F488484

General Info

Members Datasets Scaffolds Average Seq Length
1025 488 1003 144

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100144299|Ga0068853_1001442994
Length 140
Sequence MSENSSQSEEDAMAAEWAAALAESKPENEVQTDTVAPAAFQNFSPTTGGGAGNDINMILDIPVQLTVELGRTRIPIKHILQLAQGSVVELDALAGEPMDVLVNGYLIAQGEVVVVNDKFGIRLTDIVTPSERMRRLSKAN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221570 Acidovorax sp. Root568 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
15 2643221656 Pelomonas sp. Root405 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2816332133 Acidovorax radicis 2721A Isolate Unclassified
20 2831864461 Roseateles noduli HZ7 Isolate Nodule
21 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
22 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
23 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
131 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
132 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
133 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
134 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
135 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
241 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
245 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
246 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
247 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
275 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
288 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
306 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
307 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
308 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
309 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
310 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
311 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
312 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
313 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
314 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
315 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
316 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
317 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
320 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
321 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
322 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
323 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
324 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
325 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
326 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
327 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
328 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
329 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
332 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
333 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
336 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
337 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
338 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
339 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
340 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
341 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
348 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
355 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
364 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
365 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
366 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
379 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
402 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
403 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
411 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
412 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
413 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
414 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
415 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
416 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
417 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
418 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
427 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
428 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
437 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
438 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
448 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
454 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
457 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
458 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
459 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
460 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
461 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
462 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
463 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
464 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
467 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
468 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
469 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
470 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
471 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
472 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
473 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
474 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 2.05
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 0.29
Rhizoplane 3.71
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_337291 2162886007 Bacteria 943
2 JGI25156J39149_1000250 3300002705 Bacteria 37027
3 JGI25156J39149_1004359 3300002705 Bacteria 4338
4 JGI25154J39366_1000831 3300002738 Bacteria 13419
5 JGI25154J39366_1001425 3300002738 Bacteria 8516
6 JGI25157J39369_1000027 3300002741 Bacteria 147448
7 Ga0055538_1003953 3300003751 Bacteria 1769
8 Ga0055539_1000213 3300003752 Bacteria 42508
9 Ga0055539_1008866 3300003752 Bacteria 1254
10 Ga0055539_1015643 3300003752 Bacteria 922
11 Ga0055533_1000073 3300003756 Bacteria 142476
12 Ga0055533_1004066 3300003756 Bacteria 2743
13 Ga0055525_1000038 3300003759 Bacteria 297540
14 Ga0055525_1001549 3300003759 Bacteria 3824
15 Ga0055535_1000231 3300003761 Bacteria 58583
16 Ga0055542_1001267 3300003762 Bacteria 13722
17 Ga0055529_1000385 3300003763 Bacteria 47717
18 Ga0055529_1000410 3300003763 Bacteria 45041
19 Ga0055540_1036520 3300003792 Bacteria 1090
20 Ga0055541_1000163 3300003841 Bacteria 32746
21 Ga0065704_10072289 3300005289 Bacteria 8798
22 Ga0070658_10082474 3300005327 Bacteria 2642
23 Ga0070658_10107787 3300005327 Bacteria 2305
24 Ga0070658_10293181 3300005327 Bacteria 1386
25 Ga0070658_10309199 3300005327 Bacteria 1348
26 Ga0070658_10416578 3300005327 Bacteria 1155
27 Ga0070658_10505972 3300005327 Bacteria 1044
28 Ga0070683_100091520 3300005329 Bacteria 2856
29 Ga0070690_100017913 3300005330 Bacteria 4269
30 Ga0070690_101121428 3300005330 Bacteria 625
31 Ga0070670_100161505 3300005331 Bacteria 1942
32 Ga0070670_100255309 3300005331 Bacteria 1528
33 Ga0070677_10058730 3300005333 Bacteria 1580
34 Ga0068869_100013993 3300005334 Bacteria 5351
35 Ga0068869_100076053 3300005334 Bacteria 2495
36 Ga0068869_100129683 3300005334 Bacteria 1937
37 Ga0068869_100140779 3300005334 Bacteria 1862
38 Ga0070666_10071419 3300005335 Bacteria 2362
39 Ga0070666_10157695 3300005335 Bacteria 1585
40 Ga0070666_10172595 3300005335 Bacteria 1514
41 Ga0068868_100003711 3300005338 Bacteria 10664
42 Ga0068868_100059788 3300005338 Bacteria 3015
43 Ga0068868_100142665 3300005338 Bacteria 1968
44 Ga0068868_100210069 3300005338 Bacteria 1626
45 Ga0068868_100240485 3300005338 Bacteria 1521
46 Ga0068868_100725912 3300005338 Bacteria 891
47 Ga0070660_100090730 3300005339 Bacteria 2409
48 Ga0070660_100335039 3300005339 Bacteria 1244
49 Ga0070689_100704961 3300005340 Bacteria 881
50 Ga0070689_100989469 3300005340 Bacteria 748
51 Ga0070691_10600060 3300005341 Bacteria 650
52 Ga0070687_100025858 3300005343 Bacteria 2820
53 Ga0070687_100111393 3300005343 Bacteria 1549
54 Ga0070661_100130158 3300005344 Bacteria 1889
55 Ga0070668_100013101 3300005347 Bacteria 6179
56 Ga0070668_100019903 3300005347 Bacteria 5057
57 Ga0070669_100004781 3300005353 Bacteria 9772
58 Ga0070669_100080511 3300005353 Bacteria 2424
59 Ga0070669_100557682 3300005353 Bacteria 956
60 Ga0070675_100003213 3300005354 Bacteria 12380
61 Ga0070671_100006682 3300005355 Bacteria 9222
62 Ga0070671_100023685 3300005355 Bacteria 5026
63 Ga0070671_100037342 3300005355 Bacteria 4028
64 Ga0070671_100512187 3300005355 Bacteria 1033
65 Ga0070674_100064407 3300005356 Bacteria 2568
66 Ga0070674_100573828 3300005356 Bacteria 949
67 Ga0070673_100252094 3300005364 Bacteria 1539
68 Ga0070673_100299411 3300005364 Bacteria 1415
69 Ga0070688_100069655 3300005365 Bacteria 2247
70 Ga0070688_100617013 3300005365 Bacteria 832
71 Ga0070688_101477344 3300005365 Bacteria 552
72 Ga0070659_100103195 3300005366 Bacteria 2296
73 Ga0070659_100154317 3300005366 Bacteria 1874
74 Ga0070659_100404027 3300005366 Bacteria 1153
75 Ga0070667_100001219 3300005367 Bacteria 23401
76 Ga0070667_100010682 3300005367 Bacteria 7585
77 Ga0070667_100027116 3300005367 Bacteria 4767
78 Ga0070667_100165619 3300005367 Bacteria 1949
79 Ga0070667_100505867 3300005367 Bacteria 1108
80 Ga0070667_100753752 3300005367 Bacteria 902
81 Ga0070713_101231270 3300005436 Bacteria 725
82 Ga0070701_10173078 3300005438 Bacteria 1258
83 Ga0070701_10253011 3300005438 Bacteria 1065
84 Ga0070700_100408758 3300005441 Bacteria 1023
85 Ga0070700_100649848 3300005441 Bacteria 833
86 Ga0070694_100331235 3300005444 Bacteria 1174
87 Ga0070708_100063831 3300005445 Bacteria 3298
88 Ga0070708_100967280 3300005445 Bacteria 799
89 Ga0070663_100003281 3300005455 Bacteria 9317
90 Ga0070663_100412935 3300005455 Bacteria 1106
91 Ga0070678_100093252 3300005456 Bacteria 2315
92 Ga0070678_100348480 3300005456 Bacteria 1272
93 Ga0070678_100422332 3300005456 Bacteria 1162
94 Ga0070662_100008348 3300005457 Bacteria 6748
95 Ga0070662_100008670 3300005457 Bacteria 6634
96 Ga0070662_100014538 3300005457 Bacteria 5262
97 Ga0070662_100158527 3300005457 Bacteria 1768
98 Ga0070662_100348048 3300005457 Bacteria 1213
99 Ga0070662_100815651 3300005457 Bacteria 794
100 Ga0070681_10099116 3300005458 Bacteria 2860
101 Ga0070681_11005679 3300005458 Bacteria 754
102 Ga0068867_100150509 3300005459 Bacteria 1827
103 Ga0068867_100532558 3300005459 Bacteria 1015
104 Ga0068867_100625785 3300005459 Bacteria 942
105 Ga0068867_100783942 3300005459 Bacteria 848
106 Ga0070685_10028648 3300005466 Bacteria 3088
107 Ga0070685_10546974 3300005466 Bacteria 826
108 Ga0070706_100004486 3300005467 Bacteria 13456
109 Ga0070707_100168314 3300005468 Bacteria 2135
110 Ga0070707_100771912 3300005468 Bacteria 925
111 Ga0070698_100138790 3300005471 Bacteria 2384
112 Ga0070679_100043614 3300005530 Bacteria 4466
113 Ga0070679_100238522 3300005530 Bacteria 1776
114 Ga0070684_100189437 3300005535 Bacteria 1871
115 Ga0070684_100462816 3300005535 Bacteria 1173
116 Ga0068853_100089752 3300005539 Bacteria 2700
117 Ga0068853_100144299 3300005539 Bacteria 2138
118 Ga0068853_100282685 3300005539 Bacteria 1530
119 Ga0068853_100378525 3300005539 Bacteria 1321
120 Ga0070672_100046096 3300005543 Bacteria 3376
121 Ga0070672_100614549 3300005543 Bacteria 947
122 Ga0070686_100271624 3300005544 Bacteria 1247
123 Ga0070693_100104913 3300005547 Bacteria 1728
124 Ga0070693_100117118 3300005547 Bacteria 1648
125 Ga0070665_100135161 3300005548 Bacteria 2468
126 Ga0070665_100188616 3300005548 Bacteria 2063
127 Ga0068855_100472735 3300005563 Bacteria 1365
128 Ga0068855_100637779 3300005563 Bacteria 1145
129 Ga0070664_100121932 3300005564 Bacteria 2283
130 Ga0068857_100114500 3300005577 Bacteria 2425
131 Ga0068857_100169087 3300005577 Bacteria 1986
132 Ga0068857_100262457 3300005577 Bacteria 1585
133 Ga0068857_100707434 3300005577 Bacteria 957
134 Ga0068854_100143670 3300005578 Bacteria 1834
135 Ga0068854_100199615 3300005578 Bacteria 1572
136 Ga0068854_100371822 3300005578 Bacteria 1176
137 Ga0068856_100006466 3300005614 Bacteria 11493
138 Ga0068856_100218424 3300005614 Bacteria 1921
139 Ga0070702_100451528 3300005615 Bacteria 932
140 Ga0068852_100050955 3300005616 Bacteria 3550
141 Ga0068852_100069007 3300005616 Bacteria 3096
142 Ga0068852_100135132 3300005616 Bacteria 2276
143 Ga0068852_100190849 3300005616 Bacteria 1933
144 Ga0068852_100551033 3300005616 Bacteria 1153
145 Ga0068852_101134046 3300005616 Bacteria 802
146 Ga0068859_100178882 3300005617 Bacteria 2203
147 Ga0068859_100291228 3300005617 Bacteria 1726
148 Ga0068859_100704282 3300005617 Bacteria 1100
149 Ga0068859_100980946 3300005617 Bacteria 927
150 Ga0068859_101161779 3300005617 Bacteria 850
151 Ga0068864_100008283 3300005618 Bacteria 8574
152 Ga0068864_100591991 3300005618 Bacteria 1075
153 Ga0068864_101070383 3300005618 Bacteria 802
154 Ga0068866_10022876 3300005718 Bacteria 2899
155 Ga0068866_10520103 3300005718 Bacteria 791
156 Ga0068861_100007969 3300005719 Bacteria 7292
157 Ga0068861_100128984 3300005719 Bacteria 2050
158 Ga0068861_100169480 3300005719 Bacteria 1808
159 Ga0068861_101125370 3300005719 Bacteria 756
160 Ga0068861_101397726 3300005719 Bacteria 683
161 Ga0068851_10023499 3300005834 Bacteria 3014
162 Ga0068851_10518759 3300005834 Bacteria 716
163 Ga0068870_10227233 3300005840 Bacteria 1145
164 Ga0068870_10297558 3300005840 Bacteria 1017
165 Ga0068863_100024285 3300005841 Bacteria 5781
166 Ga0068863_100372012 3300005841 Bacteria 1394
167 Ga0068863_100377215 3300005841 Bacteria 1384
168 Ga0068858_100001818 3300005842 Bacteria 21717
169 Ga0068858_100009355 3300005842 Bacteria 9357
170 Ga0068858_100425093 3300005842 Bacteria 1278
171 Ga0068860_100001009 3300005843 Bacteria 31175
172 Ga0068860_100057253 3300005843 Bacteria 3705
173 Ga0068860_100317511 3300005843 Bacteria 1529
174 Ga0068860_100537904 3300005843 Bacteria 1169
175 Ga0068860_100878965 3300005843 Bacteria 912
176 Ga0068860_101969729 3300005843 Bacteria 606
177 Ga0068862_100016575 3300005844 Bacteria 6136
178 Ga0068862_100028605 3300005844 Bacteria 4695
179 Ga0068862_100234000 3300005844 Bacteria 1668
180 Ga0068862_101144648 3300005844 Bacteria 775
181 Ga0068862_102487988 3300005844 Bacteria 529
182 Ga0075365_10315211 3300006038 Bacteria 1101
183 Ga0075363_100073012 3300006048 Bacteria 1866
184 Ga0075363_100354009 3300006048 Bacteria 858
185 Ga0075364_10567811 3300006051 Bacteria 775
186 Ga0075432_10262376 3300006058 Bacteria 705
187 Ga0070715_10030856 3300006163 Bacteria 2171
188 Ga0070716_100426462 3300006173 Bacteria 960
189 Ga0075362_10107294 3300006177 Bacteria 1312
190 Ga0075362_10111955 3300006177 Bacteria 1285
191 Ga0075367_10015588 3300006178 Bacteria 4137
192 Ga0075367_10051425 3300006178 Bacteria 2435
193 Ga0075369_10013367 3300006186 Bacteria 3258
194 Ga0075369_10273240 3300006186 Bacteria 786
195 Ga0075366_10002085 3300006195 Bacteria 10151
196 Ga0075366_10005265 3300006195 Bacteria 7007
197 Ga0075366_10025896 3300006195 Bacteria 3431
198 Ga0075366_10111259 3300006195 Bacteria 1647
199 Ga0075366_10114569 3300006195 Bacteria 1623
200 Ga0075366_10134099 3300006195 Bacteria 1495
201 Ga0075366_10178739 3300006195 Bacteria 1289
202 Ga0075366_10722505 3300006195 Bacteria 619
203 Ga0097621_100901532 3300006237 Bacteria 823
204 Ga0075370_10000524 3300006353 Bacteria 14643
205 Ga0075370_10015599 3300006353 Bacteria 4070
206 Ga0075370_10046189 3300006353 Bacteria 2464
207 Ga0075370_10072039 3300006353 Bacteria 1978
208 Ga0075370_10080520 3300006353 Bacteria 1871
209 Ga0075370_10131310 3300006353 Bacteria 1461
210 Ga0075370_10154210 3300006353 Bacteria 1346
211 Ga0075370_10185102 3300006353 Bacteria 1226
212 Ga0075370_10531865 3300006353 Bacteria 710
213 Ga0075370_10553542 3300006353 Bacteria 696
214 Ga0068871_100692803 3300006358 Bacteria 933
215 Ga0068871_100888264 3300006358 Bacteria 825
216 Ga0075430_100023009 3300006846 Bacteria 5300
217 Ga0075429_100008966 3300006880 Bacteria 8689
218 Ga0068865_100458277 3300006881 Bacteria 1056
219 Ga0068865_101393966 3300006881 Bacteria 626
220 Ga0097620_100178887 3300006931 Bacteria 2203
221 Ga0097620_100291221 3300006931 Bacteria 1726
222 Ga0097620_100704274 3300006931 Bacteria 1100
223 Ga0097620_100980990 3300006931 Bacteria 927
224 Ga0097620_101161493 3300006931 Bacteria 850
225 Ga0079104_1000530 3300006946 Bacteria 40514
226 Ga0075435_100518518 3300007076 Bacteria 1031
227 Ga0105244_10242759 3300009036 Bacteria 841
228 Ga0105244_10333384 3300009036 Bacteria 700
229 Ga0105240_10002903 3300009093 Bacteria 27043
230 Ga0105240_10039246 3300009093 Bacteria 6065
231 Ga0105240_10221428 3300009093 Bacteria 2204
232 Ga0105240_10303100 3300009093 Bacteria 1827
233 Ga0105240_10456133 3300009093 Bacteria 1429
234 Ga0111539_11293384 3300009094 Bacteria 846
235 Ga0105245_10008631 3300009098 Bacteria 8888
236 Ga0105245_10281211 3300009098 Bacteria 1626
237 Ga0105245_10295690 3300009098 Bacteria 1587
238 Ga0114129_11533893 3300009147 Bacteria 818
239 Ga0114129_13059471 3300009147 Bacteria 548
240 Ga0105243_10008894 3300009148 Bacteria 7680
241 Ga0105243_10083870 3300009148 Bacteria 2608
242 Ga0105243_10098021 3300009148 Bacteria 2427
243 Ga0105243_10195115 3300009148 Bacteria 1772
244 Ga0105243_12100113 3300009148 Bacteria 601
245 Ga0105241_10165192 3300009174 Bacteria 1823
246 Ga0105241_10254402 3300009174 Bacteria 1490
247 Ga0105241_10858465 3300009174 Bacteria 840
248 Ga0105241_11123466 3300009174 Bacteria 741
249 Ga0105242_10002491 3300009176 Bacteria 14439
250 Ga0105242_10246410 3300009176 Bacteria 1608
251 Ga0105242_10670637 3300009176 Bacteria 1011
252 Ga0105242_10714194 3300009176 Bacteria 982
253 Ga0105242_11873087 3300009176 Bacteria 640
254 Ga0105248_10119484 3300009177 Bacteria 2973
255 Ga0105248_10176473 3300009177 Bacteria 2407
256 Ga0105237_10000605 3300009545 Bacteria 50037
257 Ga0105237_10014977 3300009545 Bacteria 8082
258 Ga0105237_10024647 3300009545 Bacteria 6153
259 Ga0105237_10359953 3300009545 Bacteria 1459
260 Ga0105237_10436478 3300009545 Bacteria 1315
261 Ga0105238_10131727 3300009551 Bacteria 2479
262 Ga0105238_10209691 3300009551 Bacteria 1924
263 Ga0105238_10259041 3300009551 Bacteria 1718
264 Ga0105238_10270280 3300009551 Bacteria 1681
265 Ga0105249_10034828 3300009553 Bacteria 4564
266 Ga0105249_10325198 3300009553 Bacteria 1550
267 Ga0105239_10000328 3300010375 Bacteria 70165
268 Ga0105239_10114097 3300010375 Bacteria 2997
269 Ga0105239_10192752 3300010375 Bacteria 2281
270 Ga0105246_10180369 3300011119 Bacteria 1625
271 Ga0157317_1007403 3300012475 Bacteria 787
272 Ga0157328_1012916 3300012478 Bacteria 613
273 Ga0157318_1003919 3300012482 Bacteria 885
274 Ga0157342_1031791 3300012507 Bacteria 668
275 Ga0157316_1016460 3300012510 Bacteria 760
276 Ga0157327_1006028 3300012512 Bacteria 1006
277 Ga0157371_10119053 3300013102 Bacteria 1877
278 Ga0157371_10161212 3300013102 Bacteria 1602
279 Ga0157369_10066867 3300013105 Bacteria 3866
280 Ga0157369_10106282 3300013105 Bacteria 2987
281 Ga0157369_10255279 3300013105 Bacteria 1829
282 Ga0157374_10007375 3300013296 Bacteria 9379
283 Ga0157374_10047442 3300013296 Bacteria 3983
284 Ga0157374_10423933 3300013296 Bacteria 1329
285 Ga0157374_10945256 3300013296 Bacteria 880
286 Ga0157378_10438143 3300013297 Bacteria 1295
287 Ga0163162_10244035 3300013306 Bacteria 1928
288 Ga0163162_10317266 3300013306 Bacteria 1691
289 Ga0163162_10361146 3300013306 Bacteria 1585
290 Ga0163162_10550524 3300013306 Bacteria 1282
291 Ga0163162_11193545 3300013306 Bacteria 863
292 Ga0157372_10010263 3300013307 Bacteria 9948
293 Ga0157372_10052780 3300013307 Bacteria 4528
294 Ga0157372_10371558 3300013307 Bacteria 1666
295 Ga0157375_10024076 3300013308 Bacteria 5629
296 Ga0157375_10163285 3300013308 Bacteria 2371
297 Ga0157375_10275572 3300013308 Bacteria 1845
298 Ga0157375_10387116 3300013308 Bacteria 1565
299 Ga0157375_12202274 3300013308 Bacteria 657
300 Ga0157380_10110834 3300014326 Bacteria 2306
301 Ga0157380_10116060 3300014326 Bacteria 2259
302 Ga0157380_10961560 3300014326 Bacteria 885
303 Ga0157380_11770187 3300014326 Bacteria 676
304 Ga0182008_10446782 3300014497 Bacteria 702
305 Ga0157377_10053913 3300014745 Bacteria 2275
306 Ga0157377_10480155 3300014745 Bacteria 864
307 Ga0157379_10031084 3300014968 Bacteria 4757
308 Ga0157379_10297734 3300014968 Bacteria 1470
309 Ga0157379_10331511 3300014968 Bacteria 1391
310 Ga0157376_10029275 3300014969 Bacteria 4387
311 Ga0157376_10100852 3300014969 Bacteria 2522
312 Ga0157376_10119790 3300014969 Bacteria 2331
313 Ga0157376_10249929 3300014969 Bacteria 1656
314 Ga0157376_10428805 3300014969 Bacteria 1285
315 Ga0157376_11694049 3300014969 Bacteria 667
316 Ga0182006_1179880 3300015261 Bacteria 706
317 Ga0182005_1099118 3300015265 Bacteria 815
318 Ga0163161_10234871 3300017792 Bacteria 1424
319 Ga0163161_10569870 3300017792 Bacteria 930
320 Ga0163161_11004975 3300017792 Bacteria 712
321 Ga0163161_11226008 3300017792 Bacteria 649
322 Ga0206353_11133087 3300020082 Bacteria 1345
323 Ga0213872_10000070 3300021361 Bacteria 91519
324 Ga0213872_10000161 3300021361 Bacteria 61406
325 Ga0213872_10009666 3300021361 Bacteria 4617
326 Ga0213874_10208777 3300021377 Bacteria 705
327 Ga0213876_10032219 3300021384 Bacteria 2765
328 Ga0209784_100284 3300025224 Bacteria 28522
329 Ga0209566_100262 3300025225 Bacteria 49481
330 Ga0209674_100039 3300025226 Bacteria 402292
331 Ga0209674_100200 3300025226 Bacteria 61971
332 Ga0209674_110264 3300025226 Bacteria 1004
333 Ga0209672_102750 3300025228 Bacteria 4055
334 Ga0209563_100005 3300025230 Bacteria 1774893
335 Ga0209563_100110 3300025230 Bacteria 142518
336 Ga0209563_113405 3300025230 Bacteria 1082
337 Ga0207427_100388 3300025231 Bacteria 26461
338 Ga0209258_100305 3300025242 Bacteria 78801
339 Ga0209258_100567 3300025242 Bacteria 31694
340 Ga0209646_1000046 3300025246 Bacteria 332737
341 Ga0209646_1000231 3300025246 Bacteria 59119
342 Ga0209026_1000011 3300025250 Bacteria 507291
343 Ga0209026_1006887 3300025250 Bacteria 2677
344 Ga0209677_100246 3300025253 Bacteria 37119
345 Ga0209677_103365 3300025253 Bacteria 5246
346 Ga0209677_109922 3300025253 Bacteria 1647
347 Ga0209148_1000110 3300025254 Bacteria 203536
348 Ga0209148_1012339 3300025254 Bacteria 1565
349 Ga0209759_1000107 3300025256 Bacteria 147025
350 Ga0209759_1001067 3300025256 Bacteria 18006
351 Ga0209759_1004020 3300025256 Bacteria 5635
352 Ga0209759_1006693 3300025256 Bacteria 3829
353 Ga0209759_1021621 3300025256 Bacteria 1458
354 Ga0207666_1025448 3300025271 Bacteria 887
355 Ga0209455_1000053 3300025272 Bacteria 365949
356 Ga0209564_1000051 3300025295 Bacteria 357748
357 Ga0209051_1002180 3300025303 Bacteria 14504
358 Ga0209051_1004175 3300025303 Bacteria 9023
359 Ga0209051_1007173 3300025303 Bacteria 6139
360 Ga0209257_1000182 3300025304 Bacteria 156672
361 Ga0207697_10158672 3300025315 Bacteria 986
362 Ga0207656_10008176 3300025321 Bacteria 3839
363 Ga0207656_10027048 3300025321 Bacteria 2343
364 Ga0207656_10051038 3300025321 Bacteria 1788
365 Ga0207656_10077488 3300025321 Bacteria 1488
366 Ga0207682_10008487 3300025893 Bacteria 4061
367 Ga0207682_10014215 3300025893 Bacteria 3101
368 Ga0207682_10067933 3300025893 Bacteria 1505
369 Ga0207642_10006194 3300025899 Bacteria 3963
370 Ga0207642_10097420 3300025899 Bacteria 1468
371 Ga0207642_10444082 3300025899 Bacteria 785
372 Ga0207710_10016404 3300025900 Bacteria 3132
373 Ga0207680_10002216 3300025903 Bacteria 9082
374 Ga0207647_10678529 3300025904 Bacteria 563
375 Ga0207643_10137116 3300025908 Bacteria 1459
376 Ga0207705_10253094 3300025909 Bacteria 1343
377 Ga0207705_10303962 3300025909 Bacteria 1224
378 Ga0207705_11273526 3300025909 Bacteria 562
379 Ga0207684_10005949 3300025910 Bacteria 11169
380 Ga0207654_10079428 3300025911 Bacteria 1971
381 Ga0207654_10151752 3300025911 Bacteria 1488
382 Ga0207707_10517732 3300025912 Bacteria 1016
383 Ga0207707_10658507 3300025912 Bacteria 882
384 Ga0207695_10002543 3300025913 Bacteria 26790
385 Ga0207695_10061905 3300025913 Bacteria 3866
386 Ga0207695_10088943 3300025913 Bacteria 3107
387 Ga0207671_10006429 3300025914 Bacteria 10462
388 Ga0207671_10035144 3300025914 Bacteria 3721
389 Ga0207671_10074449 3300025914 Bacteria 2538
390 Ga0207671_10074506 3300025914 Bacteria 2537
391 Ga0207671_10125132 3300025914 Bacteria 1968
392 Ga0207657_10012263 3300025919 Bacteria 8467
393 Ga0207657_10135699 3300025919 Bacteria 2014
394 Ga0207657_10258321 3300025919 Bacteria 1387
395 Ga0207649_10061744 3300025920 Bacteria 2360
396 Ga0207649_10063794 3300025920 Bacteria 2327
397 Ga0207652_10068430 3300025921 Bacteria 3081
398 Ga0207646_10067554 3300025922 Bacteria 3191
399 Ga0207681_10000795 3300025923 Bacteria 20798
400 Ga0207681_10109921 3300025923 Bacteria 2003
401 Ga0207694_10014757 3300025924 Bacteria 5890
402 Ga0207694_10072140 3300025924 Bacteria 2699
403 Ga0207694_10177669 3300025924 Bacteria 1725
404 Ga0207694_10256685 3300025924 Bacteria 1431
405 Ga0207694_10923096 3300025924 Bacteria 738
406 Ga0207650_10004501 3300025925 Bacteria 9532
407 Ga0207650_10102612 3300025925 Bacteria 2204
408 Ga0207659_10032887 3300025926 Bacteria 3563
409 Ga0207659_10104518 3300025926 Bacteria 2142
410 Ga0207659_10168680 3300025926 Bacteria 1725
411 Ga0207687_10360110 3300025927 Bacteria 1187
412 Ga0207687_10444166 3300025927 Bacteria 1075
413 Ga0207687_11180693 3300025927 Bacteria 658
414 Ga0207700_10933047 3300025928 Bacteria 777
415 Ga0207644_10024225 3300025931 Bacteria 4164
416 Ga0207644_10041723 3300025931 Bacteria 3248
417 Ga0207644_10866837 3300025931 Bacteria 756
418 Ga0207644_11044440 3300025931 Bacteria 686
419 Ga0207690_10201068 3300025932 Bacteria 1513
420 Ga0207690_10620346 3300025932 Bacteria 884
421 Ga0207690_10713146 3300025932 Bacteria 825
422 Ga0207706_10007829 3300025933 Bacteria 9862
423 Ga0207706_10014450 3300025933 Bacteria 7156
424 Ga0207706_10212182 3300025933 Bacteria 1697
425 Ga0207706_10502664 3300025933 Bacteria 1046
426 Ga0207706_10531508 3300025933 Bacteria 1013
427 Ga0207686_10015629 3300025934 Bacteria 4246
428 Ga0207686_10047390 3300025934 Bacteria 2657
429 Ga0207686_10252318 3300025934 Bacteria 1290
430 Ga0207709_10000622 3300025935 Bacteria 29028
431 Ga0207709_10030033 3300025935 Bacteria 3158
432 Ga0207709_10150093 3300025935 Bacteria 1613
433 Ga0207709_10301342 3300025935 Bacteria 1192
434 Ga0207709_10895454 3300025935 Bacteria 721
435 Ga0207709_10963796 3300025935 Bacteria 696
436 Ga0207670_10038375 3300025936 Bacteria 3128
437 Ga0207669_10245980 3300025937 Bacteria 1328
438 Ga0207704_10087739 3300025938 Bacteria 2033
439 Ga0207704_10192902 3300025938 Bacteria 1483
440 Ga0207704_10763262 3300025938 Bacteria 805
441 Ga0207704_10777717 3300025938 Bacteria 798
442 Ga0207704_11009317 3300025938 Bacteria 704
443 Ga0207665_10082203 3300025939 Bacteria 2219
444 Ga0207691_10012093 3300025940 Bacteria 8276
445 Ga0207691_10026402 3300025940 Bacteria 5449
446 Ga0207691_10032397 3300025940 Bacteria 4872
447 Ga0207711_10064486 3300025941 Bacteria 3164
448 Ga0207711_10280431 3300025941 Bacteria 1535
449 Ga0207711_10674490 3300025941 Bacteria 964
450 Ga0207711_11641883 3300025941 Bacteria 586
451 Ga0207689_10016046 3300025942 Bacteria 6341
452 Ga0207689_10050658 3300025942 Bacteria 3423
453 Ga0207689_10515849 3300025942 Bacteria 1002
454 Ga0207689_10530271 3300025942 Bacteria 988
455 Ga0207661_10140288 3300025944 Bacteria 2079
456 Ga0207661_11211799 3300025944 Bacteria 694
457 Ga0207679_10213629 3300025945 Bacteria 1619
458 Ga0207679_10869504 3300025945 Bacteria 824
459 Ga0207679_10898806 3300025945 Bacteria 810
460 Ga0207679_11210253 3300025945 Bacteria 693
461 Ga0207667_10578190 3300025949 Bacteria 1134
462 Ga0207667_11566063 3300025949 Bacteria 628
463 Ga0207651_10006629 3300025960 Bacteria 6085
464 Ga0207651_10029434 3300025960 Bacteria 3479
465 Ga0207651_10032300 3300025960 Bacteria 3360
466 Ga0207668_10017712 3300025972 Bacteria 4469
467 Ga0207668_10117687 3300025972 Bacteria 2006
468 Ga0207668_10126010 3300025972 Bacteria 1947
469 Ga0207640_10300170 3300025981 Bacteria 1270
470 Ga0207658_10001151 3300025986 Bacteria 21193
471 Ga0207658_10005593 3300025986 Bacteria 8597
472 Ga0207658_10015284 3300025986 Bacteria 5266
473 Ga0207658_10270165 3300025986 Bacteria 1453
474 Ga0207658_10280466 3300025986 Bacteria 1428
475 Ga0207658_10431244 3300025986 Bacteria 1164
476 Ga0207658_10442197 3300025986 Bacteria 1150
477 Ga0207658_11917371 3300025986 Bacteria 540
478 Ga0207677_10000452 3300026023 Bacteria 27626
479 Ga0207677_10060276 3300026023 Bacteria 2622
480 Ga0207677_10076815 3300026023 Bacteria 2379
481 Ga0207677_10161657 3300026023 Bacteria 1741
482 Ga0207677_10316529 3300026023 Bacteria 1295
483 Ga0207703_10001999 3300026035 Bacteria 17992
484 Ga0207703_10003262 3300026035 Bacteria 13624
485 Ga0207703_10988454 3300026035 Bacteria 807
486 Ga0207639_10117039 3300026041 Bacteria 2183
487 Ga0207639_10321962 3300026041 Bacteria 1373
488 Ga0207639_10634287 3300026041 Bacteria 988
489 Ga0207639_11591719 3300026041 Bacteria 613
490 Ga0207678_10002363 3300026067 Bacteria 17106
491 Ga0207678_10969347 3300026067 Bacteria 752
492 Ga0207708_10098042 3300026075 Bacteria 2266
493 Ga0207708_10785822 3300026075 Bacteria 819
494 Ga0207702_10001232 3300026078 Bacteria 25871
495 Ga0207702_10044080 3300026078 Bacteria 3748
496 Ga0207702_10212232 3300026078 Bacteria 1800
497 Ga0207641_10026325 3300026088 Bacteria 4799
498 Ga0207641_10038644 3300026088 Bacteria 3990
499 Ga0207641_10259863 3300026088 Bacteria 1625
500 Ga0207648_10039788 3300026089 Bacteria 4133
501 Ga0207648_10135139 3300026089 Bacteria 2172
502 Ga0207648_10554081 3300026089 Bacteria 1056
503 Ga0207648_10571403 3300026089 Bacteria 1040
504 Ga0207676_10042218 3300026095 Bacteria 3506
505 Ga0207676_10047914 3300026095 Bacteria 3314
506 Ga0207676_10131378 3300026095 Bacteria 2129
507 Ga0207676_10803623 3300026095 Bacteria 918
508 Ga0207676_11149406 3300026095 Bacteria 768
509 Ga0207674_10009428 3300026116 Bacteria 11151
510 Ga0207674_10018142 3300026116 Bacteria 7656
511 Ga0207674_10078389 3300026116 Bacteria 3309
512 Ga0207674_10164152 3300026116 Bacteria 2175
513 Ga0207674_10403467 3300026116 Bacteria 1321
514 Ga0207675_100059119 3300026118 Bacteria 3577
515 Ga0207675_100105634 3300026118 Bacteria 2655
516 Ga0207675_100289505 3300026118 Bacteria 1593
517 Ga0207683_10058177 3300026121 Bacteria 3394
518 Ga0207683_10112158 3300026121 Bacteria 2442
519 Ga0207683_10114109 3300026121 Bacteria 2420
520 Ga0207683_10228875 3300026121 Bacteria 1695
521 Ga0207683_10408580 3300026121 Bacteria 1249
522 Ga0207683_10420167 3300026121 Bacteria 1231
523 Ga0207683_11252312 3300026121 Bacteria 687
524 Ga0207698_10138978 3300026142 Bacteria 2089
525 Ga0207698_10185317 3300026142 Bacteria 1848
526 Ga0207698_10238217 3300026142 Bacteria 1656
527 Ga0207698_10293860 3300026142 Bacteria 1509
528 Ga0207698_11727152 3300026142 Bacteria 641
529 Ga0209281_1000599 3300027111 Bacteria 41033
530 Ga0209996_1018868 3300027395 Bacteria 960
531 Ga0209984_1008262 3300027424 Bacteria 1307
532 Ga0209995_1003267 3300027471 Bacteria 2583
533 Ga0209968_1000140 3300027526 Bacteria 12794
534 Ga0209971_1008084 3300027682 Bacteria 2497
535 Ga0209971_1073590 3300027682 Bacteria 830
536 Ga0209966_1000388 3300027695 Bacteria 13148
537 Ga0209998_10112518 3300027717 Bacteria 681
538 Ga0209974_10000798 3300027876 Bacteria 10761
539 Ga0209974_10006661 3300027876 Bacteria 4017
540 Ga0268266_10037082 3300028379 Bacteria 4153
541 Ga0268266_10114139 3300028379 Bacteria 2397
542 Ga0268266_10264699 3300028379 Bacteria 1594
543 Ga0268266_11420590 3300028379 Bacteria 669
544 Ga0268265_10013319 3300028380 Bacteria 5587
545 Ga0268265_10020524 3300028380 Bacteria 4611
546 Ga0268265_10344464 3300028380 Bacteria 1358
547 Ga0268265_10545046 3300028380 Bacteria 1100
548 Ga0268265_12584540 3300028380 Bacteria 513
549 Ga0268264_10003920 3300028381 Bacteria 12743
550 Ga0268264_10248183 3300028381 Bacteria 1652
551 Ga0268264_10357684 3300028381 Bacteria 1392
552 Ga0268264_10371900 3300028381 Bacteria 1366
553 Ga0265334_10167671 3300028573 Bacteria 770
554 Ga0265336_10000022 3300028666 Bacteria 192716
555 Ga0307517_10026165 3300028786 Bacteria 7086
556 Ga0307517_10182036 3300028786 Bacteria 1354
557 Ga0307515_10000165 3300028794 Bacteria 162589
558 Ga0307515_10000188 3300028794 Bacteria 151439
559 Ga0307515_10000232 3300028794 Bacteria 137778
560 Ga0307515_10003451 3300028794 Bacteria 33263
561 Ga0307515_10007649 3300028794 Bacteria 21312
562 Ga0307515_10009711 3300028794 Bacteria 18549
563 Ga0307515_10049534 3300028794 Bacteria 6315
564 Ga0307515_10208140 3300028794 Bacteria 1809
565 Ga0265324_10000645 3300029957 Bacteria 23682
566 Ga0307512_10030983 3300030522 Bacteria 4642
567 Ga0307512_10166710 3300030522 Bacteria 1274
568 Ga0265330_10000045 3300031235 Bacteria 109977
569 Ga0265332_10000031 3300031238 Bacteria 162330
570 Ga0265332_10000187 3300031238 Bacteria 50563
571 Ga0265325_10003774 3300031241 Bacteria 9777
572 Ga0265340_10137053 3300031247 Bacteria 1120
573 Ga0265316_10000181 3300031344 Bacteria 71764
574 Ga0307513_10043401 3300031456 Bacteria 4938
575 Ga0307513_10065125 3300031456 Bacteria 3835
576 Ga0307513_10070103 3300031456 Bacteria 3666
577 Ga0307513_10074895 3300031456 Bacteria 3518
578 Ga0307513_10285307 3300031456 Bacteria 1426
579 Ga0307513_10365268 3300031456 Bacteria 1187
580 Ga0307513_10513456 3300031456 Bacteria 914
581 Ga0307513_10646326 3300031456 Bacteria 765
582 Ga0307513_10708444 3300031456 Bacteria 712
583 Ga0307509_10003083 3300031507 Bacteria 25889
584 Ga0307509_10125033 3300031507 Bacteria 2540
585 Ga0307509_10162846 3300031507 Bacteria 2124
586 Ga0307509_10165756 3300031507 Bacteria 2099
587 Ga0307509_10717002 3300031507 Bacteria 666
588 Ga0307408_100000096 3300031548 Bacteria 97068
589 Ga0307408_100008311 3300031548 Bacteria 6853
590 Ga0307408_100039931 3300031548 Bacteria 3321
591 Ga0307408_100278466 3300031548 Bacteria 1392
592 Ga0307408_101739835 3300031548 Bacteria 595
593 Ga0307508_10000016 3300031616 Bacteria 206976
594 Ga0307508_10001467 3300031616 Bacteria 26444
595 Ga0307508_10273389 3300031616 Bacteria 1283
596 Ga0307508_10743441 3300031616 Bacteria 593
597 Ga0307514_10000711 3300031649 Bacteria 57628
598 Ga0307514_10037190 3300031649 Bacteria 3862
599 Ga0307514_10106657 3300031649 Bacteria 1997
600 Ga0307514_10119814 3300031649 Bacteria 1839
601 Ga0307514_10183502 3300031649 Bacteria 1345
602 Ga0265314_10001461 3300031711 Bacteria 26354
603 Ga0307516_10004400 3300031730 Bacteria 17413
604 Ga0307516_10005959 3300031730 Bacteria 14408
605 Ga0307516_10024129 3300031730 Bacteria 6216
606 Ga0307516_10074947 3300031730 Bacteria 3238
607 Ga0307516_10128425 3300031730 Bacteria 2317
608 Ga0307516_10422311 3300031730 Bacteria 991
609 Ga0307516_10600477 3300031730 Bacteria 755
610 Ga0307405_10021832 3300031731 Bacteria 3606
611 Ga0307405_10027461 3300031731 Bacteria 3300
612 Ga0307405_11375715 3300031731 Bacteria 616
613 Ga0307413_10699676 3300031824 Bacteria 842
614 Ga0307410_10980208 3300031852 Bacteria 728
615 Ga0307406_10000669 3300031901 Bacteria 19388
616 Ga0307406_10125933 3300031901 Bacteria 1790
617 Ga0307406_10208539 3300031901 Bacteria 1444
618 Ga0307406_10998736 3300031901 Bacteria 718
619 Ga0307407_10680368 3300031903 Bacteria 773
620 Ga0307412_10118366 3300031911 Bacteria 1903
621 Ga0307412_11546777 3300031911 Bacteria 604
622 Ga0307409_100001314 3300031995 Bacteria 12044
623 Ga0307409_100049671 3300031995 Bacteria 3200
624 Ga0307409_102495383 3300031995 Bacteria 546
625 Ga0307416_100087114 3300032002 Bacteria 2665
626 Ga0307416_100430129 3300032002 Bacteria 1367
627 Ga0307416_101239349 3300032002 Bacteria 852
628 Ga0307416_102567805 3300032002 Bacteria 607
629 Ga0307414_10195884 3300032004 Bacteria 1639
630 Ga0307414_10557851 3300032004 Bacteria 1022
631 Ga0307411_10108135 3300032005 Bacteria 1983
632 Ga0307415_100105962 3300032126 Bacteria 2074
633 Ga0307507_10177933 3300033179 Bacteria 1527
634 Ga0307507_10423621 3300033179 Bacteria 746
635 Ga0307510_10076751 3300033180 Bacteria 3283
636 Ga0373948_0056722 3300034817 Bacteria 852
637 Ga0373959_0026264 3300034820 Bacteria 1150
638 Ga0373938_0044718 3300034957 Bacteria 995
639 Ga0373928_0028805 3300035084 Bacteria 1217
640 Ga0373944_0118979 3300035089 Bacteria 909
641 Ga0373944_0154759 3300035089 Bacteria 810
642 Ga0373951_0274210 3300035091 Bacteria 513
643 Ga0373952_0028043 3300035092 Bacteria 1233
644 Ga0373932_0107511 3300035112 Bacteria 915
645 Ga0373939_0146702 3300035114 Bacteria 855
646 Ga0373939_0193460 3300035114 Bacteria 765
647 Ga0373939_0422373 3300035114 Bacteria 556
648 Ga0373953_0358069 3300035117 Bacteria 640
649 Ga0373956_0359184 3300035119 Bacteria 695
650 Ga0373957_0379102 3300035120 Bacteria 607
651 Ga0373943_0040156 3300035170 Bacteria 2259
652 Ga0373946_0108813 3300035171 Bacteria 1252
653 Ga0373946_0270935 3300035171 Bacteria 833
654 Ga0373946_0402877 3300035171 Bacteria 691
655 Ga0373955_0193714 3300035172 Bacteria 1209
656 Ga0373942_0063294 3300035207 Bacteria 1065
657 Ga0373942_0068303 3300035207 Bacteria 1032
658 Ga0373962_0249575 3300035242 Bacteria 616
659 Ga0373924_0544435 3300035410 Bacteria 522
660 Ga0373931_0015184 3300035691 Bacteria 3775
661 Ga0373931_0062197 3300035691 Bacteria 2015
662 Ga0373931_0223677 3300035691 Bacteria 1134
663 Ga0373931_0723441 3300035691 Bacteria 659
664 Ga0373927_0076004 3300035695 Bacteria 2175
665 Ga0373927_0359500 3300035695 Bacteria 960
666 Ga0373927_0741036 3300035695 Bacteria 649
667 Ga0373933_0295202 3300035724 Bacteria 1049
668 Ga0373947_0184495 3300035725 Bacteria 1359
669 Ga0373947_0363442 3300035725 Bacteria 972
670 Ga0373937_0270688 3300036401 Bacteria 1603
671 Ga0373937_0538404 3300036401 Bacteria 1109
672 Ga0373925_0015098 3300037068 Bacteria 5582
673 Ga0373925_0112972 3300037068 Bacteria 2100
674 Ga0373925_0206197 3300037068 Bacteria 1565
675 Ga0373925_0567951 3300037068 Bacteria 933
676 Ga0395899_0210560 3300037312 Bacteria 1351
677 Ga0395900_0000234 3300037418 Bacteria 87083
678 Ga0395900_0760243 3300037418 Bacteria 899
679 Ga0395898_0002077 3300037466 Bacteria 24918
680 Ga0395898_0008225 3300037466 Bacteria 11030
681 Ga0395905_0002001 3300037471 Bacteria 23293
682 Ga0395905_0011653 3300037471 Bacteria 8490
683 Ga0395905_0297020 3300037471 Bacteria 1502
684 Ga0436364_1272445 3300037853 Bacteria 682
685 Ga0436365_0514532 3300039437 Bacteria 3258
686 Ga0436365_0569739 3300039437 Bacteria 1626
687 Ga0436365_1170591 3300039437 Bacteria 2191
688 Ga0436361_0086324 3300039447 Bacteria 39001
689 Ga0436361_0154722 3300039447 Bacteria 21603
690 Ga0436361_0381246 3300039447 Bacteria 2077
691 Ga0436361_0481133 3300039447 Bacteria 61506
692 Ga0436363_1612144 3300039450 Bacteria 2536
693 Ga0439439_0100189 3300041406 Bacteria 797
694 Ga0439465_0131814 3300041413 Bacteria 883
695 Ga0451787_055325 3300041441 Bacteria 1443
696 Ga0451789_0302159 3300041443 Bacteria 649
697 Ga0451793_1056955 3300041452 Bacteria 1796
698 Ga0451795_0667820 3300041456 Bacteria 797
699 Ga0451800_0542404 3300041459 Bacteria 1181
700 Ga0451802_0517703 3300041460 Bacteria 2677
701 Ga0451807_0187731 3300041486 Bacteria 1533
702 Ga0451837_1086989 3300041494 Bacteria 659
703 Ga0451839_0443244 3300041496 Bacteria 1170
704 Ga0451849_0824555 3300041505 Bacteria 1294
705 Ga0451851_0900736 3300041507 Bacteria 1590
706 Ga0451843_0161326 3300041509 Bacteria 867
707 Ga0451843_0373713 3300041509 Bacteria 1728
708 Ga0451843_0845768 3300041509 Bacteria 780
709 Ga0451855_1365320 3300041511 Bacteria 644
710 Ga0451853_0229046 3300041512 Bacteria 744
711 Ga0451853_2156438 3300041512 Bacteria 1006
712 Ga0451853_3367089 3300041512 Bacteria 1657
713 Ga0439431_0073332 3300041997 Bacteria 915
714 Ga0439450_170667 3300042008 Bacteria 575
715 Ga0450923_024293 3300042125 Bacteria 1201
716 Ga0450890_024208 3300042127 Bacteria 837
717 Ga0450898_014883 3300042134 Bacteria 1312
718 Ga0450898_031288 3300042134 Bacteria 978
719 Ga0450900_022422 3300042136 Bacteria 887
720 Ga0450904_008783 3300042139 Bacteria 997
721 Ga0439446_0117296 3300042156 Bacteria 854
722 Ga0439458_0091746 3300042157 Bacteria 782
723 Ga0451577_0007214 3300042876 Bacteria 10951
724 Ga0451577_0033031 3300042876 Bacteria 4663
725 Ga0451577_0291388 3300042876 Bacteria 1479
726 Ga0451577_0833937 3300042876 Bacteria 832
727 Ga0466969_0009692 3300044656 Bacteria 5106
728 Ga0466969_0037790 3300044656 Bacteria 2433
729 Ga0466969_0058897 3300044656 Bacteria 1868
730 Ga0466972_0001344 3300044658 Bacteria 11923
731 Ga0466965_0017660 3300044683 Bacteria 3413
732 Ga0466965_0074067 3300044683 Bacteria 1715
733 Ga0466965_0262502 3300044683 Bacteria 928
734 Ga0466966_0000754 3300044684 Bacteria 20539
735 Ga0466966_0015315 3300044684 Bacteria 5070
736 Ga0466966_0020475 3300044684 Bacteria 4349
737 Ga0466961_0006410 3300044693 Bacteria 7472
738 Ga0466961_0051128 3300044693 Bacteria 2639
739 Ga0466963_0000935 3300044694 Bacteria 14918
740 Ga0466963_0472979 3300044694 Bacteria 884
741 Ga0466963_0867798 3300044694 Bacteria 636
742 Ga0466964_0003021 3300044706 Bacteria 6099
743 Ga0466964_0011333 3300044706 Bacteria 3366
744 Ga0466964_0056316 3300044706 Bacteria 1625
745 Ga0466964_0293986 3300044706 Bacteria 816
746 Ga0453684_0007748 3300044712 Bacteria 19588
747 Ga0453684_0051049 3300044712 Bacteria 5429
748 Ga0453684_0059811 3300044712 Bacteria 4907
749 Ga0453684_0124246 3300044712 Bacteria 3109
750 Ga0453684_0131943 3300044712 Bacteria 2996
751 Ga0453684_0213283 3300044712 Bacteria 2242
752 Ga0453684_0214562 3300044712 Bacteria 2234
753 Ga0453684_0283535 3300044712 Bacteria 1888
754 Ga0453684_0308719 3300044712 Bacteria 1796
755 Ga0466971_0015912 3300044719 Bacteria 3314
756 Ga0466971_0020029 3300044719 Bacteria 2973
757 Ga0466971_0022228 3300044719 Bacteria 2824
758 Ga0466970_0020698 3300044765 Bacteria 3420
759 Ga0466970_0035508 3300044765 Bacteria 2640
760 Ga0466970_0221817 3300044765 Bacteria 1055
761 Ga0466957_0029903 3300044842 Bacteria 3250
762 Ga0466957_0055711 3300044842 Bacteria 2416
763 Ga0466957_0264742 3300044842 Bacteria 1146
764 Ga0466957_0399742 3300044842 Bacteria 939
765 Ga0466960_0196164 3300044901 Bacteria 1101
766 Ga0466959_0013106 3300045049 Bacteria 6003
767 Ga0466959_0015936 3300045049 Bacteria 5483
768 Ga0466959_0028505 3300045049 Bacteria 4140
769 Ga0451576_0003317 3300045051 Bacteria 22316
770 Ga0451576_0016908 3300045051 Bacteria 8033
771 Ga0451576_0034152 3300045051 Bacteria 5402
772 Ga0451576_0152761 3300045051 Bacteria 2408
773 Ga0451576_0437696 3300045051 Bacteria 1372
774 Ga0451576_0653811 3300045051 Bacteria 1104
775 Ga0451576_0670885 3300045051 Bacteria 1089
776 Ga0451576_1839157 3300045051 Bacteria 625
777 Ga0466958_0043317 3300045836 Bacteria 2710
778 Ga0466958_0080601 3300045836 Bacteria 2002
779 Ga0466967_0021184 3300045976 Bacteria 5272
780 Ga0466967_0333618 3300045976 Bacteria 1465
781 Ga0466967_0501233 3300045976 Bacteria 1191
782 Ga0495592_0000213 3300046454 Bacteria 49631
783 Ga0495603_0211836 3300046455 Bacteria 1119
784 Ga0495590_0084021 3300046457 Bacteria 1122
785 Ga0495629_0040968 3300046459 Bacteria 3259
786 Ga0495638_0224989 3300046460 Bacteria 1047
787 Ga0495641_0082809 3300046461 Bacteria 1437
788 Ga0495650_0002988 3300046471 Bacteria 12804
789 Ga0495650_0030296 3300046471 Bacteria 2453
790 Ga0495650_0103274 3300046471 Bacteria 1068
791 Ga0495582_0335482 3300046473 Bacteria 870
792 Ga0495582_0434731 3300046473 Bacteria 757
793 Ga0495582_0490898 3300046473 Bacteria 710
794 Ga0495639_0054839 3300046475 Bacteria 1817
795 Ga0495639_0185617 3300046475 Bacteria 1014
796 Ga0495584_0352193 3300046491 Bacteria 748
797 Ga0495585_0160372 3300046492 Bacteria 1167
798 Ga0495607_0419577 3300046501 Bacteria 606
799 Ga0495608_0091668 3300046511 Bacteria 1965
800 Ga0495610_0093618 3300046512 Bacteria 1357
801 Ga0495618_0101195 3300046514 Bacteria 1845
802 Ga0495620_0010669 3300046515 Bacteria 4837
803 Ga0495628_0370048 3300046516 Bacteria 1051
804 Ga0495628_0568213 3300046516 Bacteria 813
805 Ga0495630_0104877 3300046517 Bacteria 2140
806 Ga0495630_0227592 3300046517 Bacteria 1424
807 Ga0495632_0010962 3300046519 Bacteria 5318
808 Ga0495632_0386400 3300046519 Bacteria 612
809 Ga0495643_0107067 3300046522 Bacteria 1426
810 Ga0495642_0137448 3300046528 Bacteria 1054
811 Ga0495654_0002282 3300046530 Bacteria 12409
812 Ga0495586_0298009 3300046535 Bacteria 924
813 Ga0495598_0019933 3300046537 Bacteria 1764
814 Ga0495598_0071363 3300046537 Bacteria 1094
815 Ga0495621_0030161 3300046539 Bacteria 1852
816 Ga0495621_0030596 3300046539 Bacteria 1841
817 Ga0495597_0000077 3300046542 Bacteria 85280
818 Ga0495645_0236725 3300046543 Bacteria 1220
819 Ga0495645_0393481 3300046543 Bacteria 884
820 Ga0495645_0402573 3300046543 Bacteria 872
821 Ga0495622_0049976 3300046557 Bacteria 1941
822 Ga0495667_0247823 3300046559 Bacteria 1134
823 Ga0495668_0060772 3300046616 Bacteria 2084
824 Ga0495668_0086062 3300046616 Bacteria 1724
825 Ga0495634_0149197 3300046642 Bacteria 1480
826 Ga0495634_0844929 3300046642 Bacteria 520
827 Ga0495611_0571555 3300046648 Bacteria 511
828 Ga0495625_0002387 3300046660 Bacteria 20399
829 Ga0495625_0021963 3300046660 Bacteria 4900
830 Ga0495659_0329924 3300046664 Bacteria 649
831 Ga0495599_0141643 3300046678 Bacteria 1492
832 Ga0495647_0190483 3300046681 Bacteria 896
833 Ga0495658_0014926 3300046683 Bacteria 3979
834 Ga0495658_0044987 3300046683 Bacteria 2476
835 Ga0495658_0118906 3300046683 Bacteria 1596
836 Ga0495658_0206479 3300046683 Bacteria 1226
837 Ga0495613_0150194 3300046689 Bacteria 1662
838 Ga0495624_0377780 3300046690 Bacteria 851
839 Ga0495670_0027835 3300046691 Bacteria 2802
840 Ga0495670_0193492 3300046691 Bacteria 1076
841 Ga0495670_0401785 3300046691 Bacteria 740
842 Ga0495649_0001371 3300046694 Bacteria 18487
843 Ga0495649_0188822 3300046694 Bacteria 1073
844 Ga0495600_0207944 3300046809 Bacteria 1255
845 Ga0495660_0035861 3300046810 Bacteria 2768
846 Ga0495581_0523836 3300047315 Bacteria 689
847 Ga0495604_0379136 3300047317 Bacteria 935
848 Ga0495674_0161840 3300047319 Bacteria 1872
849 Ga0495676_0078953 3300047321 Bacteria 2504
850 Ga0495680_0048736 3300047322 Bacteria 3325
851 Ga0495687_002064 3300047443 Bacteria 16886
852 Ga0495687_005696 3300047443 Bacteria 7855
853 Ga0495677_0047753 3300047445 Bacteria 1572
854 Ga0495685_234545 3300047447 Bacteria 584
855 Ga0495673_0101795 3300047469 Bacteria 1160
856 Ga0495684_0103716 3300047471 Bacteria 2149
857 Ga0495686_0003802 3300047472 Bacteria 12817
858 Ga0495686_0032063 3300047472 Bacteria 3403
859 Ga0495593_0023044 3300047673 Bacteria 3464
860 Ga0495593_0107975 3300047673 Bacteria 1423
861 Ga0495602_0484990 3300048088 Bacteria 867
862 Ga0495614_0052657 3300048089 Bacteria 1745
863 Ga0495615_0205635 3300048090 Bacteria 609
864 Ga0495626_0048720 3300048091 Bacteria 1965
865 Ga0495626_0228171 3300048091 Bacteria 754
866 Ga0496100_0190731 3300048903 Bacteria 1488
867 Ga0496100_0469849 3300048903 Bacteria 966
868 Ga0496100_0731449 3300048903 Bacteria 773
869 Ga0496101_0008869 3300048904 Bacteria 6584
870 Ga0496101_0771316 3300048904 Bacteria 759
871 Ga0496102_0001355 3300048905 Bacteria 21922
872 Ga0496104_0210094 3300048907 Bacteria 1858
873 Ga0496104_0691302 3300048907 Bacteria 928
874 Ga0496104_0694182 3300048907 Bacteria 926
875 Ga0496105_0170201 3300048908 Bacteria 1786
876 Ga0496105_1059980 3300048908 Bacteria 604
877 Ga0496106_0004162 3300048909 Bacteria 10783
878 Ga0496106_0012991 3300048909 Bacteria 6144
879 Ga0496106_0268153 3300048909 Bacteria 1367
880 Ga0496107_0012377 3300048910 Bacteria 5954
881 Ga0496108_0057165 3300048911 Bacteria 3278
882 Ga0496108_0059614 3300048911 Bacteria 3209
883 Ga0496108_0642548 3300048911 Bacteria 923
884 Ga0496109_0092481 3300048912 Bacteria 2798
885 Ga0496109_0928429 3300048912 Bacteria 808
886 Ga0496110_0147708 3300048913 Bacteria 2127
887 Ga0496110_0227769 3300048913 Bacteria 1695
888 Ga0496110_0244564 3300048913 Bacteria 1633
889 Ga0496111_0302090 3300048914 Bacteria 1186
890 Ga0496112_0063967 3300048915 Bacteria 3629
891 Ga0496113_0191649 3300048916 Bacteria 1623
892 Ga0496114_0000303 3300048917 Bacteria 36267
893 Ga0496114_0165229 3300048917 Bacteria 1927
894 Ga0496114_0286169 3300048917 Bacteria 1454
895 Ga0496115_0002077 3300048918 Bacteria 14341
896 Ga0496115_0487713 3300048918 Bacteria 992
897 Ga0496123_0020213 3300048926 Bacteria 5215
898 Ga0496124_0001253 3300048927 Bacteria 38792
899 Ga0496124_0024540 3300048927 Bacteria 5478
900 Ga0496124_0039147 3300048927 Bacteria 4112
901 Ga0496125_0000542 3300048928 Bacteria 64978
902 Ga0496125_0007690 3300048928 Bacteria 11424
903 Ga0496125_0026412 3300048928 Bacteria 5292
904 Ga0496125_0221799 3300048928 Bacteria 1217
905 Ga0496125_0311165 3300048928 Bacteria 960
906 Ga0496125_0370834 3300048928 Bacteria 847
907 Ga0496126_0007499 3300048929 Bacteria 11950
908 Ga0496126_0164097 3300048929 Bacteria 1897
909 Ga0496126_0424535 3300048929 Bacteria 1074
910 Ga0496126_0628469 3300048929 Bacteria 843
911 Ga0501306_026251 3300049127 Bacteria 842
912 Ga0501310_011608 3300049130 Bacteria 999
913 Ga0501305_032163 3300049161 Bacteria 822
914 Ga0495682_0165290 3300049460 Bacteria 788
915 Ga0501295_024439 3300049518 Bacteria 1138
916 Ga0501312_007415 3300049528 Bacteria 1397
917 Ga0501031_0003670 3300049568 Bacteria 9880
918 Ga0501032_0419365 3300049569 Bacteria 859
919 Ga0501033_0313121 3300049570 Bacteria 1103
920 Ga0501036_0692126 3300049572 Bacteria 843
921 Ga0501037_0214749 3300049573 Bacteria 1355
922 Ga0501039_1299034 3300049575 Bacteria 561
923 Ga0501068_0523170 3300049584 Bacteria 770
924 Ga0501199_025333 3300049650 Bacteria 708
925 Ga0501263_048478 3300049760 Bacteria 641
926 Ga0501266_000043 3300049763 Bacteria 22384
927 Ga0501035_0068336 3300049822 Bacteria 3151
928 Ga0501035_0493179 3300049822 Bacteria 1009
929 nmdc:mga03683_12587_c1 3300050489 Bacteria 3095
930 nmdc:mga0yw44_364058_c1 3300050492 Bacteria 975
931 nmdc:mga0k408_139278_c1 3300050493 Bacteria 1443
932 nmdc:mga0k408_18200_c2 3300050493 Bacteria 3187
933 nmdc:mga0k408_209775_c1 3300050493 Bacteria 1163
934 nmdc:mga0k408_219125_c1 3300050493 Bacteria 1136
935 nmdc:mga0k408_250930_c1 3300050493 Bacteria 1057
936 nmdc:mga0k408_26610_c1 3300050493 Bacteria 3281
937 nmdc:mga0k408_271462_c1 3300050493 Bacteria 1013
938 nmdc:mga0k408_40302_c1 3300050493 Bacteria 2687
939 nmdc:mga0k408_46145_c1 3300050493 Bacteria 2516
940 nmdc:mga0k408_506_c1 3300050493 Bacteria 21412
941 nmdc:mga0k408_6644_c1 3300050493 Bacteria 6167
942 nmdc:mga0k408_97084_c1 3300050493 Bacteria 1735
943 nmdc:mga06z11_14427_c1 3300050494 Bacteria 3500
944 nmdc:mga06z11_214599_c1 3300050494 Bacteria 1122
945 nmdc:mga06z11_37405_c1 3300050494 Bacteria 2403
946 nmdc:mga07m45_18856_c1 3300050496 Bacteria 3732
947 nmdc:mga07m45_249277_c1 3300050496 Bacteria 1033
948 nmdc:mga07m45_25851_c1 3300050496 Bacteria 3224
949 nmdc:mga07m45_4213_c1 3300050496 Bacteria 7032
950 nmdc:mga07m45_48072_c1 3300050496 Bacteria 2399
951 nmdc:mga07m45_58967_c1 3300050496 Bacteria 2172
952 nmdc:mga07m45_76504_c1 3300050496 Bacteria 1908
953 nmdc:mga07m45_9233_c1 3300050496 Bacteria 5106
954 nmdc:mga09592_14154_c1 3300050508 Bacteria 6507
955 nmdc:mga0qj67_47140_c1 3300050509 Bacteria 3404
956 nmdc:mga08y16_505851_c1 3300050511 Bacteria 1227
957 nmdc:mga0n895_625855_c1 3300050512 Bacteria 1077
958 nmdc:mga0sz30_5056_c1 3300050516 Bacteria 4821
959 Ga0495601_0089083 3300053077 Bacteria 1984
960 Ga0495601_0694390 3300053077 Bacteria 649
961 Ga0500635_0000289 3300053080 Bacteria 18489
962 Ga0495655_0074053 3300053083 Bacteria 959
963 Ga0500578_0169449 3300053086 Bacteria 1351
964 Ga0500578_0287913 3300053086 Bacteria 978
965 Ga0500583_0247630 3300053092 Bacteria 880
966 Ga0500651_0127767 3300053093 Bacteria 1539
967 Ga0500562_026437 3300053108 Bacteria 1521
968 Ga0500572_198351 3300053111 Bacteria 658
969 Ga0500608_018865 3300053122 Bacteria 3154
970 Ga0500658_0006983 3300053134 Bacteria 4179
971 Ga0500559_0154079 3300053136 Bacteria 1079
972 Ga0500564_096406 3300053138 Bacteria 1312
973 Ga0500586_279206 3300053145 Bacteria 511
974 Ga0500589_110194 3300053147 Bacteria 1182
975 Ga0500590_056793 3300053148 Bacteria 1976
976 Ga0500616_0129967 3300053153 Bacteria 1191
977 Ga0500619_000073 3300053154 Bacteria 28363
978 Ga0500622_0003844 3300053156 Bacteria 9770
979 Ga0500627_0076259 3300053158 Bacteria 1491
980 Ga0500634_0005385 3300053161 Bacteria 6066
981 Ga0500636_0177401 3300053177 Bacteria 1147
982 Ga0500645_007607 3300053730 Bacteria 3758
983 Ga0590071_019067 3300059421 Bacteria 1614
984 Ga0590075_036240 3300059424 Bacteria 1257
985 Ga0587084_008625 3300059477 Bacteria 1296
986 Ga0587093_017088 3300059478 Bacteria 932
987 Ga0587077_015148 3300059493 Bacteria 1279
988 Ga0587080_038820 3300059503 Bacteria 860
989 Ga0587082_043019 3300059504 Bacteria 835
990 Ga0587083_0027171 3300059505 Bacteria 1110
991 Ga0587062_030232 3300059639 Bacteria 825
992 Ga0587068_006413 3300059641 Bacteria 1647
993 Ga0587069_041970 3300059642 Bacteria 784
994 Ga0587076_025679 3300059645 Bacteria 1009
995 Ga0587076_073087 3300059645 Bacteria 716
996 Ga0587118_00497 3300059657 Bacteria 2000
997 Ga0587124_003541 3300059660 Bacteria 1165
998 Ga0587071_046243 3300060344 Bacteria 887
999 Ga0587111_0017584 3300060346 Bacteria 1334
1000 Ga0587111_0132451 3300060346 Bacteria 653
1001 Ga0466962_0008120 3300061719 Bacteria 5033
1002 Ga0466962_0052497 3300061719 Bacteria 1948
1003 Ga0466962_0055459 3300061719 Bacteria 1893

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10134099 Ga0075366_101340992 125
2 3300050493 nmdc:mga0k408_506_c1 nmdc:mga0k408_506_c1_8172_8603 125
3 3300037471 Ga0395905_0002001 Ga0395905_0002001_10401_10883 126
4 3300048908 Ga0496105_1059980 Ga0496105_1059980_58_486 126
5 iso_pu_bacteria 2858688981 2858691201 126
6 3300013105 Ga0157369_10066867 Ga0157369_100668674 127
7 3300013296 Ga0157374_10423933 Ga0157374_104239331 127
8 3300025935 Ga0207709_10150093 Ga0207709_101500933 127
9 3300034817 Ga0373948_0056722 Ga0373948_0056722_172_612 127
10 3300035084 Ga0373928_0028805 Ga0373928_0028805_358_834 127
11 3300039447 Ga0436361_0381246 Ga0436361_0381246_1559_1987 127
12 3300044656 Ga0466969_0037790 Ga0466969_0037790_263_688 127
13 3300044683 Ga0466965_0074067 Ga0466965_0074067_483_908 127
14 3300044683 Ga0466965_0262502 Ga0466965_0262502_319_747 127
15 3300044684 Ga0466966_0020475 Ga0466966_0020475_3087_3512 127
16 3300044693 Ga0466961_0006410 Ga0466961_0006410_4663_5088 127
17 3300044694 Ga0466963_0867798 Ga0466963_0867798_181_606 127
18 3300044706 Ga0466964_0293986 Ga0466964_0293986_141_566 127
19 3300044712 Ga0453684_0213283 Ga0453684_0213283_1479_1919 127
20 3300044719 Ga0466971_0015912 Ga0466971_0015912_848_1273 127
21 3300044765 Ga0466970_0221817 Ga0466970_0221817_126_551 127
22 3300044842 Ga0466957_0399742 Ga0466957_0399742_275_700 127
23 3300044901 Ga0466960_0196164 Ga0466960_0196164_37_465 127
24 3300045049 Ga0466959_0015936 Ga0466959_0015936_1141_1566 127
25 3300045051 Ga0451576_0034152 Ga0451576_0034152_247_687 127
26 3300045976 Ga0466967_0333618 Ga0466967_0333618_109_534 127
27 3300046528 Ga0495642_0137448 Ga0495642_0137448_150_575 127
28 3300046616 Ga0495668_0086062 Ga0495668_0086062_890_1315 127
29 3300048905 Ga0496102_0001355 Ga0496102_0001355_10036_10494 127
30 3300053147 Ga0500589_110194 Ga0500589_110194_329_754 127
31 3300061719 Ga0466962_0052497 Ga0466962_0052497_361_786 127
32 iso_pu_bacteria 2831864461 2831866105 127
33 3300006058 Ga0075432_10262376 Ga0075432_102623762 128
34 3300037068 Ga0373925_0206197 Ga0373925_0206197_420_863 128
35 3300037471 Ga0395905_0297020 Ga0395905_0297020_757_1185 128
36 3300042134 Ga0450898_031288 Ga0450898_031288_52_477 128
37 3300042876 Ga0451577_0007214 Ga0451577_0007214_10304_10732 128
38 3300044712 Ga0453684_0214562 Ga0453684_0214562_489_935 128
39 3300045051 Ga0451576_0437696 Ga0451576_0437696_417_860 128
40 3300049650 Ga0501199_025333 Ga0501199_025333_53_478 128
41 iso_pu_bacteria 2526164512 2526213794 128
42 iso_pu_bacteria 2643221544 2643743910 128
43 3300005333 Ga0070677_10058730 Ga0070677_100587303 129
44 3300005335 Ga0070666_10157695 Ga0070666_101576952 129
45 3300005340 Ga0070689_100704961 Ga0070689_1007049611 129
46 3300005343 Ga0070687_100111393 Ga0070687_1001113933 129
47 3300005347 Ga0070668_100013101 Ga0070668_1000131019 129
48 3300005353 Ga0070669_100004781 Ga0070669_1000047819 129
49 3300005365 Ga0070688_101477344 Ga0070688_1014773441 129
50 3300005367 Ga0070667_100001219 Ga0070667_1000012192 129
51 3300005436 Ga0070713_101231270 Ga0070713_1012312702 129
52 3300005438 Ga0070701_10173078 Ga0070701_101730781 129
53 3300005547 Ga0070693_100104913 Ga0070693_1001049132 129
54 3300005719 Ga0068861_100169480 Ga0068861_1001694803 129
55 3300005834 Ga0068851_10518759 Ga0068851_105187592 129
56 3300005840 Ga0068870_10227233 Ga0068870_102272332 129
57 3300005840 Ga0068870_10297558 Ga0068870_102975582 129
58 3300005842 Ga0068858_100009355 Ga0068858_1000093553 129
59 3300005843 Ga0068860_100001009 Ga0068860_10000100915 129
60 3300006173 Ga0070716_100426462 Ga0070716_1004264622 129
61 3300006353 Ga0075370_10072039 Ga0075370_100720392 129
62 3300009098 Ga0105245_10008631 Ga0105245_100086313 129
63 3300009148 Ga0105243_10098021 Ga0105243_100980213 129
64 3300009176 Ga0105242_10670637 Ga0105242_106706372 129
65 3300009553 Ga0105249_10034828 Ga0105249_100348286 129
66 3300010375 Ga0105239_10192752 Ga0105239_101927523 129
67 3300013306 Ga0163162_10361146 Ga0163162_103611463 129
68 3300013306 Ga0163162_11193545 Ga0163162_111935452 129
69 3300013308 Ga0157375_10387116 Ga0157375_103871162 129
70 3300014326 Ga0157380_10961560 Ga0157380_109615602 129
71 3300017792 Ga0163161_10234871 Ga0163161_102348713 129
72 3300025315 Ga0207697_10158672 Ga0207697_101586722 129
73 3300025321 Ga0207656_10077488 Ga0207656_100774883 129
74 3300025900 Ga0207710_10016404 Ga0207710_100164042 129
75 3300025909 Ga0207705_10303962 Ga0207705_103039622 129
76 3300025909 Ga0207705_11273526 Ga0207705_112735261 129
77 3300025923 Ga0207681_10000795 Ga0207681_1000079513 129
78 3300025925 Ga0207650_10004501 Ga0207650_100045015 129
79 3300025926 Ga0207659_10168680 Ga0207659_101686802 129
80 3300025927 Ga0207687_10444166 Ga0207687_104441662 129
81 3300025928 Ga0207700_10933047 Ga0207700_109330472 129
82 3300025939 Ga0207665_10082203 Ga0207665_100822033 129
83 3300025972 Ga0207668_10017712 Ga0207668_100177122 129
84 3300025986 Ga0207658_10001151 Ga0207658_100011517 129
85 3300026023 Ga0207677_10161657 Ga0207677_101616572 129
86 3300026035 Ga0207703_10001999 Ga0207703_100019997 129
87 3300026075 Ga0207708_10098042 Ga0207708_100980423 129
88 3300026088 Ga0207641_10026325 Ga0207641_100263257 129
89 3300026095 Ga0207676_10131378 Ga0207676_101313782 129
90 3300028381 Ga0268264_10003920 Ga0268264_100039207 129
91 3300035089 Ga0373944_0154759 Ga0373944_0154759_43_468 129
92 3300035119 Ga0373956_0359184 Ga0373956_0359184_31_456 129
93 3300035170 Ga0373943_0040156 Ga0373943_0040156_456_881 129
94 3300035172 Ga0373955_0193714 Ga0373955_0193714_613_1038 129
95 3300035410 Ga0373924_0544435 Ga0373924_0544435_17_442 129
96 3300035691 Ga0373931_0723441 Ga0373931_0723441_28_462 129
97 3300035695 Ga0373927_0359500 Ga0373927_0359500_12_437 129
98 3300039437 Ga0436365_1170591 Ga0436365_1170591_1271_1696 129
99 3300044712 Ga0453684_0308719 Ga0453684_0308719_689_1126 129
100 3300045051 Ga0451576_0670885 Ga0451576_0670885_113_550 129
101 3300046473 Ga0495582_0335482 Ga0495582_0335482_18_443 129
102 3300046543 Ga0495645_0402573 Ga0495645_0402573_411_836 129
103 3300046559 Ga0495667_0247823 Ga0495667_0247823_23_448 129
104 3300046642 Ga0495634_0844929 Ga0495634_0844929_83_508 129
105 3300046683 Ga0495658_0118906 Ga0495658_0118906_912_1337 129
106 3300046691 Ga0495670_0193492 Ga0495670_0193492_216_641 129
107 3300047315 Ga0495581_0523836 Ga0495581_0523836_120_545 129
108 3300048911 Ga0496108_0059614 Ga0496108_0059614_358_783 129
109 3300050496 nmdc:mga07m45_249277_c1 nmdc:mga07m45_249277_c1_538_969 129
110 3300050511 nmdc:mga08y16_505851_c1 nmdc:mga08y16_505851_c1_339_764 129
111 3300053077 Ga0495601_0694390 Ga0495601_0694390_111_536 129
112 3300053083 Ga0495655_0074053 Ga0495655_0074053_104_532 129
113 iso_pu_bacteria 2643221639 2644217213 129
114 iso_pu_bacteria 2643221646 2644259019 129
115 iso_pu_bacteria 2738541337 2739055756 129
116 3300005355 Ga0070671_100006682 Ga0070671_10000668212 130
117 3300005364 Ga0070673_100252094 Ga0070673_1002520942 130
118 3300005458 Ga0070681_10099116 Ga0070681_100991163 130
119 3300005466 Ga0070685_10546974 Ga0070685_105469742 130
120 3300005530 Ga0070679_100043614 Ga0070679_1000436144 130
121 3300005539 Ga0068853_100144299 Ga0068853_1001442994 130
122 3300005543 Ga0070672_100046096 Ga0070672_1000460963 130
123 3300005617 Ga0068859_100291228 Ga0068859_1002912282 130
124 3300005719 Ga0068861_101125370 Ga0068861_1011253702 130
125 3300005844 Ga0068862_101144648 Ga0068862_1011446482 130
126 3300006881 Ga0068865_100458277 Ga0068865_1004582773 130
127 3300006931 Ga0097620_100291221 Ga0097620_1002912212 130
128 3300009093 Ga0105240_10002903 Ga0105240_1000290315 130
129 3300009094 Ga0111539_11293384 Ga0111539_112933842 130
130 3300009176 Ga0105242_10246410 Ga0105242_102464102 130
131 3300009545 Ga0105237_10000605 Ga0105237_1000060521 130
132 3300010375 Ga0105239_10000328 Ga0105239_1000032840 130
133 3300012512 Ga0157327_1006028 Ga0157327_10060282 130
134 3300014969 Ga0157376_10119790 Ga0157376_101197904 130
135 3300025295 Ga0209564_1000051 Ga0209564_1000051119 130
136 3300025893 Ga0207682_10008487 Ga0207682_100084876 130
137 3300025904 Ga0207647_10678529 Ga0207647_106785292 130
138 3300025911 Ga0207654_10151752 Ga0207654_101517522 130
139 3300025913 Ga0207695_10002543 Ga0207695_1000254315 130
140 3300025914 Ga0207671_10006429 Ga0207671_100064296 130
141 3300025921 Ga0207652_10068430 Ga0207652_100684304 130
142 3300025924 Ga0207694_10072140 Ga0207694_100721403 130
143 3300025926 Ga0207659_10104518 Ga0207659_101045183 130
144 3300025931 Ga0207644_11044440 Ga0207644_110444402 130
145 3300025935 Ga0207709_10895454 Ga0207709_108954542 130
146 3300025940 Ga0207691_10026402 Ga0207691_100264026 130
147 3300025972 Ga0207668_10117687 Ga0207668_101176872 130
148 3300026041 Ga0207639_10321962 Ga0207639_103219622 130
149 3300026118 Ga0207675_100289505 Ga0207675_1002895052 130
150 3300026121 Ga0207683_10408580 Ga0207683_104085802 130
151 3300028380 Ga0268265_10545046 Ga0268265_105450462 130
152 3300031344 Ga0265316_10000181 Ga0265316_1000018142 130
153 3300031731 Ga0307405_10021832 Ga0307405_100218323 130
154 3300031911 Ga0307412_10118366 Ga0307412_101183662 130
155 3300031995 Ga0307409_100001314 Ga0307409_10000131413 130
156 3300032004 Ga0307414_10195884 Ga0307414_101958842 130
157 3300032126 Ga0307415_100105962 Ga0307415_1001059623 130
158 3300041406 Ga0439439_0100189 Ga0439439_0100189_187_621 130
159 3300044712 Ga0453684_0059811 Ga0453684_0059811_2337_2798 130
160 3300045051 Ga0451576_0003317 Ga0451576_0003317_18361_18822 130
161 3300046537 Ga0495598_0071363 Ga0495598_0071363_97_522 130
162 3300046539 Ga0495621_0030596 Ga0495621_0030596_523_948 130
163 3300048903 Ga0496100_0469849 Ga0496100_0469849_191_643 130
164 3300048917 Ga0496114_0000303 Ga0496114_0000303_24991_25443 130
165 3300048928 Ga0496125_0311165 Ga0496125_0311165_92_517 130
166 3300048929 Ga0496126_0424535 Ga0496126_0424535_475_918 130
167 iso_pu_bacteria 2585428062 2587756188 130
168 iso_pu_bacteria 2643221585 2643933070 130
169 iso_pu_bacteria 2643221654 2644301598 130
170 iso_pu_bacteria 2643221656 2644314319 130
171 3300005327 Ga0070658_10082474 Ga0070658_100824743 131
172 3300005327 Ga0070658_10293181 Ga0070658_102931813 131
173 3300005327 Ga0070658_10505972 Ga0070658_105059722 131
174 3300005335 Ga0070666_10172595 Ga0070666_101725952 131
175 3300005343 Ga0070687_100025858 Ga0070687_1000258583 131
176 3300005364 Ga0070673_100299411 Ga0070673_1002994112 131
177 3300005366 Ga0070659_100404027 Ga0070659_1004040271 131
178 3300005367 Ga0070667_100010682 Ga0070667_1000106823 131
179 3300005455 Ga0070663_100412935 Ga0070663_1004129352 131
180 3300005616 Ga0068852_100551033 Ga0068852_1005510332 131
181 3300009093 Ga0105240_10456133 Ga0105240_104561333 131
182 3300009545 Ga0105237_10359953 Ga0105237_103599532 131
183 3300012475 Ga0157317_1007403 Ga0157317_10074031 131
184 3300012478 Ga0157328_1012916 Ga0157328_10129161 131
185 3300012482 Ga0157318_1003919 Ga0157318_10039191 131
186 3300012507 Ga0157342_1031791 Ga0157342_10317911 131
187 3300012510 Ga0157316_1016460 Ga0157316_10164602 131
188 3300013296 Ga0157374_10945256 Ga0157374_109452561 131
189 3300013308 Ga0157375_12202274 Ga0157375_122022741 131
190 3300014326 Ga0157380_10110834 Ga0157380_101108342 131
191 3300014497 Ga0182008_10446782 Ga0182008_104467822 131
192 3300020082 Ga0206353_11133087 Ga0206353_111330872 131
193 3300021361 Ga0213872_10000161 Ga0213872_100001616 131
194 3300021384 Ga0213876_10032219 Ga0213876_100322193 131
195 3300025256 Ga0209759_1004020 Ga0209759_10040206 131
196 3300025893 Ga0207682_10014215 Ga0207682_100142153 131
197 3300025919 Ga0207657_10012263 Ga0207657_100122635 131
198 3300025932 Ga0207690_10713146 Ga0207690_107131462 131
199 3300025941 Ga0207711_10064486 Ga0207711_100644863 131
200 3300025945 Ga0207679_10869504 Ga0207679_108695041 131
201 3300025945 Ga0207679_11210253 Ga0207679_112102532 131
202 3300025960 Ga0207651_10032300 Ga0207651_100323006 131
203 3300025986 Ga0207658_10005593 Ga0207658_100055939 131
204 3300026035 Ga0207703_10988454 Ga0207703_109884542 131
205 3300026067 Ga0207678_10969347 Ga0207678_109693471 131
206 3300026121 Ga0207683_10420167 Ga0207683_104201673 131
207 3300031238 Ga0265332_10000187 Ga0265332_1000018718 131
208 3300031456 Ga0307513_10285307 Ga0307513_102853072 131
209 3300031548 Ga0307408_100278466 Ga0307408_1002784663 131
210 3300031616 Ga0307508_10743441 Ga0307508_107434411 131
211 3300031901 Ga0307406_10998736 Ga0307406_109987361 131
212 3300032002 Ga0307416_102567805 Ga0307416_1025678051 131
213 3300035120 Ga0373957_0379102 Ga0373957_0379102_19_450 131
214 3300035171 Ga0373946_0270935 Ga0373946_0270935_182_613 131
215 3300035724 Ga0373933_0295202 Ga0373933_0295202_455_886 131
216 3300035725 Ga0373947_0363442 Ga0373947_0363442_84_515 131
217 3300037312 Ga0395899_0210560 Ga0395899_0210560_346_780 131
218 3300039437 Ga0436365_0514532 Ga0436365_0514532_1562_1993 131
219 3300039447 Ga0436361_0481133 Ga0436361_0481133_58284_58733 131
220 3300041509 Ga0451843_0161326 Ga0451843_0161326_34_459 131
221 3300042127 Ga0450890_024208 Ga0450890_024208_104_538 131
222 3300042139 Ga0450904_008783 Ga0450904_008783_281_715 131
223 3300044656 Ga0466969_0009692 Ga0466969_0009692_460_894 131
224 3300044683 Ga0466965_0017660 Ga0466965_0017660_372_806 131
225 3300044684 Ga0466966_0000754 Ga0466966_0000754_16151_16585 131
226 3300044694 Ga0466963_0472979 Ga0466963_0472979_371_805 131
227 3300044706 Ga0466964_0011333 Ga0466964_0011333_444_878 131
228 3300044719 Ga0466971_0022228 Ga0466971_0022228_520_954 131
229 3300044765 Ga0466970_0035508 Ga0466970_0035508_1842_2276 131
230 3300044842 Ga0466957_0029903 Ga0466957_0029903_204_638 131
231 3300045049 Ga0466959_0028505 Ga0466959_0028505_674_1108 131
232 3300045836 Ga0466958_0043317 Ga0466958_0043317_467_901 131
233 3300046459 Ga0495629_0040968 Ga0495629_0040968_300_731 131
234 3300046471 Ga0495650_0030296 Ga0495650_0030296_1225_1659 131
235 3300046511 Ga0495608_0091668 Ga0495608_0091668_1168_1599 131
236 3300046514 Ga0495618_0101195 Ga0495618_0101195_84_515 131
237 3300046516 Ga0495628_0370048 Ga0495628_0370048_373_804 131
238 3300046517 Ga0495630_0104877 Ga0495630_0104877_710_1141 131
239 3300046543 Ga0495645_0236725 Ga0495645_0236725_344_775 131
240 3300046543 Ga0495645_0393481 Ga0495645_0393481_254_685 131
241 3300046678 Ga0495599_0141643 Ga0495599_0141643_910_1341 131
242 3300046683 Ga0495658_0014926 Ga0495658_0014926_1869_2300 131
243 3300046689 Ga0495613_0150194 Ga0495613_0150194_1035_1466 131
244 3300046691 Ga0495670_0027835 Ga0495670_0027835_2061_2501 131
245 3300046809 Ga0495600_0207944 Ga0495600_0207944_590_1021 131
246 3300047319 Ga0495674_0161840 Ga0495674_0161840_102_533 131
247 3300047322 Ga0495680_0048736 Ga0495680_0048736_1751_2182 131
248 3300047471 Ga0495684_0103716 Ga0495684_0103716_631_1062 131
249 3300047673 Ga0495593_0107975 Ga0495593_0107975_44_475 131
250 3300048909 Ga0496106_0268153 Ga0496106_0268153_155_592 131
251 3300049130 Ga0501310_011608 Ga0501310_011608_83_517 131
252 3300049161 Ga0501305_032163 Ga0501305_032163_33_467 131
253 3300049528 Ga0501312_007415 Ga0501312_007415_494_928 131
254 3300050512 nmdc:mga0n895_625855_c1 nmdc:mga0n895_625855_c1_244_675 131
255 3300053077 Ga0495601_0089083 Ga0495601_0089083_1003_1434 131
256 3300053156 Ga0500622_0003844 Ga0500622_0003844_5004_5444 131
257 3300061719 Ga0466962_0008120 Ga0466962_0008120_2021_2455 131
258 3300002705 JGI25156J39149_1000250 JGI25156J39149_10002502 132
259 3300002738 JGI25154J39366_1000831 JGI25154J39366_100083110 132
260 3300002741 JGI25157J39369_1000027 JGI25157J39369_100002721 132
261 3300003752 Ga0055539_1000213 Ga0055539_10002132 132
262 3300003752 Ga0055539_1015643 Ga0055539_10156432 132
263 3300003756 Ga0055533_1000073 Ga0055533_100007320 132
264 3300003759 Ga0055525_1001549 Ga0055525_10015491 132
265 3300003761 Ga0055535_1000231 Ga0055535_100023117 132
266 3300003763 Ga0055529_1000385 Ga0055529_10003853 132
267 3300003763 Ga0055529_1000410 Ga0055529_100041030 132
268 3300003792 Ga0055540_1036520 Ga0055540_10365202 132
269 3300005327 Ga0070658_10107787 Ga0070658_101077873 132
270 3300005327 Ga0070658_10309199 Ga0070658_103091992 132
271 3300005329 Ga0070683_100091520 Ga0070683_1000915203 132
272 3300005330 Ga0070690_100017913 Ga0070690_1000179135 132
273 3300005334 Ga0068869_100013993 Ga0068869_1000139934 132
274 3300005334 Ga0068869_100076053 Ga0068869_1000760533 132
275 3300005338 Ga0068868_100210069 Ga0068868_1002100692 132
276 3300005338 Ga0068868_100240485 Ga0068868_1002404852 132
277 3300005338 Ga0068868_100725912 Ga0068868_1007259121 132
278 3300005339 Ga0070660_100090730 Ga0070660_1000907302 132
279 3300005339 Ga0070660_100335039 Ga0070660_1003350392 132
280 3300005340 Ga0070689_100989469 Ga0070689_1009894691 132
281 3300005344 Ga0070661_100130158 Ga0070661_1001301583 132
282 3300005347 Ga0070668_100019903 Ga0070668_1000199034 132
283 3300005353 Ga0070669_100080511 Ga0070669_1000805113 132
284 3300005355 Ga0070671_100023685 Ga0070671_1000236852 132
285 3300005356 Ga0070674_100064407 Ga0070674_1000644073 132
286 3300005356 Ga0070674_100573828 Ga0070674_1005738282 132
287 3300005366 Ga0070659_100103195 Ga0070659_1001031953 132
288 3300005366 Ga0070659_100154317 Ga0070659_1001543172 132
289 3300005441 Ga0070700_100408758 Ga0070700_1004087582 132
290 3300005444 Ga0070694_100331235 Ga0070694_1003312352 132
291 3300005445 Ga0070708_100063831 Ga0070708_1000638312 132
292 3300005445 Ga0070708_100967280 Ga0070708_1009672802 132
293 3300005456 Ga0070678_100348480 Ga0070678_1003484803 132
294 3300005457 Ga0070662_100014538 Ga0070662_1000145383 132
295 3300005457 Ga0070662_100348048 Ga0070662_1003480483 132
296 3300005458 Ga0070681_11005679 Ga0070681_110056792 132
297 3300005459 Ga0068867_100532558 Ga0068867_1005325582 132
298 3300005459 Ga0068867_100783942 Ga0068867_1007839421 132
299 3300005467 Ga0070706_100004486 Ga0070706_1000044866 132
300 3300005468 Ga0070707_100168314 Ga0070707_1001683144 132
301 3300005471 Ga0070698_100138790 Ga0070698_1001387902 132
302 3300005530 Ga0070679_100238522 Ga0070679_1002385223 132
303 3300005535 Ga0070684_100189437 Ga0070684_1001894372 132
304 3300005535 Ga0070684_100462816 Ga0070684_1004628162 132
305 3300005539 Ga0068853_100378525 Ga0068853_1003785252 132
306 3300005543 Ga0070672_100614549 Ga0070672_1006145492 132
307 3300005544 Ga0070686_100271624 Ga0070686_1002716242 132
308 3300005547 Ga0070693_100117118 Ga0070693_1001171183 132
309 3300005563 Ga0068855_100472735 Ga0068855_1004727352 132
310 3300005563 Ga0068855_100637779 Ga0068855_1006377793 132
311 3300005564 Ga0070664_100121932 Ga0070664_1001219323 132
312 3300005577 Ga0068857_100114500 Ga0068857_1001145003 132
313 3300005577 Ga0068857_100169087 Ga0068857_1001690873 132
314 3300005577 Ga0068857_100262457 Ga0068857_1002624573 132
315 3300005578 Ga0068854_100143670 Ga0068854_1001436704 132
316 3300005578 Ga0068854_100199615 Ga0068854_1001996152 132
317 3300005614 Ga0068856_100006466 Ga0068856_1000064668 132
318 3300005614 Ga0068856_100218424 Ga0068856_1002184242 132
319 3300005616 Ga0068852_100050955 Ga0068852_1000509553 132
320 3300005616 Ga0068852_100135132 Ga0068852_1001351322 132
321 3300005617 Ga0068859_101161779 Ga0068859_1011617792 132
322 3300005618 Ga0068864_100591991 Ga0068864_1005919913 132
323 3300005719 Ga0068861_100007969 Ga0068861_1000079693 132
324 3300005719 Ga0068861_100128984 Ga0068861_1001289843 132
325 3300005719 Ga0068861_101397726 Ga0068861_1013977262 132
326 3300005843 Ga0068860_100537904 Ga0068860_1005379042 132
327 3300005844 Ga0068862_100234000 Ga0068862_1002340002 132
328 3300005844 Ga0068862_102487988 Ga0068862_1024879881 132
329 3300006048 Ga0075363_100354009 Ga0075363_1003540092 132
330 3300006178 Ga0075367_10015588 Ga0075367_100155882 132
331 3300006195 Ga0075366_10005265 Ga0075366_100052655 132
332 3300006195 Ga0075366_10114569 Ga0075366_101145692 132
333 3300006353 Ga0075370_10015599 Ga0075370_100155993 132
334 3300006353 Ga0075370_10046189 Ga0075370_100461893 132
335 3300006881 Ga0068865_101393966 Ga0068865_1013939661 132
336 3300006931 Ga0097620_101161493 Ga0097620_1011614932 132
337 3300007076 Ga0075435_100518518 Ga0075435_1005185182 132
338 3300009093 Ga0105240_10221428 Ga0105240_102214285 132
339 3300009093 Ga0105240_10303100 Ga0105240_103031002 132
340 3300009147 Ga0114129_13059471 Ga0114129_130594712 132
341 3300009148 Ga0105243_10083870 Ga0105243_100838704 132
342 3300009174 Ga0105241_10165192 Ga0105241_101651923 132
343 3300009174 Ga0105241_10254402 Ga0105241_102544022 132
344 3300009174 Ga0105241_11123466 Ga0105241_111234662 132
345 3300009176 Ga0105242_11873087 Ga0105242_118730871 132
346 3300009545 Ga0105237_10024647 Ga0105237_100246473 132
347 3300009545 Ga0105237_10436478 Ga0105237_104364782 132
348 3300009551 Ga0105238_10131727 Ga0105238_101317273 132
349 3300009551 Ga0105238_10259041 Ga0105238_102590412 132
350 3300009551 Ga0105238_10270280 Ga0105238_102702802 132
351 3300011119 Ga0105246_10180369 Ga0105246_101803692 132
352 3300013102 Ga0157371_10119053 Ga0157371_101190533 132
353 3300013102 Ga0157371_10161212 Ga0157371_101612122 132
354 3300013105 Ga0157369_10106282 Ga0157369_101062825 132
355 3300013105 Ga0157369_10255279 Ga0157369_102552793 132
356 3300013296 Ga0157374_10007375 Ga0157374_100073752 132
357 3300013306 Ga0163162_10317266 Ga0163162_103172663 132
358 3300013306 Ga0163162_10550524 Ga0163162_105505242 132
359 3300013307 Ga0157372_10010263 Ga0157372_100102639 132
360 3300013307 Ga0157372_10052780 Ga0157372_100527804 132
361 3300013307 Ga0157372_10371558 Ga0157372_103715583 132
362 3300013308 Ga0157375_10163285 Ga0157375_101632853 132
363 3300014745 Ga0157377_10053913 Ga0157377_100539133 132
364 3300014968 Ga0157379_10331511 Ga0157379_103315113 132
365 3300014969 Ga0157376_10029275 Ga0157376_100292752 132
366 3300014969 Ga0157376_10249929 Ga0157376_102499292 132
367 3300014969 Ga0157376_11694049 Ga0157376_116940492 132
368 3300015261 Ga0182006_1179880 Ga0182006_11798802 132
369 3300015265 Ga0182005_1099118 Ga0182005_10991182 132
370 3300017792 Ga0163161_10569870 Ga0163161_105698702 132
371 3300017792 Ga0163161_11004975 Ga0163161_110049752 132
372 3300021377 Ga0213874_10208777 Ga0213874_102087772 132
373 3300025226 Ga0209674_100039 Ga0209674_100039212 132
374 3300025228 Ga0209672_102750 Ga0209672_1027506 132
375 3300025230 Ga0209563_100110 Ga0209563_100110118 132
376 3300025231 Ga0207427_100388 Ga0207427_10038826 132
377 3300025242 Ga0209258_100305 Ga0209258_10030548 132
378 3300025242 Ga0209258_100567 Ga0209258_1005673 132
379 3300025246 Ga0209646_1000231 Ga0209646_100023154 132
380 3300025250 Ga0209026_1000011 Ga0209026_1000011125 132
381 3300025253 Ga0209677_100246 Ga0209677_1002463 132
382 3300025253 Ga0209677_109922 Ga0209677_1099222 132
383 3300025254 Ga0209148_1012339 Ga0209148_10123392 132
384 3300025256 Ga0209759_1000107 Ga0209759_1000107125 132
385 3300025256 Ga0209759_1001067 Ga0209759_100106718 132
386 3300025256 Ga0209759_1021621 Ga0209759_10216212 132
387 3300025272 Ga0209455_1000053 Ga0209455_100005349 132
388 3300025303 Ga0209051_1002180 Ga0209051_10021809 132
389 3300025321 Ga0207656_10008176 Ga0207656_100081761 132
390 3300025321 Ga0207656_10027048 Ga0207656_100270482 132
391 3300025899 Ga0207642_10097420 Ga0207642_100974202 132
392 3300025909 Ga0207705_10253094 Ga0207705_102530941 132
393 3300025910 Ga0207684_10005949 Ga0207684_100059493 132
394 3300025911 Ga0207654_10079428 Ga0207654_100794282 132
395 3300025912 Ga0207707_10517732 Ga0207707_105177322 132
396 3300025912 Ga0207707_10658507 Ga0207707_106585071 132
397 3300025913 Ga0207695_10061905 Ga0207695_100619056 132
398 3300025913 Ga0207695_10088943 Ga0207695_100889432 132
399 3300025914 Ga0207671_10035144 Ga0207671_100351442 132
400 3300025914 Ga0207671_10074506 Ga0207671_100745063 132
401 3300025919 Ga0207657_10135699 Ga0207657_101356992 132
402 3300025919 Ga0207657_10258321 Ga0207657_102583212 132
403 3300025920 Ga0207649_10063794 Ga0207649_100637943 132
404 3300025922 Ga0207646_10067554 Ga0207646_100675543 132
405 3300025923 Ga0207681_10109921 Ga0207681_101099213 132
406 3300025924 Ga0207694_10014757 Ga0207694_100147571 132
407 3300025924 Ga0207694_10177669 Ga0207694_101776692 132
408 3300025924 Ga0207694_10256685 Ga0207694_102566852 132
409 3300025926 Ga0207659_10032887 Ga0207659_100328876 132
410 3300025927 Ga0207687_11180693 Ga0207687_111806932 132
411 3300025931 Ga0207644_10866837 Ga0207644_108668372 132
412 3300025932 Ga0207690_10201068 Ga0207690_102010681 132
413 3300025932 Ga0207690_10620346 Ga0207690_106203461 132
414 3300025933 Ga0207706_10502664 Ga0207706_105026642 132
415 3300025934 Ga0207686_10047390 Ga0207686_100473901 132
416 3300025934 Ga0207686_10252318 Ga0207686_102523182 132
417 3300025935 Ga0207709_10030033 Ga0207709_100300334 132
418 3300025935 Ga0207709_10963796 Ga0207709_109637962 132
419 3300025937 Ga0207669_10245980 Ga0207669_102459803 132
420 3300025938 Ga0207704_10192902 Ga0207704_101929022 132
421 3300025938 Ga0207704_10763262 Ga0207704_107632621 132
422 3300025938 Ga0207704_11009317 Ga0207704_110093171 132
423 3300025940 Ga0207691_10032397 Ga0207691_100323973 132
424 3300025941 Ga0207711_11641883 Ga0207711_116418831 132
425 3300025942 Ga0207689_10016046 Ga0207689_100160467 132
426 3300025944 Ga0207661_10140288 Ga0207661_101402882 132
427 3300025944 Ga0207661_11211799 Ga0207661_112117992 132
428 3300025945 Ga0207679_10213629 Ga0207679_102136292 132
429 3300025945 Ga0207679_10898806 Ga0207679_108988062 132
430 3300025949 Ga0207667_10578190 Ga0207667_105781901 132
431 3300025960 Ga0207651_10006629 Ga0207651_100066296 132
432 3300025972 Ga0207668_10126010 Ga0207668_101260104 132
433 3300025986 Ga0207658_10442197 Ga0207658_104421972 132
434 3300026023 Ga0207677_10076815 Ga0207677_100768153 132
435 3300026023 Ga0207677_10316529 Ga0207677_103165292 132
436 3300026041 Ga0207639_10117039 Ga0207639_101170392 132
437 3300026041 Ga0207639_10634287 Ga0207639_106342872 132
438 3300026075 Ga0207708_10785822 Ga0207708_107858222 132
439 3300026078 Ga0207702_10001232 Ga0207702_100012327 132
440 3300026078 Ga0207702_10044080 Ga0207702_100440803 132
441 3300026078 Ga0207702_10212232 Ga0207702_102122322 132
442 3300026089 Ga0207648_10554081 Ga0207648_105540812 132
443 3300026095 Ga0207676_10047914 Ga0207676_100479143 132
444 3300026116 Ga0207674_10018142 Ga0207674_100181429 132
445 3300026116 Ga0207674_10078389 Ga0207674_100783896 132
446 3300026116 Ga0207674_10164152 Ga0207674_101641522 132
447 3300026118 Ga0207675_100059119 Ga0207675_1000591195 132
448 3300026118 Ga0207675_100105634 Ga0207675_1001056342 132
449 3300026121 Ga0207683_10058177 Ga0207683_100581775 132
450 3300026142 Ga0207698_10138978 Ga0207698_101389782 132
451 3300026142 Ga0207698_10238217 Ga0207698_102382173 132
452 3300026142 Ga0207698_10293860 Ga0207698_102938602 132
453 3300026142 Ga0207698_11727152 Ga0207698_117271522 132
454 3300027395 Ga0209996_1018868 Ga0209996_10188682 132
455 3300027471 Ga0209995_1003267 Ga0209995_10032673 132
456 3300027526 Ga0209968_1000140 Ga0209968_100014013 132
457 3300027695 Ga0209966_1000388 Ga0209966_10003884 132
458 3300028379 Ga0268266_10114139 Ga0268266_101141393 132
459 3300028379 Ga0268266_11420590 Ga0268266_114205901 132
460 3300028380 Ga0268265_10344464 Ga0268265_103444642 132
461 3300028381 Ga0268264_10248183 Ga0268264_102481833 132
462 3300028573 Ga0265334_10167671 Ga0265334_101676711 132
463 3300028666 Ga0265336_10000022 Ga0265336_100000224 132
464 3300028794 Ga0307515_10000165 Ga0307515_1000016592 132
465 3300028794 Ga0307515_10000188 Ga0307515_10000188120 132
466 3300029957 Ga0265324_10000645 Ga0265324_100006459 132
467 3300031456 Ga0307513_10646326 Ga0307513_106463262 132
468 3300031730 Ga0307516_10005959 Ga0307516_100059598 132
469 3300031730 Ga0307516_10422311 Ga0307516_104223112 132
470 3300031901 Ga0307406_10208539 Ga0307406_102085392 132
471 3300031995 Ga0307409_100049671 Ga0307409_1000496712 132
472 3300032002 Ga0307416_101239349 Ga0307416_1012393492 132
473 3300034820 Ga0373959_0026264 Ga0373959_0026264_146_583 132
474 3300034957 Ga0373938_0044718 Ga0373938_0044718_31_465 132
475 3300035092 Ga0373952_0028043 Ga0373952_0028043_573_1007 132
476 3300035114 Ga0373939_0193460 Ga0373939_0193460_116_550 132
477 3300035207 Ga0373942_0063294 Ga0373942_0063294_383_829 132
478 3300035207 Ga0373942_0068303 Ga0373942_0068303_516_950 132
479 3300035691 Ga0373931_0015184 Ga0373931_0015184_2354_2788 132
480 3300035691 Ga0373931_0223677 Ga0373931_0223677_167_604 132
481 3300035695 Ga0373927_0741036 Ga0373927_0741036_80_517 132
482 3300037418 Ga0395900_0760243 Ga0395900_0760243_256_693 132
483 3300037466 Ga0395898_0008225 Ga0395898_0008225_2004_2441 132
484 3300039450 Ga0436363_1612144 Ga0436363_1612144_599_1033 132
485 3300041413 Ga0439465_0131814 Ga0439465_0131814_400_825 132
486 3300041486 Ga0451807_0187731 Ga0451807_0187731_945_1382 132
487 3300041512 Ga0451853_0229046 Ga0451853_0229046_221_661 132
488 3300042876 Ga0451577_0033031 Ga0451577_0033031_3130_3615 132
489 3300044712 Ga0453684_0124246 Ga0453684_0124246_1610_2095 132
490 3300044712 Ga0453684_0283535 Ga0453684_0283535_1297_1743 132
491 3300044842 Ga0466957_0264742 Ga0466957_0264742_111_548 132
492 3300045976 Ga0466967_0501233 Ga0466967_0501233_424_861 132
493 3300046475 Ga0495639_0054839 Ga0495639_0054839_855_1292 132
494 3300046537 Ga0495598_0019933 Ga0495598_0019933_796_1230 132
495 3300046539 Ga0495621_0030161 Ga0495621_0030161_560_994 132
496 3300046642 Ga0495634_0149197 Ga0495634_0149197_263_700 132
497 3300046691 Ga0495670_0401785 Ga0495670_0401785_34_468 132
498 3300047472 Ga0495686_0003802 Ga0495686_0003802_9232_9669 132
499 3300048088 Ga0495602_0484990 Ga0495602_0484990_209_646 132
500 3300048090 Ga0495615_0205635 Ga0495615_0205635_22_456 132
501 3300048903 Ga0496100_0731449 Ga0496100_0731449_295_729 132
502 3300048904 Ga0496101_0008869 Ga0496101_0008869_1472_1906 132
503 3300048904 Ga0496101_0771316 Ga0496101_0771316_286_723 132
504 3300048907 Ga0496104_0210094 Ga0496104_0210094_225_674 132
505 3300048907 Ga0496104_0691302 Ga0496104_0691302_297_734 132
506 3300048909 Ga0496106_0004162 Ga0496106_0004162_414_848 132
507 3300048910 Ga0496107_0012377 Ga0496107_0012377_4976_5410 132
508 3300048911 Ga0496108_0057165 Ga0496108_0057165_1735_2187 132
509 3300048911 Ga0496108_0642548 Ga0496108_0642548_315_752 132
510 3300048912 Ga0496109_0092481 Ga0496109_0092481_1739_2191 132
511 3300048913 Ga0496110_0147708 Ga0496110_0147708_1194_1628 132
512 3300048914 Ga0496111_0302090 Ga0496111_0302090_520_954 132
513 3300048915 Ga0496112_0063967 Ga0496112_0063967_1913_2347 132
514 3300048917 Ga0496114_0286169 Ga0496114_0286169_280_714 132
515 3300048918 Ga0496115_0002077 Ga0496115_0002077_13830_14264 132
516 3300048929 Ga0496126_0628469 Ga0496126_0628469_320_757 132
517 3300049569 Ga0501032_0419365 Ga0501032_0419365_292_720 132
518 3300050493 nmdc:mga0k408_139278_c1 nmdc:mga0k408_139278_c1_235_660 132
519 3300050493 nmdc:mga0k408_97084_c1 nmdc:mga0k408_97084_c1_595_1032 132
520 3300050494 nmdc:mga06z11_37405_c1 nmdc:mga06z11_37405_c1_564_989 132
521 3300050496 nmdc:mga07m45_48072_c1 nmdc:mga07m45_48072_c1_458_895 132
522 3300050496 nmdc:mga07m45_58967_c1 nmdc:mga07m45_58967_c1_1293_1718 132
523 3300053080 Ga0500635_0000289 Ga0500635_0000289_2084_2521 132
524 3300053111 Ga0500572_198351 Ga0500572_198351_118_555 132
525 3300053122 Ga0500608_018865 Ga0500608_018865_2292_2729 132
526 3300053136 Ga0500559_0154079 Ga0500559_0154079_471_908 132
527 3300053177 Ga0500636_0177401 Ga0500636_0177401_513_950 132
528 3300059477 Ga0587084_008625 Ga0587084_008625_183_620 132
529 3300059478 Ga0587093_017088 Ga0587093_017088_420_857 132
530 3300059493 Ga0587077_015148 Ga0587077_015148_508_945 132
531 3300059503 Ga0587080_038820 Ga0587080_038820_303_740 132
532 3300059504 Ga0587082_043019 Ga0587082_043019_70_507 132
533 3300059505 Ga0587083_0027171 Ga0587083_0027171_489_926 132
534 3300059639 Ga0587062_030232 Ga0587062_030232_145_582 132
535 3300059641 Ga0587068_006413 Ga0587068_006413_113_550 132
536 3300059642 Ga0587069_041970 Ga0587069_041970_248_685 132
537 3300059645 Ga0587076_025679 Ga0587076_025679_162_599 132
538 3300059645 Ga0587076_073087 Ga0587076_073087_225_668 132
539 3300059657 Ga0587118_00497 Ga0587118_00497_124_561 132
540 3300059660 Ga0587124_003541 Ga0587124_003541_644_1081 132
541 3300060344 Ga0587071_046243 Ga0587071_046243_318_755 132
542 3300060346 Ga0587111_0017584 Ga0587111_0017584_563_1000 132
543 3300060346 Ga0587111_0132451 Ga0587111_0132451_70_507 132
544 3300003759 Ga0055525_1000038 Ga0055525_100003840 133
545 3300005327 Ga0070658_10416578 Ga0070658_104165782 133
546 3300005330 Ga0070690_101121428 Ga0070690_1011214281 133
547 3300005331 Ga0070670_100255309 Ga0070670_1002553092 133
548 3300005334 Ga0068869_100129683 Ga0068869_1001296833 133
549 3300005334 Ga0068869_100140779 Ga0068869_1001407792 133
550 3300005335 Ga0070666_10071419 Ga0070666_100714192 133
551 3300005338 Ga0068868_100003711 Ga0068868_10000371112 133
552 3300005338 Ga0068868_100142665 Ga0068868_1001426653 133
553 3300005341 Ga0070691_10600060 Ga0070691_106000601 133
554 3300005353 Ga0070669_100557682 Ga0070669_1005576822 133
555 3300005354 Ga0070675_100003213 Ga0070675_1000032133 133
556 3300005355 Ga0070671_100037342 Ga0070671_1000373425 133
557 3300005355 Ga0070671_100512187 Ga0070671_1005121872 133
558 3300005365 Ga0070688_100069655 Ga0070688_1000696553 133
559 3300005367 Ga0070667_100027116 Ga0070667_1000271163 133
560 3300005367 Ga0070667_100165619 Ga0070667_1001656193 133
561 3300005367 Ga0070667_100505867 Ga0070667_1005058672 133
562 3300005367 Ga0070667_100753752 Ga0070667_1007537522 133
563 3300005438 Ga0070701_10253011 Ga0070701_102530112 133
564 3300005455 Ga0070663_100003281 Ga0070663_10000328110 133
565 3300005456 Ga0070678_100093252 Ga0070678_1000932524 133
566 3300005457 Ga0070662_100008348 Ga0070662_1000083482 133
567 3300005457 Ga0070662_100158527 Ga0070662_1001585271 133
568 3300005457 Ga0070662_100815651 Ga0070662_1008156512 133
569 3300005459 Ga0068867_100150509 Ga0068867_1001505092 133
570 3300005459 Ga0068867_100625785 Ga0068867_1006257852 133
571 3300005466 Ga0070685_10028648 Ga0070685_100286483 133
572 3300005548 Ga0070665_100135161 Ga0070665_1001351613 133
573 3300005577 Ga0068857_100707434 Ga0068857_1007074342 133
574 3300005578 Ga0068854_100371822 Ga0068854_1003718222 133
575 3300005615 Ga0070702_100451528 Ga0070702_1004515282 133
576 3300005616 Ga0068852_100069007 Ga0068852_1000690073 133
577 3300005616 Ga0068852_100190849 Ga0068852_1001908492 133
578 3300005617 Ga0068859_100178882 Ga0068859_1001788822 133
579 3300005617 Ga0068859_100704282 Ga0068859_1007042822 133
580 3300005618 Ga0068864_100008283 Ga0068864_1000082838 133
581 3300005718 Ga0068866_10022876 Ga0068866_100228764 133
582 3300005718 Ga0068866_10520103 Ga0068866_105201032 133
583 3300005834 Ga0068851_10023499 Ga0068851_100234994 133
584 3300005841 Ga0068863_100024285 Ga0068863_1000242856 133
585 3300005842 Ga0068858_100001818 Ga0068858_10000181813 133
586 3300005843 Ga0068860_100057253 Ga0068860_1000572535 133
587 3300005843 Ga0068860_101969729 Ga0068860_1019697292 133
588 3300006051 Ga0075364_10567811 Ga0075364_105678112 133
589 3300006163 Ga0070715_10030856 Ga0070715_100308563 133
590 3300006177 Ga0075362_10107294 Ga0075362_101072943 133
591 3300006177 Ga0075362_10111955 Ga0075362_101119552 133
592 3300006186 Ga0075369_10273240 Ga0075369_102732402 133
593 3300006195 Ga0075366_10025896 Ga0075366_100258966 133
594 3300006237 Ga0097621_100901532 Ga0097621_1009015322 133
595 3300006353 Ga0075370_10000524 Ga0075370_100005242 133
596 3300006353 Ga0075370_10131310 Ga0075370_101313101 133
597 3300006353 Ga0075370_10185102 Ga0075370_101851023 133
598 3300006353 Ga0075370_10531865 Ga0075370_105318651 133
599 3300006358 Ga0068871_100888264 Ga0068871_1008882642 133
600 3300006931 Ga0097620_100178887 Ga0097620_1001788872 133
601 3300006931 Ga0097620_100704274 Ga0097620_1007042742 133
602 3300009093 Ga0105240_10039246 Ga0105240_100392464 133
603 3300009098 Ga0105245_10295690 Ga0105245_102956902 133
604 3300009148 Ga0105243_12100113 Ga0105243_121001131 133
605 3300009174 Ga0105241_10858465 Ga0105241_108584652 133
606 3300009177 Ga0105248_10119484 Ga0105248_101194842 133
607 3300009177 Ga0105248_10176473 Ga0105248_101764733 133
608 3300009545 Ga0105237_10014977 Ga0105237_100149774 133
609 3300009551 Ga0105238_10209691 Ga0105238_102096912 133
610 3300010375 Ga0105239_10114097 Ga0105239_101140975 133
611 3300013296 Ga0157374_10047442 Ga0157374_100474422 133
612 3300013306 Ga0163162_10244035 Ga0163162_102440353 133
613 3300013308 Ga0157375_10024076 Ga0157375_100240765 133
614 3300014326 Ga0157380_10116060 Ga0157380_101160603 133
615 3300014326 Ga0157380_11770187 Ga0157380_117701871 133
616 3300014745 Ga0157377_10480155 Ga0157377_104801552 133
617 3300014968 Ga0157379_10031084 Ga0157379_100310845 133
618 3300014969 Ga0157376_10100852 Ga0157376_101008523 133
619 3300021361 Ga0213872_10000070 Ga0213872_1000007019 133
620 3300025226 Ga0209674_110264 Ga0209674_1102641 133
621 3300025230 Ga0209563_100005 Ga0209563_1000051232 133
622 3300025271 Ga0207666_1025448 Ga0207666_10254482 133
623 3300025303 Ga0209051_1004175 Ga0209051_10041753 133
624 3300025303 Ga0209051_1007173 Ga0209051_10071737 133
625 3300025304 Ga0209257_1000182 Ga0209257_100018246 133
626 3300025321 Ga0207656_10051038 Ga0207656_100510383 133
627 3300025893 Ga0207682_10067933 Ga0207682_100679332 133
628 3300025899 Ga0207642_10006194 Ga0207642_100061943 133
629 3300025899 Ga0207642_10444082 Ga0207642_104440822 133
630 3300025903 Ga0207680_10002216 Ga0207680_100022163 133
631 3300025908 Ga0207643_10137116 Ga0207643_101371162 133
632 3300025914 Ga0207671_10074449 Ga0207671_100744494 133
633 3300025924 Ga0207694_10923096 Ga0207694_109230962 133
634 3300025925 Ga0207650_10102612 Ga0207650_101026123 133
635 3300025927 Ga0207687_10360110 Ga0207687_103601103 133
636 3300025931 Ga0207644_10024225 Ga0207644_100242255 133
637 3300025933 Ga0207706_10007829 Ga0207706_1000782910 133
638 3300025933 Ga0207706_10212182 Ga0207706_102121822 133
639 3300025936 Ga0207670_10038375 Ga0207670_100383753 133
640 3300025941 Ga0207711_10674490 Ga0207711_106744902 133
641 3300025942 Ga0207689_10050658 Ga0207689_100506585 133
642 3300025942 Ga0207689_10530271 Ga0207689_105302711 133
643 3300025981 Ga0207640_10300170 Ga0207640_103001703 133
644 3300025986 Ga0207658_10015284 Ga0207658_100152846 133
645 3300025986 Ga0207658_10270165 Ga0207658_102701652 133
646 3300025986 Ga0207658_10431244 Ga0207658_104312442 133
647 3300026023 Ga0207677_10000452 Ga0207677_100004523 133
648 3300026035 Ga0207703_10003262 Ga0207703_1000326213 133
649 3300026067 Ga0207678_10002363 Ga0207678_1000236313 133
650 3300026088 Ga0207641_10038644 Ga0207641_100386443 133
651 3300026095 Ga0207676_10042218 Ga0207676_100422184 133
652 3300026116 Ga0207674_10403467 Ga0207674_104034673 133
653 3300026121 Ga0207683_10114109 Ga0207683_101141093 133
654 3300026142 Ga0207698_10185317 Ga0207698_101853173 133
655 3300027682 Ga0209971_1073590 Ga0209971_10735902 133
656 3300028380 Ga0268265_12584540 Ga0268265_125845401 133
657 3300028381 Ga0268264_10357684 Ga0268264_103576841 133
658 3300031456 Ga0307513_10074895 Ga0307513_100748953 133
659 3300031616 Ga0307508_10273389 Ga0307508_102733892 133
660 3300031731 Ga0307405_11375715 Ga0307405_113757151 133
661 3300031903 Ga0307407_10680368 Ga0307407_106803681 133
662 3300031911 Ga0307412_11546777 Ga0307412_115467771 133
663 3300031995 Ga0307409_102495383 Ga0307409_1024953831 133
664 3300035089 Ga0373944_0118979 Ga0373944_0118979_50_487 133
665 3300035171 Ga0373946_0402877 Ga0373946_0402877_78_515 133
666 3300035725 Ga0373947_0184495 Ga0373947_0184495_356_793 133
667 3300036401 Ga0373937_0538404 Ga0373937_0538404_369_806 133
668 3300037068 Ga0373925_0567951 Ga0373925_0567951_53_490 133
669 3300037471 Ga0395905_0011653 Ga0395905_0011653_85_528 133
670 3300039447 Ga0436361_0154722 Ga0436361_0154722_1078_1518 133
671 3300041512 Ga0451853_2156438 Ga0451853_2156438_241_681 133
672 3300041997 Ga0439431_0073332 Ga0439431_0073332_340_768 133
673 3300042008 Ga0439450_170667 Ga0439450_170667_68_496 133
674 3300042134 Ga0450898_014883 Ga0450898_014883_137_565 133
675 3300042156 Ga0439446_0117296 Ga0439446_0117296_331_759 133
676 3300042157 Ga0439458_0091746 Ga0439458_0091746_177_605 133
677 3300042876 Ga0451577_0291388 Ga0451577_0291388_877_1305 133
678 3300042876 Ga0451577_0833937 Ga0451577_0833937_68_496 133
679 3300044712 Ga0453684_0007748 Ga0453684_0007748_7411_7836 133
680 3300044712 Ga0453684_0051049 Ga0453684_0051049_1047_1475 133
681 3300044712 Ga0453684_0131943 Ga0453684_0131943_2273_2698 133
682 3300045051 Ga0451576_0016908 Ga0451576_0016908_1865_2290 133
683 3300046455 Ga0495603_0211836 Ga0495603_0211836_183_620 133
684 3300046471 Ga0495650_0103274 Ga0495650_0103274_13_444 133
685 3300046473 Ga0495582_0490898 Ga0495582_0490898_183_620 133
686 3300046501 Ga0495607_0419577 Ga0495607_0419577_135_563 133
687 3300046522 Ga0495643_0107067 Ga0495643_0107067_392_820 133
688 3300046535 Ga0495586_0298009 Ga0495586_0298009_252_689 133
689 3300046648 Ga0495611_0571555 Ga0495611_0571555_63_491 133
690 3300046681 Ga0495647_0190483 Ga0495647_0190483_194_631 133
691 3300046683 Ga0495658_0044987 Ga0495658_0044987_1181_1618 133
692 3300047443 Ga0495687_002064 Ga0495687_002064_10081_10509 133
693 3300048091 Ga0495626_0228171 Ga0495626_0228171_299_727 133
694 3300048903 Ga0496100_0190731 Ga0496100_0190731_783_1220 133
695 3300048908 Ga0496105_0170201 Ga0496105_0170201_472_909 133
696 3300048912 Ga0496109_0928429 Ga0496109_0928429_296_733 133
697 3300048913 Ga0496110_0244564 Ga0496110_0244564_661_1098 133
698 3300048917 Ga0496114_0165229 Ga0496114_0165229_1203_1640 133
699 3300048918 Ga0496115_0487713 Ga0496115_0487713_527_964 133
700 3300048927 Ga0496124_0001253 Ga0496124_0001253_20179_20634 133
701 3300048928 Ga0496125_0370834 Ga0496125_0370834_275_730 133
702 3300049572 Ga0501036_0692126 Ga0501036_0692126_85_513 133
703 3300049760 Ga0501263_048478 Ga0501263_048478_66_503 133
704 3300050489 nmdc:mga03683_12587_c1 nmdc:mga03683_12587_c1_1988_2416 133
705 3300050493 nmdc:mga0k408_18200_c2 nmdc:mga0k408_18200_c2_695_1126 133
706 3300050493 nmdc:mga0k408_209775_c1 nmdc:mga0k408_209775_c1_684_1130 133
707 3300050493 nmdc:mga0k408_26610_c1 nmdc:mga0k408_26610_c1_1826_2254 133
708 3300050493 nmdc:mga0k408_271462_c1 nmdc:mga0k408_271462_c1_185_610 133
709 3300050493 nmdc:mga0k408_40302_c1 nmdc:mga0k408_40302_c1_2182_2610 133
710 3300050494 nmdc:mga06z11_214599_c1 nmdc:mga06z11_214599_c1_179_607 133
711 3300050496 nmdc:mga07m45_18856_c1 nmdc:mga07m45_18856_c1_1602_2045 133
712 3300050496 nmdc:mga07m45_4213_c1 nmdc:mga07m45_4213_c1_3332_3760 133
713 3300050496 nmdc:mga07m45_76504_c1 nmdc:mga07m45_76504_c1_789_1226 133
714 3300050496 nmdc:mga07m45_9233_c1 nmdc:mga07m45_9233_c1_4090_4518 133
715 3300002705 JGI25156J39149_1004359 JGI25156J39149_10043595 134
716 3300002738 JGI25154J39366_1001425 JGI25154J39366_10014257 134
717 3300003751 Ga0055538_1003953 Ga0055538_10039532 134
718 3300003752 Ga0055539_1008866 Ga0055539_10088662 134
719 3300003756 Ga0055533_1004066 Ga0055533_10040663 134
720 3300003762 Ga0055542_1001267 Ga0055542_10012678 134
721 3300003841 Ga0055541_1000163 Ga0055541_100016317 134
722 3300005331 Ga0070670_100161505 Ga0070670_1001615053 134
723 3300005338 Ga0068868_100059788 Ga0068868_1000597882 134
724 3300005456 Ga0070678_100422332 Ga0070678_1004223321 134
725 3300005457 Ga0070662_100008670 Ga0070662_1000086703 134
726 3300005468 Ga0070707_100771912 Ga0070707_1007719122 134
727 3300005548 Ga0070665_100188616 Ga0070665_1001886163 134
728 3300005616 Ga0068852_101134046 Ga0068852_1011340462 134
729 3300005618 Ga0068864_101070383 Ga0068864_1010703832 134
730 3300005841 Ga0068863_100372012 Ga0068863_1003720123 134
731 3300005841 Ga0068863_100377215 Ga0068863_1003772152 134
732 3300005843 Ga0068860_100317511 Ga0068860_1003175112 134
733 3300005843 Ga0068860_100878965 Ga0068860_1008789651 134
734 3300005844 Ga0068862_100016575 Ga0068862_1000165758 134
735 3300006038 Ga0075365_10315211 Ga0075365_103152112 134
736 3300006048 Ga0075363_100073012 Ga0075363_1000730122 134
737 3300006178 Ga0075367_10051425 Ga0075367_100514253 134
738 3300006186 Ga0075369_10013367 Ga0075369_100133676 134
739 3300006195 Ga0075366_10002085 Ga0075366_100020859 134
740 3300006195 Ga0075366_10111259 Ga0075366_101112593 134
741 3300006353 Ga0075370_10080520 Ga0075370_100805202 134
742 3300006353 Ga0075370_10154210 Ga0075370_101542103 134
743 3300006358 Ga0068871_100692803 Ga0068871_1006928031 134
744 3300009098 Ga0105245_10281211 Ga0105245_102812112 134
745 3300009553 Ga0105249_10325198 Ga0105249_103251982 134
746 3300013297 Ga0157378_10438143 Ga0157378_104381432 134
747 3300013308 Ga0157375_10275572 Ga0157375_102755722 134
748 3300014968 Ga0157379_10297734 Ga0157379_102977342 134
749 3300014969 Ga0157376_10428805 Ga0157376_104288052 134
750 3300025224 Ga0209784_100284 Ga0209784_10028412 134
751 3300025225 Ga0209566_100262 Ga0209566_10026229 134
752 3300025226 Ga0209674_100200 Ga0209674_10020044 134
753 3300025230 Ga0209563_113405 Ga0209563_1134052 134
754 3300025246 Ga0209646_1000046 Ga0209646_100004652 134
755 3300025250 Ga0209026_1006887 Ga0209026_10068873 134
756 3300025253 Ga0209677_103365 Ga0209677_1033655 134
757 3300025254 Ga0209148_1000110 Ga0209148_1000110157 134
758 3300025256 Ga0209759_1006693 Ga0209759_10066932 134
759 3300025920 Ga0207649_10061744 Ga0207649_100617443 134
760 3300025931 Ga0207644_10041723 Ga0207644_100417234 134
761 3300025933 Ga0207706_10014450 Ga0207706_100144506 134
762 3300025938 Ga0207704_10087739 Ga0207704_100877393 134
763 3300025941 Ga0207711_10280431 Ga0207711_102804313 134
764 3300025942 Ga0207689_10515849 Ga0207689_105158491 134
765 3300025986 Ga0207658_11917371 Ga0207658_119173711 134
766 3300026088 Ga0207641_10259863 Ga0207641_102598633 134
767 3300026095 Ga0207676_10803623 Ga0207676_108036232 134
768 3300026095 Ga0207676_11149406 Ga0207676_111494062 134
769 3300026121 Ga0207683_11252312 Ga0207683_112523122 134
770 3300027717 Ga0209998_10112518 Ga0209998_101125182 134
771 3300028379 Ga0268266_10037082 Ga0268266_100370824 134
772 3300028379 Ga0268266_10264699 Ga0268266_102646992 134
773 3300028380 Ga0268265_10013319 Ga0268265_100133194 134
774 3300028381 Ga0268264_10371900 Ga0268264_103719003 134
775 3300028786 Ga0307517_10182036 Ga0307517_101820362 134
776 3300028794 Ga0307515_10000232 Ga0307515_1000023254 134
777 3300028794 Ga0307515_10007649 Ga0307515_100076492 134
778 3300028794 Ga0307515_10009711 Ga0307515_1000971115 134
779 3300028794 Ga0307515_10208140 Ga0307515_102081401 134
780 3300030522 Ga0307512_10030983 Ga0307512_100309832 134
781 3300031456 Ga0307513_10065125 Ga0307513_100651254 134
782 3300031456 Ga0307513_10070103 Ga0307513_100701032 134
783 3300031507 Ga0307509_10717002 Ga0307509_107170022 134
784 3300031616 Ga0307508_10001467 Ga0307508_1000146727 134
785 3300031649 Ga0307514_10119814 Ga0307514_101198143 134
786 3300031730 Ga0307516_10024129 Ga0307516_100241292 134
787 3300031730 Ga0307516_10128425 Ga0307516_101284251 134
788 3300032004 Ga0307414_10557851 Ga0307414_105578512 134
789 3300033179 Ga0307507_10177933 Ga0307507_101779332 134
790 3300035117 Ga0373953_0358069 Ga0373953_0358069_183_614 134
791 3300035171 Ga0373946_0108813 Ga0373946_0108813_101_532 134
792 3300036401 Ga0373937_0270688 Ga0373937_0270688_487_918 134
793 3300037068 Ga0373925_0112972 Ga0373925_0112972_986_1423 134
794 3300037418 Ga0395900_0000234 Ga0395900_0000234_12030_12473 134
795 3300037466 Ga0395898_0002077 Ga0395898_0002077_12075_12518 134
796 3300037853 Ga0436364_1272445 Ga0436364_1272445_62_505 134
797 3300041441 Ga0451787_055325 Ga0451787_055325_967_1404 134
798 3300041443 Ga0451789_0302159 Ga0451789_0302159_110_547 134
799 3300041452 Ga0451793_1056955 Ga0451793_1056955_315_752 134
800 3300041494 Ga0451837_1086989 Ga0451837_1086989_10_450 134
801 3300041496 Ga0451839_0443244 Ga0451839_0443244_313_750 134
802 3300041505 Ga0451849_0824555 Ga0451849_0824555_532_969 134
803 3300041507 Ga0451851_0900736 Ga0451851_0900736_111_548 134
804 3300041509 Ga0451843_0845768 Ga0451843_0845768_201_638 134
805 3300041511 Ga0451855_1365320 Ga0451855_1365320_110_547 134
806 3300041512 Ga0451853_3367089 Ga0451853_3367089_171_608 134
807 3300044656 Ga0466969_0058897 Ga0466969_0058897_166_606 134
808 3300044658 Ga0466972_0001344 Ga0466972_0001344_500_949 134
809 3300044684 Ga0466966_0015315 Ga0466966_0015315_2983_3423 134
810 3300044693 Ga0466961_0051128 Ga0466961_0051128_1206_1646 134
811 3300044694 Ga0466963_0000935 Ga0466963_0000935_11620_12060 134
812 3300044706 Ga0466964_0003021 Ga0466964_0003021_3179_3619 134
813 3300044706 Ga0466964_0056316 Ga0466964_0056316_836_1285 134
814 3300044719 Ga0466971_0020029 Ga0466971_0020029_1200_1640 134
815 3300044765 Ga0466970_0020698 Ga0466970_0020698_2504_2944 134
816 3300044842 Ga0466957_0055711 Ga0466957_0055711_148_588 134
817 3300045049 Ga0466959_0013106 Ga0466959_0013106_3580_4020 134
818 3300045051 Ga0451576_0152761 Ga0451576_0152761_440_970 134
819 3300045836 Ga0466958_0080601 Ga0466958_0080601_477_917 134
820 3300045976 Ga0466967_0021184 Ga0466967_0021184_470_910 134
821 3300046457 Ga0495590_0084021 Ga0495590_0084021_172_603 134
822 3300046460 Ga0495638_0224989 Ga0495638_0224989_466_897 134
823 3300046471 Ga0495650_0002988 Ga0495650_0002988_3396_3833 134
824 3300046491 Ga0495584_0352193 Ga0495584_0352193_175_606 134
825 3300046512 Ga0495610_0093618 Ga0495610_0093618_156_593 134
826 3300046515 Ga0495620_0010669 Ga0495620_0010669_282_719 134
827 3300046519 Ga0495632_0010962 Ga0495632_0010962_3324_3755 134
828 3300046519 Ga0495632_0386400 Ga0495632_0386400_72_509 134
829 3300046616 Ga0495668_0060772 Ga0495668_0060772_685_1116 134
830 3300046660 Ga0495625_0002387 Ga0495625_0002387_356_793 134
831 3300046660 Ga0495625_0021963 Ga0495625_0021963_1934_2365 134
832 3300046664 Ga0495659_0329924 Ga0495659_0329924_74_505 134
833 3300046683 Ga0495658_0206479 Ga0495658_0206479_407_844 134
834 3300046694 Ga0495649_0001371 Ga0495649_0001371_963_1394 134
835 3300046810 Ga0495660_0035861 Ga0495660_0035861_1990_2421 134
836 3300047443 Ga0495687_005696 Ga0495687_005696_3914_4345 134
837 3300047445 Ga0495677_0047753 Ga0495677_0047753_1040_1471 134
838 3300047447 Ga0495685_234545 Ga0495685_234545_76_507 134
839 3300047472 Ga0495686_0032063 Ga0495686_0032063_762_1199 134
840 3300048091 Ga0495626_0048720 Ga0495626_0048720_865_1296 134
841 3300048916 Ga0496113_0191649 Ga0496113_0191649_608_1045 134
842 3300048927 Ga0496124_0039147 Ga0496124_0039147_931_1374 134
843 3300049460 Ga0495682_0165290 Ga0495682_0165290_308_739 134
844 3300049575 Ga0501039_1299034 Ga0501039_1299034_28_462 134
845 3300049822 Ga0501035_0068336 Ga0501035_0068336_1737_2186 134
846 3300049822 Ga0501035_0493179 Ga0501035_0493179_302_736 134
847 3300050492 nmdc:mga0yw44_364058_c1 nmdc:mga0yw44_364058_c1_137_568 134
848 3300050493 nmdc:mga0k408_250930_c1 nmdc:mga0k408_250930_c1_233_679 134
849 3300050493 nmdc:mga0k408_46145_c1 nmdc:mga0k408_46145_c1_992_1429 134
850 3300050493 nmdc:mga0k408_6644_c1 nmdc:mga0k408_6644_c1_2954_3385 134
851 3300050494 nmdc:mga06z11_14427_c1 nmdc:mga06z11_14427_c1_942_1373 134
852 3300050496 nmdc:mga07m45_25851_c1 nmdc:mga07m45_25851_c1_970_1401 134
853 3300050516 nmdc:mga0sz30_5056_c1 nmdc:mga0sz30_5056_c1_1832_2263 134
854 3300053086 Ga0500578_0287913 Ga0500578_0287913_509_940 134
855 3300053092 Ga0500583_0247630 Ga0500583_0247630_386_823 134
856 3300053134 Ga0500658_0006983 Ga0500658_0006983_1816_2247 134
857 3300059421 Ga0590071_019067 Ga0590071_019067_666_1106 134
858 3300059424 Ga0590075_036240 Ga0590075_036240_70_510 134
859 3300061719 Ga0466962_0055459 Ga0466962_0055459_977_1417 134
860 3300005539 Ga0068853_100282685 Ga0068853_1002826852 135
861 3300005617 Ga0068859_100980946 Ga0068859_1009809462 135
862 3300005844 Ga0068862_100028605 Ga0068862_1000286056 135
863 3300006931 Ga0097620_100980990 Ga0097620_1009809902 135
864 3300009148 Ga0105243_10195115 Ga0105243_101951152 135
865 3300025914 Ga0207671_10125132 Ga0207671_101251322 135
866 3300025933 Ga0207706_10531508 Ga0207706_105315082 135
867 3300025935 Ga0207709_10301342 Ga0207709_103013422 135
868 3300025938 Ga0207704_10777717 Ga0207704_107777171 135
869 3300025940 Ga0207691_10012093 Ga0207691_100120935 135
870 3300025949 Ga0207667_11566063 Ga0207667_115660631 135
871 3300025960 Ga0207651_10029434 Ga0207651_100294344 135
872 3300025986 Ga0207658_10280466 Ga0207658_102804663 135
873 3300026023 Ga0207677_10060276 Ga0207677_100602763 135
874 3300026089 Ga0207648_10039788 Ga0207648_100397883 135
875 3300026089 Ga0207648_10135139 Ga0207648_101351393 135
876 3300026116 Ga0207674_10009428 Ga0207674_100094288 135
877 3300026121 Ga0207683_10228875 Ga0207683_102288752 135
878 3300028380 Ga0268265_10020524 Ga0268265_100205246 135
879 3300028786 Ga0307517_10026165 Ga0307517_100261659 135
880 3300031456 Ga0307513_10513456 Ga0307513_105134562 135
881 3300031507 Ga0307509_10003083 Ga0307509_100030832 135
882 3300031507 Ga0307509_10162846 Ga0307509_101628462 135
883 3300031507 Ga0307509_10165756 Ga0307509_101657563 135
884 3300031616 Ga0307508_10000016 Ga0307508_1000001638 135
885 3300031649 Ga0307514_10037190 Ga0307514_100371904 135
886 3300031649 Ga0307514_10106657 Ga0307514_101066573 135
887 3300031649 Ga0307514_10183502 Ga0307514_101835022 135
888 3300031730 Ga0307516_10004400 Ga0307516_1000440017 135
889 3300031730 Ga0307516_10074947 Ga0307516_100749473 135
890 3300031730 Ga0307516_10600477 Ga0307516_106004772 135
891 3300031824 Ga0307413_10699676 Ga0307413_106996762 135
892 3300031852 Ga0307410_10980208 Ga0307410_109802082 135
893 3300031901 Ga0307406_10125933 Ga0307406_101259333 135
894 3300032002 Ga0307416_100430129 Ga0307416_1004301293 135
895 3300033179 Ga0307507_10423621 Ga0307507_104236211 135
896 3300035091 Ga0373951_0274210 Ga0373951_0274210_48_491 135
897 3300035112 Ga0373932_0107511 Ga0373932_0107511_194_637 135
898 3300035114 Ga0373939_0146702 Ga0373939_0146702_160_603 135
899 3300035242 Ga0373962_0249575 Ga0373962_0249575_10_453 135
900 3300035691 Ga0373931_0062197 Ga0373931_0062197_865_1308 135
901 3300035695 Ga0373927_0076004 Ga0373927_0076004_113_556 135
902 3300037068 Ga0373925_0015098 Ga0373925_0015098_4030_4473 135
903 3300039437 Ga0436365_0569739 Ga0436365_0569739_1014_1460 135
904 3300041456 Ga0451795_0667820 Ga0451795_0667820_258_701 135
905 3300045051 Ga0451576_0653811 Ga0451576_0653811_138_563 135
906 3300045051 Ga0451576_1839157 Ga0451576_1839157_138_563 135
907 3300046454 Ga0495592_0000213 Ga0495592_0000213_32585_33028 135
908 3300046461 Ga0495641_0082809 Ga0495641_0082809_186_629 135
909 3300046473 Ga0495582_0434731 Ga0495582_0434731_205_648 135
910 3300046475 Ga0495639_0185617 Ga0495639_0185617_161_604 135
911 3300046492 Ga0495585_0160372 Ga0495585_0160372_672_1112 135
912 3300046516 Ga0495628_0568213 Ga0495628_0568213_220_663 135
913 3300046517 Ga0495630_0227592 Ga0495630_0227592_488_931 135
914 3300046557 Ga0495622_0049976 Ga0495622_0049976_1317_1760 135
915 3300046690 Ga0495624_0377780 Ga0495624_0377780_220_663 135
916 3300046694 Ga0495649_0188822 Ga0495649_0188822_406_849 135
917 3300047317 Ga0495604_0379136 Ga0495604_0379136_89_532 135
918 3300047321 Ga0495676_0078953 Ga0495676_0078953_530_973 135
919 3300047469 Ga0495673_0101795 Ga0495673_0101795_513_953 135
920 3300047673 Ga0495593_0023044 Ga0495593_0023044_1253_1696 135
921 3300048089 Ga0495614_0052657 Ga0495614_0052657_788_1231 135
922 3300048907 Ga0496104_0694182 Ga0496104_0694182_73_516 135
923 3300048909 Ga0496106_0012991 Ga0496106_0012991_5104_5544 135
924 3300053093 Ga0500651_0127767 Ga0500651_0127767_394_837 135
925 3300053138 Ga0500564_096406 Ga0500564_096406_424_867 135
926 3300053154 Ga0500619_000073 Ga0500619_000073_2430_2867 135
927 3300006195 Ga0075366_10722505 Ga0075366_107225051 136
928 3300006846 Ga0075430_100023009 Ga0075430_1000230096 136
929 3300006880 Ga0075429_100008966 Ga0075429_1000089664 136
930 3300009147 Ga0114129_11533893 Ga0114129_115338932 136
931 3300031456 Ga0307513_10365268 Ga0307513_103652683 136
932 3300031507 Ga0307509_10125033 Ga0307509_101250332 136
933 3300031548 Ga0307408_101739835 Ga0307408_1017398352 136
934 3300035114 Ga0373939_0422373 Ga0373939_0422373_88_540 136
935 3300041459 Ga0451800_0542404 Ga0451800_0542404_122_559 136
936 3300041460 Ga0451802_0517703 Ga0451802_0517703_424_864 136
937 3300048913 Ga0496110_0227769 Ga0496110_0227769_674_1150 136
938 3300049570 Ga0501033_0313121 Ga0501033_0313121_122_622 136
939 3300050508 nmdc:mga09592_14154_c1 nmdc:mga09592_14154_c1_2286_2729 136
940 3300050509 nmdc:mga0qj67_47140_c1 nmdc:mga0qj67_47140_c1_2331_2774 136
941 3300053086 Ga0500578_0169449 Ga0500578_0169449_484_921 136
942 3300053145 Ga0500586_279206 Ga0500586_279206_37_462 136
943 3300053158 Ga0500627_0076259 Ga0500627_0076259_723_1163 136
944 3300053730 Ga0500645_007607 Ga0500645_007607_1635_2072 136
945 3300005539 Ga0068853_100089752 Ga0068853_1000897524 137
946 3300006195 Ga0075366_10178739 Ga0075366_101787392 137
947 3300006353 Ga0075370_10553542 Ga0075370_105535422 137
948 3300009176 Ga0105242_10714194 Ga0105242_107141942 137
949 3300026041 Ga0207639_11591719 Ga0207639_115917192 137
950 3300026089 Ga0207648_10571403 Ga0207648_105714032 137
951 3300026121 Ga0207683_10112158 Ga0207683_101121583 137
952 3300028794 Ga0307515_10049534 Ga0307515_100495347 137
953 3300031456 Ga0307513_10708444 Ga0307513_107084442 137
954 3300046530 Ga0495654_0002282 Ga0495654_0002282_783_1208 137
955 3300050493 nmdc:mga0k408_219125_c1 nmdc:mga0k408_219125_c1_273_725 137
956 3300053108 Ga0500562_026437 Ga0500562_026437_474_902 137
957 3300053153 Ga0500616_0129967 Ga0500616_0129967_104_535 137
958 iso_pu_bacteria 2842718218 2842721898 137
959 3300005365 Ga0070688_100617013 Ga0070688_1006170132 138
960 3300005441 Ga0070700_100649848 Ga0070700_1006498482 138
961 3300005842 Ga0068858_100425093 Ga0068858_1004250932 138
962 3300009036 Ga0105244_10333384 Ga0105244_103333842 138
963 3300017792 Ga0163161_11226008 Ga0163161_112260081 138
964 3300031548 Ga0307408_100039931 Ga0307408_1000399312 138
965 3300032002 Ga0307416_100087114 Ga0307416_1000871145 138
966 3300032005 Ga0307411_10108135 Ga0307411_101081352 138
967 3300049127 Ga0501306_026251 Ga0501306_026251_232_690 138
968 3300049518 Ga0501295_024439 Ga0501295_024439_204_656 138
969 3300049584 Ga0501068_0523170 Ga0501068_0523170_66_509 138
970 3300053148 Ga0500590_056793 Ga0500590_056793_72_515 138
971 3300028794 Ga0307515_10003451 Ga0307515_1000345116 139
972 3300030522 Ga0307512_10166710 Ga0307512_101667102 139
973 3300031456 Ga0307513_10043401 Ga0307513_100434013 139
974 3300031649 Ga0307514_10000711 Ga0307514_1000071139 139
975 3300031731 Ga0307405_10027461 Ga0307405_100274613 139
976 3300033180 Ga0307510_10076751 Ga0307510_100767514 139
977 3300048927 Ga0496124_0024540 Ga0496124_0024540_4547_4978 139
978 3300048928 Ga0496125_0007690 Ga0496125_0007690_760_1194 139
979 3300048928 Ga0496125_0026412 Ga0496125_0026412_862_1293 139
980 3300048928 Ga0496125_0221799 Ga0496125_0221799_586_1017 139
981 3300048929 Ga0496126_0164097 Ga0496126_0164097_785_1216 139
982 iso_pu_bacteria 2547132374 2548501227 139
983 iso_pu_bacteria 2643221570 2643868532 139
984 iso_pu_bacteria 2643221596 2643994631 139
985 iso_pu_bacteria 2643221609 2644061689 139
986 iso_pu_bacteria 2643221611 2644075220 139
987 iso_pu_bacteria 2643221652 2644295484 139
988 iso_pu_bacteria 2643221717 2644649228 139
989 iso_pu_bacteria 2738543012 2739243385 139
990 iso_pu_bacteria 2816332133 2816473964 139
991 iso_pu_bacteria 2990710928 2990715570 139
992 3300021361 Ga0213872_10009666 Ga0213872_100096664 140
993 3300027424 Ga0209984_1008262 Ga0209984_10082622 140
994 3300027682 Ga0209971_1008084 Ga0209971_10080843 140
995 3300027876 Ga0209974_10006661 Ga0209974_100066615 140
996 3300039447 Ga0436361_0086324 Ga0436361_0086324_13099_13530 140
997 3300049763 Ga0501266_000043 Ga0501266_000043_13026_13457 140
998 3300006946 Ga0079104_1000530 Ga0079104_100053031 141
999 3300009148 Ga0105243_10008894 Ga0105243_100088946 141
1000 3300025935 Ga0207709_10000622 Ga0207709_1000062216 141
1001 3300027111 Ga0209281_1000599 Ga0209281_100059931 141
1002 3300046542 Ga0495597_0000077 Ga0495597_0000077_15421_15852 141
1003 3300049568 Ga0501031_0003670 Ga0501031_0003670_326_787 141
1004 3300009036 Ga0105244_10242759 Ga0105244_102427591 142
1005 3300009176 Ga0105242_10002491 Ga0105242_100024919 142
1006 3300025934 Ga0207686_10015629 Ga0207686_100156297 142
1007 3300027876 Ga0209974_10000798 Ga0209974_1000079811 142
1008 3300031548 Ga0307408_100000096 Ga0307408_10000009676 142
1009 3300031548 Ga0307408_100008311 Ga0307408_10000831110 142
1010 3300031901 Ga0307406_10000669 Ga0307406_100006698 142
1011 3300041509 Ga0451843_0373713 Ga0451843_0373713_643_1080 142
1012 3300042125 Ga0450923_024293 Ga0450923_024293_332_769 142
1013 3300042136 Ga0450900_022422 Ga0450900_022422_149_586 142
1014 3300049573 Ga0501037_0214749 Ga0501037_0214749_701_1144 142
1015 3300053161 Ga0500634_0005385 Ga0500634_0005385_327_773 144
1016 3300031235 Ga0265330_10000045 Ga0265330_10000045105 145
1017 3300031238 Ga0265332_10000031 Ga0265332_10000031142 145
1018 3300031241 Ga0265325_10003774 Ga0265325_100037749 145
1019 3300031247 Ga0265340_10137053 Ga0265340_101370532 145
1020 3300031711 Ga0265314_10001461 Ga0265314_1000146115 145
1021 2162886007 SwRhRL2b_contig_337291 SwRhRL2b_0265.00000380 148
1022 3300005289 Ga0065704_10072289 Ga0065704_100722895 148
1023 3300048926 Ga0496123_0020213 Ga0496123_0020213_1010_1456 148
1024 3300048928 Ga0496125_0000542 Ga0496125_0000542_51085_51531 148
1025 3300048929 Ga0496126_0007499 Ga0496126_0007499_9635_10081 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01052

FliMN_C

Type III flagellar switch regulator (C-ring) FliN C-term

56

128

0.97

Feature Viewer

pLDDT pTM Quality
52.45 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map