_107084442 | 137 |
| 954 | 3300046530 | Ga0495654_0002282 | Ga0495654_0002282_783_1208 | 137 |
| 955 | 3300050493 | nmdc:mga0k408_219125_c1 | nmdc:mga0k408_219125_c1_273_725 | 137 |
| 956 | 3300053108 | Ga0500562_026437 | Ga0500562_026437_474_902 | 137 |
| 957 | 3300053153 | Ga0500616_0129967 | Ga0500616_0129967_104_535 | 137 |
| 958 | iso_pu_bacteria | 2842718218 | 2842721898 | 137 |
| 959 | 3300005365 | Ga0070688_100617013 | Ga0070688_1006170132 | 138 |
| 960 | 3300005441 | Ga0070700_100649848 | Ga0070700_1006498482 | 138 |
| 961 | 3300005842 | Ga0068858_100425093 | Ga0068858_1004250932 | 138 |
| 962 | 3300009036 | Ga0105244_10333384 | Ga0105244_103333842 | 138 |
| 963 | 3300017792 | Ga0163161_11226008 | Ga0163161_112260081 | 138 |
| 964 | 3300031548 | Ga0307408_100039931 | Ga0307408_1000399312 | 138 |
| 965 | 3300032002 | Ga0307416_100087114 | Ga0307416_1000871145 | 138 |
| 966 | 3300032005 | Ga0307411_10108135 | Ga0307411_101081352 | 138 |
| 967 | 3300049127 | Ga0501306_026251 | Ga0501306_026251_232_690 | 138 |
| 968 | 3300049518 | Ga0501295_024439 | Ga0501295_024439_204_656 | 138 |
| 969 | 3300049584 | Ga0501068_0523170 | Ga0501068_0523170_66_509 | 138 |
| 970 | 3300053148 | Ga0500590_056793 | Ga0500590_056793_72_515 | 138 |
| 971 | 3300028794 | Ga0307515_10003451 | Ga0307515_1000345116 | 139 |
| 972 | 3300030522 | Ga0307512_10166710 | Ga0307512_101667102 | 139 |
| 973 | 3300031456 | Ga0307513_10043401 | Ga0307513_100434013 | 139 |
| 974 | 3300031649 | Ga0307514_10000711 | Ga0307514_1000071139 | 139 |
| 975 | 3300031731 | Ga0307405_10027461 | Ga0307405_100274613 | 139 |
| 976 | 3300033180 | Ga0307510_10076751 | Ga0307510_100767514 | 139 |
| 977 | 3300048927 | Ga0496124_0024540 | Ga0496124_0024540_4547_4978 | 139 |
| 978 | 3300048928 | Ga0496125_0007690 | Ga0496125_0007690_760_1194 | 139 |
| 979 | 3300048928 | Ga0496125_0026412 | Ga0496125_0026412_862_1293 | 139 |
| 980 | 3300048928 | Ga0496125_0221799 | Ga0496125_0221799_586_1017 | 139 |
| 981 | 3300048929 | Ga0496126_0164097 | Ga0496126_0164097_785_1216 | 139 |
| 982 | iso_pu_bacteria | 2547132374 | 2548501227 | 139 |
| 983 | iso_pu_bacteria | 2643221570 | 2643868532 | 139 |
| 984 | iso_pu_bacteria | 2643221596 | 2643994631 | 139 |
| 985 | iso_pu_bacteria | 2643221609 | 2644061689 | 139 |
| 986 | iso_pu_bacteria | 2643221611 | 2644075220 | 139 |
| 987 | iso_pu_bacteria | 2643221652 | 2644295484 | 139 |
| 988 | iso_pu_bacteria | 2643221717 | 2644649228 | 139 |
| 989 | iso_pu_bacteria | 2738543012 | 2739243385 | 139 |
| 990 | iso_pu_bacteria | 2816332133 | 2816473964 | 139 |
| 991 | iso_pu_bacteria | 2990710928 | 2990715570 | 139 |
| 992 | 3300021361 | Ga0213872_10009666 | Ga0213872_100096664 | 140 |
| 993 | 3300027424 | Ga0209984_1008262 | Ga0209984_10082622 | 140 |
| 994 | 3300027682 | Ga0209971_1008084 | Ga0209971_10080843 | 140 |
| 995 | 3300027876 | Ga0209974_10006661 | Ga0209974_100066615 | 140 |
| 996 | 3300039447 | Ga0436361_0086324 | Ga0436361_0086324_13099_13530 | 140 |
| 997 | 3300049763 | Ga0501266_000043 | Ga0501266_000043_13026_13457 | 140 |
| 998 | 3300006946 | Ga0079104_1000530 | Ga0079104_100053031 | 141 |
| 999 | 3300009148 | Ga0105243_10008894 | Ga0105243_100088946 | 141 |
| 1000 | 3300025935 | Ga0207709_10000622 | Ga0207709_1000062216 | 141 |
| 1001 | 3300027111 | Ga0209281_1000599 | Ga0209281_100059931 | 141 |
| 1002 | 3300046542 | Ga0495597_0000077 | Ga0495597_0000077_15421_15852 | 141 |
| 1003 | 3300049568 | Ga0501031_0003670 | Ga0501031_0003670_326_787 | 141 |
| 1004 | 3300009036 | Ga0105244_10242759 | Ga0105244_102427591 | 142 |
| 1005 | 3300009176 | Ga0105242_10002491 | Ga0105242_100024919 | 142 |
| 1006 | 3300025934 | Ga0207686_10015629 | Ga0207686_100156297 | 142 |
| 1007 | 3300027876 | Ga0209974_10000798 | Ga0209974_1000079811 | 142 |
| 1008 | 3300031548 | Ga0307408_100000096 | Ga0307408_10000009676 | 142 |
| 1009 | 3300031548 | Ga0307408_100008311 | Ga0307408_10000831110 | 142 |
| 1010 | 3300031901 | Ga0307406_10000669 | Ga0307406_100006698 | 142 |
| 1011 | 3300041509 | Ga0451843_0373713 | Ga0451843_0373713_643_1080 | 142 |
| 1012 | 3300042125 | Ga0450923_024293 | Ga0450923_024293_332_769 | 142 |
| 1013 | 3300042136 | Ga0450900_022422 | Ga0450900_022422_149_586 | 142 |
| 1014 | 3300049573 | Ga0501037_0214749 | Ga0501037_0214749_701_1144 | 142 |
| 1015 | 3300053161 | Ga0500634_0005385 | Ga0500634_0005385_327_773 | 144 |
| 1016 | 3300031235 | Ga0265330_10000045 | Ga0265330_10000045105 | 145 |
| 1017 | 3300031238 | Ga0265332_10000031 | Ga0265332_10000031142 | 145 |
| 1018 | 3300031241 | Ga0265325_10003774 | Ga0265325_100037749 | 145 |
| 1019 | 3300031247 | Ga0265340_10137053 | Ga0265340_101370532 | 145 |
| 1020 | 3300031711 | Ga0265314_10001461 | Ga0265314_1000146115 | 145 |
| 1021 | 2162886007 | SwRhRL2b_contig_337291 | SwRhRL2b_0265.00000380 | 148 |
| 1022 | 3300005289 | Ga0065704_10072289 | Ga0065704_100722895 | 148 |
| 1023 | 3300048926 | Ga0496123_0020213 | Ga0496123_0020213_1010_1456 | 148 |
| 1024 | 3300048928 | Ga0496125_0000542 | Ga0496125_0000542_51085_51531 | 148 |
| 1025 | 3300048929 | Ga0496126_0007499 | Ga0496126_0007499_9635_10081 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar