F488442

General Info

Members Datasets Scaffolds Average Seq Length
1023 438 941 373

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10061872|Ga0207699_100618721
Length 423
Sequence MSVDAHRQAGGGRTLGCNGTSTNAEFASRLATSGPRLRGEGERLLVAPRVLVDATAVPADRGALGRYVDGLISALGTLEADLAVACQRADEERYGRLVPNASIVAGPTAIAHRPARLAWEQTGLPLVAQQVNADVLHAPHYTMPLRPGVPVVSTIHDLTYFTEPDAHNAVTATFFKSAIRTAARRATRLLVPSKATRDELVRVLGADPTRIDVAYHGVDHELFHRPSPERVHQVSDRLGLHDQPYVAYLGGLEPRKNVPALISAWAAAVSDLPDPPALVLGGGSGWSEEVDEAVAAVPAHLRLVRPGYLRFTDLPGFLGGAMVVAFPSRGEGFGLPVLEAMACGAPVLTTHRTSLPEVGGDAVAYTEPDAESIEAALRGLLDDPARLEALGAAGHARSQEFTWTASAEAHMASYQRAAAQRGE

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
5 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
6 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
7 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
8 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
9 2517572101 Frankia sp. DC12 Isolate Nodule
10 2527291627 Frankia casuarinae Thr Isolate Nodule
11 2527291629 Frankia sp. BMG5.23 Isolate Nodule
12 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
13 2576861822 Frankia sp. CeD Isolate Nodule
14 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
15 2619618881 Frankia sp. ACN1ag Isolate Unclassified
16 2619619003 Frankia sp. CpI1-P Isolate Nodule
17 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
18 2626541554 Frankia sp. AvcI.1 Isolate Nodule
19 2671180195 Frankia sp. CcI49 Isolate Nodule
20 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
21 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
22 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
23 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
24 2684623036 Frankia sp. CgIM4 Isolate Nodule
25 2687453737 Frankia sp. BMG5.36 Isolate Nodule
26 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
27 2710264753 Frankia sp. KB5 Isolate Nodule
28 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
29 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
30 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
31 2773857922 Frankia sp. CcI49 Isolate Nodule
32 2773857924 Frankia sp. CgIS1 Isolate Nodule
33 2773857933 Frankia sp. BMG5.30 Isolate Nodule
34 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
35 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
36 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
37 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
38 2855683550 Micromonospora sp. RP3T Isolate Unclassified
39 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
40 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
41 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
42 2858868258 Micromonospora sp. MH33 Isolate Unclassified
43 2858882152 Micromonospora noduli MED15 Isolate Nodule
44 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
45 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
46 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
47 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
48 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
49 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
50 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
51 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
52 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
53 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
54 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
55 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
56 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
57 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
58 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
59 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
60 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
61 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
62 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
63 2902582711 Micromonospora sp. AP08 Isolate Unclassified
64 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
65 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
66 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
67 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
68 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
91 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
99 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
100 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
128 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
239 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
251 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
285 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
286 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
305 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
306 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
307 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
331 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
341 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
342 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
343 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
376 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
379 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
382 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
383 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
399 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
411 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
412 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
413 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
414 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
415 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
416 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
417 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
418 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
419 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
420 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
424 637000116 Frankia casuarinae CcI3 Isolate Nodule
425 649633069 Micromonospora sp. L5 Isolate Unclassified
426 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
427 8002775197 Frankia nepalensis CN7 Isolate Nodule
428 8002784119 Frankia sp. AgB1.9 Isolate Nodule
429 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
430 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
431 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
432 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
433 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
434 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
435 8054920844 Frankia tisae Agncl-8 Isolate Nodule
436 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
437 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
438 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.74
Metatranscriptomes 2.25
Isolates 8.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 2.93
Rhizoplane 4.79
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002018 3300002459 Bacteria 4129
2 JGI25406J46586_10004614 3300003203 Bacteria 6412
3 JGI25404J52841_10000075 3300003659 Bacteria 8877
4 Ga0070658_10001118 3300005327 Bacteria 22898
5 Ga0070658_10003470 3300005327 Bacteria 12954
6 Ga0070658_10009930 3300005327 Bacteria 7647
7 Ga0070658_10017982 3300005327 Bacteria 5654
8 Ga0070683_100015194 3300005329 Bacteria 6759
9 Ga0070683_100018197 3300005329 Bacteria 6220
10 Ga0070683_100044057 3300005329 Bacteria 4114
11 Ga0070683_100087942 3300005329 Bacteria 2914
12 Ga0070683_100278666 3300005329 Bacteria 1591
13 Ga0070690_100023328 3300005330 Bacteria 3795
14 Ga0070690_100033297 3300005330 Bacteria 3224
15 Ga0068869_100013739 3300005334 Bacteria 5393
16 Ga0068869_100015407 3300005334 Bacteria 5127
17 Ga0070666_10024666 3300005335 Bacteria 3919
18 Ga0070666_10058171 3300005335 Bacteria 2614
19 Ga0070680_100000019 3300005336 Bacteria 83282
20 Ga0070680_100003813 3300005336 Bacteria 11276
21 Ga0070680_100013109 3300005336 Bacteria 6452
22 Ga0070680_100014672 3300005336 Bacteria 6126
23 Ga0070680_100068565 3300005336 Bacteria 2911
24 Ga0070680_100182631 3300005336 Bacteria 1767
25 Ga0070682_100006794 3300005337 Bacteria 6420
26 Ga0068868_100142844 3300005338 Bacteria 1966
27 Ga0068868_100221969 3300005338 Bacteria 1582
28 Ga0070660_100022161 3300005339 Bacteria 4694
29 Ga0070660_100058074 3300005339 Bacteria 2999
30 Ga0070660_100061951 3300005339 Bacteria 2905
31 Ga0070660_100091712 3300005339 Bacteria 2397
32 Ga0070691_10006356 3300005341 Bacteria 5401
33 Ga0070691_10030804 3300005341 Bacteria 2513
34 Ga0070661_100012709 3300005344 Bacteria 5892
35 Ga0070661_100241375 3300005344 Bacteria 1391
36 Ga0070668_100013693 3300005347 Bacteria 6056
37 Ga0070675_100135349 3300005354 Bacteria 2103
38 Ga0070671_100002204 3300005355 Bacteria 15049
39 Ga0070671_100015566 3300005355 Bacteria 6145
40 Ga0070673_100156302 3300005364 Bacteria 1936
41 Ga0070659_100001638 3300005366 Bacteria 16131
42 Ga0070659_100039025 3300005366 Bacteria 3706
43 Ga0070659_100084291 3300005366 Bacteria 2541
44 Ga0070703_10014363 3300005406 Bacteria 2256
45 Ga0070709_10004634 3300005434 Bacteria 7422
46 Ga0070714_100000877 3300005435 Bacteria 21361
47 Ga0070714_100002785 3300005435 Bacteria 12892
48 Ga0070714_100053543 3300005435 Bacteria 3445
49 Ga0070713_100044557 3300005436 Bacteria 3632
50 Ga0070713_100142731 3300005436 Bacteria 2123
51 Ga0070713_100177256 3300005436 Bacteria 1913
52 Ga0070710_10004969 3300005437 Bacteria 6293
53 Ga0070710_10013610 3300005437 Bacteria 4079
54 Ga0070710_10015852 3300005437 Bacteria 3822
55 Ga0070711_100009445 3300005439 Bacteria 6010
56 Ga0070711_100013224 3300005439 Bacteria 5179
57 Ga0070700_100013919 3300005441 Bacteria 4530
58 Ga0070700_100096942 3300005441 Bacteria 1936
59 Ga0070708_100001990 3300005445 Bacteria 15740
60 Ga0070708_100038743 3300005445 Bacteria 4166
61 Ga0070708_100215491 3300005445 Bacteria 1799
62 Ga0070663_100003873 3300005455 Bacteria 8717
63 Ga0070663_100079246 3300005455 Bacteria 2409
64 Ga0070678_100001742 3300005456 Bacteria 11694
65 Ga0070678_100036396 3300005456 Bacteria 3445
66 Ga0070678_100267617 3300005456 Bacteria 1440
67 Ga0070662_100182529 3300005457 Bacteria 1655
68 Ga0070681_10000017 3300005458 Bacteria 125537
69 Ga0070681_10028471 3300005458 Bacteria 5617
70 Ga0070681_10053546 3300005458 Bacteria 4022
71 Ga0070681_10104459 3300005458 Bacteria 2775
72 Ga0070681_10166530 3300005458 Bacteria 2127
73 Ga0070681_10199900 3300005458 Bacteria 1917
74 Ga0070681_10283710 3300005458 Bacteria 1567
75 Ga0070681_10301624 3300005458 Bacteria 1511
76 Ga0070685_10046254 3300005466 Bacteria 2497
77 Ga0070706_100001029 3300005467 Bacteria 30268
78 Ga0070706_100001284 3300005467 Bacteria 26767
79 Ga0070706_100001929 3300005467 Bacteria 21385
80 Ga0070706_100007327 3300005467 Bacteria 10349
81 Ga0070706_100025572 3300005467 Bacteria 5434
82 Ga0070706_100040802 3300005467 Bacteria 4284
83 Ga0070706_100419422 3300005467 Bacteria 1246
84 Ga0070707_100000401 3300005468 Bacteria 42604
85 Ga0070707_100001962 3300005468 Bacteria 19673
86 Ga0070707_100005223 3300005468 Bacteria 12156
87 Ga0070707_100008725 3300005468 Bacteria 9401
88 Ga0070707_100063475 3300005468 Bacteria 3545
89 Ga0070698_100000080 3300005471 Bacteria 73829
90 Ga0070698_100000919 3300005471 Bacteria 32170
91 Ga0070698_100000923 3300005471 Bacteria 32124
92 Ga0070698_100004456 3300005471 Bacteria 15390
93 Ga0070698_100007681 3300005471 Bacteria 11662
94 Ga0070698_100020077 3300005471 Bacteria 7004
95 Ga0070698_100026316 3300005471 Bacteria 6055
96 Ga0070698_100035301 3300005471 Bacteria 5171
97 Ga0070698_100125068 3300005471 Bacteria 2529
98 Ga0070699_100013280 3300005518 Bacteria 7103
99 Ga0070699_100016925 3300005518 Bacteria 6262
100 Ga0070699_100347768 3300005518 Bacteria 1335
101 Ga0070679_100000009 3300005530 Bacteria 191579
102 Ga0070679_100009553 3300005530 Bacteria 9175
103 Ga0070679_100048561 3300005530 Bacteria 4227
104 Ga0070679_100086963 3300005530 Bacteria 3113
105 Ga0070679_100207422 3300005530 Bacteria 1924
106 Ga0070684_100027727 3300005535 Bacteria 4784
107 Ga0070684_100029302 3300005535 Bacteria 4663
108 Ga0070684_100033699 3300005535 Bacteria 4375
109 Ga0070684_100035706 3300005535 Bacteria 4256
110 Ga0070684_100074848 3300005535 Bacteria 2985
111 Ga0070684_100130270 3300005535 Bacteria 2269
112 Ga0070684_100167150 3300005535 Bacteria 1997
113 Ga0070697_100002101 3300005536 Bacteria 15249
114 Ga0070672_100200979 3300005543 Bacteria 1666
115 Ga0070686_100020426 3300005544 Bacteria 3918
116 Ga0070695_100064596 3300005545 Bacteria 2381
117 Ga0070696_100017190 3300005546 Bacteria 4881
118 Ga0070696_100066308 3300005546 Bacteria 2532
119 Ga0070693_100001537 3300005547 Bacteria 10418
120 Ga0070693_100006574 3300005547 Bacteria 5640
121 Ga0068855_100075065 3300005563 Bacteria 3926
122 Ga0068855_100386873 3300005563 Bacteria 1535
123 Ga0070664_100050035 3300005564 Bacteria 3535
124 Ga0068857_100006962 3300005577 Bacteria 9732
125 Ga0068857_100019231 3300005577 Bacteria 5996
126 Ga0068857_100042159 3300005577 Bacteria 4047
127 Ga0068856_100015360 3300005614 Bacteria 7401
128 Ga0070702_100000711 3300005615 Bacteria 12580
129 Ga0068852_100052482 3300005616 Bacteria 3504
130 Ga0068852_100144517 3300005616 Bacteria 2205
131 Ga0068859_100000293 3300005617 Bacteria 49833
132 Ga0068859_100004481 3300005617 Bacteria 14254
133 Ga0068859_100054813 3300005617 Bacteria 4011
134 Ga0068864_100022577 3300005618 Bacteria 5276
135 Ga0068864_100062859 3300005618 Bacteria 3217
136 Ga0068851_10015915 3300005834 Bacteria 3591
137 Ga0068870_10000902 3300005840 Bacteria 11616
138 Ga0068863_100000336 3300005841 Bacteria 47714
139 Ga0068863_100025168 3300005841 Bacteria 5675
140 Ga0068863_100055511 3300005841 Bacteria 3751
141 Ga0068863_100121010 3300005841 Bacteria 2496
142 Ga0068858_100000013 3300005842 Bacteria 216466
143 Ga0068858_100000337 3300005842 Bacteria 49725
144 Ga0068858_100076132 3300005842 Bacteria 3117
145 Ga0068858_100154807 3300005842 Bacteria 2156
146 Ga0068860_100097668 3300005843 Bacteria 2800
147 Ga0068860_100231992 3300005843 Bacteria 1794
148 Ga0068862_100001926 3300005844 Bacteria 18852
149 Ga0068862_100090901 3300005844 Bacteria 2658
150 Ga0081455_10000144 3300005937 Bacteria 84406
151 Ga0081455_10103387 3300005937 Bacteria 2281
152 Ga0081540_1000299 3300005983 Bacteria 51428
153 Ga0081540_1002226 3300005983 Bacteria 15985
154 Ga0081540_1003289 3300005983 Bacteria 12831
155 Ga0081540_1007479 3300005983 Bacteria 7777
156 Ga0081539_10000213 3300005985 Bacteria 136148
157 Ga0081539_10002741 3300005985 Bacteria 23779
158 Ga0081539_10002986 3300005985 Bacteria 22169
159 Ga0081539_10012936 3300005985 Bacteria 6348
160 Ga0081539_10027270 3300005985 Bacteria 3622
161 Ga0070717_10003011 3300006028 Bacteria 12003
162 Ga0070717_10011738 3300006028 Bacteria 6666
163 Ga0070717_10193787 3300006028 Bacteria 1777
164 Ga0075364_10079214 3300006051 Bacteria 2171
165 Ga0075432_10002675 3300006058 Bacteria 5946
166 Ga0070716_100005898 3300006173 Bacteria 5959
167 Ga0070716_100043553 3300006173 Bacteria 2510
168 Ga0070712_100022670 3300006175 Bacteria 4138
169 Ga0070712_100056772 3300006175 Bacteria 2747
170 Ga0070712_100061032 3300006175 Bacteria 2662
171 Ga0097621_100051471 3300006237 Bacteria 3352
172 Ga0068871_100177428 3300006358 Bacteria 1829
173 Ga0075428_100000425 3300006844 Bacteria 41939
174 Ga0075428_100001119 3300006844 Bacteria 28604
175 Ga0075428_100024241 3300006844 Bacteria 6711
176 Ga0075428_100059868 3300006844 Bacteria 4169
177 Ga0075428_100241040 3300006844 Bacteria 1951
178 Ga0075428_100300235 3300006844 Bacteria 1726
179 Ga0075428_100373660 3300006844 Bacteria 1528
180 Ga0075430_100003247 3300006846 Bacteria 13622
181 Ga0075430_100030199 3300006846 Bacteria 4601
182 Ga0075430_100032748 3300006846 Bacteria 4411
183 Ga0075431_100018040 3300006847 Bacteria 7179
184 Ga0075431_100047815 3300006847 Bacteria 4411
185 Ga0075431_100063606 3300006847 Bacteria 3807
186 Ga0075431_100109311 3300006847 Bacteria 2854
187 Ga0075431_100189136 3300006847 Bacteria 2110
188 Ga0075431_100339620 3300006847 Bacteria 1512
189 Ga0075431_100387872 3300006847 Bacteria 1400
190 Ga0075433_10006006 3300006852 Bacteria 9566
191 Ga0075434_100007362 3300006871 Bacteria 10186
192 Ga0075429_100019498 3300006880 Bacteria 5876
193 Ga0075429_100087546 3300006880 Bacteria 2714
194 Ga0075429_100283044 3300006880 Bacteria 1452
195 Ga0075436_100043678 3300006914 Bacteria 3090
196 Ga0097620_100000293 3300006931 Bacteria 49833
197 Ga0097620_100004481 3300006931 Bacteria 14254
198 Ga0097620_100054815 3300006931 Bacteria 4011
199 Ga0075435_100001372 3300007076 Bacteria 15726
200 Ga0075435_100001745 3300007076 Bacteria 14156
201 Ga0075435_100043180 3300007076 Bacteria 3608
202 Ga0075435_100054010 3300007076 Bacteria 3241
203 Ga0105251_10038138 3300009011 Bacteria 2355
204 Ga0105240_10405914 3300009093 Bacteria 1534
205 Ga0111539_10014972 3300009094 Bacteria 9668
206 Ga0111539_10022132 3300009094 Bacteria 7814
207 Ga0111539_10305187 3300009094 Bacteria 1852
208 Ga0105245_10461533 3300009098 Bacteria 1280
209 Ga0105247_10000016 3300009101 Bacteria 263389
210 Ga0105247_10001099 3300009101 Bacteria 20120
211 Ga0114129_10000459 3300009147 Bacteria 48751
212 Ga0114129_10002321 3300009147 Bacteria 26414
213 Ga0114129_10009711 3300009147 Bacteria 13730
214 Ga0114129_10013018 3300009147 Bacteria 11848
215 Ga0114129_10110803 3300009147 Bacteria 3788
216 Ga0114129_10373314 3300009147 Bacteria 1885
217 Ga0105243_10017634 3300009148 Bacteria 5400
218 Ga0105243_10220030 3300009148 Bacteria 1678
219 Ga0105241_10005369 3300009174 Bacteria 9473
220 Ga0105241_10172881 3300009174 Bacteria 1786
221 Ga0105248_10000108 3300009177 Bacteria 93521
222 Ga0105248_10010886 3300009177 Bacteria 10037
223 Ga0105248_10031587 3300009177 Bacteria 5917
224 Ga0105248_10109486 3300009177 Bacteria 3114
225 Ga0105248_10136281 3300009177 Bacteria 2769
226 Ga0105248_10182631 3300009177 Bacteria 2364
227 Ga0105248_10222528 3300009177 Bacteria 2125
228 Ga0105237_10074165 3300009545 Bacteria 3394
229 Ga0105237_10333854 3300009545 Bacteria 1520
230 Ga0105238_10162797 3300009551 Bacteria 2207
231 Ga0105249_10017845 3300009553 Bacteria 6305
232 Ga0105249_10333492 3300009553 Bacteria 1531
233 Ga0105246_10026012 3300011119 Bacteria 3818
234 Ga0105246_10035616 3300011119 Bacteria 3328
235 Ga0105246_10145282 3300011119 Bacteria 1789
236 Ga0157338_1002384 3300012515 Bacteria 1471
237 Ga0157373_10177094 3300013100 Bacteria 1501
238 Ga0157370_10033518 3300013104 Bacteria 5007
239 Ga0157369_10001900 3300013105 Bacteria 25188
240 Ga0157369_10007835 3300013105 Bacteria 12285
241 Ga0157369_10093927 3300013105 Bacteria 3202
242 Ga0157369_10210689 3300013105 Bacteria 2037
243 Ga0157369_10318845 3300013105 Bacteria 1616
244 Ga0157369_10364095 3300013105 Bacteria 1501
245 Ga0157369_10510184 3300013105 Bacteria 1244
246 Ga0157374_10071248 3300013296 Bacteria 3277
247 Ga0157378_10084496 3300013297 Bacteria 2874
248 Ga0157378_10257286 3300013297 Bacteria 1673
249 Ga0163162_10082540 3300013306 Bacteria 3286
250 Ga0163162_10167824 3300013306 Bacteria 2319
251 Ga0157375_10017783 3300013308 Bacteria 6428
252 Ga0157375_10293875 3300013308 Bacteria 1788
253 Ga0163163_10006537 3300014325 Bacteria 10205
254 Ga0163163_10011970 3300014325 Bacteria 7894
255 Ga0163163_10055451 3300014325 Bacteria 3917
256 Ga0163163_10057393 3300014325 Bacteria 3849
257 Ga0157380_10070273 3300014326 Bacteria 2829
258 Ga0157377_10003028 3300014745 Bacteria 7533
259 Ga0157379_10000006 3300014968 Bacteria 163550
260 Ga0157379_10003427 3300014968 Bacteria 13413
261 Ga0157379_10093503 3300014968 Bacteria 2698
262 Ga0157379_10099047 3300014968 Bacteria 2617
263 Ga0157379_10137096 3300014968 Bacteria 2205
264 Ga0157379_10259284 3300014968 Bacteria 1579
265 Ga0197907_10115527 3300020069 Bacteria 2062
266 Ga0197907_10792685 3300020069 Bacteria 1770
267 Ga0197907_10794598 3300020069 Bacteria 3122
268 Ga0206356_10284254 3300020070 Bacteria 2615
269 Ga0206356_10605687 3300020070 Bacteria 4538
270 Ga0206356_11080813 3300020070 Bacteria 2548
271 Ga0206356_11585499 3300020070 Bacteria 1376
272 Ga0206349_1497504 3300020075 Bacteria 1154
273 Ga0206351_11016986 3300020077 Bacteria 1592
274 Ga0206350_10827113 3300020080 Bacteria 1140
275 Ga0206354_10329808 3300020081 Bacteria 4363
276 Ga0206354_10912500 3300020081 Bacteria 2587
277 Ga0206354_10945499 3300020081 Bacteria 1339
278 Ga0206353_10178569 3300020082 Bacteria 7592
279 Ga0206353_10378610 3300020082 Bacteria 14406
280 Ga0206353_11220165 3300020082 Bacteria 1656
281 Ga0206353_11961061 3300020082 Bacteria 3107
282 Ga0213876_10001920 3300021384 Bacteria 12469
283 Ga0213875_10004227 3300021388 Bacteria 7924
284 Ga0213875_10007463 3300021388 Bacteria 5641
285 Ga0213875_10028706 3300021388 Bacteria 2640
286 Ga0224712_10000779 3300022467 Bacteria 6689
287 Ga0224712_10019335 3300022467 Bacteria 2295
288 Ga0224712_10028877 3300022467 Bacteria 1987
289 Ga0224712_10049097 3300022467 Bacteria 1633
290 Ga0224712_10083263 3300022467 Bacteria 1325
291 Ga0228598_1011957 3300024227 Bacteria 1726
292 Ga0207656_10039796 3300025321 Bacteria 1991
293 Ga0207653_10001531 3300025885 Bacteria 7480
294 Ga0207692_10004000 3300025898 Bacteria 5796
295 Ga0207692_10007720 3300025898 Bacteria 4419
296 Ga0207692_10016564 3300025898 Bacteria 3268
297 Ga0207692_10099768 3300025898 Bacteria 1591
298 Ga0207710_10000017 3300025900 Bacteria 370962
299 Ga0207710_10000062 3300025900 Bacteria 164192
300 Ga0207688_10012968 3300025901 Bacteria 4532
301 Ga0207688_10080748 3300025901 Bacteria 1856
302 Ga0207647_10066059 3300025904 Bacteria 2194
303 Ga0207699_10029310 3300025906 Bacteria 3068
304 Ga0207699_10030097 3300025906 Bacteria 3035
305 Ga0207699_10033262 3300025906 Bacteria 2913
306 Ga0207699_10061872 3300025906 Bacteria 2254
307 Ga0207699_10075186 3300025906 Bacteria 2077
308 Ga0207645_10036604 3300025907 Bacteria 3151
309 Ga0207643_10000275 3300025908 Bacteria 35710
310 Ga0207643_10022020 3300025908 Bacteria 3507
311 Ga0207705_10000251 3300025909 Bacteria 52410
312 Ga0207705_10007287 3300025909 Bacteria 8135
313 Ga0207705_10099474 3300025909 Bacteria 2138
314 Ga0207705_10101214 3300025909 Bacteria 2119
315 Ga0207705_10139447 3300025909 Bacteria 1810
316 Ga0207705_10220573 3300025909 Bacteria 1440
317 Ga0207684_10004433 3300025910 Bacteria 13229
318 Ga0207684_10006577 3300025910 Bacteria 10576
319 Ga0207684_10017472 3300025910 Bacteria 6153
320 Ga0207684_10046467 3300025910 Bacteria 3683
321 Ga0207684_10054794 3300025910 Bacteria 3383
322 Ga0207684_10073463 3300025910 Bacteria 2904
323 Ga0207684_10257802 3300025910 Bacteria 1504
324 Ga0207654_10024844 3300025911 Bacteria 3226
325 Ga0207707_10000831 3300025912 Bacteria 30306
326 Ga0207707_10013510 3300025912 Bacteria 7117
327 Ga0207707_10015071 3300025912 Bacteria 6730
328 Ga0207707_10015846 3300025912 Bacteria 6573
329 Ga0207707_10079236 3300025912 Bacteria 2868
330 Ga0207707_10107891 3300025912 Bacteria 2434
331 Ga0207671_10104769 3300025914 Bacteria 2145
332 Ga0207693_10009698 3300025915 Bacteria 7839
333 Ga0207693_10022281 3300025915 Bacteria 5035
334 Ga0207693_10049686 3300025915 Bacteria 3294
335 Ga0207693_10053781 3300025915 Bacteria 3159
336 Ga0207663_10002199 3300025916 Bacteria 9327
337 Ga0207663_10012258 3300025916 Bacteria 4630
338 Ga0207663_10065351 3300025916 Bacteria 2325
339 Ga0207663_10094618 3300025916 Bacteria 1991
340 Ga0207663_10115691 3300025916 Bacteria 1827
341 Ga0207660_10000169 3300025917 Bacteria 41207
342 Ga0207660_10005501 3300025917 Bacteria 8228
343 Ga0207660_10010403 3300025917 Bacteria 6036
344 Ga0207660_10015498 3300025917 Bacteria 5031
345 Ga0207660_10114500 3300025917 Bacteria 2034
346 Ga0207660_10116690 3300025917 Bacteria 2017
347 Ga0207662_10008115 3300025918 Bacteria 5738
348 Ga0207657_10014063 3300025919 Bacteria 7831
349 Ga0207657_10015744 3300025919 Bacteria 7313
350 Ga0207657_10020177 3300025919 Bacteria 6306
351 Ga0207657_10032462 3300025919 Bacteria 4717
352 Ga0207657_10115455 3300025919 Bacteria 2213
353 Ga0207649_10005696 3300025920 Bacteria 6744
354 Ga0207649_10051801 3300025920 Bacteria 2543
355 Ga0207652_10000124 3300025921 Bacteria 82835
356 Ga0207652_10046759 3300025921 Bacteria 3694
357 Ga0207652_10060684 3300025921 Bacteria 3263
358 Ga0207652_10085358 3300025921 Bacteria 2767
359 Ga0207652_10108861 3300025921 Bacteria 2456
360 Ga0207652_10113643 3300025921 Bacteria 2404
361 Ga0207652_10175687 3300025921 Bacteria 1923
362 Ga0207652_10185400 3300025921 Bacteria 1871
363 Ga0207646_10000589 3300025922 Bacteria 47411
364 Ga0207646_10000691 3300025922 Bacteria 43602
365 Ga0207646_10010303 3300025922 Bacteria 9143
366 Ga0207646_10019370 3300025922 Bacteria 6326
367 Ga0207646_10201062 3300025922 Bacteria 1800
368 Ga0207650_10001561 3300025925 Bacteria 16379
369 Ga0207659_10002333 3300025926 Bacteria 11293
370 Ga0207687_10047620 3300025927 Bacteria 2972
371 Ga0207700_10005012 3300025928 Bacteria 7877
372 Ga0207700_10018326 3300025928 Bacteria 4701
373 Ga0207700_10020783 3300025928 Bacteria 4468
374 Ga0207700_10024035 3300025928 Bacteria 4213
375 Ga0207700_10049010 3300025928 Bacteria 3139
376 Ga0207700_10157573 3300025928 Bacteria 1883
377 Ga0207700_10298686 3300025928 Bacteria 1390
378 Ga0207664_10002411 3300025929 Bacteria 12355
379 Ga0207664_10015282 3300025929 Bacteria 5566
380 Ga0207664_10022658 3300025929 Bacteria 4694
381 Ga0207664_10042787 3300025929 Bacteria 3538
382 Ga0207664_10071983 3300025929 Bacteria 2786
383 Ga0207664_10248924 3300025929 Bacteria 1550
384 Ga0207664_10262355 3300025929 Bacteria 1511
385 Ga0207690_10000189 3300025932 Bacteria 47490
386 Ga0207690_10024372 3300025932 Bacteria 3790
387 Ga0207690_10207976 3300025932 Bacteria 1490
388 Ga0207706_10019224 3300025933 Bacteria 6143
389 Ga0207706_10050008 3300025933 Bacteria 3694
390 Ga0207669_10053731 3300025937 Bacteria 2429
391 Ga0207665_10005099 3300025939 Bacteria 8767
392 Ga0207665_10007526 3300025939 Bacteria 7200
393 Ga0207691_10033339 3300025940 Bacteria 4795
394 Ga0207691_10113017 3300025940 Bacteria 2414
395 Ga0207711_10000101 3300025941 Bacteria 90693
396 Ga0207711_10044426 3300025941 Bacteria 3793
397 Ga0207711_10106390 3300025941 Bacteria 2489
398 Ga0207711_10112432 3300025941 Bacteria 2423
399 Ga0207689_10001392 3300025942 Bacteria 23099
400 Ga0207689_10006270 3300025942 Bacteria 10541
401 Ga0207689_10017361 3300025942 Bacteria 6090
402 Ga0207661_10001624 3300025944 Bacteria 15294
403 Ga0207661_10008312 3300025944 Bacteria 7414
404 Ga0207661_10024922 3300025944 Bacteria 4541
405 Ga0207661_10028998 3300025944 Bacteria 4246
406 Ga0207661_10031508 3300025944 Bacteria 4097
407 Ga0207661_10103845 3300025944 Bacteria 2392
408 Ga0207661_10161798 3300025944 Bacteria 1943
409 Ga0207679_10000388 3300025945 Bacteria 31607
410 Ga0207679_10032798 3300025945 Bacteria 3650
411 Ga0207679_10191433 3300025945 Bacteria 1701
412 Ga0207679_10271579 3300025945 Bacteria 1450
413 Ga0207651_10183394 3300025960 Bacteria 1662
414 Ga0207668_10005044 3300025972 Bacteria 7771
415 Ga0207658_10012594 3300025986 Bacteria 5774
416 Ga0207677_10001030 3300026023 Bacteria 15352
417 Ga0207677_10148512 3300026023 Bacteria 1805
418 Ga0207677_10213095 3300026023 Bacteria 1544
419 Ga0207703_10000006 3300026035 Bacteria 502351
420 Ga0207703_10000009 3300026035 Bacteria 343983
421 Ga0207703_10065822 3300026035 Bacteria 2979
422 Ga0207678_10002799 3300026067 Bacteria 15829
423 Ga0207678_10010176 3300026067 Bacteria 8256
424 Ga0207678_10012567 3300026067 Bacteria 7440
425 Ga0207678_10016803 3300026067 Bacteria 6428
426 Ga0207708_10003131 3300026075 Bacteria 12175
427 Ga0207708_10008319 3300026075 Bacteria 7682
428 Ga0207702_10001952 3300026078 Bacteria 20108
429 Ga0207702_10010057 3300026078 Bacteria 7928
430 Ga0207702_10011128 3300026078 Bacteria 7508
431 Ga0207702_10020010 3300026078 Bacteria 5545
432 Ga0207641_10007965 3300026088 Bacteria 8780
433 Ga0207641_10049245 3300026088 Bacteria 3559
434 Ga0207641_10144458 3300026088 Bacteria 2150
435 Ga0207648_10026334 3300026089 Bacteria 5169
436 Ga0207676_10000955 3300026095 Bacteria 22339
437 Ga0207676_10010572 3300026095 Bacteria 6578
438 Ga0207676_10022346 3300026095 Bacteria 4652
439 Ga0207676_10081216 3300026095 Bacteria 2633
440 Ga0207674_10003957 3300026116 Bacteria 18011
441 Ga0207674_10009912 3300026116 Bacteria 10837
442 Ga0207674_10023553 3300026116 Bacteria 6592
443 Ga0207674_10033285 3300026116 Bacteria 5397
444 Ga0207674_10101680 3300026116 Bacteria 2855
445 Ga0207674_10264051 3300026116 Bacteria 1669
446 Ga0207675_100020355 3300026118 Bacteria 6184
447 Ga0207683_10002054 3300026121 Bacteria 17812
448 Ga0207683_10006776 3300026121 Bacteria 9805
449 Ga0207683_10068473 3300026121 Bacteria 3133
450 Ga0207683_10198412 3300026121 Bacteria 1823
451 Ga0207698_10067185 3300026142 Bacteria 2826
452 Ga0207428_10006365 3300027907 Bacteria 10922
453 Ga0268266_10056619 3300028379 Bacteria 3372
454 Ga0268266_10343666 3300028379 Bacteria 1401
455 Ga0268265_10000041 3300028380 Bacteria 189918
456 Ga0265336_10010667 3300028666 Bacteria 3144
457 Ga0307517_10078602 3300028786 Bacteria 2850
458 Ga0307515_10000668 3300028794 Bacteria 79033
459 Ga0307515_10002310 3300028794 Bacteria 41672
460 Ga0307515_10052102 3300028794 Bacteria 6080
461 Ga0307515_10075893 3300028794 Bacteria 4469
462 Ga0307515_10142854 3300028794 Bacteria 2556
463 Ga0265338_10003387 3300028800 Bacteria 22494
464 Ga0265338_10023839 3300028800 Bacteria 6274
465 Ga0307512_10001051 3300030522 Bacteria 40387
466 Ga0307512_10056605 3300030522 Bacteria 3077
467 Ga0265320_10005227 3300031240 Bacteria 8372
468 Ga0265325_10000147 3300031241 Bacteria 49704
469 Ga0265340_10001511 3300031247 Bacteria 13340
470 Ga0265339_10008228 3300031249 Bacteria 6651
471 Ga0265316_10060639 3300031344 Bacteria 2940
472 Ga0307513_10007756 3300031456 Bacteria 13856
473 Ga0307509_10029457 3300031507 Bacteria 6093
474 Ga0307509_10110655 3300031507 Bacteria 2752
475 Ga0307408_100125412 3300031548 Bacteria 1995
476 Ga0307508_10001073 3300031616 Bacteria 31643
477 Ga0307508_10057552 3300031616 Bacteria 3440
478 Ga0307508_10100251 3300031616 Bacteria 2491
479 Ga0307514_10057500 3300031649 Bacteria 2979
480 Ga0265314_10013888 3300031711 Bacteria 6480
481 Ga0316576_10008132 3300031727 Bacteria 6659
482 Ga0316578_10103644 3300031728 Bacteria 1706
483 Ga0307516_10000909 3300031730 Bacteria 40652
484 Ga0307516_10018087 3300031730 Bacteria 7330
485 Ga0307516_10021159 3300031730 Bacteria 6704
486 Ga0307516_10112781 3300031730 Bacteria 2518
487 Ga0307405_10012062 3300031731 Bacteria 4558
488 Ga0307413_10066592 3300031824 Bacteria 2248
489 Ga0307413_10070336 3300031824 Bacteria 2200
490 Ga0307410_10030743 3300031852 Bacteria 3436
491 Ga0326468_10000415 3300031889 Bacteria 4524
492 Ga0307406_10031194 3300031901 Bacteria 3243
493 Ga0307406_10040262 3300031901 Bacteria 2905
494 Ga0307406_10048881 3300031901 Bacteria 2674
495 Ga0307407_10059388 3300031903 Bacteria 2227
496 Ga0307412_10038615 3300031911 Bacteria 3076
497 Ga0307409_100015923 3300031995 Bacteria 4954
498 Ga0307409_100021071 3300031995 Bacteria 4461
499 Ga0307409_100025998 3300031995 Bacteria 4120
500 Ga0307409_100132310 3300031995 Bacteria 2134
501 Ga0307416_100014053 3300032002 Bacteria 5466
502 Ga0307416_100032279 3300032002 Bacteria 3954
503 Ga0307416_100303777 3300032002 Bacteria 1588
504 Ga0307415_100000137 3300032126 Bacteria 32064
505 Ga0307415_100017053 3300032126 Bacteria 4346
506 Ga0307415_100063093 3300032126 Bacteria 2573
507 Ga0307415_100077547 3300032126 Bacteria 2360
508 Ga0307415_100150007 3300032126 Bacteria 1793
509 Ga0307415_100259497 3300032126 Bacteria 1417
510 Ga0307507_10075995 3300033179 Bacteria 3000
511 Ga0307510_10131081 3300033180 Bacteria 2180
512 Ga0316214_1002497 3300033545 Bacteria 2262
513 Ga0373926_0000163 3300035083 Bacteria 14585
514 Ga0373926_0000879 3300035083 Bacteria 8603
515 Ga0373928_0007702 3300035084 Bacteria 2081
516 Ga0373934_0006628 3300035086 Bacteria 4299
517 Ga0373940_0013628 3300035088 Bacteria 1971
518 Ga0373944_0002760 3300035089 Bacteria 4487
519 Ga0373944_0005699 3300035089 Bacteria 3285
520 Ga0373951_0000053 3300035091 Bacteria 46153
521 Ga0373923_0014873 3300035111 Bacteria 2930
522 Ga0373923_0027720 3300035111 Bacteria 2261
523 Ga0373936_0000453 3300035113 Bacteria 13757
524 Ga0373936_0036582 3300035113 Bacteria 1958
525 Ga0373941_0007679 3300035115 Bacteria 2649
526 Ga0373945_0011696 3300035116 Bacteria 2905
527 Ga0373953_0000203 3300035117 Bacteria 15944
528 Ga0373953_0001254 3300035117 Bacteria 7250
529 Ga0373953_0019143 3300035117 Bacteria 2543
530 Ga0373954_0004129 3300035118 Bacteria 6221
531 Ga0373954_0004734 3300035118 Bacteria 5865
532 Ga0373954_0059798 3300035118 Bacteria 1796
533 Ga0373956_0017516 3300035119 Bacteria 3022
534 Ga0373956_0019106 3300035119 Bacteria 2904
535 Ga0373956_0030849 3300035119 Bacteria 2345
536 Ga0373957_0000063 3300035120 Bacteria 26126
537 Ga0373957_0009923 3300035120 Bacteria 3129
538 Ga0373957_0019829 3300035120 Bacteria 2370
539 Ga0373960_0002089 3300035121 Bacteria 4494
540 Ga0373943_0002709 3300035170 Bacteria 8044
541 Ga0373943_0053483 3300035170 Bacteria 1994
542 Ga0373943_0166925 3300035170 Bacteria 1202
543 Ga0373946_0000448 3300035171 Bacteria 13554
544 Ga0373946_0000523 3300035171 Bacteria 12731
545 Ga0373955_0000011 3300035172 Bacteria 74059
546 Ga0373955_0009396 3300035172 Bacteria 4574
547 Ga0373955_0011175 3300035172 Bacteria 4267
548 Ga0373955_0024170 3300035172 Bacteria 3104
549 Ga0373955_0053298 3300035172 Bacteria 2208
550 Ga0373942_0001340 3300035207 Bacteria 6384
551 Ga0373942_0027342 3300035207 Bacteria 1483
552 Ga0316574_0032463 3300035398 Bacteria 3173
553 Ga0373924_0000153 3300035410 Bacteria 20261
554 Ga0373924_0019187 3300035410 Bacteria 2646
555 Ga0373924_0074675 3300035410 Bacteria 1434
556 Ga0373931_0013722 3300035691 Bacteria 3950
557 Ga0373935_0000992 3300035692 Bacteria 15444
558 Ga0373935_0003522 3300035692 Bacteria 9109
559 Ga0373935_0062286 3300035692 Bacteria 2389
560 Ga0373935_0068151 3300035692 Bacteria 2289
561 Ga0373935_0128494 3300035692 Bacteria 1700
562 Ga0373927_0000290 3300035695 Bacteria 39619
563 Ga0373927_0129597 3300035695 Bacteria 1647
564 Ga0373927_0134966 3300035695 Bacteria 1612
565 Ga0373933_0000027 3300035724 Bacteria 90038
566 Ga0373933_0001003 3300035724 Bacteria 17193
567 Ga0373933_0005876 3300035724 Bacteria 6672
568 Ga0373933_0011863 3300035724 Bacteria 4812
569 Ga0373947_0000011 3300035725 Bacteria 160778
570 Ga0373947_0002876 3300035725 Bacteria 10281
571 Ga0373947_0008178 3300035725 Bacteria 6030
572 Ga0373947_0141135 3300035725 Bacteria 1545
573 Ga0310104_04007 3300036242 Bacteria 1271
574 Ga0373937_0000159 3300036401 Bacteria 65235
575 Ga0373937_0011182 3300036401 Bacteria 7867
576 Ga0373937_0032325 3300036401 Bacteria 4746
577 Ga0373937_0180492 3300036401 Bacteria 1982
578 Ga0316584_0057010 3300036712 Bacteria 2924
579 Ga0373925_0000878 3300037068 Bacteria 27482
580 Ga0373925_0004238 3300037068 Bacteria 10867
581 Ga0373925_0119052 3300037068 Bacteria 2048
582 Ga0373925_0150450 3300037068 Bacteria 1827
583 Ga0373925_0170847 3300037068 Bacteria 1716
584 Ga0395900_0024268 3300037418 Bacteria 6209
585 Ga0395900_0024531 3300037418 Bacteria 6175
586 Ga0395900_0142162 3300037418 Bacteria 2457
587 Ga0395898_0014304 3300037466 Bacteria 8155
588 Ga0395898_0030902 3300037466 Bacteria 5357
589 Ga0395898_0375076 3300037466 Bacteria 1357
590 Ga0395905_0006998 3300037471 Bacteria 11276
591 Ga0436364_0149270 3300037853 Bacteria 2493
592 Ga0436364_0280596 3300037853 Bacteria 4084
593 Ga0436364_0722685 3300037853 Bacteria 18129
594 Ga0436364_0922907 3300037853 Bacteria 1683
595 Ga0436364_1159643 3300037853 Bacteria 1417
596 Ga0436364_1520802 3300037853 Bacteria 2851
597 Ga0436364_1553651 3300037853 Bacteria 21365
598 Ga0395901_0041350 3300038443 Bacteria 4776
599 Ga0395901_0051590 3300038443 Bacteria 4277
600 Ga0395901_0142494 3300038443 Bacteria 2519
601 Ga0436365_1454613 3300039437 Bacteria 26721
602 Ga0436363_0196300 3300039450 Bacteria 2030
603 Ga0451853_0837750 3300041512 Bacteria 5028
604 Ga0451853_2391966 3300041512 Bacteria 1342
605 Ga0439448_0010651 3300042005 Bacteria 2730
606 Ga0466966_0059011 3300044684 Bacteria 2424
607 Ga0466961_0010687 3300044693 Bacteria 5862
608 Ga0466961_0020498 3300044693 Bacteria 4255
609 Ga0466963_0017021 3300044694 Bacteria 4528
610 Ga0466963_0024825 3300044694 Bacteria 3818
611 Ga0466963_0058706 3300044694 Bacteria 2566
612 Ga0466963_0216881 3300044694 Bacteria 1339
613 Ga0466959_0097225 3300045049 Bacteria 2110
614 Ga0466959_0099477 3300045049 Bacteria 2082
615 Ga0466958_0005490 3300045836 Bacteria 6838
616 Ga0466958_0078079 3300045836 Bacteria 2034
617 Ga0466967_0008838 3300045976 Bacteria 7426
618 Ga0466967_0117782 3300045976 Bacteria 2449
619 Ga0466967_0536776 3300045976 Bacteria 1150
620 Ga0495592_0000019 3300046454 Bacteria 140749
621 Ga0495592_0005327 3300046454 Bacteria 9488
622 Ga0495592_0043869 3300046454 Bacteria 3343
623 Ga0495592_0073197 3300046454 Bacteria 2492
624 Ga0495592_0092868 3300046454 Bacteria 2162
625 Ga0495603_0026763 3300046455 Bacteria 3483
626 Ga0495629_0001359 3300046459 Bacteria 19280
627 Ga0495629_0064450 3300046459 Bacteria 2559
628 Ga0495629_0091202 3300046459 Bacteria 2126
629 Ga0495629_0163313 3300046459 Bacteria 1547
630 Ga0495629_0163762 3300046459 Bacteria 1544
631 Ga0495641_0003679 3300046461 Bacteria 11311
632 Ga0495641_0007998 3300046461 Bacteria 6519
633 Ga0495641_0022054 3300046461 Bacteria 3192
634 Ga0495641_0085619 3300046461 Bacteria 1410
635 Ga0495651_0000012 3300046462 Bacteria 138280
636 Ga0495651_0003573 3300046462 Bacteria 11926
637 Ga0495651_0042453 3300046462 Bacteria 3530
638 Ga0495651_0062977 3300046462 Bacteria 2836
639 Ga0495651_0194711 3300046462 Bacteria 1423
640 Ga0495653_0003237 3300046463 Bacteria 13053
641 Ga0495653_0003567 3300046463 Bacteria 12545
642 Ga0495653_0003779 3300046463 Bacteria 12252
643 Ga0495653_0012324 3300046463 Bacteria 6974
644 Ga0495653_0032382 3300046463 Bacteria 4151
645 Ga0495653_0070691 3300046463 Bacteria 2611
646 Ga0495582_0001655 3300046473 Bacteria 12564
647 Ga0495582_0027792 3300046473 Bacteria 3102
648 Ga0495582_0043694 3300046473 Bacteria 2467
649 Ga0495639_0002648 3300046475 Bacteria 7783
650 Ga0495639_0010076 3300046475 Bacteria 4062
651 Ga0495662_0027650 3300046476 Bacteria 2739
652 Ga0495664_0000511 3300046477 Bacteria 19396
653 Ga0495664_0027295 3300046477 Bacteria 3328
654 Ga0495664_0033364 3300046477 Bacteria 3025
655 Ga0495664_0109916 3300046477 Bacteria 1663
656 Ga0495594_0006518 3300046499 Bacteria 6003
657 Ga0495594_0028912 3300046499 Bacteria 2993
658 Ga0495594_0086622 3300046499 Bacteria 1753
659 Ga0495606_0001302 3300046507 Bacteria 34396
660 Ga0495608_0000048 3300046511 Bacteria 97364
661 Ga0495608_0003833 3300046511 Bacteria 10807
662 Ga0495608_0026238 3300046511 Bacteria 3973
663 Ga0495608_0027568 3300046511 Bacteria 3864
664 Ga0495608_0052607 3300046511 Bacteria 2695
665 Ga0495618_0014608 3300046514 Bacteria 4786
666 Ga0495618_0020319 3300046514 Bacteria 4087
667 Ga0495618_0186199 3300046514 Bacteria 1318
668 Ga0495628_0000053 3300046516 Bacteria 91080
669 Ga0495628_0040356 3300046516 Bacteria 3729
670 Ga0495628_0044642 3300046516 Bacteria 3524
671 Ga0495628_0080679 3300046516 Bacteria 2528
672 Ga0495628_0128125 3300046516 Bacteria 1943
673 Ga0495628_0133676 3300046516 Bacteria 1896
674 Ga0495630_0001359 3300046517 Bacteria 16817
675 Ga0495630_0029186 3300046517 Bacteria 4099
676 Ga0495630_0039687 3300046517 Bacteria 3519
677 Ga0495630_0135422 3300046517 Bacteria 1872
678 Ga0495648_0028013 3300046524 Bacteria 3760
679 Ga0495666_0000806 3300046526 Bacteria 14505
680 Ga0495666_0051119 3300046526 Bacteria 1986
681 Ga0495652_0000163 3300046529 Bacteria 76177
682 Ga0495652_0008769 3300046529 Bacteria 9204
683 Ga0495652_0017359 3300046529 Bacteria 6422
684 Ga0495652_0062468 3300046529 Bacteria 3140
685 Ga0495652_0068593 3300046529 Bacteria 2970
686 Ga0495652_0093442 3300046529 Bacteria 2455
687 Ga0495665_0005717 3300046531 Bacteria 6711
688 Ga0495640_0043428 3300046533 Bacteria 3130
689 Ga0495640_0057082 3300046533 Bacteria 2665
690 Ga0495640_0061441 3300046533 Bacteria 2552
691 Ga0495586_0000988 3300046535 Bacteria 16075
692 Ga0495587_0000027 3300046536 Bacteria 140741
693 Ga0495587_0007610 3300046536 Bacteria 7010
694 Ga0495587_0052309 3300046536 Bacteria 2410
695 Ga0495587_0095508 3300046536 Bacteria 1715
696 Ga0495645_0006188 3300046543 Bacteria 8286
697 Ga0495645_0024024 3300046543 Bacteria 4418
698 Ga0495645_0033500 3300046543 Bacteria 3748
699 Ga0495645_0056217 3300046543 Bacteria 2857
700 Ga0495645_0065395 3300046543 Bacteria 2630
701 Ga0495645_0223985 3300046543 Bacteria 1263
702 Ga0495667_0000074 3300046559 Bacteria 74078
703 Ga0495667_0004210 3300046559 Bacteria 9696
704 Ga0495667_0023900 3300046559 Bacteria 4116
705 Ga0495667_0044706 3300046559 Bacteria 2932
706 Ga0495667_0056587 3300046559 Bacteria 2579
707 Ga0495667_0130888 3300046559 Bacteria 1618
708 Ga0495668_0000182 3300046616 Bacteria 93763
709 Ga0495634_0002568 3300046642 Bacteria 14990
710 Ga0495634_0139587 3300046642 Bacteria 1539
711 Ga0495625_0001990 3300046660 Bacteria 23065
712 Ga0495635_0003562 3300046663 Bacteria 10775
713 Ga0495635_0004360 3300046663 Bacteria 9795
714 Ga0495635_0008090 3300046663 Bacteria 7347
715 Ga0495635_0016444 3300046663 Bacteria 5167
716 Ga0495635_0028853 3300046663 Bacteria 3857
717 Ga0495635_0031140 3300046663 Bacteria 3705
718 Ga0495635_0032993 3300046663 Bacteria 3592
719 Ga0495635_0177172 3300046663 Bacteria 1449
720 Ga0495657_0000025 3300046675 Bacteria 140749
721 Ga0495657_0007174 3300046675 Bacteria 8647
722 Ga0495657_0013347 3300046675 Bacteria 6066
723 Ga0495599_0000026 3300046678 Bacteria 117515
724 Ga0495599_0017607 3300046678 Bacteria 4443
725 Ga0495599_0032847 3300046678 Bacteria 3258
726 Ga0495599_0037334 3300046678 Bacteria 3051
727 Ga0495599_0064516 3300046678 Bacteria 2287
728 Ga0495599_0067518 3300046678 Bacteria 2233
729 Ga0495599_0075516 3300046678 Bacteria 2104
730 Ga0495599_0101605 3300046678 Bacteria 1792
731 Ga0495599_0135054 3300046678 Bacteria 1531
732 Ga0495623_0000181 3300046679 Bacteria 39838
733 Ga0495623_0015258 3300046679 Bacteria 4964
734 Ga0495623_0064209 3300046679 Bacteria 2297
735 Ga0495646_0001454 3300046680 Bacteria 14074
736 Ga0495646_0012816 3300046680 Bacteria 5329
737 Ga0495646_0013096 3300046680 Bacteria 5270
738 Ga0495646_0039423 3300046680 Bacteria 2912
739 Ga0495646_0088445 3300046680 Bacteria 1794
740 Ga0495658_0013106 3300046683 Bacteria 4216
741 Ga0495613_0003573 3300046689 Bacteria 11654
742 Ga0495613_0006912 3300046689 Bacteria 8466
743 Ga0495613_0009693 3300046689 Bacteria 7155
744 Ga0495624_0020763 3300046690 Bacteria 4364
745 Ga0495624_0098248 3300046690 Bacteria 1803
746 Ga0495600_0000789 3300046809 Bacteria 16734
747 Ga0495600_0001653 3300046809 Bacteria 12429
748 Ga0495600_0002721 3300046809 Bacteria 10229
749 Ga0495600_0002960 3300046809 Bacteria 9906
750 Ga0495600_0025950 3300046809 Bacteria 3779
751 Ga0495581_0000249 3300047315 Bacteria 25767
752 Ga0495581_0002580 3300047315 Bacteria 10300
753 Ga0495604_0000029 3300047317 Bacteria 140740
754 Ga0495604_0004486 3300047317 Bacteria 11057
755 Ga0495604_0020691 3300047317 Bacteria 5253
756 Ga0495604_0040637 3300047317 Bacteria 3651
757 Ga0495604_0088120 3300047317 Bacteria 2309
758 Ga0495674_0000245 3300047319 Bacteria 45797
759 Ga0495674_0007661 3300047319 Bacteria 10313
760 Ga0495674_0048170 3300047319 Bacteria 3773
761 Ga0495674_0070927 3300047319 Bacteria 3009
762 Ga0495674_0086075 3300047319 Bacteria 2691
763 Ga0495674_0246952 3300047319 Bacteria 1469
764 Ga0495676_0005249 3300047321 Bacteria 11854
765 Ga0495676_0071597 3300047321 Bacteria 2665
766 Ga0495680_0000011 3300047322 Bacteria 140733
767 Ga0495680_0003354 3300047322 Bacteria 15816
768 Ga0495680_0006351 3300047322 Bacteria 11005
769 Ga0495680_0008112 3300047322 Bacteria 9571
770 Ga0495680_0015821 3300047322 Bacteria 6494
771 Ga0495680_0048041 3300047322 Bacteria 3353
772 Ga0495680_0134147 3300047322 Bacteria 1816
773 Ga0495680_0202216 3300047322 Bacteria 1424
774 Ga0495675_0000172 3300047444 Bacteria 46844
775 Ga0495675_0001732 3300047444 Bacteria 13050
776 Ga0495675_0002028 3300047444 Bacteria 12102
777 Ga0495675_0004540 3300047444 Bacteria 8416
778 Ga0495675_0025404 3300047444 Bacteria 3777
779 Ga0495675_0069232 3300047444 Bacteria 2228
780 Ga0495684_0002083 3300047471 Bacteria 16082
781 Ga0495684_0005702 3300047471 Bacteria 9682
782 Ga0495684_0009265 3300047471 Bacteria 7602
783 Ga0495684_0012380 3300047471 Bacteria 6578
784 Ga0495684_0019055 3300047471 Bacteria 5283
785 Ga0495684_0023576 3300047471 Bacteria 4731
786 Ga0495684_0073597 3300047471 Bacteria 2595
787 Ga0495684_0122856 3300047471 Bacteria 1954
788 Ga0495593_0000843 3300047673 Bacteria 17787
789 Ga0495593_0003291 3300047673 Bacteria 9691
790 Ga0495593_0053844 3300047673 Bacteria 2122
791 Ga0495593_0071433 3300047673 Bacteria 1802
792 Ga0495602_0000033 3300048088 Bacteria 140750
793 Ga0495602_0017852 3300048088 Bacteria 7102
794 Ga0495602_0104780 3300048088 Bacteria 2313
795 Ga0495602_0111432 3300048088 Bacteria 2222
796 Ga0495614_0009740 3300048089 Bacteria 4246
797 Ga0495626_0000286 3300048091 Bacteria 54819
798 Ga0496100_0014210 3300048903 Bacteria 4616
799 Ga0496100_0149186 3300048903 Bacteria 1665
800 Ga0496101_0034817 3300048904 Bacteria 3560
801 Ga0496101_0052208 3300048904 Bacteria 2947
802 Ga0496102_0006518 3300048905 Bacteria 9959
803 Ga0496102_0175503 3300048905 Bacteria 2017
804 Ga0496102_0240148 3300048905 Bacteria 1708
805 Ga0496103_0096672 3300048906 Bacteria 1866
806 Ga0496103_0173917 3300048906 Bacteria 1383
807 Ga0496104_0002235 3300048907 Bacteria 16698
808 Ga0496104_0117036 3300048907 Bacteria 2557
809 Ga0496105_0004813 3300048908 Bacteria 10198
810 Ga0496105_0007134 3300048908 Bacteria 8619
811 Ga0496105_0114708 3300048908 Bacteria 2222
812 Ga0496106_0034912 3300048909 Bacteria 3758
813 Ga0496106_0052920 3300048909 Bacteria 3065
814 Ga0496107_0072646 3300048910 Bacteria 2501
815 Ga0496108_0000016 3300048911 Bacteria 237051
816 Ga0496108_0002160 3300048911 Bacteria 15757
817 Ga0496108_0005669 3300048911 Bacteria 10108
818 Ga0496108_0074729 3300048911 Bacteria 2862
819 Ga0496108_0077574 3300048911 Bacteria 2810
820 Ga0496108_0089230 3300048911 Bacteria 2620
821 Ga0496108_0122248 3300048911 Bacteria 2233
822 Ga0496109_0006542 3300048912 Bacteria 9808
823 Ga0496109_0031948 3300048912 Bacteria 4729
824 Ga0496109_0047058 3300048912 Bacteria 3920
825 Ga0496109_0128775 3300048912 Bacteria 2361
826 Ga0496109_0251175 3300048912 Bacteria 1665
827 Ga0496110_0011403 3300048913 Bacteria 7273
828 Ga0496110_0020154 3300048913 Bacteria 5626
829 Ga0496110_0080324 3300048913 Bacteria 2905
830 Ga0496110_0269908 3300048913 Bacteria 1549
831 Ga0496111_0000525 3300048914 Bacteria 19825
832 Ga0496111_0080383 3300048914 Bacteria 2378
833 Ga0496112_0002256 3300048915 Bacteria 15399
834 Ga0496112_0013474 3300048915 Bacteria 7549
835 Ga0496112_0015264 3300048915 Bacteria 7161
836 Ga0496112_0070068 3300048915 Bacteria 3464
837 Ga0496112_0192221 3300048915 Bacteria 2002
838 Ga0496113_0041238 3300048916 Bacteria 3405
839 Ga0496113_0154469 3300048916 Bacteria 1811
840 Ga0496114_0042235 3300048917 Bacteria 3779
841 Ga0496114_0069401 3300048917 Bacteria 2959
842 Ga0496114_0113750 3300048917 Bacteria 2320
843 Ga0496115_0079484 3300048918 Bacteria 2669
844 Ga0496115_0140644 3300048918 Bacteria 1991
845 Ga0496115_0160610 3300048918 Bacteria 1857
846 Ga0496116_0000192 3300048919 Bacteria 122270
847 Ga0496117_0019119 3300048920 Bacteria 5640
848 Ga0496117_0031740 3300048920 Bacteria 4028
849 Ga0496118_0003054 3300048921 Bacteria 21531
850 Ga0496118_0114757 3300048921 Bacteria 1775
851 Ga0496119_0002564 3300048922 Bacteria 19763
852 Ga0496119_0007202 3300048922 Bacteria 10076
853 Ga0496119_0014413 3300048922 Bacteria 6191
854 Ga0496120_0000050 3300048923 Bacteria 187078
855 Ga0496121_0008981 3300048924 Bacteria 11592
856 Ga0496121_0018636 3300048924 Bacteria 6988
857 Ga0496122_0035353 3300048925 Bacteria 4067
858 Ga0496123_0000142 3300048926 Bacteria 146932
859 Ga0496124_0000420 3300048927 Bacteria 75761
860 Ga0501031_0049769 3300049568 Bacteria 2731
861 Ga0501032_0024223 3300049569 Bacteria 4193
862 Ga0501037_0025472 3300049573 Bacteria 4371
863 Ga0501037_0175756 3300049573 Bacteria 1521
864 Ga0501038_0036197 3300049574 Bacteria 4332
865 Ga0501040_0021935 3300049576 Bacteria 4270
866 Ga0501041_0018601 3300049577 Bacteria 4138
867 Ga0501043_0202536 3300049579 Bacteria 1540
868 Ga0501047_0000170 3300049581 Bacteria 79815
869 Ga0501047_0015438 3300049581 Bacteria 7277
870 Ga0501047_0275491 3300049581 Bacteria 1528
871 Ga0501047_0316401 3300049581 Bacteria 1401
872 Ga0501048_0028474 3300049582 Bacteria 4055
873 Ga0501069_0003390 3300049585 Bacteria 8182
874 Ga0501070_0000776 3300049586 Bacteria 29084
875 Ga0501070_0002547 3300049586 Bacteria 15964
876 Ga0501070_0008238 3300049586 Bacteria 8812
877 Ga0501070_0051300 3300049586 Bacteria 3425
878 Ga0501070_0097343 3300049586 Bacteria 2434
879 Ga0501072_0028411 3300049588 Bacteria 4367
880 Ga0501073_0001322 3300049589 Bacteria 18252
881 Ga0501073_0107578 3300049589 Bacteria 1935
882 Ga0501074_0001371 3300049590 Bacteria 16150
883 Ga0501074_0029042 3300049590 Bacteria 4006
884 Ga0501074_0038017 3300049590 Bacteria 3489
885 Ga0501075_0173542 3300049591 Bacteria 1645
886 Ga0501077_0040313 3300049593 Bacteria 2976
887 Ga0501079_0000029 3300049741 Bacteria 60538
888 Ga0501080_0002688 3300049742 Bacteria 15576
889 Ga0501080_0003657 3300049742 Bacteria 13569
890 Ga0501080_0085799 3300049742 Bacteria 2925
891 Ga0501035_0308814 3300049822 Bacteria 1331
892 Ga0501044_0002655 3300049823 Bacteria 20338
893 Ga0501044_0153998 3300049823 Bacteria 2279
894 Ga0501044_0177348 3300049823 Bacteria 2099
895 nmdc:mga05p37_115556_c1 3300050507 Bacteria 3299
896 nmdc:mga05p37_154_c1 3300050507 Bacteria 65419
897 nmdc:mga05p37_189174_c1 3300050507 Bacteria 2501
898 nmdc:mga05p37_285091_c1 3300050507 Bacteria 1968
899 nmdc:mga05p37_2885_c1 3300050507 Bacteria 19950
900 nmdc:mga05p37_329126_c1 3300050507 Bacteria 1805
901 nmdc:mga05p37_38321_c1 3300050507 Bacteria 5880
902 nmdc:mga09592_10495_c1 3300050508 Bacteria 7536
903 nmdc:mga09592_36_c3 3300050508 Bacteria 51356
904 nmdc:mga09592_64933_c1 3300050508 Bacteria 3091
905 nmdc:mga0qj67_134036_c1 3300050509 Bacteria 2007
906 nmdc:mga0qj67_17774_c1 3300050509 Bacteria 5409
907 nmdc:mga0qj67_42_c1 3300050509 Bacteria 46863
908 nmdc:mga06r32_152059_c1 3300050510 Bacteria 2293
909 nmdc:mga06r32_162431_c1 3300050510 Bacteria 2216
910 nmdc:mga06r32_170671_c1 3300050510 Bacteria 2159
911 nmdc:mga06r32_351449_c1 3300050510 Bacteria 1458
912 nmdc:mga06r32_42425_c1 3300050510 Bacteria 4326
913 nmdc:mga06r32_42_c2 3300050510 Bacteria 56690
914 nmdc:mga06r32_87602_c1 3300050510 Bacteria 3038
915 nmdc:mga08y16_272253_c1 3300050511 Bacteria 1748
916 nmdc:mga0n895_2212_c1 3300050512 Bacteria 15040
917 nmdc:mga0n895_386613_c1 3300050512 Bacteria 1416
918 nmdc:mga0n895_98553_c1 3300050512 Bacteria 2930
919 nmdc:mga0rr50_169327_c1 3300050513 Bacteria 1779
920 nmdc:mga0rr50_278029_c1 3300050513 Bacteria 1397
921 nmdc:mga08x19_44867_c1 3300050514 Bacteria 2823
922 nmdc:mga08x19_865_c1 3300050514 Bacteria 18923
923 nmdc:mga0a205_29220_c1 3300050515 Bacteria 5275
924 nmdc:mga0a205_9008_c1 3300050515 Bacteria 9095
925 Ga0495601_0002647 3300053077 Bacteria 10153
926 Ga0495612_0008165 3300053078 Bacteria 4255
927 Ga0495612_0008856 3300053078 Bacteria 4077
928 Ga0495612_0044581 3300053078 Bacteria 1815
929 Ga0495612_0048385 3300053078 Bacteria 1743
930 Ga0495595_0007435 3300053084 Bacteria 4485
931 Ga0495595_0008888 3300053084 Bacteria 4138
932 Ga0495619_0002147 3300053085 Bacteria 13084
933 Ga0495619_0010728 3300053085 Bacteria 5768
934 Ga0495619_0026390 3300053085 Bacteria 3737
935 Ga0500643_000413 3300053087 Bacteria 32620
936 Ga0500646_0000860 3300053090 Bacteria 8415
937 Ga0500583_0036495 3300053092 Bacteria 2201
938 Ga0500594_0008757 3300053118 Bacteria 2314
939 Ga0500568_0012243 3300053139 Bacteria 3951
940 Ga0501084_0074286 3300054114 Bacteria 2847
941 Ga0530510_0009308 3300061734 Bacteria 6892

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0163762 Ga0495629_0163762_547_1527 314
2 3300005327 Ga0070658_10001118 Ga0070658_1000111821 321
3 3300005336 Ga0070680_100013109 Ga0070680_1000131095 321
4 3300025909 Ga0207705_10000251 Ga0207705_100002512 321
5 3300025917 Ga0207660_10015498 Ga0207660_100154984 321
6 3300044693 Ga0466961_0020498 Ga0466961_0020498_1225_2343 321
7 3300005336 Ga0070680_100000019 Ga0070680_10000001952 324
8 3300005458 Ga0070681_10000017 Ga0070681_1000001760 324
9 3300005530 Ga0070679_100000009 Ga0070679_10000000956 324
10 3300025912 Ga0207707_10015071 Ga0207707_100150716 324
11 3300025917 Ga0207660_10000169 Ga0207660_1000016927 324
12 3300025921 Ga0207652_10000124 Ga0207652_1000012418 324
13 3300005439 Ga0070711_100009445 Ga0070711_1000094453 329
14 3300006175 Ga0070712_100022670 Ga0070712_1000226702 329
15 3300025916 Ga0207663_10065351 Ga0207663_100653512 329
16 3300045049 Ga0466959_0097225 Ga0466959_0097225_847_2016 331
17 3300037853 Ga0436364_0922907 Ga0436364_0922907_515_1600 332
18 3300025933 Ga0207706_10019224 Ga0207706_100192244 335
19 3300021388 Ga0213875_10007463 Ga0213875_100074634 338
20 3300037853 Ga0436364_1553651 Ga0436364_1553651_2090_3241 338
21 3300020070 Ga0206356_10605687 Ga0206356_106056874 339
22 3300020075 Ga0206349_1497504 Ga0206349_14975041 339
23 3300013105 Ga0157369_10510184 Ga0157369_105101841 340
24 3300053090 Ga0500646_0000860 Ga0500646_0000860_6288_7313 340
25 3300053092 Ga0500583_0036495 Ga0500583_0036495_320_1345 340
26 3300013297 Ga0157378_10257286 Ga0157378_102572862 343
27 3300014968 Ga0157379_10093503 Ga0157379_100935032 343
28 3300021388 Ga0213875_10028706 Ga0213875_100287062 343
29 3300025986 Ga0207658_10012594 Ga0207658_100125944 343
30 3300035692 Ga0373935_0062286 Ga0373935_0062286_1071_2111 343
31 3300053118 Ga0500594_0008757 Ga0500594_0008757_824_1864 343
32 3300005336 Ga0070680_100014672 Ga0070680_1000146723 344
33 3300005339 Ga0070660_100091712 Ga0070660_1000917121 344
34 3300005458 Ga0070681_10283710 Ga0070681_102837102 344
35 3300005530 Ga0070679_100207422 Ga0070679_1002074222 344
36 3300025912 Ga0207707_10013510 Ga0207707_100135102 344
37 3300025917 Ga0207660_10005501 Ga0207660_100055014 344
38 3300025919 Ga0207657_10115455 Ga0207657_101154552 344
39 3300025921 Ga0207652_10185400 Ga0207652_101854002 344
40 3300025944 Ga0207661_10031508 Ga0207661_100315083 345
41 3300005458 Ga0070681_10104459 Ga0070681_101044592 346
42 3300005458 Ga0070681_10301624 Ga0070681_103016242 346
43 3300025912 Ga0207707_10107891 Ga0207707_101078912 346
44 3300025921 Ga0207652_10060684 Ga0207652_100606842 346
45 3300009147 Ga0114129_10013018 Ga0114129_1001301810 347
46 3300050507 nmdc:mga05p37_115556_c1 nmdc:mga05p37_115556_c1_1576_2628 347
47 3300050508 nmdc:mga09592_10495_c1 nmdc:mga09592_10495_c1_2521_3573 347
48 3300050509 nmdc:mga0qj67_17774_c1 nmdc:mga0qj67_17774_c1_128_1180 347
49 3300050510 nmdc:mga06r32_42425_c1 nmdc:mga06r32_42425_c1_1371_2423 347
50 3300046477 Ga0495664_0033364 Ga0495664_0033364_921_1970 348
51 3300048911 Ga0496108_0002160 Ga0496108_0002160_38_1084 348
52 3300050511 nmdc:mga08y16_272253_c1 nmdc:mga08y16_272253_c1_665_1711 348
53 3300050513 nmdc:mga0rr50_169327_c1 nmdc:mga0rr50_169327_c1_37_1083 348
54 3300013105 Ga0157369_10001900 Ga0157369_100019005 349
55 3300037853 Ga0436364_0722685 Ga0436364_0722685_7073_8191 350
56 3300050513 nmdc:mga0rr50_278029_c1 nmdc:mga0rr50_278029_c1_242_1300 351
57 3300050515 nmdc:mga0a205_29220_c1 nmdc:mga0a205_29220_c1_473_1531 351
58 3300020080 Ga0206350_10827113 Ga0206350_108271131 352
59 3300037466 Ga0395898_0014304 Ga0395898_0014304_4379_5446 352
60 3300048088 Ga0495602_0017852 Ga0495602_0017852_5133_6257 352
61 3300020069 Ga0197907_10794598 Ga0197907_107945981 353
62 3300022467 Ga0224712_10019335 Ga0224712_100193352 353
63 3300048915 Ga0496112_0192221 Ga0496112_0192221_582_1643 353
64 3300035089 Ga0373944_0005699 Ga0373944_0005699_703_1821 354
65 3300035170 Ga0373943_0002709 Ga0373943_0002709_6601_7719 354
66 3300035171 Ga0373946_0000448 Ga0373946_0000448_12218_13336 354
67 3300035695 Ga0373927_0000290 Ga0373927_0000290_12096_13214 354
68 3300035725 Ga0373947_0008178 Ga0373947_0008178_382_1500 354
69 3300037068 Ga0373925_0000878 Ga0373925_0000878_4250_5368 354
70 3300037418 Ga0395900_0142162 Ga0395900_0142162_521_1654 354
71 3300037853 Ga0436364_1520802 Ga0436364_1520802_1631_2782 354
72 3300038443 Ga0395901_0142494 Ga0395901_0142494_970_2103 354
73 3300046463 Ga0495653_0003567 Ga0495653_0003567_9247_10365 354
74 3300046477 Ga0495664_0000511 Ga0495664_0000511_14760_15878 354
75 3300046516 Ga0495628_0080679 Ga0495628_0080679_1312_2430 354
76 3300046529 Ga0495652_0017359 Ga0495652_0017359_4036_5154 354
77 3300046533 Ga0495640_0061441 Ga0495640_0061441_972_2090 354
78 3300046559 Ga0495667_0023900 Ga0495667_0023900_2379_3497 354
79 3300046663 Ga0495635_0008090 Ga0495635_0008090_3218_4336 354
80 3300046678 Ga0495599_0067518 Ga0495599_0067518_635_1753 354
81 3300046678 Ga0495599_0075516 Ga0495599_0075516_88_1206 354
82 3300046680 Ga0495646_0088445 Ga0495646_0088445_612_1730 354
83 3300046690 Ga0495624_0098248 Ga0495624_0098248_13_1131 354
84 3300047319 Ga0495674_0000245 Ga0495674_0000245_30421_31539 354
85 3300047321 Ga0495676_0005249 Ga0495676_0005249_8810_9928 354
86 3300047322 Ga0495680_0003354 Ga0495680_0003354_13884_15002 354
87 3300047471 Ga0495684_0002083 Ga0495684_0002083_8652_9770 354
88 3300035083 Ga0373926_0000879 Ga0373926_0000879_6798_7868 355
89 3300035692 Ga0373935_0000992 Ga0373935_0000992_3471_4541 355
90 3300035725 Ga0373947_0000011 Ga0373947_0000011_10809_11879 355
91 3300036242 Ga0310104_04007 Ga0310104_04007_52_1122 355
92 3300037853 Ga0436364_1159643 Ga0436364_1159643_315_1385 355
93 3300049573 Ga0501037_0175756 Ga0501037_0175756_26_1096 355
94 3300009148 Ga0105243_10017634 Ga0105243_100176342 356
95 3300011119 Ga0105246_10026012 Ga0105246_100260124 356
96 3300013297 Ga0157378_10084496 Ga0157378_100844962 356
97 3300014326 Ga0157380_10070273 Ga0157380_100702732 356
98 3300033545 Ga0316214_1002497 Ga0316214_10024972 356
99 3300035121 Ga0373960_0002089 Ga0373960_0002089_822_1940 356
100 3300035691 Ga0373931_0013722 Ga0373931_0013722_580_1698 356
101 3300046499 Ga0495594_0006518 Ga0495594_0006518_310_1428 356
102 3300047471 Ga0495684_0122856 Ga0495684_0122856_778_1896 356
103 3300048903 Ga0496100_0149186 Ga0496100_0149186_517_1635 356
104 3300048904 Ga0496101_0052208 Ga0496101_0052208_1712_2830 356
105 3300048905 Ga0496102_0175503 Ga0496102_0175503_118_1236 356
106 3300048906 Ga0496103_0096672 Ga0496103_0096672_605_1723 356
107 3300048917 Ga0496114_0113750 Ga0496114_0113750_1086_2204 356
108 3300012515 Ga0157338_1002384 Ga0157338_10023841 357
109 3300039437 Ga0436365_1454613 Ga0436365_1454613_21457_22530 357
110 3300046462 Ga0495651_0062977 Ga0495651_0062977_1248_2366 357
111 3300046463 Ga0495653_0032382 Ga0495653_0032382_1585_2703 357
112 3300046511 Ga0495608_0052607 Ga0495608_0052607_395_1513 357
113 3300046543 Ga0495645_0223985 Ga0495645_0223985_93_1211 357
114 3300046559 Ga0495667_0130888 Ga0495667_0130888_404_1522 357
115 3300047322 Ga0495680_0008112 Ga0495680_0008112_1406_2524 357
116 3300048088 Ga0495602_0111432 Ga0495602_0111432_454_1572 357
117 3300009177 Ga0105248_10000108 Ga0105248_1000010867 358
118 3300009553 Ga0105249_10017845 Ga0105249_100178451 358
119 3300045976 Ga0466967_0536776 Ga0466967_0536776_42_1127 358
120 3300048905 Ga0496102_0006518 Ga0496102_0006518_2545_3663 358
121 3300048919 Ga0496116_0000192 Ga0496116_0000192_1611_2729 358
122 3300048920 Ga0496117_0019119 Ga0496117_0019119_3734_4852 358
123 3300048920 Ga0496117_0031740 Ga0496117_0031740_2521_3639 358
124 3300048921 Ga0496118_0003054 Ga0496118_0003054_20385_21503 358
125 3300048921 Ga0496118_0114757 Ga0496118_0114757_360_1478 358
126 3300048922 Ga0496119_0014413 Ga0496119_0014413_2460_3578 358
127 3300048924 Ga0496121_0018636 Ga0496121_0018636_4456_5574 358
128 3300048925 Ga0496122_0035353 Ga0496122_0035353_1614_2699 358
129 3300048926 Ga0496123_0000142 Ga0496123_0000142_137252_138337 358
130 3300009094 Ga0111539_10305187 Ga0111539_103051871 359
131 3300009147 Ga0114129_10009711 Ga0114129_100097111 359
132 3300035084 Ga0373928_0007702 Ga0373928_0007702_231_1313 359
133 3300035086 Ga0373934_0006628 Ga0373934_0006628_2395_3477 359
134 3300035113 Ga0373936_0036582 Ga0373936_0036582_378_1460 359
135 3300035119 Ga0373956_0030849 Ga0373956_0030849_839_1921 359
136 3300035120 Ga0373957_0009923 Ga0373957_0009923_1217_2299 359
137 3300035120 Ga0373957_0019829 Ga0373957_0019829_214_1296 359
138 3300035172 Ga0373955_0011175 Ga0373955_0011175_1380_2462 359
139 3300035172 Ga0373955_0053298 Ga0373955_0053298_310_1392 359
140 3300035692 Ga0373935_0068151 Ga0373935_0068151_854_1936 359
141 3300035692 Ga0373935_0128494 Ga0373935_0128494_267_1349 359
142 3300035695 Ga0373927_0129597 Ga0373927_0129597_219_1301 359
143 3300035724 Ga0373933_0001003 Ga0373933_0001003_12650_13732 359
144 3300036401 Ga0373937_0032325 Ga0373937_0032325_1914_2996 359
145 3300037068 Ga0373925_0170847 Ga0373925_0170847_233_1315 359
146 3300037418 Ga0395900_0024268 Ga0395900_0024268_1432_2520 359
147 3300037466 Ga0395898_0030902 Ga0395898_0030902_2999_4087 359
148 3300038443 Ga0395901_0051590 Ga0395901_0051590_2602_3690 359
149 3300046454 Ga0495592_0005327 Ga0495592_0005327_7396_8478 359
150 3300046454 Ga0495592_0073197 Ga0495592_0073197_599_1681 359
151 3300046459 Ga0495629_0091202 Ga0495629_0091202_595_1677 359
152 3300046461 Ga0495641_0022054 Ga0495641_0022054_277_1359 359
153 3300046461 Ga0495641_0085619 Ga0495641_0085619_291_1373 359
154 3300046462 Ga0495651_0042453 Ga0495651_0042453_1988_3070 359
155 3300046473 Ga0495582_0043694 Ga0495582_0043694_1029_2111 359
156 3300046499 Ga0495594_0028912 Ga0495594_0028912_765_1847 359
157 3300046511 Ga0495608_0027568 Ga0495608_0027568_2286_3368 359
158 3300046517 Ga0495630_0039687 Ga0495630_0039687_445_1527 359
159 3300046529 Ga0495652_0068593 Ga0495652_0068593_1075_2157 359
160 3300046536 Ga0495587_0007610 Ga0495587_0007610_2797_3879 359
161 3300046543 Ga0495645_0065395 Ga0495645_0065395_1261_2343 359
162 3300046559 Ga0495667_0044706 Ga0495667_0044706_861_1943 359
163 3300046663 Ga0495635_0028853 Ga0495635_0028853_1100_2182 359
164 3300046675 Ga0495657_0007174 Ga0495657_0007174_4276_5358 359
165 3300046678 Ga0495599_0064516 Ga0495599_0064516_518_1600 359
166 3300046689 Ga0495613_0009693 Ga0495613_0009693_329_1411 359
167 3300047315 Ga0495581_0002580 Ga0495581_0002580_7425_8507 359
168 3300047322 Ga0495680_0006351 Ga0495680_0006351_2630_3712 359
169 3300047322 Ga0495680_0134147 Ga0495680_0134147_333_1415 359
170 3300047444 Ga0495675_0025404 Ga0495675_0025404_1621_2703 359
171 3300047444 Ga0495675_0069232 Ga0495675_0069232_293_1375 359
172 3300047471 Ga0495684_0009265 Ga0495684_0009265_1089_2171 359
173 3300047471 Ga0495684_0012380 Ga0495684_0012380_51_1133 359
174 3300047673 Ga0495593_0003291 Ga0495593_0003291_3676_4758 359
175 3300047673 Ga0495593_0053844 Ga0495593_0053844_613_1695 359
176 3300048911 Ga0496108_0074729 Ga0496108_0074729_1433_2596 359
177 3300050507 nmdc:mga05p37_38321_c1 nmdc:mga05p37_38321_c1_4642_5724 359
178 3300050512 nmdc:mga0n895_386613_c1 nmdc:mga0n895_386613_c1_316_1398 359
179 3300050512 nmdc:mga0n895_98553_c1 nmdc:mga0n895_98553_c1_1084_2166 359
180 3300050514 nmdc:mga08x19_44867_c1 nmdc:mga08x19_44867_c1_222_1304 359
181 3300053087 Ga0500643_000413 Ga0500643_000413_6811_7890 359
182 3300009553 Ga0105249_10333492 Ga0105249_103334922 360
183 3300035083 Ga0373926_0000163 Ga0373926_0000163_11723_12841 360
184 3300035089 Ga0373944_0002760 Ga0373944_0002760_3166_4284 360
185 3300035113 Ga0373936_0000453 Ga0373936_0000453_11066_12184 360
186 3300035116 Ga0373945_0011696 Ga0373945_0011696_206_1324 360
187 3300035117 Ga0373953_0001254 Ga0373953_0001254_6092_7210 360
188 3300035118 Ga0373954_0059798 Ga0373954_0059798_248_1366 360
189 3300035171 Ga0373946_0000523 Ga0373946_0000523_8492_9610 360
190 3300035410 Ga0373924_0019187 Ga0373924_0019187_1211_2329 360
191 3300035695 Ga0373927_0134966 Ga0373927_0134966_277_1395 360
192 3300035724 Ga0373933_0005876 Ga0373933_0005876_157_1275 360
193 3300035725 Ga0373947_0002876 Ga0373947_0002876_73_1191 360
194 3300037068 Ga0373925_0150450 Ga0373925_0150450_200_1318 360
195 3300046455 Ga0495603_0026763 Ga0495603_0026763_1871_2989 360
196 3300046461 Ga0495641_0003679 Ga0495641_0003679_1574_2692 360
197 3300046473 Ga0495582_0001655 Ga0495582_0001655_10983_12101 360
198 3300046475 Ga0495639_0010076 Ga0495639_0010076_1073_2191 360
199 3300046516 Ga0495628_0133676 Ga0495628_0133676_706_1824 360
200 3300046517 Ga0495630_0001359 Ga0495630_0001359_11078_12196 360
201 3300046524 Ga0495648_0028013 Ga0495648_0028013_115_1233 360
202 3300046526 Ga0495666_0000806 Ga0495666_0000806_11131_12249 360
203 3300046529 Ga0495652_0062468 Ga0495652_0062468_1950_3068 360
204 3300046531 Ga0495665_0005717 Ga0495665_0005717_4434_5552 360
205 3300046533 Ga0495640_0043428 Ga0495640_0043428_1073_2191 360
206 3300046535 Ga0495586_0000988 Ga0495586_0000988_7855_8973 360
207 3300046536 Ga0495587_0052309 Ga0495587_0052309_74_1192 360
208 3300046536 Ga0495587_0095508 Ga0495587_0095508_510_1628 360
209 3300046543 Ga0495645_0006188 Ga0495645_0006188_1950_3068 360
210 3300046559 Ga0495667_0056587 Ga0495667_0056587_1246_2364 360
211 3300046642 Ga0495634_0002568 Ga0495634_0002568_10930_12048 360
212 3300046663 Ga0495635_0004360 Ga0495635_0004360_5498_6616 360
213 3300046663 Ga0495635_0177172 Ga0495635_0177172_259_1377 360
214 3300046678 Ga0495599_0037334 Ga0495599_0037334_378_1496 360
215 3300046679 Ga0495623_0064209 Ga0495623_0064209_1024_2142 360
216 3300046680 Ga0495646_0001454 Ga0495646_0001454_2554_3672 360
217 3300046683 Ga0495658_0013106 Ga0495658_0013106_2816_3934 360
218 3300046689 Ga0495613_0003573 Ga0495613_0003573_9091_10209 360
219 3300046809 Ga0495600_0000789 Ga0495600_0000789_6654_7772 360
220 3300046809 Ga0495600_0025950 Ga0495600_0025950_2481_3599 360
221 3300047315 Ga0495581_0000249 Ga0495581_0000249_11038_12156 360
222 3300047317 Ga0495604_0040637 Ga0495604_0040637_1179_2297 360
223 3300047319 Ga0495674_0070927 Ga0495674_0070927_73_1191 360
224 3300047322 Ga0495680_0202216 Ga0495680_0202216_101_1219 360
225 3300047444 Ga0495675_0002028 Ga0495675_0002028_73_1191 360
226 3300047471 Ga0495684_0005702 Ga0495684_0005702_73_1191 360
227 3300047673 Ga0495593_0000843 Ga0495593_0000843_11672_12790 360
228 3300048088 Ga0495602_0104780 Ga0495602_0104780_280_1398 360
229 3300048089 Ga0495614_0009740 Ga0495614_0009740_2216_3334 360
230 3300053077 Ga0495601_0002647 Ga0495601_0002647_8963_10081 360
231 3300053078 Ga0495612_0008165 Ga0495612_0008165_2485_3603 360
232 3300053084 Ga0495595_0008888 Ga0495595_0008888_1072_2190 360
233 3300053085 Ga0495619_0002147 Ga0495619_0002147_10894_12012 360
234 3300021388 Ga0213875_10004227 Ga0213875_100042277 361
235 3300005467 Ga0070706_100001284 Ga0070706_1000012848 362
236 3300005471 Ga0070698_100004456 Ga0070698_1000044569 362
237 3300005617 Ga0068859_100000293 Ga0068859_1000002932 362
238 3300005844 Ga0068862_100001926 Ga0068862_1000019262 362
239 3300006931 Ga0097620_100000293 Ga0097620_1000002932 362
240 3300025910 Ga0207684_10073463 Ga0207684_100734632 362
241 3300025941 Ga0207711_10000101 Ga0207711_1000010121 362
242 3300028380 Ga0268265_10000041 Ga0268265_1000004138 362
243 3300049568 Ga0501031_0049769 Ga0501031_0049769_262_1422 362
244 3300049576 Ga0501040_0021935 Ga0501040_0021935_907_2067 362
245 3300049577 Ga0501041_0018601 Ga0501041_0018601_2373_3533 362
246 3300049579 Ga0501043_0202536 Ga0501043_0202536_17_1177 362
247 3300049582 Ga0501048_0028474 Ga0501048_0028474_860_2020 362
248 3300049588 Ga0501072_0028411 Ga0501072_0028411_2357_3517 362
249 3300049589 Ga0501073_0107578 Ga0501073_0107578_113_1273 362
250 3300049590 Ga0501074_0038017 Ga0501074_0038017_2249_3409 362
251 3300049591 Ga0501075_0173542 Ga0501075_0173542_17_1177 362
252 3300049593 Ga0501077_0040313 Ga0501077_0040313_698_1858 362
253 3300054114 Ga0501084_0074286 Ga0501084_0074286_1403_2563 362
254 3300061734 Ga0530510_0009308 Ga0530510_0009308_1209_2369 362
255 3300005435 Ga0070714_100000877 Ga0070714_1000008772 363
256 3300005436 Ga0070713_100044557 Ga0070713_1000445571 363
257 3300005445 Ga0070708_100001990 Ga0070708_10000199013 363
258 3300005468 Ga0070707_100001962 Ga0070707_10000196215 363
259 3300025928 Ga0207700_10298686 Ga0207700_102986861 363
260 3300025929 Ga0207664_10002411 Ga0207664_1000241110 363
261 3300046499 Ga0495594_0086622 Ga0495594_0086622_441_1544 363
262 3300005617 Ga0068859_100004481 Ga0068859_10000448110 364
263 3300005841 Ga0068863_100000336 Ga0068863_10000033618 364
264 3300005842 Ga0068858_100076132 Ga0068858_1000761322 364
265 3300006931 Ga0097620_100004481 Ga0097620_10000448110 364
266 3300024227 Ga0228598_1011957 Ga0228598_10119572 364
267 3300026035 Ga0207703_10065822 Ga0207703_100658221 364
268 3300026088 Ga0207641_10007965 Ga0207641_100079656 364
269 3300044684 Ga0466966_0059011 Ga0466966_0059011_1255_2370 364
270 3300047319 Ga0495674_0246952 Ga0495674_0246952_191_1294 366
271 3300003659 JGI25404J52841_10000075 JGI25404J52841_100000754 367
272 3300005329 Ga0070683_100015194 Ga0070683_1000151942 367
273 3300005330 Ga0070690_100023328 Ga0070690_1000233282 367
274 3300005334 Ga0068869_100013739 Ga0068869_1000137391 367
275 3300005335 Ga0070666_10024666 Ga0070666_100246663 367
276 3300005339 Ga0070660_100058074 Ga0070660_1000580742 367
277 3300005341 Ga0070691_10030804 Ga0070691_100308043 367
278 3300005344 Ga0070661_100012709 Ga0070661_1000127092 367
279 3300005355 Ga0070671_100015566 Ga0070671_1000155663 367
280 3300005366 Ga0070659_100084291 Ga0070659_1000842912 367
281 3300005406 Ga0070703_10014363 Ga0070703_100143633 367
282 3300005441 Ga0070700_100096942 Ga0070700_1000969422 367
283 3300005455 Ga0070663_100079246 Ga0070663_1000792462 367
284 3300005456 Ga0070678_100036396 Ga0070678_1000363962 367
285 3300005458 Ga0070681_10028471 Ga0070681_100284715 367
286 3300005466 Ga0070685_10046254 Ga0070685_100462542 367
287 3300005535 Ga0070684_100029302 Ga0070684_1000293024 367
288 3300005544 Ga0070686_100020426 Ga0070686_1000204263 367
289 3300005545 Ga0070695_100064596 Ga0070695_1000645961 367
290 3300005546 Ga0070696_100017190 Ga0070696_1000171904 367
291 3300005547 Ga0070693_100006574 Ga0070693_1000065744 367
292 3300005564 Ga0070664_100050035 Ga0070664_1000500353 367
293 3300005577 Ga0068857_100042159 Ga0068857_1000421592 367
294 3300005616 Ga0068852_100052482 Ga0068852_1000524822 367
295 3300005617 Ga0068859_100054813 Ga0068859_1000548133 367
296 3300005618 Ga0068864_100062859 Ga0068864_1000628593 367
297 3300005841 Ga0068863_100025168 Ga0068863_1000251684 367
298 3300005843 Ga0068860_100097668 Ga0068860_1000976682 367
299 3300005983 Ga0081540_1000299 Ga0081540_10002999 367
300 3300006237 Ga0097621_100051471 Ga0097621_1000514713 367
301 3300006358 Ga0068871_100177428 Ga0068871_1001774282 367
302 3300006931 Ga0097620_100054815 Ga0097620_1000548153 367
303 3300007076 Ga0075435_100054010 Ga0075435_1000540103 367
304 3300009093 Ga0105240_10405914 Ga0105240_104059141 367
305 3300009174 Ga0105241_10172881 Ga0105241_101728811 367
306 3300009177 Ga0105248_10136281 Ga0105248_101362811 367
307 3300009551 Ga0105238_10162797 Ga0105238_101627971 367
308 3300013296 Ga0157374_10071248 Ga0157374_100712482 367
309 3300013306 Ga0163162_10082540 Ga0163162_100825402 367
310 3300014325 Ga0163163_10057393 Ga0163163_100573932 367
311 3300025321 Ga0207656_10039796 Ga0207656_100397962 367
312 3300025885 Ga0207653_10001531 Ga0207653_100015311 367
313 3300025901 Ga0207688_10012968 Ga0207688_100129683 367
314 3300025907 Ga0207645_10036604 Ga0207645_100366043 367
315 3300025908 Ga0207643_10022020 Ga0207643_100220202 367
316 3300025909 Ga0207705_10101214 Ga0207705_101012142 367
317 3300025916 Ga0207663_10094618 Ga0207663_100946182 367
318 3300025918 Ga0207662_10008115 Ga0207662_100081154 367
319 3300025919 Ga0207657_10015744 Ga0207657_100157445 367
320 3300025921 Ga0207652_10175687 Ga0207652_101756872 367
321 3300025928 Ga0207700_10005012 Ga0207700_100050126 367
322 3300025929 Ga0207664_10042787 Ga0207664_100427872 367
323 3300025932 Ga0207690_10207976 Ga0207690_102079762 367
324 3300025937 Ga0207669_10053731 Ga0207669_100537312 367
325 3300025940 Ga0207691_10033339 Ga0207691_100333393 367
326 3300025941 Ga0207711_10106390 Ga0207711_101063901 367
327 3300025942 Ga0207689_10006270 Ga0207689_100062706 367
328 3300025960 Ga0207651_10183394 Ga0207651_101833941 367
329 3300026067 Ga0207678_10012567 Ga0207678_100125676 367
330 3300026075 Ga0207708_10008319 Ga0207708_100083193 367
331 3300026078 Ga0207702_10011128 Ga0207702_100111285 367
332 3300026088 Ga0207641_10049245 Ga0207641_100492451 367
333 3300026089 Ga0207648_10026334 Ga0207648_100263344 367
334 3300026095 Ga0207676_10081216 Ga0207676_100812162 367
335 3300026116 Ga0207674_10003957 Ga0207674_1000395712 367
336 3300026118 Ga0207675_100020355 Ga0207675_1000203554 367
337 3300026121 Ga0207683_10006776 Ga0207683_100067762 367
338 3300026142 Ga0207698_10067185 Ga0207698_100671853 367
339 3300028379 Ga0268266_10056619 Ga0268266_100566192 367
340 3300050510 nmdc:mga06r32_87602_c1 nmdc:mga06r32_87602_c1_903_2009 367
341 iso_pu_bacteria 2675903060 2676494335 367
342 iso_pu_bacteria 2884693830 2884695180 367
343 iso_pu_bacteria 2895427314 2895432498 367
344 iso_pu_bacteria 2895442618 2895446112 367
345 3300005518 Ga0070699_100016925 Ga0070699_1000169252 368
346 3300005530 Ga0070679_100048561 Ga0070679_1000485613 369
347 3300006173 Ga0070716_100043553 Ga0070716_1000435532 369
348 3300013105 Ga0157369_10093927 Ga0157369_100939272 369
349 3300020081 Ga0206354_10912500 Ga0206354_109125002 369
350 3300020082 Ga0206353_11961061 Ga0206353_119610614 369
351 3300025898 Ga0207692_10016564 Ga0207692_100165641 369
352 3300025921 Ga0207652_10108861 Ga0207652_101088612 369
353 3300026067 Ga0207678_10016803 Ga0207678_100168036 369
354 iso_pu_bacteria 8057568493 8057569644 369
355 3300005518 Ga0070699_100013280 Ga0070699_1000132804 370
356 3300005536 Ga0070697_100002101 Ga0070697_1000021014 370
357 3300009147 Ga0114129_10110803 Ga0114129_101108033 370
358 3300009147 Ga0114129_10373314 Ga0114129_103733142 370
359 3300025910 Ga0207684_10054794 Ga0207684_100547943 370
360 3300025922 Ga0207646_10019370 Ga0207646_100193702 370
361 3300037418 Ga0395900_0024531 Ga0395900_0024531_2818_3939 370
362 3300037471 Ga0395905_0006998 Ga0395905_0006998_9705_10826 370
363 3300038443 Ga0395901_0041350 Ga0395901_0041350_2137_3258 370
364 3300041512 Ga0451853_0837750 Ga0451853_0837750_1366_2487 370
365 3300050507 nmdc:mga05p37_189174_c1 nmdc:mga05p37_189174_c1_773_1894 370
366 3300050507 nmdc:mga05p37_329126_c1 nmdc:mga05p37_329126_c1_120_1235 370
367 3300050508 nmdc:mga09592_64933_c1 nmdc:mga09592_64933_c1_404_1525 370
368 3300050510 nmdc:mga06r32_170671_c1 nmdc:mga06r32_170671_c1_959_2074 370
369 3300005329 Ga0070683_100278666 Ga0070683_1002786662 371
370 3300005535 Ga0070684_100074848 Ga0070684_1000748482 371
371 3300009098 Ga0105245_10461533 Ga0105245_104615331 371
372 3300009147 Ga0114129_10000459 Ga0114129_1000045935 371
373 3300009147 Ga0114129_10002321 Ga0114129_100023212 371
374 3300009177 Ga0105248_10031587 Ga0105248_100315876 371
375 3300009545 Ga0105237_10074165 Ga0105237_100741653 371
376 3300013105 Ga0157369_10007835 Ga0157369_100078356 371
377 3300013105 Ga0157369_10364095 Ga0157369_103640952 371
378 3300013306 Ga0163162_10167824 Ga0163162_101678242 371
379 3300013308 Ga0157375_10017783 Ga0157375_100177832 371
380 3300014325 Ga0163163_10011970 Ga0163163_100119702 371
381 3300014325 Ga0163163_10055451 Ga0163163_100554514 371
382 3300014968 Ga0157379_10259284 Ga0157379_102592842 371
383 3300025944 Ga0207661_10161798 Ga0207661_101617981 371
384 3300025945 Ga0207679_10191433 Ga0207679_101914332 371
385 3300026023 Ga0207677_10148512 Ga0207677_101485122 371
386 3300035088 Ga0373940_0013628 Ga0373940_0013628_285_1409 371
387 3300035115 Ga0373941_0007679 Ga0373941_0007679_490_1614 371
388 3300035170 Ga0373943_0166925 Ga0373943_0166925_48_1166 371
389 3300035207 Ga0373942_0001340 Ga0373942_0001340_4857_5981 371
390 3300037068 Ga0373925_0119052 Ga0373925_0119052_59_1177 371
391 3300037853 Ga0436364_0280596 Ga0436364_0280596_949_2070 371
392 3300039450 Ga0436363_0196300 Ga0436363_0196300_686_1801 371
393 3300044693 Ga0466961_0010687 Ga0466961_0010687_4398_5513 371
394 3300044694 Ga0466963_0017021 Ga0466963_0017021_210_1325 371
395 3300044694 Ga0466963_0216881 Ga0466963_0216881_211_1326 371
396 3300045049 Ga0466959_0099477 Ga0466959_0099477_644_1759 371
397 3300045836 Ga0466958_0005490 Ga0466958_0005490_4535_5650 371
398 3300045976 Ga0466967_0008838 Ga0466967_0008838_4003_5118 371
399 3300045976 Ga0466967_0117782 Ga0466967_0117782_821_1936 371
400 3300046459 Ga0495629_0064450 Ga0495629_0064450_490_1608 371
401 3300048904 Ga0496101_0034817 Ga0496101_0034817_890_2020 371
402 3300048911 Ga0496108_0000016 Ga0496108_0000016_210631_211755 371
403 3300048911 Ga0496108_0122248 Ga0496108_0122248_166_1296 371
404 3300048912 Ga0496109_0006542 Ga0496109_0006542_603_1721 371
405 3300048912 Ga0496109_0128775 Ga0496109_0128775_156_1286 371
406 3300048913 Ga0496110_0011403 Ga0496110_0011403_4988_6106 371
407 3300048913 Ga0496110_0020154 Ga0496110_0020154_1589_2704 371
408 3300048913 Ga0496110_0080324 Ga0496110_0080324_1063_2193 371
409 3300048913 Ga0496110_0269908 Ga0496110_0269908_348_1472 371
410 3300048914 Ga0496111_0080383 Ga0496111_0080383_883_2001 371
411 3300048915 Ga0496112_0013474 Ga0496112_0013474_1455_2585 371
412 3300048915 Ga0496112_0070068 Ga0496112_0070068_2214_3332 371
413 3300048916 Ga0496113_0041238 Ga0496113_0041238_1606_2724 371
414 3300048917 Ga0496114_0069401 Ga0496114_0069401_677_1807 371
415 3300048918 Ga0496115_0140644 Ga0496115_0140644_168_1283 371
416 3300049569 Ga0501032_0024223 Ga0501032_0024223_2602_3717 371
417 3300049573 Ga0501037_0025472 Ga0501037_0025472_1465_2580 371
418 3300049581 Ga0501047_0275491 Ga0501047_0275491_331_1446 371
419 3300049585 Ga0501069_0003390 Ga0501069_0003390_6897_8012 371
420 3300049586 Ga0501070_0000776 Ga0501070_0000776_21704_22819 371
421 3300049586 Ga0501070_0002547 Ga0501070_0002547_4726_5841 371
422 3300049586 Ga0501070_0008238 Ga0501070_0008238_5288_6403 371
423 3300049586 Ga0501070_0051300 Ga0501070_0051300_1269_2384 371
424 3300049586 Ga0501070_0097343 Ga0501070_0097343_919_2034 371
425 3300049589 Ga0501073_0001322 Ga0501073_0001322_14929_16044 371
426 3300049590 Ga0501074_0001371 Ga0501074_0001371_7485_8600 371
427 3300049741 Ga0501079_0000029 Ga0501079_0000029_50484_51599 371
428 3300049742 Ga0501080_0002688 Ga0501080_0002688_7871_8986 371
429 3300049742 Ga0501080_0003657 Ga0501080_0003657_900_2015 371
430 3300049742 Ga0501080_0085799 Ga0501080_0085799_614_1729 371
431 3300049822 Ga0501035_0308814 Ga0501035_0308814_47_1186 371
432 3300049823 Ga0501044_0002655 Ga0501044_0002655_4918_6033 371
433 3300049823 Ga0501044_0153998 Ga0501044_0153998_358_1473 371
434 3300050507 nmdc:mga05p37_154_c1 nmdc:mga05p37_154_c1_47669_48793 371
435 3300050507 nmdc:mga05p37_2885_c1 nmdc:mga05p37_2885_c1_3773_4888 371
436 3300050508 nmdc:mga09592_36_c3 nmdc:mga09592_36_c3_47617_48741 371
437 3300050509 nmdc:mga0qj67_42_c1 nmdc:mga0qj67_42_c1_42657_43781 371
438 3300050510 nmdc:mga06r32_42_c2 nmdc:mga06r32_42_c2_27829_28953 371
439 iso_pu_bacteria 2506783011 2506865622 371
440 iso_pu_bacteria 2773857933 2774903567 371
441 3300009011 Ga0105251_10038138 Ga0105251_100381382 372
442 3300009101 Ga0105247_10000016 Ga0105247_1000001674 372
443 3300009101 Ga0105247_10001099 Ga0105247_100010998 372
444 3300009177 Ga0105248_10010886 Ga0105248_100108868 372
445 3300014325 Ga0163163_10006537 Ga0163163_100065374 372
446 3300014968 Ga0157379_10003427 Ga0157379_100034278 372
447 3300014968 Ga0157379_10099047 Ga0157379_100990472 372
448 3300025906 Ga0207699_10033262 Ga0207699_100332622 372
449 3300031995 Ga0307409_100025998 Ga0307409_1000259982 372
450 3300044694 Ga0466963_0024825 Ga0466963_0024825_1405_2523 372
451 3300048922 Ga0496119_0002564 Ga0496119_0002564_1770_2888 372
452 3300048922 Ga0496119_0007202 Ga0496119_0007202_4739_5857 372
453 3300048923 Ga0496120_0000050 Ga0496120_0000050_89124_90242 372
454 3300048924 Ga0496121_0008981 Ga0496121_0008981_1337_2455 372
455 3300050509 nmdc:mga0qj67_134036_c1 nmdc:mga0qj67_134036_c1_406_1533 372
456 iso_pu_bacteria 2501939600 2501943223 372
457 iso_pu_bacteria 2508501039 2508670469 372
458 iso_pu_bacteria 2515154088 2515493698 372
459 iso_pu_bacteria 2515154129 2515720548 372
460 iso_pu_bacteria 2515154137 2515755087 372
461 iso_pu_bacteria 2515154202 2516084115 372
462 iso_pu_bacteria 2515154203 2516087770 372
463 iso_pu_bacteria 2517572101 2517762687 372
464 iso_pu_bacteria 2527291627 2528202514 372
465 iso_pu_bacteria 2527291629 2528212455 372
466 iso_pu_bacteria 2546825537 2546947167 372
467 iso_pu_bacteria 2576861822 2579747331 372
468 iso_pu_bacteria 2579778521 2579854055 372
469 iso_pu_bacteria 2619618881 2619854281 372
470 iso_pu_bacteria 2619619003 2620350261 372
471 iso_pu_bacteria 2622736626 2623586706 372
472 iso_pu_bacteria 2626541554 2626635991 372
473 iso_pu_bacteria 2671180195 2671835549 372
474 iso_pu_bacteria 2675902999 2676199306 372
475 iso_pu_bacteria 2675903059 2676480372 372
476 iso_pu_bacteria 2684623035 2686540291 372
477 iso_pu_bacteria 2684623036 2686541335 372
478 iso_pu_bacteria 2687453737 2689962489 372
479 iso_pu_bacteria 2687453743 2689994692 372
480 iso_pu_bacteria 2710264753 2710602233 372
481 iso_pu_bacteria 2772190715 2772641906 372
482 iso_pu_bacteria 2773857921 2774843884 372
483 iso_pu_bacteria 2773857922 2774853705 372
484 iso_pu_bacteria 2773857924 2774868201 372
485 iso_pu_bacteria 2831935698 2831938812 372
486 iso_pu_bacteria 2832004796 2832006339 372
487 iso_pu_bacteria 2855670206 2855671494 372
488 iso_pu_bacteria 2855676851 2855680604 372
489 iso_pu_bacteria 2855683550 2855684884 372
490 iso_pu_bacteria 2856858025 2856860621 372
491 iso_pu_bacteria 2857288857 2857292190 372
492 iso_pu_bacteria 2858848962 2858853384 372
493 iso_pu_bacteria 2858868258 2858868721 372
494 iso_pu_bacteria 2858882152 2858883653 372
495 iso_pu_bacteria 2858888857 2858890506 372
496 iso_pu_bacteria 2858895516 2858901135 372
497 iso_pu_bacteria 2858902515 2858903366 372
498 iso_pu_bacteria 2866065130 2866069178 372
499 iso_pu_bacteria 2867302475 2867304059 372
500 iso_pu_bacteria 2867312974 2867313096 372
501 iso_pu_bacteria 2867319477 2867325120 372
502 iso_pu_bacteria 2867507094 2867509565 372
503 iso_pu_bacteria 2869048445 2869048601 372
504 iso_pu_bacteria 2869061728 2869063745 372
505 iso_pu_bacteria 2869068681 2869070368 372
506 iso_pu_bacteria 2880489317 2880493487 372
507 iso_pu_bacteria 2880495981 2880498821 372
508 iso_pu_bacteria 2895880812 2895885082 372
509 iso_pu_bacteria 2902582711 2902586120 372
510 iso_pu_bacteria 2929219909 2929220820 372
511 iso_pu_bacteria 2929226422 2929227408 372
512 iso_pu_bacteria 2996221748 2996227092 372
513 iso_pu_bacteria 637000116 637878068 372
514 iso_pu_bacteria 649633069 649811356 372
515 iso_pu_bacteria 8002775197 8002784078 372
516 iso_pu_bacteria 8002784119 8002788598 372
517 iso_pu_bacteria 8003830390 8003832069 372
518 iso_pu_bacteria 8003870546 8003871442 372
519 iso_pu_bacteria 8054704163 8054709898 372
520 iso_pu_bacteria 8054727385 8054727594 372
521 iso_pu_bacteria 8054734606 8054738076 372
522 iso_pu_bacteria 8054913762 8054920412 372
523 iso_pu_bacteria 8054920844 8054924655 372
524 iso_pu_bacteria 8055157932 8055160056 372
525 iso_pu_bacteria 8055412473 8055414122 372
526 3300005467 Ga0070706_100025572 Ga0070706_1000255722 373
527 3300005535 Ga0070684_100130270 Ga0070684_1001302702 373
528 3300005937 Ga0081455_10000144 Ga0081455_1000014460 373
529 3300005937 Ga0081455_10103387 Ga0081455_101033872 373
530 3300009094 Ga0111539_10014972 Ga0111539_100149724 373
531 3300009094 Ga0111539_10022132 Ga0111539_100221326 373
532 3300009148 Ga0105243_10220030 Ga0105243_102200302 373
533 3300009174 Ga0105241_10005369 Ga0105241_100053699 373
534 3300009177 Ga0105248_10182631 Ga0105248_101826311 373
535 3300009177 Ga0105248_10222528 Ga0105248_102225282 373
536 3300009545 Ga0105237_10333854 Ga0105237_103338541 373
537 3300011119 Ga0105246_10035616 Ga0105246_100356163 373
538 3300011119 Ga0105246_10145282 Ga0105246_101452821 373
539 3300013100 Ga0157373_10177094 Ga0157373_101770941 373
540 3300013104 Ga0157370_10033518 Ga0157370_100335184 373
541 3300013105 Ga0157369_10210689 Ga0157369_102106892 373
542 3300013308 Ga0157375_10293875 Ga0157375_102938752 373
543 3300014745 Ga0157377_10003028 Ga0157377_100030284 373
544 3300014968 Ga0157379_10137096 Ga0157379_101370962 373
545 3300025944 Ga0207661_10008312 Ga0207661_100083127 373
546 3300033180 Ga0307510_10131081 Ga0307510_101310812 373
547 3300035091 Ga0373951_0000053 Ga0373951_0000053_37276_38406 373
548 3300035111 Ga0373923_0014873 Ga0373923_0014873_1331_2455 373
549 3300035117 Ga0373953_0000203 Ga0373953_0000203_2523_3647 373
550 3300035118 Ga0373954_0004129 Ga0373954_0004129_3862_4986 373
551 3300035119 Ga0373956_0017516 Ga0373956_0017516_1080_2204 373
552 3300035120 Ga0373957_0000063 Ga0373957_0000063_24633_25757 373
553 3300035172 Ga0373955_0000011 Ga0373955_0000011_54654_55778 373
554 3300035172 Ga0373955_0024170 Ga0373955_0024170_895_2019 373
555 3300035207 Ga0373942_0027342 Ga0373942_0027342_122_1246 373
556 3300035410 Ga0373924_0000153 Ga0373924_0000153_2349_3473 373
557 3300035410 Ga0373924_0074675 Ga0373924_0074675_85_1209 373
558 3300035724 Ga0373933_0000027 Ga0373933_0000027_34233_35357 373
559 3300036401 Ga0373937_0000159 Ga0373937_0000159_9430_10554 373
560 3300036401 Ga0373937_0011182 Ga0373937_0011182_2498_3622 373
561 3300036401 Ga0373937_0180492 Ga0373937_0180492_205_1329 373
562 3300037068 Ga0373925_0004238 Ga0373925_0004238_7314_8438 373
563 3300037466 Ga0395898_0375076 Ga0395898_0375076_32_1153 373
564 3300042005 Ga0439448_0010651 Ga0439448_0010651_713_1834 373
565 3300046454 Ga0495592_0000019 Ga0495592_0000019_84944_86068 373
566 3300046454 Ga0495592_0092868 Ga0495592_0092868_380_1504 373
567 3300046462 Ga0495651_0000012 Ga0495651_0000012_82475_83599 373
568 3300046462 Ga0495651_0003573 Ga0495651_0003573_2643_3767 373
569 3300046463 Ga0495653_0003237 Ga0495653_0003237_9525_10649 373
570 3300046463 Ga0495653_0003779 Ga0495653_0003779_86_1210 373
571 3300046477 Ga0495664_0027295 Ga0495664_0027295_446_1570 373
572 3300046511 Ga0495608_0000048 Ga0495608_0000048_84944_86068 373
573 3300046511 Ga0495608_0003833 Ga0495608_0003833_7165_8289 373
574 3300046514 Ga0495618_0020319 Ga0495618_0020319_1283_2407 373
575 3300046514 Ga0495618_0186199 Ga0495618_0186199_181_1305 373
576 3300046516 Ga0495628_0000053 Ga0495628_0000053_5042_6166 373
577 3300046516 Ga0495628_0044642 Ga0495628_0044642_998_2122 373
578 3300046516 Ga0495628_0128125 Ga0495628_0128125_434_1558 373
579 3300046517 Ga0495630_0135422 Ga0495630_0135422_714_1841 373
580 3300046529 Ga0495652_0000163 Ga0495652_0000163_54682_55806 373
581 3300046529 Ga0495652_0008769 Ga0495652_0008769_6334_7458 373
582 3300046533 Ga0495640_0057082 Ga0495640_0057082_355_1479 373
583 3300046536 Ga0495587_0000027 Ga0495587_0000027_84944_86068 373
584 3300046543 Ga0495645_0033500 Ga0495645_0033500_1677_2801 373
585 3300046559 Ga0495667_0000074 Ga0495667_0000074_54682_55806 373
586 3300046559 Ga0495667_0004210 Ga0495667_0004210_2473_3597 373
587 3300046663 Ga0495635_0016444 Ga0495635_0016444_1026_2150 373
588 3300046663 Ga0495635_0032993 Ga0495635_0032993_1297_2421 373
589 3300046675 Ga0495657_0000025 Ga0495657_0000025_84944_86068 373
590 3300046675 Ga0495657_0013347 Ga0495657_0013347_2357_3481 373
591 3300046678 Ga0495599_0000026 Ga0495599_0000026_84945_86069 373
592 3300046678 Ga0495599_0017607 Ga0495599_0017607_902_2026 373
593 3300046678 Ga0495599_0101605 Ga0495599_0101605_631_1755 373
594 3300046679 Ga0495623_0000181 Ga0495623_0000181_28603_29727 373
595 3300046679 Ga0495623_0015258 Ga0495623_0015258_1514_2638 373
596 3300046680 Ga0495646_0012816 Ga0495646_0012816_510_1634 373
597 3300046680 Ga0495646_0039423 Ga0495646_0039423_343_1467 373
598 3300046809 Ga0495600_0001653 Ga0495600_0001653_9133_10257 373
599 3300047317 Ga0495604_0000029 Ga0495604_0000029_54682_55806 373
600 3300047317 Ga0495604_0004486 Ga0495604_0004486_8112_9236 373
601 3300047319 Ga0495674_0007661 Ga0495674_0007661_7634_8758 373
602 3300047319 Ga0495674_0048170 Ga0495674_0048170_1735_2859 373
603 3300047321 Ga0495676_0071597 Ga0495676_0071597_633_1757 373
604 3300047322 Ga0495680_0000011 Ga0495680_0000011_54682_55806 373
605 3300047322 Ga0495680_0015821 Ga0495680_0015821_2435_3559 373
606 3300047444 Ga0495675_0000172 Ga0495675_0000172_25424_26548 373
607 3300047444 Ga0495675_0004540 Ga0495675_0004540_6675_7799 373
608 3300047471 Ga0495684_0023576 Ga0495684_0023576_1667_2791 373
609 3300048088 Ga0495602_0000033 Ga0495602_0000033_84945_86069 373
610 3300048903 Ga0496100_0014210 Ga0496100_0014210_810_1934 373
611 3300048905 Ga0496102_0240148 Ga0496102_0240148_278_1399 373
612 3300048906 Ga0496103_0173917 Ga0496103_0173917_37_1158 373
613 3300048907 Ga0496104_0002235 Ga0496104_0002235_5097_6221 373
614 3300048907 Ga0496104_0117036 Ga0496104_0117036_164_1288 373
615 3300048908 Ga0496105_0004813 Ga0496105_0004813_8378_9502 373
616 3300048908 Ga0496105_0007134 Ga0496105_0007134_4358_5482 373
617 3300048908 Ga0496105_0114708 Ga0496105_0114708_837_1958 373
618 3300048909 Ga0496106_0034912 Ga0496106_0034912_342_1463 373
619 3300048909 Ga0496106_0052920 Ga0496106_0052920_1018_2142 373
620 3300048910 Ga0496107_0072646 Ga0496107_0072646_1284_2405 373
621 3300048911 Ga0496108_0005669 Ga0496108_0005669_8118_9242 373
622 3300048911 Ga0496108_0077574 Ga0496108_0077574_172_1296 373
623 3300048912 Ga0496109_0031948 Ga0496109_0031948_1199_2323 373
624 3300048912 Ga0496109_0047058 Ga0496109_0047058_2309_3433 373
625 3300048912 Ga0496109_0251175 Ga0496109_0251175_515_1636 373
626 3300048914 Ga0496111_0000525 Ga0496111_0000525_10769_11890 373
627 3300048915 Ga0496112_0002256 Ga0496112_0002256_5886_7010 373
628 3300048916 Ga0496113_0154469 Ga0496113_0154469_595_1716 373
629 3300048917 Ga0496114_0042235 Ga0496114_0042235_502_1626 373
630 3300048918 Ga0496115_0079484 Ga0496115_0079484_1186_2310 373
631 3300048918 Ga0496115_0160610 Ga0496115_0160610_707_1828 373
632 3300048927 Ga0496124_0000420 Ga0496124_0000420_50220_51341 373
633 3300050507 nmdc:mga05p37_285091_c1 nmdc:mga05p37_285091_c1_677_1798 373
634 3300050510 nmdc:mga06r32_351449_c1 nmdc:mga06r32_351449_c1_32_1183 373
635 3300050512 nmdc:mga0n895_2212_c1 nmdc:mga0n895_2212_c1_8916_10037 373
636 3300050514 nmdc:mga08x19_865_c1 nmdc:mga08x19_865_c1_9962_11083 373
637 3300050515 nmdc:mga0a205_9008_c1 nmdc:mga0a205_9008_c1_7708_8829 373
638 3300053078 Ga0495612_0048385 Ga0495612_0048385_197_1321 373
639 3300053085 Ga0495619_0026390 Ga0495619_0026390_935_2059 373
640 iso_pu_bacteria 2751185782 2753263579 373
641 3300006844 Ga0075428_100000425 Ga0075428_10000042517 374
642 3300006847 Ga0075431_100063606 Ga0075431_1000636061 374
643 3300006847 Ga0075431_100109311 Ga0075431_1001093112 374
644 3300050510 nmdc:mga06r32_152059_c1 nmdc:mga06r32_152059_c1_486_1619 374
645 iso_pu_bacteria 2861520306 2861524606 374
646 3300003203 JGI25406J46586_10004614 JGI25406J46586_100046144 375
647 3300005327 Ga0070658_10009930 Ga0070658_100099303 375
648 3300005330 Ga0070690_100033297 Ga0070690_1000332972 375
649 3300005336 Ga0070680_100003813 Ga0070680_1000038136 375
650 3300005336 Ga0070680_100182631 Ga0070680_1001826311 375
651 3300005339 Ga0070660_100022161 Ga0070660_1000221614 375
652 3300005366 Ga0070659_100001638 Ga0070659_1000016387 375
653 3300005366 Ga0070659_100039025 Ga0070659_1000390252 375
654 3300005530 Ga0070679_100009553 Ga0070679_1000095537 375
655 3300005985 Ga0081539_10000213 Ga0081539_1000021322 375
656 3300005985 Ga0081539_10027270 Ga0081539_100272705 375
657 3300006051 Ga0075364_10079214 Ga0075364_100792142 375
658 3300006844 Ga0075428_100059868 Ga0075428_1000598682 375
659 3300006844 Ga0075428_100300235 Ga0075428_1003002351 375
660 3300006847 Ga0075431_100189136 Ga0075431_1001891362 375
661 3300006880 Ga0075429_100283044 Ga0075429_1002830442 375
662 3300020070 Ga0206356_11585499 Ga0206356_115854991 375
663 3300020077 Ga0206351_11016986 Ga0206351_110169862 375
664 3300020081 Ga0206354_10329808 Ga0206354_103298084 375
665 3300020081 Ga0206354_10945499 Ga0206354_109454991 375
666 3300020082 Ga0206353_10378610 Ga0206353_103786107 375
667 3300020082 Ga0206353_11220165 Ga0206353_112201652 375
668 3300022467 Ga0224712_10000779 Ga0224712_100007793 375
669 3300022467 Ga0224712_10083263 Ga0224712_100832631 375
670 3300025904 Ga0207647_10066059 Ga0207647_100660592 375
671 3300025912 Ga0207707_10000831 Ga0207707_1000083121 375
672 3300025914 Ga0207671_10104769 Ga0207671_101047692 375
673 3300025917 Ga0207660_10010403 Ga0207660_100104033 375
674 3300025917 Ga0207660_10116690 Ga0207660_101166902 375
675 3300025919 Ga0207657_10020177 Ga0207657_100201772 375
676 3300025932 Ga0207690_10000189 Ga0207690_1000018940 375
677 3300025932 Ga0207690_10024372 Ga0207690_100243722 375
678 3300025945 Ga0207679_10271579 Ga0207679_102715791 375
679 3300028379 Ga0268266_10343666 Ga0268266_103436662 375
680 3300028786 Ga0307517_10078602 Ga0307517_100786023 375
681 3300028794 Ga0307515_10000668 Ga0307515_1000066844 375
682 3300028794 Ga0307515_10002310 Ga0307515_1000231033 375
683 3300028794 Ga0307515_10052102 Ga0307515_100521024 375
684 3300028794 Ga0307515_10142854 Ga0307515_101428542 375
685 3300028800 Ga0265338_10003387 Ga0265338_1000338711 375
686 3300030522 Ga0307512_10001051 Ga0307512_1000105124 375
687 3300031241 Ga0265325_10000147 Ga0265325_1000014745 375
688 3300031247 Ga0265340_10001511 Ga0265340_100015116 375
689 3300031249 Ga0265339_10008228 Ga0265339_100082282 375
690 3300031456 Ga0307513_10007756 Ga0307513_1000775612 375
691 3300031507 Ga0307509_10110655 Ga0307509_101106553 375
692 3300031616 Ga0307508_10057552 Ga0307508_100575522 375
693 3300031730 Ga0307516_10000909 Ga0307516_100009098 375
694 3300031730 Ga0307516_10018087 Ga0307516_100180873 375
695 3300031730 Ga0307516_10021159 Ga0307516_100211593 375
696 3300031730 Ga0307516_10112781 Ga0307516_101127813 375
697 3300041512 Ga0451853_2391966 Ga0451853_2391966_33_1178 375
698 iso_pu_bacteria 2887478801 2887484016 375
699 iso_pu_bacteria 8001781756 8001783763 375
700 iso_pu_bacteria 8001781756 8001784883 375
701 3300005327 Ga0070658_10003470 Ga0070658_100034709 376
702 3300005329 Ga0070683_100087942 Ga0070683_1000879423 376
703 3300005336 Ga0070680_100068565 Ga0070680_1000685651 376
704 3300005338 Ga0068868_100221969 Ga0068868_1002219691 376
705 3300005344 Ga0070661_100241375 Ga0070661_1002413751 376
706 3300005347 Ga0070668_100013693 Ga0070668_1000136933 376
707 3300005436 Ga0070713_100142731 Ga0070713_1001427312 376
708 3300005458 Ga0070681_10053546 Ga0070681_100535463 376
709 3300005530 Ga0070679_100086963 Ga0070679_1000869632 376
710 3300005535 Ga0070684_100033699 Ga0070684_1000336994 376
711 3300005563 Ga0068855_100386873 Ga0068855_1003868732 376
712 3300005577 Ga0068857_100019231 Ga0068857_1000192315 376
713 3300005618 Ga0068864_100022577 Ga0068864_1000225775 376
714 3300005841 Ga0068863_100055511 Ga0068863_1000555112 376
715 3300005842 Ga0068858_100000013 Ga0068858_100000013193 376
716 3300005842 Ga0068858_100000337 Ga0068858_10000033745 376
717 3300005842 Ga0068858_100154807 Ga0068858_1001548073 376
718 3300005983 Ga0081540_1002226 Ga0081540_10022268 376
719 3300005983 Ga0081540_1003289 Ga0081540_10032892 376
720 3300005985 Ga0081539_10002741 Ga0081539_100027419 376
721 3300006844 Ga0075428_100001119 Ga0075428_10000111921 376
722 3300006844 Ga0075428_100024241 Ga0075428_1000242412 376
723 3300006846 Ga0075430_100030199 Ga0075430_1000301994 376
724 3300006846 Ga0075430_100032748 Ga0075430_1000327484 376
725 3300006847 Ga0075431_100018040 Ga0075431_1000180403 376
726 3300006847 Ga0075431_100047815 Ga0075431_1000478154 376
727 3300006880 Ga0075429_100019498 Ga0075429_1000194985 376
728 3300006880 Ga0075429_100087546 Ga0075429_1000875463 376
729 3300014968 Ga0157379_10000006 Ga0157379_1000000670 376
730 3300020069 Ga0197907_10792685 Ga0197907_107926852 376
731 3300020070 Ga0206356_11080813 Ga0206356_110808131 376
732 3300020082 Ga0206353_10178569 Ga0206353_101785693 376
733 3300025900 Ga0207710_10000017 Ga0207710_10000017258 376
734 3300025900 Ga0207710_10000062 Ga0207710_1000006257 376
735 3300025909 Ga0207705_10139447 Ga0207705_101394472 376
736 3300025909 Ga0207705_10220573 Ga0207705_102205731 376
737 3300025912 Ga0207707_10079236 Ga0207707_100792363 376
738 3300025915 Ga0207693_10053781 Ga0207693_100537813 376
739 3300025919 Ga0207657_10014063 Ga0207657_100140634 376
740 3300025920 Ga0207649_10051801 Ga0207649_100518012 376
741 3300025921 Ga0207652_10085358 Ga0207652_100853582 376
742 3300025928 Ga0207700_10157573 Ga0207700_101575731 376
743 3300025929 Ga0207664_10262355 Ga0207664_102623551 376
744 3300025941 Ga0207711_10044426 Ga0207711_100444262 376
745 3300025941 Ga0207711_10112432 Ga0207711_101124321 376
746 3300025944 Ga0207661_10024922 Ga0207661_100249222 376
747 3300025972 Ga0207668_10005044 Ga0207668_100050443 376
748 3300026035 Ga0207703_10000006 Ga0207703_1000000678 376
749 3300026035 Ga0207703_10000009 Ga0207703_10000009191 376
750 3300026088 Ga0207641_10144458 Ga0207641_101444582 376
751 3300026095 Ga0207676_10010572 Ga0207676_100105722 376
752 3300026095 Ga0207676_10022346 Ga0207676_100223462 376
753 3300026116 Ga0207674_10033285 Ga0207674_100332855 376
754 3300026116 Ga0207674_10264051 Ga0207674_102640512 376
755 3300026121 Ga0207683_10068473 Ga0207683_100684732 376
756 3300030522 Ga0307512_10056605 Ga0307512_100566052 376
757 3300031507 Ga0307509_10029457 Ga0307509_100294572 376
758 3300031616 Ga0307508_10001073 Ga0307508_100010739 376
759 3300031731 Ga0307405_10012062 Ga0307405_100120622 376
760 3300031824 Ga0307413_10066592 Ga0307413_100665922 376
761 3300031901 Ga0307406_10048881 Ga0307406_100488812 376
762 3300031903 Ga0307407_10059388 Ga0307407_100593882 376
763 3300031911 Ga0307412_10038615 Ga0307412_100386152 376
764 3300032002 Ga0307416_100014053 Ga0307416_1000140534 376
765 3300032126 Ga0307415_100000137 Ga0307415_10000013724 376
766 3300032126 Ga0307415_100077547 Ga0307415_1000775472 376
767 3300032126 Ga0307415_100150007 Ga0307415_1001500072 376
768 3300033179 Ga0307507_10075995 Ga0307507_100759953 376
769 3300046459 Ga0495629_0163313 Ga0495629_0163313_327_1496 376
770 3300049581 Ga0501047_0015438 Ga0501047_0015438_5346_6500 376
771 3300005434 Ga0070709_10004634 Ga0070709_100046342 377
772 3300005435 Ga0070714_100002785 Ga0070714_1000027855 377
773 3300005435 Ga0070714_100053543 Ga0070714_1000535432 377
774 3300005436 Ga0070713_100177256 Ga0070713_1001772562 377
775 3300005437 Ga0070710_10004969 Ga0070710_100049695 377
776 3300005437 Ga0070710_10013610 Ga0070710_100136102 377
777 3300005437 Ga0070710_10015852 Ga0070710_100158522 377
778 3300005439 Ga0070711_100013224 Ga0070711_1000132242 377
779 3300005445 Ga0070708_100038743 Ga0070708_1000387433 377
780 3300005445 Ga0070708_100215491 Ga0070708_1002154912 377
781 3300005456 Ga0070678_100267617 Ga0070678_1002676171 377
782 3300005458 Ga0070681_10166530 Ga0070681_101665302 377
783 3300005467 Ga0070706_100001029 Ga0070706_10000102913 377
784 3300005467 Ga0070706_100001929 Ga0070706_1000019293 377
785 3300005467 Ga0070706_100007327 Ga0070706_1000073275 377
786 3300005467 Ga0070706_100419422 Ga0070706_1004194221 377
787 3300005468 Ga0070707_100000401 Ga0070707_10000040139 377
788 3300005468 Ga0070707_100005223 Ga0070707_1000052233 377
789 3300005468 Ga0070707_100008725 Ga0070707_1000087252 377
790 3300005468 Ga0070707_100063475 Ga0070707_1000634753 377
791 3300005471 Ga0070698_100000080 Ga0070698_10000008039 377
792 3300005471 Ga0070698_100000923 Ga0070698_10000092315 377
793 3300005471 Ga0070698_100007681 Ga0070698_1000076817 377
794 3300005471 Ga0070698_100020077 Ga0070698_1000200774 377
795 3300005471 Ga0070698_100026316 Ga0070698_1000263163 377
796 3300005471 Ga0070698_100035301 Ga0070698_1000353012 377
797 3300005471 Ga0070698_100125068 Ga0070698_1001250682 377
798 3300005518 Ga0070699_100347768 Ga0070699_1003477681 377
799 3300005535 Ga0070684_100167150 Ga0070684_1001671502 377
800 3300005546 Ga0070696_100066308 Ga0070696_1000663082 377
801 3300005563 Ga0068855_100075065 Ga0068855_1000750653 377
802 3300005614 Ga0068856_100015360 Ga0068856_1000153602 377
803 3300005841 Ga0068863_100121010 Ga0068863_1001210103 377
804 3300005983 Ga0081540_1007479 Ga0081540_10074795 377
805 3300006028 Ga0070717_10003011 Ga0070717_100030113 377
806 3300006028 Ga0070717_10011738 Ga0070717_100117382 377
807 3300006173 Ga0070716_100005898 Ga0070716_1000058985 377
808 3300006175 Ga0070712_100056772 Ga0070712_1000567722 377
809 3300006175 Ga0070712_100061032 Ga0070712_1000610322 377
810 3300006844 Ga0075428_100241040 Ga0075428_1002410402 377
811 3300006846 Ga0075430_100003247 Ga0075430_10000324711 377
812 3300007076 Ga0075435_100001372 Ga0075435_1000013722 377
813 3300007076 Ga0075435_100043180 Ga0075435_1000431803 377
814 3300009177 Ga0105248_10109486 Ga0105248_101094863 377
815 3300013105 Ga0157369_10318845 Ga0157369_103188452 377
816 3300020069 Ga0197907_10115527 Ga0197907_101155272 377
817 3300020070 Ga0206356_10284254 Ga0206356_102842542 377
818 3300022467 Ga0224712_10028877 Ga0224712_100288772 377
819 3300022467 Ga0224712_10049097 Ga0224712_100490971 377
820 3300025898 Ga0207692_10004000 Ga0207692_100040005 377
821 3300025898 Ga0207692_10007720 Ga0207692_100077203 377
822 3300025906 Ga0207699_10030097 Ga0207699_100300973 377
823 3300025906 Ga0207699_10075186 Ga0207699_100751862 377
824 3300025910 Ga0207684_10004433 Ga0207684_1000443310 377
825 3300025910 Ga0207684_10006577 Ga0207684_100065774 377
826 3300025910 Ga0207684_10017472 Ga0207684_100174723 377
827 3300025910 Ga0207684_10046467 Ga0207684_100464671 377
828 3300025910 Ga0207684_10257802 Ga0207684_102578021 377
829 3300025915 Ga0207693_10009698 Ga0207693_100096982 377
830 3300025915 Ga0207693_10022281 Ga0207693_100222812 377
831 3300025915 Ga0207693_10049686 Ga0207693_100496862 377
832 3300025916 Ga0207663_10002199 Ga0207663_100021995 377
833 3300025916 Ga0207663_10012258 Ga0207663_100122582 377
834 3300025916 Ga0207663_10115691 Ga0207663_101156912 377
835 3300025921 Ga0207652_10113643 Ga0207652_101136432 377
836 3300025922 Ga0207646_10000589 Ga0207646_100005893 377
837 3300025922 Ga0207646_10000691 Ga0207646_1000069138 377
838 3300025922 Ga0207646_10010303 Ga0207646_100103036 377
839 3300025922 Ga0207646_10201062 Ga0207646_102010621 377
840 3300025927 Ga0207687_10047620 Ga0207687_100476202 377
841 3300025928 Ga0207700_10018326 Ga0207700_100183263 377
842 3300025928 Ga0207700_10024035 Ga0207700_100240352 377
843 3300025929 Ga0207664_10015282 Ga0207664_100152824 377
844 3300025929 Ga0207664_10022658 Ga0207664_100226582 377
845 3300025929 Ga0207664_10248924 Ga0207664_102489241 377
846 3300025939 Ga0207665_10005099 Ga0207665_100050995 377
847 3300025939 Ga0207665_10007526 Ga0207665_100075262 377
848 3300025944 Ga0207661_10028998 Ga0207661_100289983 377
849 3300026023 Ga0207677_10213095 Ga0207677_102130952 377
850 3300026116 Ga0207674_10101680 Ga0207674_101016802 377
851 3300026121 Ga0207683_10198412 Ga0207683_101984122 377
852 3300028794 Ga0307515_10075893 Ga0307515_100758933 377
853 3300031616 Ga0307508_10100251 Ga0307508_101002512 377
854 3300035111 Ga0373923_0027720 Ga0373923_0027720_238_1389 377
855 3300035117 Ga0373953_0019143 Ga0373953_0019143_1000_2151 377
856 3300035118 Ga0373954_0004734 Ga0373954_0004734_849_2000 377
857 3300035119 Ga0373956_0019106 Ga0373956_0019106_673_1824 377
858 3300035170 Ga0373943_0053483 Ga0373943_0053483_38_1174 377
859 3300035172 Ga0373955_0009396 Ga0373955_0009396_3079_4230 377
860 3300035692 Ga0373935_0003522 Ga0373935_0003522_546_1682 377
861 3300035724 Ga0373933_0011863 Ga0373933_0011863_1137_2288 377
862 3300035725 Ga0373947_0141135 Ga0373947_0141135_163_1314 377
863 3300037853 Ga0436364_0149270 Ga0436364_0149270_1199_2350 377
864 3300044694 Ga0466963_0058706 Ga0466963_0058706_665_1807 377
865 3300045836 Ga0466958_0078079 Ga0466958_0078079_467_1609 377
866 3300046454 Ga0495592_0043869 Ga0495592_0043869_506_1642 377
867 3300046459 Ga0495629_0001359 Ga0495629_0001359_7142_8278 377
868 3300046461 Ga0495641_0007998 Ga0495641_0007998_3978_5114 377
869 3300046462 Ga0495651_0194711 Ga0495651_0194711_193_1344 377
870 3300046463 Ga0495653_0012324 Ga0495653_0012324_1634_2785 377
871 3300046463 Ga0495653_0070691 Ga0495653_0070691_506_1642 377
872 3300046473 Ga0495582_0027792 Ga0495582_0027792_1686_2822 377
873 3300046475 Ga0495639_0002648 Ga0495639_0002648_2852_3988 377
874 3300046476 Ga0495662_0027650 Ga0495662_0027650_970_2106 377
875 3300046477 Ga0495664_0109916 Ga0495664_0109916_38_1174 377
876 3300046511 Ga0495608_0026238 Ga0495608_0026238_1537_2673 377
877 3300046514 Ga0495618_0014608 Ga0495618_0014608_296_1432 377
878 3300046516 Ga0495628_0040356 Ga0495628_0040356_2498_3649 377
879 3300046517 Ga0495630_0029186 Ga0495630_0029186_800_1936 377
880 3300046526 Ga0495666_0051119 Ga0495666_0051119_401_1537 377
881 3300046529 Ga0495652_0093442 Ga0495652_0093442_970_2106 377
882 3300046543 Ga0495645_0024024 Ga0495645_0024024_490_1626 377
883 3300046543 Ga0495645_0056217 Ga0495645_0056217_1042_2193 377
884 3300046642 Ga0495634_0139587 Ga0495634_0139587_109_1245 377
885 3300046663 Ga0495635_0003562 Ga0495635_0003562_5045_6196 377
886 3300046663 Ga0495635_0031140 Ga0495635_0031140_2206_3342 377
887 3300046678 Ga0495599_0032847 Ga0495599_0032847_399_1535 377
888 3300046678 Ga0495599_0135054 Ga0495599_0135054_147_1298 377
889 3300046680 Ga0495646_0013096 Ga0495646_0013096_4040_5191 377
890 3300046689 Ga0495613_0006912 Ga0495613_0006912_3609_4745 377
891 3300046690 Ga0495624_0020763 Ga0495624_0020763_2888_4024 377
892 3300046809 Ga0495600_0002721 Ga0495600_0002721_4193_5344 377
893 3300046809 Ga0495600_0002960 Ga0495600_0002960_516_1652 377
894 3300047317 Ga0495604_0020691 Ga0495604_0020691_256_1392 377
895 3300047317 Ga0495604_0088120 Ga0495604_0088120_1111_2262 377
896 3300047319 Ga0495674_0086075 Ga0495674_0086075_1312_2463 377
897 3300047322 Ga0495680_0048041 Ga0495680_0048041_1349_2500 377
898 3300047444 Ga0495675_0001732 Ga0495675_0001732_9024_10160 377
899 3300047471 Ga0495684_0019055 Ga0495684_0019055_463_1614 377
900 3300047471 Ga0495684_0073597 Ga0495684_0073597_970_2106 377
901 3300047673 Ga0495593_0071433 Ga0495593_0071433_378_1514 377
902 3300049581 Ga0501047_0000170 Ga0501047_0000170_37313_38452 377
903 3300053078 Ga0495612_0008856 Ga0495612_0008856_300_1436 377
904 3300053078 Ga0495612_0044581 Ga0495612_0044581_407_1558 377
905 3300053084 Ga0495595_0007435 Ga0495595_0007435_1944_3080 377
906 3300053085 Ga0495619_0010728 Ga0495619_0010728_3676_4812 377
907 3300053139 Ga0500568_0012243 Ga0500568_0012243_2569_3711 377
908 3300005327 Ga0070658_10017982 Ga0070658_100179823 378
909 3300005329 Ga0070683_100018197 Ga0070683_1000181974 378
910 3300005329 Ga0070683_100044057 Ga0070683_1000440573 378
911 3300005334 Ga0068869_100015407 Ga0068869_1000154072 378
912 3300005441 Ga0070700_100013919 Ga0070700_1000139194 378
913 3300005457 Ga0070662_100182529 Ga0070662_1001825291 378
914 3300005458 Ga0070681_10199900 Ga0070681_101999002 378
915 3300005535 Ga0070684_100027727 Ga0070684_1000277272 378
916 3300005535 Ga0070684_100035706 Ga0070684_1000357062 378
917 3300005577 Ga0068857_100006962 Ga0068857_1000069624 378
918 3300005616 Ga0068852_100144517 Ga0068852_1001445172 378
919 3300005844 Ga0068862_100090901 Ga0068862_1000909012 378
920 3300005985 Ga0081539_10002986 Ga0081539_100029864 378
921 3300005985 Ga0081539_10012936 Ga0081539_100129364 378
922 3300006847 Ga0075431_100339620 Ga0075431_1003396201 378
923 3300021384 Ga0213876_10001920 Ga0213876_100019208 378
924 3300025901 Ga0207688_10080748 Ga0207688_100807482 378
925 3300025909 Ga0207705_10099474 Ga0207705_100994742 378
926 3300025942 Ga0207689_10017361 Ga0207689_100173614 378
927 3300025944 Ga0207661_10103845 Ga0207661_101038451 378
928 3300025945 Ga0207679_10032798 Ga0207679_100327982 378
929 3300026067 Ga0207678_10010176 Ga0207678_100101765 378
930 3300026075 Ga0207708_10003131 Ga0207708_100031315 378
931 3300026116 Ga0207674_10009912 Ga0207674_100099126 378
932 3300031240 Ga0265320_10005227 Ga0265320_100052274 378
933 3300031344 Ga0265316_10060639 Ga0265316_100606392 378
934 3300031548 Ga0307408_100125412 Ga0307408_1001254122 378
935 3300031649 Ga0307514_10057500 Ga0307514_100575002 378
936 3300031711 Ga0265314_10013888 Ga0265314_100138883 378
937 3300031852 Ga0307410_10030743 Ga0307410_100307432 378
938 3300031889 Ga0326468_10000415 Ga0326468_100004153 378
939 3300031901 Ga0307406_10031194 Ga0307406_100311943 378
940 3300031901 Ga0307406_10040262 Ga0307406_100402622 378
941 3300031995 Ga0307409_100015923 Ga0307409_1000159232 378
942 3300031995 Ga0307409_100021071 Ga0307409_1000210713 378
943 3300031995 Ga0307409_100132310 Ga0307409_1001323102 378
944 3300032002 Ga0307416_100032279 Ga0307416_1000322793 378
945 3300032002 Ga0307416_100303777 Ga0307416_1003037772 378
946 3300032126 Ga0307415_100017053 Ga0307415_1000170532 378
947 3300032126 Ga0307415_100063093 Ga0307415_1000630932 378
948 3300032126 Ga0307415_100259497 Ga0307415_1002594971 378
949 3300046507 Ga0495606_0001302 Ga0495606_0001302_29295_30452 378
950 3300046616 Ga0495668_0000182 Ga0495668_0000182_49938_51095 378
951 3300046660 Ga0495625_0001990 Ga0495625_0001990_12434_13591 378
952 3300048091 Ga0495626_0000286 Ga0495626_0000286_26281_27438 378
953 3300048915 Ga0496112_0015264 Ga0496112_0015264_1196_2401 378
954 3300005467 Ga0070706_100040802 Ga0070706_1000408023 379
955 3300005471 Ga0070698_100000919 Ga0070698_1000009197 379
956 3300031824 Ga0307413_10070336 Ga0307413_100703362 379
957 3300002459 JGI24751J29686_10002018 JGI24751J29686_100020181 380
958 3300005335 Ga0070666_10058171 Ga0070666_100581713 380
959 3300005337 Ga0070682_100006794 Ga0070682_1000067946 380
960 3300005338 Ga0068868_100142844 Ga0068868_1001428442 380
961 3300005339 Ga0070660_100061951 Ga0070660_1000619513 380
962 3300005341 Ga0070691_10006356 Ga0070691_100063562 380
963 3300005354 Ga0070675_100135349 Ga0070675_1001353492 380
964 3300005355 Ga0070671_100002204 Ga0070671_1000022046 380
965 3300005364 Ga0070673_100156302 Ga0070673_1001563022 380
966 3300005455 Ga0070663_100003873 Ga0070663_1000038734 380
967 3300005456 Ga0070678_100001742 Ga0070678_1000017422 380
968 3300005543 Ga0070672_100200979 Ga0070672_1002009791 380
969 3300005547 Ga0070693_100001537 Ga0070693_1000015373 380
970 3300005615 Ga0070702_100000711 Ga0070702_1000007116 380
971 3300005834 Ga0068851_10015915 Ga0068851_100159151 380
972 3300005840 Ga0068870_10000902 Ga0068870_100009029 380
973 3300005843 Ga0068860_100231992 Ga0068860_1002319922 380
974 3300006028 Ga0070717_10193787 Ga0070717_101937871 380
975 3300006058 Ga0075432_10002675 Ga0075432_100026752 380
976 3300006844 Ga0075428_100373660 Ga0075428_1003736601 380
977 3300006847 Ga0075431_100387872 Ga0075431_1003878721 380
978 3300006852 Ga0075433_10006006 Ga0075433_100060065 380
979 3300006871 Ga0075434_100007362 Ga0075434_1000073626 380
980 3300006914 Ga0075436_100043678 Ga0075436_1000436782 380
981 3300007076 Ga0075435_100001745 Ga0075435_1000017456 380
982 3300025898 Ga0207692_10099768 Ga0207692_100997681 380
983 3300025906 Ga0207699_10029310 Ga0207699_100293102 380
984 3300025906 Ga0207699_10061872 Ga0207699_100618721 380
985 3300025908 Ga0207643_10000275 Ga0207643_100002759 380
986 3300025909 Ga0207705_10007287 Ga0207705_100072873 380
987 3300025911 Ga0207654_10024844 Ga0207654_100248442 380
988 3300025912 Ga0207707_10015846 Ga0207707_100158462 380
989 3300025917 Ga0207660_10114500 Ga0207660_101145002 380
990 3300025919 Ga0207657_10032462 Ga0207657_100324624 380
991 3300025920 Ga0207649_10005696 Ga0207649_100056964 380
992 3300025921 Ga0207652_10046759 Ga0207652_100467591 380
993 3300025925 Ga0207650_10001561 Ga0207650_100015612 380
994 3300025926 Ga0207659_10002333 Ga0207659_100023335 380
995 3300025928 Ga0207700_10020783 Ga0207700_100207832 380
996 3300025928 Ga0207700_10049010 Ga0207700_100490102 380
997 3300025929 Ga0207664_10071983 Ga0207664_100719832 380
998 3300025933 Ga0207706_10050008 Ga0207706_100500084 380
999 3300025940 Ga0207691_10113017 Ga0207691_101130171 380
1000 3300025942 Ga0207689_10001392 Ga0207689_1000139216 380
1001 3300025944 Ga0207661_10001624 Ga0207661_100016245 380
1002 3300025945 Ga0207679_10000388 Ga0207679_1000038810 380
1003 3300026023 Ga0207677_10001030 Ga0207677_100010302 380
1004 3300026067 Ga0207678_10002799 Ga0207678_100027997 380
1005 3300026078 Ga0207702_10001952 Ga0207702_1000195210 380
1006 3300026078 Ga0207702_10010057 Ga0207702_100100575 380
1007 3300026078 Ga0207702_10020010 Ga0207702_100200102 380
1008 3300026095 Ga0207676_10000955 Ga0207676_1000095515 380
1009 3300026116 Ga0207674_10023553 Ga0207674_100235533 380
1010 3300026121 Ga0207683_10002054 Ga0207683_100020549 380
1011 3300027907 Ga0207428_10006365 Ga0207428_1000636510 380
1012 3300028666 Ga0265336_10010667 Ga0265336_100106672 380
1013 3300028800 Ga0265338_10023839 Ga0265338_100238393 380
1014 3300031727 Ga0316576_10008132 Ga0316576_100081323 380
1015 3300031728 Ga0316578_10103644 Ga0316578_101036442 380
1016 3300035398 Ga0316574_0032463 Ga0316574_0032463_836_1996 380
1017 3300036712 Ga0316584_0057010 Ga0316584_0057010_634_1794 380
1018 3300048911 Ga0496108_0089230 Ga0496108_0089230_230_1375 380
1019 3300049574 Ga0501038_0036197 Ga0501038_0036197_2961_4109 380
1020 3300049581 Ga0501047_0316401 Ga0501047_0316401_37_1185 380
1021 3300049590 Ga0501074_0029042 Ga0501074_0029042_2066_3214 380
1022 3300049823 Ga0501044_0177348 Ga0501044_0177348_759_1907 380
1023 3300050510 nmdc:mga06r32_162431_c1 nmdc:mga06r32_162431_c1_564_1712 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

233

397

0.94

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

62

222

0.94

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

243

383

0.82

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

257

412

0.81

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

62

217

0.8

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

214

420

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8304 175 358
5d00-assembly1.cif.gz_A crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump 0.8141 4 375
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.8133 7 377
5d01-assembly1.cif.gz_B crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate 0.8128 4 375
5d01-assembly1.cif.gz_A crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate 0.8126 4 374
ID Description Score Start End Superfamily
af_P9WMZ1_187_386_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8896 192 374 3.40.50.2000
3okaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8886 177 357 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8851 185 358 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8804 204 358 3.40.50.2000
af_P9WMY7_260_428_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8636 200 359 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3N5XD62-F1-model_v4 Glycosyltransferase 0.925 7 380 GO:0009103
GO:0016757
GO:0045226
AF-A0A3A9SMX4-F1-model_v4 Glycosyltransferase family 1 protein 0.919 7 376 GO:0009103
GO:0016757
GO:0045226
AF-A0A0S8DN91-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9181 4 376 GO:0009103
GO:0016757
GO:0045226
AF-A0A7W1FA95-F1-model_v4 Glycosyltransferase family 4 protein 0.9171 6 376 GO:0009103
GO:0016757
GO:0045226
AF-A0A136P3K8-F1-model_v4 deleted 0.9158 56 372

Feature Viewer

pLDDT pTM Quality
92.66 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map