F488442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 438 | 941 | 373 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10061872|Ga0207699_100618721 |
| Length | 423 |
| Sequence | MSVDAHRQAGGGRTLGCNGTSTNAEFASRLATSGPRLRGEGERLLVAPRVLVDATAVPADRGALGRYVDGLISALGTLEADLAVACQRADEERYGRLVPNASIVAGPTAIAHRPARLAWEQTGLPLVAQQVNADVLHAPHYTMPLRPGVPVVSTIHDLTYFTEPDAHNAVTATFFKSAIRTAARRATRLLVPSKATRDELVRVLGADPTRIDVAYHGVDHELFHRPSPERVHQVSDRLGLHDQPYVAYLGGLEPRKNVPALISAWAAAVSDLPDPPALVLGGGSGWSEEVDEAVAAVPAHLRLVRPGYLRFTDLPGFLGGAMVVAFPSRGEGFGLPVLEAMACGAPVLTTHRTSLPEVGGDAVAYTEPDAESIEAALRGLLDDPARLEALGAAGHARSQEFTWTASAEAHMASYQRAAAQRGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 4 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 5 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 6 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 7 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 8 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 9 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 10 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 11 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 12 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 13 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 14 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 15 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 16 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 17 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 18 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 19 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 20 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 21 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 22 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 23 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 24 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 25 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 26 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 27 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 28 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 29 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 30 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 31 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 32 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 33 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 34 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 35 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 36 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 37 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 38 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 39 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 40 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 41 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 42 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 43 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 44 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 45 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 46 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 47 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 48 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 49 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 50 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 51 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 52 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 53 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 54 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 55 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 56 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 57 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 58 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 59 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 60 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 61 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 62 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 63 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 64 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 65 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 66 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 67 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 68 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 78 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 117 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 118 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 128 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 131 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 158 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 177 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 178 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 239 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 242 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 251 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 256 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 286 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 290 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 292 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 300 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 301 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 305 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 306 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 376 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 377 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 378 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 379 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 380 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 381 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 382 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 383 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 384 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 418 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 419 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 420 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 424 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 425 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 426 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 427 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 428 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 429 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 430 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 431 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 432 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 433 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 434 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 435 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 436 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 437 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 438 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.74 |
| Metatranscriptomes | 2.25 |
| Isolates | 8.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 2.93 |
| Rhizoplane | 4.79 |
| Rhizosphere | 83.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10002018 | 3300002459 | Bacteria | 4129 |
| 2 | JGI25406J46586_10004614 | 3300003203 | Bacteria | 6412 |
| 3 | JGI25404J52841_10000075 | 3300003659 | Bacteria | 8877 |
| 4 | Ga0070658_10001118 | 3300005327 | Bacteria | 22898 |
| 5 | Ga0070658_10003470 | 3300005327 | Bacteria | 12954 |
| 6 | Ga0070658_10009930 | 3300005327 | Bacteria | 7647 |
| 7 | Ga0070658_10017982 | 3300005327 | Bacteria | 5654 |
| 8 | Ga0070683_100015194 | 3300005329 | Bacteria | 6759 |
| 9 | Ga0070683_100018197 | 3300005329 | Bacteria | 6220 |
| 10 | Ga0070683_100044057 | 3300005329 | Bacteria | 4114 |
| 11 | Ga0070683_100087942 | 3300005329 | Bacteria | 2914 |
| 12 | Ga0070683_100278666 | 3300005329 | Bacteria | 1591 |
| 13 | Ga0070690_100023328 | 3300005330 | Bacteria | 3795 |
| 14 | Ga0070690_100033297 | 3300005330 | Bacteria | 3224 |
| 15 | Ga0068869_100013739 | 3300005334 | Bacteria | 5393 |
| 16 | Ga0068869_100015407 | 3300005334 | Bacteria | 5127 |
| 17 | Ga0070666_10024666 | 3300005335 | Bacteria | 3919 |
| 18 | Ga0070666_10058171 | 3300005335 | Bacteria | 2614 |
| 19 | Ga0070680_100000019 | 3300005336 | Bacteria | 83282 |
| 20 | Ga0070680_100003813 | 3300005336 | Bacteria | 11276 |
| 21 | Ga0070680_100013109 | 3300005336 | Bacteria | 6452 |
| 22 | Ga0070680_100014672 | 3300005336 | Bacteria | 6126 |
| 23 | Ga0070680_100068565 | 3300005336 | Bacteria | 2911 |
| 24 | Ga0070680_100182631 | 3300005336 | Bacteria | 1767 |
| 25 | Ga0070682_100006794 | 3300005337 | Bacteria | 6420 |
| 26 | Ga0068868_100142844 | 3300005338 | Bacteria | 1966 |
| 27 | Ga0068868_100221969 | 3300005338 | Bacteria | 1582 |
| 28 | Ga0070660_100022161 | 3300005339 | Bacteria | 4694 |
| 29 | Ga0070660_100058074 | 3300005339 | Bacteria | 2999 |
| 30 | Ga0070660_100061951 | 3300005339 | Bacteria | 2905 |
| 31 | Ga0070660_100091712 | 3300005339 | Bacteria | 2397 |
| 32 | Ga0070691_10006356 | 3300005341 | Bacteria | 5401 |
| 33 | Ga0070691_10030804 | 3300005341 | Bacteria | 2513 |
| 34 | Ga0070661_100012709 | 3300005344 | Bacteria | 5892 |
| 35 | Ga0070661_100241375 | 3300005344 | Bacteria | 1391 |
| 36 | Ga0070668_100013693 | 3300005347 | Bacteria | 6056 |
| 37 | Ga0070675_100135349 | 3300005354 | Bacteria | 2103 |
| 38 | Ga0070671_100002204 | 3300005355 | Bacteria | 15049 |
| 39 | Ga0070671_100015566 | 3300005355 | Bacteria | 6145 |
| 40 | Ga0070673_100156302 | 3300005364 | Bacteria | 1936 |
| 41 | Ga0070659_100001638 | 3300005366 | Bacteria | 16131 |
| 42 | Ga0070659_100039025 | 3300005366 | Bacteria | 3706 |
| 43 | Ga0070659_100084291 | 3300005366 | Bacteria | 2541 |
| 44 | Ga0070703_10014363 | 3300005406 | Bacteria | 2256 |
| 45 | Ga0070709_10004634 | 3300005434 | Bacteria | 7422 |
| 46 | Ga0070714_100000877 | 3300005435 | Bacteria | 21361 |
| 47 | Ga0070714_100002785 | 3300005435 | Bacteria | 12892 |
| 48 | Ga0070714_100053543 | 3300005435 | Bacteria | 3445 |
| 49 | Ga0070713_100044557 | 3300005436 | Bacteria | 3632 |
| 50 | Ga0070713_100142731 | 3300005436 | Bacteria | 2123 |
| 51 | Ga0070713_100177256 | 3300005436 | Bacteria | 1913 |
| 52 | Ga0070710_10004969 | 3300005437 | Bacteria | 6293 |
| 53 | Ga0070710_10013610 | 3300005437 | Bacteria | 4079 |
| 54 | Ga0070710_10015852 | 3300005437 | Bacteria | 3822 |
| 55 | Ga0070711_100009445 | 3300005439 | Bacteria | 6010 |
| 56 | Ga0070711_100013224 | 3300005439 | Bacteria | 5179 |
| 57 | Ga0070700_100013919 | 3300005441 | Bacteria | 4530 |
| 58 | Ga0070700_100096942 | 3300005441 | Bacteria | 1936 |
| 59 | Ga0070708_100001990 | 3300005445 | Bacteria | 15740 |
| 60 | Ga0070708_100038743 | 3300005445 | Bacteria | 4166 |
| 61 | Ga0070708_100215491 | 3300005445 | Bacteria | 1799 |
| 62 | Ga0070663_100003873 | 3300005455 | Bacteria | 8717 |
| 63 | Ga0070663_100079246 | 3300005455 | Bacteria | 2409 |
| 64 | Ga0070678_100001742 | 3300005456 | Bacteria | 11694 |
| 65 | Ga0070678_100036396 | 3300005456 | Bacteria | 3445 |
| 66 | Ga0070678_100267617 | 3300005456 | Bacteria | 1440 |
| 67 | Ga0070662_100182529 | 3300005457 | Bacteria | 1655 |
| 68 | Ga0070681_10000017 | 3300005458 | Bacteria | 125537 |
| 69 | Ga0070681_10028471 | 3300005458 | Bacteria | 5617 |
| 70 | Ga0070681_10053546 | 3300005458 | Bacteria | 4022 |
| 71 | Ga0070681_10104459 | 3300005458 | Bacteria | 2775 |
| 72 | Ga0070681_10166530 | 3300005458 | Bacteria | 2127 |
| 73 | Ga0070681_10199900 | 3300005458 | Bacteria | 1917 |
| 74 | Ga0070681_10283710 | 3300005458 | Bacteria | 1567 |
| 75 | Ga0070681_10301624 | 3300005458 | Bacteria | 1511 |
| 76 | Ga0070685_10046254 | 3300005466 | Bacteria | 2497 |
| 77 | Ga0070706_100001029 | 3300005467 | Bacteria | 30268 |
| 78 | Ga0070706_100001284 | 3300005467 | Bacteria | 26767 |
| 79 | Ga0070706_100001929 | 3300005467 | Bacteria | 21385 |
| 80 | Ga0070706_100007327 | 3300005467 | Bacteria | 10349 |
| 81 | Ga0070706_100025572 | 3300005467 | Bacteria | 5434 |
| 82 | Ga0070706_100040802 | 3300005467 | Bacteria | 4284 |
| 83 | Ga0070706_100419422 | 3300005467 | Bacteria | 1246 |
| 84 | Ga0070707_100000401 | 3300005468 | Bacteria | 42604 |
| 85 | Ga0070707_100001962 | 3300005468 | Bacteria | 19673 |
| 86 | Ga0070707_100005223 | 3300005468 | Bacteria | 12156 |
| 87 | Ga0070707_100008725 | 3300005468 | Bacteria | 9401 |
| 88 | Ga0070707_100063475 | 3300005468 | Bacteria | 3545 |
| 89 | Ga0070698_100000080 | 3300005471 | Bacteria | 73829 |
| 90 | Ga0070698_100000919 | 3300005471 | Bacteria | 32170 |
| 91 | Ga0070698_100000923 | 3300005471 | Bacteria | 32124 |
| 92 | Ga0070698_100004456 | 3300005471 | Bacteria | 15390 |
| 93 | Ga0070698_100007681 | 3300005471 | Bacteria | 11662 |
| 94 | Ga0070698_100020077 | 3300005471 | Bacteria | 7004 |
| 95 | Ga0070698_100026316 | 3300005471 | Bacteria | 6055 |
| 96 | Ga0070698_100035301 | 3300005471 | Bacteria | 5171 |
| 97 | Ga0070698_100125068 | 3300005471 | Bacteria | 2529 |
| 98 | Ga0070699_100013280 | 3300005518 | Bacteria | 7103 |
| 99 | Ga0070699_100016925 | 3300005518 | Bacteria | 6262 |
| 100 | Ga0070699_100347768 | 3300005518 | Bacteria | 1335 |
| 101 | Ga0070679_100000009 | 3300005530 | Bacteria | 191579 |
| 102 | Ga0070679_100009553 | 3300005530 | Bacteria | 9175 |
| 103 | Ga0070679_100048561 | 3300005530 | Bacteria | 4227 |
| 104 | Ga0070679_100086963 | 3300005530 | Bacteria | 3113 |
| 105 | Ga0070679_100207422 | 3300005530 | Bacteria | 1924 |
| 106 | Ga0070684_100027727 | 3300005535 | Bacteria | 4784 |
| 107 | Ga0070684_100029302 | 3300005535 | Bacteria | 4663 |
| 108 | Ga0070684_100033699 | 3300005535 | Bacteria | 4375 |
| 109 | Ga0070684_100035706 | 3300005535 | Bacteria | 4256 |
| 110 | Ga0070684_100074848 | 3300005535 | Bacteria | 2985 |
| 111 | Ga0070684_100130270 | 3300005535 | Bacteria | 2269 |
| 112 | Ga0070684_100167150 | 3300005535 | Bacteria | 1997 |
| 113 | Ga0070697_100002101 | 3300005536 | Bacteria | 15249 |
| 114 | Ga0070672_100200979 | 3300005543 | Bacteria | 1666 |
| 115 | Ga0070686_100020426 | 3300005544 | Bacteria | 3918 |
| 116 | Ga0070695_100064596 | 3300005545 | Bacteria | 2381 |
| 117 | Ga0070696_100017190 | 3300005546 | Bacteria | 4881 |
| 118 | Ga0070696_100066308 | 3300005546 | Bacteria | 2532 |
| 119 | Ga0070693_100001537 | 3300005547 | Bacteria | 10418 |
| 120 | Ga0070693_100006574 | 3300005547 | Bacteria | 5640 |
| 121 | Ga0068855_100075065 | 3300005563 | Bacteria | 3926 |
| 122 | Ga0068855_100386873 | 3300005563 | Bacteria | 1535 |
| 123 | Ga0070664_100050035 | 3300005564 | Bacteria | 3535 |
| 124 | Ga0068857_100006962 | 3300005577 | Bacteria | 9732 |
| 125 | Ga0068857_100019231 | 3300005577 | Bacteria | 5996 |
| 126 | Ga0068857_100042159 | 3300005577 | Bacteria | 4047 |
| 127 | Ga0068856_100015360 | 3300005614 | Bacteria | 7401 |
| 128 | Ga0070702_100000711 | 3300005615 | Bacteria | 12580 |
| 129 | Ga0068852_100052482 | 3300005616 | Bacteria | 3504 |
| 130 | Ga0068852_100144517 | 3300005616 | Bacteria | 2205 |
| 131 | Ga0068859_100000293 | 3300005617 | Bacteria | 49833 |
| 132 | Ga0068859_100004481 | 3300005617 | Bacteria | 14254 |
| 133 | Ga0068859_100054813 | 3300005617 | Bacteria | 4011 |
| 134 | Ga0068864_100022577 | 3300005618 | Bacteria | 5276 |
| 135 | Ga0068864_100062859 | 3300005618 | Bacteria | 3217 |
| 136 | Ga0068851_10015915 | 3300005834 | Bacteria | 3591 |
| 137 | Ga0068870_10000902 | 3300005840 | Bacteria | 11616 |
| 138 | Ga0068863_100000336 | 3300005841 | Bacteria | 47714 |
| 139 | Ga0068863_100025168 | 3300005841 | Bacteria | 5675 |
| 140 | Ga0068863_100055511 | 3300005841 | Bacteria | 3751 |
| 141 | Ga0068863_100121010 | 3300005841 | Bacteria | 2496 |
| 142 | Ga0068858_100000013 | 3300005842 | Bacteria | 216466 |
| 143 | Ga0068858_100000337 | 3300005842 | Bacteria | 49725 |
| 144 | Ga0068858_100076132 | 3300005842 | Bacteria | 3117 |
| 145 | Ga0068858_100154807 | 3300005842 | Bacteria | 2156 |
| 146 | Ga0068860_100097668 | 3300005843 | Bacteria | 2800 |
| 147 | Ga0068860_100231992 | 3300005843 | Bacteria | 1794 |
| 148 | Ga0068862_100001926 | 3300005844 | Bacteria | 18852 |
| 149 | Ga0068862_100090901 | 3300005844 | Bacteria | 2658 |
| 150 | Ga0081455_10000144 | 3300005937 | Bacteria | 84406 |
| 151 | Ga0081455_10103387 | 3300005937 | Bacteria | 2281 |
| 152 | Ga0081540_1000299 | 3300005983 | Bacteria | 51428 |
| 153 | Ga0081540_1002226 | 3300005983 | Bacteria | 15985 |
| 154 | Ga0081540_1003289 | 3300005983 | Bacteria | 12831 |
| 155 | Ga0081540_1007479 | 3300005983 | Bacteria | 7777 |
| 156 | Ga0081539_10000213 | 3300005985 | Bacteria | 136148 |
| 157 | Ga0081539_10002741 | 3300005985 | Bacteria | 23779 |
| 158 | Ga0081539_10002986 | 3300005985 | Bacteria | 22169 |
| 159 | Ga0081539_10012936 | 3300005985 | Bacteria | 6348 |
| 160 | Ga0081539_10027270 | 3300005985 | Bacteria | 3622 |
| 161 | Ga0070717_10003011 | 3300006028 | Bacteria | 12003 |
| 162 | Ga0070717_10011738 | 3300006028 | Bacteria | 6666 |
| 163 | Ga0070717_10193787 | 3300006028 | Bacteria | 1777 |
| 164 | Ga0075364_10079214 | 3300006051 | Bacteria | 2171 |
| 165 | Ga0075432_10002675 | 3300006058 | Bacteria | 5946 |
| 166 | Ga0070716_100005898 | 3300006173 | Bacteria | 5959 |
| 167 | Ga0070716_100043553 | 3300006173 | Bacteria | 2510 |
| 168 | Ga0070712_100022670 | 3300006175 | Bacteria | 4138 |
| 169 | Ga0070712_100056772 | 3300006175 | Bacteria | 2747 |
| 170 | Ga0070712_100061032 | 3300006175 | Bacteria | 2662 |
| 171 | Ga0097621_100051471 | 3300006237 | Bacteria | 3352 |
| 172 | Ga0068871_100177428 | 3300006358 | Bacteria | 1829 |
| 173 | Ga0075428_100000425 | 3300006844 | Bacteria | 41939 |
| 174 | Ga0075428_100001119 | 3300006844 | Bacteria | 28604 |
| 175 | Ga0075428_100024241 | 3300006844 | Bacteria | 6711 |
| 176 | Ga0075428_100059868 | 3300006844 | Bacteria | 4169 |
| 177 | Ga0075428_100241040 | 3300006844 | Bacteria | 1951 |
| 178 | Ga0075428_100300235 | 3300006844 | Bacteria | 1726 |
| 179 | Ga0075428_100373660 | 3300006844 | Bacteria | 1528 |
| 180 | Ga0075430_100003247 | 3300006846 | Bacteria | 13622 |
| 181 | Ga0075430_100030199 | 3300006846 | Bacteria | 4601 |
| 182 | Ga0075430_100032748 | 3300006846 | Bacteria | 4411 |
| 183 | Ga0075431_100018040 | 3300006847 | Bacteria | 7179 |
| 184 | Ga0075431_100047815 | 3300006847 | Bacteria | 4411 |
| 185 | Ga0075431_100063606 | 3300006847 | Bacteria | 3807 |
| 186 | Ga0075431_100109311 | 3300006847 | Bacteria | 2854 |
| 187 | Ga0075431_100189136 | 3300006847 | Bacteria | 2110 |
| 188 | Ga0075431_100339620 | 3300006847 | Bacteria | 1512 |
| 189 | Ga0075431_100387872 | 3300006847 | Bacteria | 1400 |
| 190 | Ga0075433_10006006 | 3300006852 | Bacteria | 9566 |
| 191 | Ga0075434_100007362 | 3300006871 | Bacteria | 10186 |
| 192 | Ga0075429_100019498 | 3300006880 | Bacteria | 5876 |
| 193 | Ga0075429_100087546 | 3300006880 | Bacteria | 2714 |
| 194 | Ga0075429_100283044 | 3300006880 | Bacteria | 1452 |
| 195 | Ga0075436_100043678 | 3300006914 | Bacteria | 3090 |
| 196 | Ga0097620_100000293 | 3300006931 | Bacteria | 49833 |
| 197 | Ga0097620_100004481 | 3300006931 | Bacteria | 14254 |
| 198 | Ga0097620_100054815 | 3300006931 | Bacteria | 4011 |
| 199 | Ga0075435_100001372 | 3300007076 | Bacteria | 15726 |
| 200 | Ga0075435_100001745 | 3300007076 | Bacteria | 14156 |
| 201 | Ga0075435_100043180 | 3300007076 | Bacteria | 3608 |
| 202 | Ga0075435_100054010 | 3300007076 | Bacteria | 3241 |
| 203 | Ga0105251_10038138 | 3300009011 | Bacteria | 2355 |
| 204 | Ga0105240_10405914 | 3300009093 | Bacteria | 1534 |
| 205 | Ga0111539_10014972 | 3300009094 | Bacteria | 9668 |
| 206 | Ga0111539_10022132 | 3300009094 | Bacteria | 7814 |
| 207 | Ga0111539_10305187 | 3300009094 | Bacteria | 1852 |
| 208 | Ga0105245_10461533 | 3300009098 | Bacteria | 1280 |
| 209 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 210 | Ga0105247_10001099 | 3300009101 | Bacteria | 20120 |
| 211 | Ga0114129_10000459 | 3300009147 | Bacteria | 48751 |
| 212 | Ga0114129_10002321 | 3300009147 | Bacteria | 26414 |
| 213 | Ga0114129_10009711 | 3300009147 | Bacteria | 13730 |
| 214 | Ga0114129_10013018 | 3300009147 | Bacteria | 11848 |
| 215 | Ga0114129_10110803 | 3300009147 | Bacteria | 3788 |
| 216 | Ga0114129_10373314 | 3300009147 | Bacteria | 1885 |
| 217 | Ga0105243_10017634 | 3300009148 | Bacteria | 5400 |
| 218 | Ga0105243_10220030 | 3300009148 | Bacteria | 1678 |
| 219 | Ga0105241_10005369 | 3300009174 | Bacteria | 9473 |
| 220 | Ga0105241_10172881 | 3300009174 | Bacteria | 1786 |
| 221 | Ga0105248_10000108 | 3300009177 | Bacteria | 93521 |
| 222 | Ga0105248_10010886 | 3300009177 | Bacteria | 10037 |
| 223 | Ga0105248_10031587 | 3300009177 | Bacteria | 5917 |
| 224 | Ga0105248_10109486 | 3300009177 | Bacteria | 3114 |
| 225 | Ga0105248_10136281 | 3300009177 | Bacteria | 2769 |
| 226 | Ga0105248_10182631 | 3300009177 | Bacteria | 2364 |
| 227 | Ga0105248_10222528 | 3300009177 | Bacteria | 2125 |
| 228 | Ga0105237_10074165 | 3300009545 | Bacteria | 3394 |
| 229 | Ga0105237_10333854 | 3300009545 | Bacteria | 1520 |
| 230 | Ga0105238_10162797 | 3300009551 | Bacteria | 2207 |
| 231 | Ga0105249_10017845 | 3300009553 | Bacteria | 6305 |
| 232 | Ga0105249_10333492 | 3300009553 | Bacteria | 1531 |
| 233 | Ga0105246_10026012 | 3300011119 | Bacteria | 3818 |
| 234 | Ga0105246_10035616 | 3300011119 | Bacteria | 3328 |
| 235 | Ga0105246_10145282 | 3300011119 | Bacteria | 1789 |
| 236 | Ga0157338_1002384 | 3300012515 | Bacteria | 1471 |
| 237 | Ga0157373_10177094 | 3300013100 | Bacteria | 1501 |
| 238 | Ga0157370_10033518 | 3300013104 | Bacteria | 5007 |
| 239 | Ga0157369_10001900 | 3300013105 | Bacteria | 25188 |
| 240 | Ga0157369_10007835 | 3300013105 | Bacteria | 12285 |
| 241 | Ga0157369_10093927 | 3300013105 | Bacteria | 3202 |
| 242 | Ga0157369_10210689 | 3300013105 | Bacteria | 2037 |
| 243 | Ga0157369_10318845 | 3300013105 | Bacteria | 1616 |
| 244 | Ga0157369_10364095 | 3300013105 | Bacteria | 1501 |
| 245 | Ga0157369_10510184 | 3300013105 | Bacteria | 1244 |
| 246 | Ga0157374_10071248 | 3300013296 | Bacteria | 3277 |
| 247 | Ga0157378_10084496 | 3300013297 | Bacteria | 2874 |
| 248 | Ga0157378_10257286 | 3300013297 | Bacteria | 1673 |
| 249 | Ga0163162_10082540 | 3300013306 | Bacteria | 3286 |
| 250 | Ga0163162_10167824 | 3300013306 | Bacteria | 2319 |
| 251 | Ga0157375_10017783 | 3300013308 | Bacteria | 6428 |
| 252 | Ga0157375_10293875 | 3300013308 | Bacteria | 1788 |
| 253 | Ga0163163_10006537 | 3300014325 | Bacteria | 10205 |
| 254 | Ga0163163_10011970 | 3300014325 | Bacteria | 7894 |
| 255 | Ga0163163_10055451 | 3300014325 | Bacteria | 3917 |
| 256 | Ga0163163_10057393 | 3300014325 | Bacteria | 3849 |
| 257 | Ga0157380_10070273 | 3300014326 | Bacteria | 2829 |
| 258 | Ga0157377_10003028 | 3300014745 | Bacteria | 7533 |
| 259 | Ga0157379_10000006 | 3300014968 | Bacteria | 163550 |
| 260 | Ga0157379_10003427 | 3300014968 | Bacteria | 13413 |
| 261 | Ga0157379_10093503 | 3300014968 | Bacteria | 2698 |
| 262 | Ga0157379_10099047 | 3300014968 | Bacteria | 2617 |
| 263 | Ga0157379_10137096 | 3300014968 | Bacteria | 2205 |
| 264 | Ga0157379_10259284 | 3300014968 | Bacteria | 1579 |
| 265 | Ga0197907_10115527 | 3300020069 | Bacteria | 2062 |
| 266 | Ga0197907_10792685 | 3300020069 | Bacteria | 1770 |
| 267 | Ga0197907_10794598 | 3300020069 | Bacteria | 3122 |
| 268 | Ga0206356_10284254 | 3300020070 | Bacteria | 2615 |
| 269 | Ga0206356_10605687 | 3300020070 | Bacteria | 4538 |
| 270 | Ga0206356_11080813 | 3300020070 | Bacteria | 2548 |
| 271 | Ga0206356_11585499 | 3300020070 | Bacteria | 1376 |
| 272 | Ga0206349_1497504 | 3300020075 | Bacteria | 1154 |
| 273 | Ga0206351_11016986 | 3300020077 | Bacteria | 1592 |
| 274 | Ga0206350_10827113 | 3300020080 | Bacteria | 1140 |
| 275 | Ga0206354_10329808 | 3300020081 | Bacteria | 4363 |
| 276 | Ga0206354_10912500 | 3300020081 | Bacteria | 2587 |
| 277 | Ga0206354_10945499 | 3300020081 | Bacteria | 1339 |
| 278 | Ga0206353_10178569 | 3300020082 | Bacteria | 7592 |
| 279 | Ga0206353_10378610 | 3300020082 | Bacteria | 14406 |
| 280 | Ga0206353_11220165 | 3300020082 | Bacteria | 1656 |
| 281 | Ga0206353_11961061 | 3300020082 | Bacteria | 3107 |
| 282 | Ga0213876_10001920 | 3300021384 | Bacteria | 12469 |
| 283 | Ga0213875_10004227 | 3300021388 | Bacteria | 7924 |
| 284 | Ga0213875_10007463 | 3300021388 | Bacteria | 5641 |
| 285 | Ga0213875_10028706 | 3300021388 | Bacteria | 2640 |
| 286 | Ga0224712_10000779 | 3300022467 | Bacteria | 6689 |
| 287 | Ga0224712_10019335 | 3300022467 | Bacteria | 2295 |
| 288 | Ga0224712_10028877 | 3300022467 | Bacteria | 1987 |
| 289 | Ga0224712_10049097 | 3300022467 | Bacteria | 1633 |
| 290 | Ga0224712_10083263 | 3300022467 | Bacteria | 1325 |
| 291 | Ga0228598_1011957 | 3300024227 | Bacteria | 1726 |
| 292 | Ga0207656_10039796 | 3300025321 | Bacteria | 1991 |
| 293 | Ga0207653_10001531 | 3300025885 | Bacteria | 7480 |
| 294 | Ga0207692_10004000 | 3300025898 | Bacteria | 5796 |
| 295 | Ga0207692_10007720 | 3300025898 | Bacteria | 4419 |
| 296 | Ga0207692_10016564 | 3300025898 | Bacteria | 3268 |
| 297 | Ga0207692_10099768 | 3300025898 | Bacteria | 1591 |
| 298 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 299 | Ga0207710_10000062 | 3300025900 | Bacteria | 164192 |
| 300 | Ga0207688_10012968 | 3300025901 | Bacteria | 4532 |
| 301 | Ga0207688_10080748 | 3300025901 | Bacteria | 1856 |
| 302 | Ga0207647_10066059 | 3300025904 | Bacteria | 2194 |
| 303 | Ga0207699_10029310 | 3300025906 | Bacteria | 3068 |
| 304 | Ga0207699_10030097 | 3300025906 | Bacteria | 3035 |
| 305 | Ga0207699_10033262 | 3300025906 | Bacteria | 2913 |
| 306 | Ga0207699_10061872 | 3300025906 | Bacteria | 2254 |
| 307 | Ga0207699_10075186 | 3300025906 | Bacteria | 2077 |
| 308 | Ga0207645_10036604 | 3300025907 | Bacteria | 3151 |
| 309 | Ga0207643_10000275 | 3300025908 | Bacteria | 35710 |
| 310 | Ga0207643_10022020 | 3300025908 | Bacteria | 3507 |
| 311 | Ga0207705_10000251 | 3300025909 | Bacteria | 52410 |
| 312 | Ga0207705_10007287 | 3300025909 | Bacteria | 8135 |
| 313 | Ga0207705_10099474 | 3300025909 | Bacteria | 2138 |
| 314 | Ga0207705_10101214 | 3300025909 | Bacteria | 2119 |
| 315 | Ga0207705_10139447 | 3300025909 | Bacteria | 1810 |
| 316 | Ga0207705_10220573 | 3300025909 | Bacteria | 1440 |
| 317 | Ga0207684_10004433 | 3300025910 | Bacteria | 13229 |
| 318 | Ga0207684_10006577 | 3300025910 | Bacteria | 10576 |
| 319 | Ga0207684_10017472 | 3300025910 | Bacteria | 6153 |
| 320 | Ga0207684_10046467 | 3300025910 | Bacteria | 3683 |
| 321 | Ga0207684_10054794 | 3300025910 | Bacteria | 3383 |
| 322 | Ga0207684_10073463 | 3300025910 | Bacteria | 2904 |
| 323 | Ga0207684_10257802 | 3300025910 | Bacteria | 1504 |
| 324 | Ga0207654_10024844 | 3300025911 | Bacteria | 3226 |
| 325 | Ga0207707_10000831 | 3300025912 | Bacteria | 30306 |
| 326 | Ga0207707_10013510 | 3300025912 | Bacteria | 7117 |
| 327 | Ga0207707_10015071 | 3300025912 | Bacteria | 6730 |
| 328 | Ga0207707_10015846 | 3300025912 | Bacteria | 6573 |
| 329 | Ga0207707_10079236 | 3300025912 | Bacteria | 2868 |
| 330 | Ga0207707_10107891 | 3300025912 | Bacteria | 2434 |
| 331 | Ga0207671_10104769 | 3300025914 | Bacteria | 2145 |
| 332 | Ga0207693_10009698 | 3300025915 | Bacteria | 7839 |
| 333 | Ga0207693_10022281 | 3300025915 | Bacteria | 5035 |
| 334 | Ga0207693_10049686 | 3300025915 | Bacteria | 3294 |
| 335 | Ga0207693_10053781 | 3300025915 | Bacteria | 3159 |
| 336 | Ga0207663_10002199 | 3300025916 | Bacteria | 9327 |
| 337 | Ga0207663_10012258 | 3300025916 | Bacteria | 4630 |
| 338 | Ga0207663_10065351 | 3300025916 | Bacteria | 2325 |
| 339 | Ga0207663_10094618 | 3300025916 | Bacteria | 1991 |
| 340 | Ga0207663_10115691 | 3300025916 | Bacteria | 1827 |
| 341 | Ga0207660_10000169 | 3300025917 | Bacteria | 41207 |
| 342 | Ga0207660_10005501 | 3300025917 | Bacteria | 8228 |
| 343 | Ga0207660_10010403 | 3300025917 | Bacteria | 6036 |
| 344 | Ga0207660_10015498 | 3300025917 | Bacteria | 5031 |
| 345 | Ga0207660_10114500 | 3300025917 | Bacteria | 2034 |
| 346 | Ga0207660_10116690 | 3300025917 | Bacteria | 2017 |
| 347 | Ga0207662_10008115 | 3300025918 | Bacteria | 5738 |
| 348 | Ga0207657_10014063 | 3300025919 | Bacteria | 7831 |
| 349 | Ga0207657_10015744 | 3300025919 | Bacteria | 7313 |
| 350 | Ga0207657_10020177 | 3300025919 | Bacteria | 6306 |
| 351 | Ga0207657_10032462 | 3300025919 | Bacteria | 4717 |
| 352 | Ga0207657_10115455 | 3300025919 | Bacteria | 2213 |
| 353 | Ga0207649_10005696 | 3300025920 | Bacteria | 6744 |
| 354 | Ga0207649_10051801 | 3300025920 | Bacteria | 2543 |
| 355 | Ga0207652_10000124 | 3300025921 | Bacteria | 82835 |
| 356 | Ga0207652_10046759 | 3300025921 | Bacteria | 3694 |
| 357 | Ga0207652_10060684 | 3300025921 | Bacteria | 3263 |
| 358 | Ga0207652_10085358 | 3300025921 | Bacteria | 2767 |
| 359 | Ga0207652_10108861 | 3300025921 | Bacteria | 2456 |
| 360 | Ga0207652_10113643 | 3300025921 | Bacteria | 2404 |
| 361 | Ga0207652_10175687 | 3300025921 | Bacteria | 1923 |
| 362 | Ga0207652_10185400 | 3300025921 | Bacteria | 1871 |
| 363 | Ga0207646_10000589 | 3300025922 | Bacteria | 47411 |
| 364 | Ga0207646_10000691 | 3300025922 | Bacteria | 43602 |
| 365 | Ga0207646_10010303 | 3300025922 | Bacteria | 9143 |
| 366 | Ga0207646_10019370 | 3300025922 | Bacteria | 6326 |
| 367 | Ga0207646_10201062 | 3300025922 | Bacteria | 1800 |
| 368 | Ga0207650_10001561 | 3300025925 | Bacteria | 16379 |
| 369 | Ga0207659_10002333 | 3300025926 | Bacteria | 11293 |
| 370 | Ga0207687_10047620 | 3300025927 | Bacteria | 2972 |
| 371 | Ga0207700_10005012 | 3300025928 | Bacteria | 7877 |
| 372 | Ga0207700_10018326 | 3300025928 | Bacteria | 4701 |
| 373 | Ga0207700_10020783 | 3300025928 | Bacteria | 4468 |
| 374 | Ga0207700_10024035 | 3300025928 | Bacteria | 4213 |
| 375 | Ga0207700_10049010 | 3300025928 | Bacteria | 3139 |
| 376 | Ga0207700_10157573 | 3300025928 | Bacteria | 1883 |
| 377 | Ga0207700_10298686 | 3300025928 | Bacteria | 1390 |
| 378 | Ga0207664_10002411 | 3300025929 | Bacteria | 12355 |
| 379 | Ga0207664_10015282 | 3300025929 | Bacteria | 5566 |
| 380 | Ga0207664_10022658 | 3300025929 | Bacteria | 4694 |
| 381 | Ga0207664_10042787 | 3300025929 | Bacteria | 3538 |
| 382 | Ga0207664_10071983 | 3300025929 | Bacteria | 2786 |
| 383 | Ga0207664_10248924 | 3300025929 | Bacteria | 1550 |
| 384 | Ga0207664_10262355 | 3300025929 | Bacteria | 1511 |
| 385 | Ga0207690_10000189 | 3300025932 | Bacteria | 47490 |
| 386 | Ga0207690_10024372 | 3300025932 | Bacteria | 3790 |
| 387 | Ga0207690_10207976 | 3300025932 | Bacteria | 1490 |
| 388 | Ga0207706_10019224 | 3300025933 | Bacteria | 6143 |
| 389 | Ga0207706_10050008 | 3300025933 | Bacteria | 3694 |
| 390 | Ga0207669_10053731 | 3300025937 | Bacteria | 2429 |
| 391 | Ga0207665_10005099 | 3300025939 | Bacteria | 8767 |
| 392 | Ga0207665_10007526 | 3300025939 | Bacteria | 7200 |
| 393 | Ga0207691_10033339 | 3300025940 | Bacteria | 4795 |
| 394 | Ga0207691_10113017 | 3300025940 | Bacteria | 2414 |
| 395 | Ga0207711_10000101 | 3300025941 | Bacteria | 90693 |
| 396 | Ga0207711_10044426 | 3300025941 | Bacteria | 3793 |
| 397 | Ga0207711_10106390 | 3300025941 | Bacteria | 2489 |
| 398 | Ga0207711_10112432 | 3300025941 | Bacteria | 2423 |
| 399 | Ga0207689_10001392 | 3300025942 | Bacteria | 23099 |
| 400 | Ga0207689_10006270 | 3300025942 | Bacteria | 10541 |
| 401 | Ga0207689_10017361 | 3300025942 | Bacteria | 6090 |
| 402 | Ga0207661_10001624 | 3300025944 | Bacteria | 15294 |
| 403 | Ga0207661_10008312 | 3300025944 | Bacteria | 7414 |
| 404 | Ga0207661_10024922 | 3300025944 | Bacteria | 4541 |
| 405 | Ga0207661_10028998 | 3300025944 | Bacteria | 4246 |
| 406 | Ga0207661_10031508 | 3300025944 | Bacteria | 4097 |
| 407 | Ga0207661_10103845 | 3300025944 | Bacteria | 2392 |
| 408 | Ga0207661_10161798 | 3300025944 | Bacteria | 1943 |
| 409 | Ga0207679_10000388 | 3300025945 | Bacteria | 31607 |
| 410 | Ga0207679_10032798 | 3300025945 | Bacteria | 3650 |
| 411 | Ga0207679_10191433 | 3300025945 | Bacteria | 1701 |
| 412 | Ga0207679_10271579 | 3300025945 | Bacteria | 1450 |
| 413 | Ga0207651_10183394 | 3300025960 | Bacteria | 1662 |
| 414 | Ga0207668_10005044 | 3300025972 | Bacteria | 7771 |
| 415 | Ga0207658_10012594 | 3300025986 | Bacteria | 5774 |
| 416 | Ga0207677_10001030 | 3300026023 | Bacteria | 15352 |
| 417 | Ga0207677_10148512 | 3300026023 | Bacteria | 1805 |
| 418 | Ga0207677_10213095 | 3300026023 | Bacteria | 1544 |
| 419 | Ga0207703_10000006 | 3300026035 | Bacteria | 502351 |
| 420 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 421 | Ga0207703_10065822 | 3300026035 | Bacteria | 2979 |
| 422 | Ga0207678_10002799 | 3300026067 | Bacteria | 15829 |
| 423 | Ga0207678_10010176 | 3300026067 | Bacteria | 8256 |
| 424 | Ga0207678_10012567 | 3300026067 | Bacteria | 7440 |
| 425 | Ga0207678_10016803 | 3300026067 | Bacteria | 6428 |
| 426 | Ga0207708_10003131 | 3300026075 | Bacteria | 12175 |
| 427 | Ga0207708_10008319 | 3300026075 | Bacteria | 7682 |
| 428 | Ga0207702_10001952 | 3300026078 | Bacteria | 20108 |
| 429 | Ga0207702_10010057 | 3300026078 | Bacteria | 7928 |
| 430 | Ga0207702_10011128 | 3300026078 | Bacteria | 7508 |
| 431 | Ga0207702_10020010 | 3300026078 | Bacteria | 5545 |
| 432 | Ga0207641_10007965 | 3300026088 | Bacteria | 8780 |
| 433 | Ga0207641_10049245 | 3300026088 | Bacteria | 3559 |
| 434 | Ga0207641_10144458 | 3300026088 | Bacteria | 2150 |
| 435 | Ga0207648_10026334 | 3300026089 | Bacteria | 5169 |
| 436 | Ga0207676_10000955 | 3300026095 | Bacteria | 22339 |
| 437 | Ga0207676_10010572 | 3300026095 | Bacteria | 6578 |
| 438 | Ga0207676_10022346 | 3300026095 | Bacteria | 4652 |
| 439 | Ga0207676_10081216 | 3300026095 | Bacteria | 2633 |
| 440 | Ga0207674_10003957 | 3300026116 | Bacteria | 18011 |
| 441 | Ga0207674_10009912 | 3300026116 | Bacteria | 10837 |
| 442 | Ga0207674_10023553 | 3300026116 | Bacteria | 6592 |
| 443 | Ga0207674_10033285 | 3300026116 | Bacteria | 5397 |
| 444 | Ga0207674_10101680 | 3300026116 | Bacteria | 2855 |
| 445 | Ga0207674_10264051 | 3300026116 | Bacteria | 1669 |
| 446 | Ga0207675_100020355 | 3300026118 | Bacteria | 6184 |
| 447 | Ga0207683_10002054 | 3300026121 | Bacteria | 17812 |
| 448 | Ga0207683_10006776 | 3300026121 | Bacteria | 9805 |
| 449 | Ga0207683_10068473 | 3300026121 | Bacteria | 3133 |
| 450 | Ga0207683_10198412 | 3300026121 | Bacteria | 1823 |
| 451 | Ga0207698_10067185 | 3300026142 | Bacteria | 2826 |
| 452 | Ga0207428_10006365 | 3300027907 | Bacteria | 10922 |
| 453 | Ga0268266_10056619 | 3300028379 | Bacteria | 3372 |
| 454 | Ga0268266_10343666 | 3300028379 | Bacteria | 1401 |
| 455 | Ga0268265_10000041 | 3300028380 | Bacteria | 189918 |
| 456 | Ga0265336_10010667 | 3300028666 | Bacteria | 3144 |
| 457 | Ga0307517_10078602 | 3300028786 | Bacteria | 2850 |
| 458 | Ga0307515_10000668 | 3300028794 | Bacteria | 79033 |
| 459 | Ga0307515_10002310 | 3300028794 | Bacteria | 41672 |
| 460 | Ga0307515_10052102 | 3300028794 | Bacteria | 6080 |
| 461 | Ga0307515_10075893 | 3300028794 | Bacteria | 4469 |
| 462 | Ga0307515_10142854 | 3300028794 | Bacteria | 2556 |
| 463 | Ga0265338_10003387 | 3300028800 | Bacteria | 22494 |
| 464 | Ga0265338_10023839 | 3300028800 | Bacteria | 6274 |
| 465 | Ga0307512_10001051 | 3300030522 | Bacteria | 40387 |
| 466 | Ga0307512_10056605 | 3300030522 | Bacteria | 3077 |
| 467 | Ga0265320_10005227 | 3300031240 | Bacteria | 8372 |
| 468 | Ga0265325_10000147 | 3300031241 | Bacteria | 49704 |
| 469 | Ga0265340_10001511 | 3300031247 | Bacteria | 13340 |
| 470 | Ga0265339_10008228 | 3300031249 | Bacteria | 6651 |
| 471 | Ga0265316_10060639 | 3300031344 | Bacteria | 2940 |
| 472 | Ga0307513_10007756 | 3300031456 | Bacteria | 13856 |
| 473 | Ga0307509_10029457 | 3300031507 | Bacteria | 6093 |
| 474 | Ga0307509_10110655 | 3300031507 | Bacteria | 2752 |
| 475 | Ga0307408_100125412 | 3300031548 | Bacteria | 1995 |
| 476 | Ga0307508_10001073 | 3300031616 | Bacteria | 31643 |
| 477 | Ga0307508_10057552 | 3300031616 | Bacteria | 3440 |
| 478 | Ga0307508_10100251 | 3300031616 | Bacteria | 2491 |
| 479 | Ga0307514_10057500 | 3300031649 | Bacteria | 2979 |
| 480 | Ga0265314_10013888 | 3300031711 | Bacteria | 6480 |
| 481 | Ga0316576_10008132 | 3300031727 | Bacteria | 6659 |
| 482 | Ga0316578_10103644 | 3300031728 | Bacteria | 1706 |
| 483 | Ga0307516_10000909 | 3300031730 | Bacteria | 40652 |
| 484 | Ga0307516_10018087 | 3300031730 | Bacteria | 7330 |
| 485 | Ga0307516_10021159 | 3300031730 | Bacteria | 6704 |
| 486 | Ga0307516_10112781 | 3300031730 | Bacteria | 2518 |
| 487 | Ga0307405_10012062 | 3300031731 | Bacteria | 4558 |
| 488 | Ga0307413_10066592 | 3300031824 | Bacteria | 2248 |
| 489 | Ga0307413_10070336 | 3300031824 | Bacteria | 2200 |
| 490 | Ga0307410_10030743 | 3300031852 | Bacteria | 3436 |
| 491 | Ga0326468_10000415 | 3300031889 | Bacteria | 4524 |
| 492 | Ga0307406_10031194 | 3300031901 | Bacteria | 3243 |
| 493 | Ga0307406_10040262 | 3300031901 | Bacteria | 2905 |
| 494 | Ga0307406_10048881 | 3300031901 | Bacteria | 2674 |
| 495 | Ga0307407_10059388 | 3300031903 | Bacteria | 2227 |
| 496 | Ga0307412_10038615 | 3300031911 | Bacteria | 3076 |
| 497 | Ga0307409_100015923 | 3300031995 | Bacteria | 4954 |
| 498 | Ga0307409_100021071 | 3300031995 | Bacteria | 4461 |
| 499 | Ga0307409_100025998 | 3300031995 | Bacteria | 4120 |
| 500 | Ga0307409_100132310 | 3300031995 | Bacteria | 2134 |
| 501 | Ga0307416_100014053 | 3300032002 | Bacteria | 5466 |
| 502 | Ga0307416_100032279 | 3300032002 | Bacteria | 3954 |
| 503 | Ga0307416_100303777 | 3300032002 | Bacteria | 1588 |
| 504 | Ga0307415_100000137 | 3300032126 | Bacteria | 32064 |
| 505 | Ga0307415_100017053 | 3300032126 | Bacteria | 4346 |
| 506 | Ga0307415_100063093 | 3300032126 | Bacteria | 2573 |
| 507 | Ga0307415_100077547 | 3300032126 | Bacteria | 2360 |
| 508 | Ga0307415_100150007 | 3300032126 | Bacteria | 1793 |
| 509 | Ga0307415_100259497 | 3300032126 | Bacteria | 1417 |
| 510 | Ga0307507_10075995 | 3300033179 | Bacteria | 3000 |
| 511 | Ga0307510_10131081 | 3300033180 | Bacteria | 2180 |
| 512 | Ga0316214_1002497 | 3300033545 | Bacteria | 2262 |
| 513 | Ga0373926_0000163 | 3300035083 | Bacteria | 14585 |
| 514 | Ga0373926_0000879 | 3300035083 | Bacteria | 8603 |
| 515 | Ga0373928_0007702 | 3300035084 | Bacteria | 2081 |
| 516 | Ga0373934_0006628 | 3300035086 | Bacteria | 4299 |
| 517 | Ga0373940_0013628 | 3300035088 | Bacteria | 1971 |
| 518 | Ga0373944_0002760 | 3300035089 | Bacteria | 4487 |
| 519 | Ga0373944_0005699 | 3300035089 | Bacteria | 3285 |
| 520 | Ga0373951_0000053 | 3300035091 | Bacteria | 46153 |
| 521 | Ga0373923_0014873 | 3300035111 | Bacteria | 2930 |
| 522 | Ga0373923_0027720 | 3300035111 | Bacteria | 2261 |
| 523 | Ga0373936_0000453 | 3300035113 | Bacteria | 13757 |
| 524 | Ga0373936_0036582 | 3300035113 | Bacteria | 1958 |
| 525 | Ga0373941_0007679 | 3300035115 | Bacteria | 2649 |
| 526 | Ga0373945_0011696 | 3300035116 | Bacteria | 2905 |
| 527 | Ga0373953_0000203 | 3300035117 | Bacteria | 15944 |
| 528 | Ga0373953_0001254 | 3300035117 | Bacteria | 7250 |
| 529 | Ga0373953_0019143 | 3300035117 | Bacteria | 2543 |
| 530 | Ga0373954_0004129 | 3300035118 | Bacteria | 6221 |
| 531 | Ga0373954_0004734 | 3300035118 | Bacteria | 5865 |
| 532 | Ga0373954_0059798 | 3300035118 | Bacteria | 1796 |
| 533 | Ga0373956_0017516 | 3300035119 | Bacteria | 3022 |
| 534 | Ga0373956_0019106 | 3300035119 | Bacteria | 2904 |
| 535 | Ga0373956_0030849 | 3300035119 | Bacteria | 2345 |
| 536 | Ga0373957_0000063 | 3300035120 | Bacteria | 26126 |
| 537 | Ga0373957_0009923 | 3300035120 | Bacteria | 3129 |
| 538 | Ga0373957_0019829 | 3300035120 | Bacteria | 2370 |
| 539 | Ga0373960_0002089 | 3300035121 | Bacteria | 4494 |
| 540 | Ga0373943_0002709 | 3300035170 | Bacteria | 8044 |
| 541 | Ga0373943_0053483 | 3300035170 | Bacteria | 1994 |
| 542 | Ga0373943_0166925 | 3300035170 | Bacteria | 1202 |
| 543 | Ga0373946_0000448 | 3300035171 | Bacteria | 13554 |
| 544 | Ga0373946_0000523 | 3300035171 | Bacteria | 12731 |
| 545 | Ga0373955_0000011 | 3300035172 | Bacteria | 74059 |
| 546 | Ga0373955_0009396 | 3300035172 | Bacteria | 4574 |
| 547 | Ga0373955_0011175 | 3300035172 | Bacteria | 4267 |
| 548 | Ga0373955_0024170 | 3300035172 | Bacteria | 3104 |
| 549 | Ga0373955_0053298 | 3300035172 | Bacteria | 2208 |
| 550 | Ga0373942_0001340 | 3300035207 | Bacteria | 6384 |
| 551 | Ga0373942_0027342 | 3300035207 | Bacteria | 1483 |
| 552 | Ga0316574_0032463 | 3300035398 | Bacteria | 3173 |
| 553 | Ga0373924_0000153 | 3300035410 | Bacteria | 20261 |
| 554 | Ga0373924_0019187 | 3300035410 | Bacteria | 2646 |
| 555 | Ga0373924_0074675 | 3300035410 | Bacteria | 1434 |
| 556 | Ga0373931_0013722 | 3300035691 | Bacteria | 3950 |
| 557 | Ga0373935_0000992 | 3300035692 | Bacteria | 15444 |
| 558 | Ga0373935_0003522 | 3300035692 | Bacteria | 9109 |
| 559 | Ga0373935_0062286 | 3300035692 | Bacteria | 2389 |
| 560 | Ga0373935_0068151 | 3300035692 | Bacteria | 2289 |
| 561 | Ga0373935_0128494 | 3300035692 | Bacteria | 1700 |
| 562 | Ga0373927_0000290 | 3300035695 | Bacteria | 39619 |
| 563 | Ga0373927_0129597 | 3300035695 | Bacteria | 1647 |
| 564 | Ga0373927_0134966 | 3300035695 | Bacteria | 1612 |
| 565 | Ga0373933_0000027 | 3300035724 | Bacteria | 90038 |
| 566 | Ga0373933_0001003 | 3300035724 | Bacteria | 17193 |
| 567 | Ga0373933_0005876 | 3300035724 | Bacteria | 6672 |
| 568 | Ga0373933_0011863 | 3300035724 | Bacteria | 4812 |
| 569 | Ga0373947_0000011 | 3300035725 | Bacteria | 160778 |
| 570 | Ga0373947_0002876 | 3300035725 | Bacteria | 10281 |
| 571 | Ga0373947_0008178 | 3300035725 | Bacteria | 6030 |
| 572 | Ga0373947_0141135 | 3300035725 | Bacteria | 1545 |
| 573 | Ga0310104_04007 | 3300036242 | Bacteria | 1271 |
| 574 | Ga0373937_0000159 | 3300036401 | Bacteria | 65235 |
| 575 | Ga0373937_0011182 | 3300036401 | Bacteria | 7867 |
| 576 | Ga0373937_0032325 | 3300036401 | Bacteria | 4746 |
| 577 | Ga0373937_0180492 | 3300036401 | Bacteria | 1982 |
| 578 | Ga0316584_0057010 | 3300036712 | Bacteria | 2924 |
| 579 | Ga0373925_0000878 | 3300037068 | Bacteria | 27482 |
| 580 | Ga0373925_0004238 | 3300037068 | Bacteria | 10867 |
| 581 | Ga0373925_0119052 | 3300037068 | Bacteria | 2048 |
| 582 | Ga0373925_0150450 | 3300037068 | Bacteria | 1827 |
| 583 | Ga0373925_0170847 | 3300037068 | Bacteria | 1716 |
| 584 | Ga0395900_0024268 | 3300037418 | Bacteria | 6209 |
| 585 | Ga0395900_0024531 | 3300037418 | Bacteria | 6175 |
| 586 | Ga0395900_0142162 | 3300037418 | Bacteria | 2457 |
| 587 | Ga0395898_0014304 | 3300037466 | Bacteria | 8155 |
| 588 | Ga0395898_0030902 | 3300037466 | Bacteria | 5357 |
| 589 | Ga0395898_0375076 | 3300037466 | Bacteria | 1357 |
| 590 | Ga0395905_0006998 | 3300037471 | Bacteria | 11276 |
| 591 | Ga0436364_0149270 | 3300037853 | Bacteria | 2493 |
| 592 | Ga0436364_0280596 | 3300037853 | Bacteria | 4084 |
| 593 | Ga0436364_0722685 | 3300037853 | Bacteria | 18129 |
| 594 | Ga0436364_0922907 | 3300037853 | Bacteria | 1683 |
| 595 | Ga0436364_1159643 | 3300037853 | Bacteria | 1417 |
| 596 | Ga0436364_1520802 | 3300037853 | Bacteria | 2851 |
| 597 | Ga0436364_1553651 | 3300037853 | Bacteria | 21365 |
| 598 | Ga0395901_0041350 | 3300038443 | Bacteria | 4776 |
| 599 | Ga0395901_0051590 | 3300038443 | Bacteria | 4277 |
| 600 | Ga0395901_0142494 | 3300038443 | Bacteria | 2519 |
| 601 | Ga0436365_1454613 | 3300039437 | Bacteria | 26721 |
| 602 | Ga0436363_0196300 | 3300039450 | Bacteria | 2030 |
| 603 | Ga0451853_0837750 | 3300041512 | Bacteria | 5028 |
| 604 | Ga0451853_2391966 | 3300041512 | Bacteria | 1342 |
| 605 | Ga0439448_0010651 | 3300042005 | Bacteria | 2730 |
| 606 | Ga0466966_0059011 | 3300044684 | Bacteria | 2424 |
| 607 | Ga0466961_0010687 | 3300044693 | Bacteria | 5862 |
| 608 | Ga0466961_0020498 | 3300044693 | Bacteria | 4255 |
| 609 | Ga0466963_0017021 | 3300044694 | Bacteria | 4528 |
| 610 | Ga0466963_0024825 | 3300044694 | Bacteria | 3818 |
| 611 | Ga0466963_0058706 | 3300044694 | Bacteria | 2566 |
| 612 | Ga0466963_0216881 | 3300044694 | Bacteria | 1339 |
| 613 | Ga0466959_0097225 | 3300045049 | Bacteria | 2110 |
| 614 | Ga0466959_0099477 | 3300045049 | Bacteria | 2082 |
| 615 | Ga0466958_0005490 | 3300045836 | Bacteria | 6838 |
| 616 | Ga0466958_0078079 | 3300045836 | Bacteria | 2034 |
| 617 | Ga0466967_0008838 | 3300045976 | Bacteria | 7426 |
| 618 | Ga0466967_0117782 | 3300045976 | Bacteria | 2449 |
| 619 | Ga0466967_0536776 | 3300045976 | Bacteria | 1150 |
| 620 | Ga0495592_0000019 | 3300046454 | Bacteria | 140749 |
| 621 | Ga0495592_0005327 | 3300046454 | Bacteria | 9488 |
| 622 | Ga0495592_0043869 | 3300046454 | Bacteria | 3343 |
| 623 | Ga0495592_0073197 | 3300046454 | Bacteria | 2492 |
| 624 | Ga0495592_0092868 | 3300046454 | Bacteria | 2162 |
| 625 | Ga0495603_0026763 | 3300046455 | Bacteria | 3483 |
| 626 | Ga0495629_0001359 | 3300046459 | Bacteria | 19280 |
| 627 | Ga0495629_0064450 | 3300046459 | Bacteria | 2559 |
| 628 | Ga0495629_0091202 | 3300046459 | Bacteria | 2126 |
| 629 | Ga0495629_0163313 | 3300046459 | Bacteria | 1547 |
| 630 | Ga0495629_0163762 | 3300046459 | Bacteria | 1544 |
| 631 | Ga0495641_0003679 | 3300046461 | Bacteria | 11311 |
| 632 | Ga0495641_0007998 | 3300046461 | Bacteria | 6519 |
| 633 | Ga0495641_0022054 | 3300046461 | Bacteria | 3192 |
| 634 | Ga0495641_0085619 | 3300046461 | Bacteria | 1410 |
| 635 | Ga0495651_0000012 | 3300046462 | Bacteria | 138280 |
| 636 | Ga0495651_0003573 | 3300046462 | Bacteria | 11926 |
| 637 | Ga0495651_0042453 | 3300046462 | Bacteria | 3530 |
| 638 | Ga0495651_0062977 | 3300046462 | Bacteria | 2836 |
| 639 | Ga0495651_0194711 | 3300046462 | Bacteria | 1423 |
| 640 | Ga0495653_0003237 | 3300046463 | Bacteria | 13053 |
| 641 | Ga0495653_0003567 | 3300046463 | Bacteria | 12545 |
| 642 | Ga0495653_0003779 | 3300046463 | Bacteria | 12252 |
| 643 | Ga0495653_0012324 | 3300046463 | Bacteria | 6974 |
| 644 | Ga0495653_0032382 | 3300046463 | Bacteria | 4151 |
| 645 | Ga0495653_0070691 | 3300046463 | Bacteria | 2611 |
| 646 | Ga0495582_0001655 | 3300046473 | Bacteria | 12564 |
| 647 | Ga0495582_0027792 | 3300046473 | Bacteria | 3102 |
| 648 | Ga0495582_0043694 | 3300046473 | Bacteria | 2467 |
| 649 | Ga0495639_0002648 | 3300046475 | Bacteria | 7783 |
| 650 | Ga0495639_0010076 | 3300046475 | Bacteria | 4062 |
| 651 | Ga0495662_0027650 | 3300046476 | Bacteria | 2739 |
| 652 | Ga0495664_0000511 | 3300046477 | Bacteria | 19396 |
| 653 | Ga0495664_0027295 | 3300046477 | Bacteria | 3328 |
| 654 | Ga0495664_0033364 | 3300046477 | Bacteria | 3025 |
| 655 | Ga0495664_0109916 | 3300046477 | Bacteria | 1663 |
| 656 | Ga0495594_0006518 | 3300046499 | Bacteria | 6003 |
| 657 | Ga0495594_0028912 | 3300046499 | Bacteria | 2993 |
| 658 | Ga0495594_0086622 | 3300046499 | Bacteria | 1753 |
| 659 | Ga0495606_0001302 | 3300046507 | Bacteria | 34396 |
| 660 | Ga0495608_0000048 | 3300046511 | Bacteria | 97364 |
| 661 | Ga0495608_0003833 | 3300046511 | Bacteria | 10807 |
| 662 | Ga0495608_0026238 | 3300046511 | Bacteria | 3973 |
| 663 | Ga0495608_0027568 | 3300046511 | Bacteria | 3864 |
| 664 | Ga0495608_0052607 | 3300046511 | Bacteria | 2695 |
| 665 | Ga0495618_0014608 | 3300046514 | Bacteria | 4786 |
| 666 | Ga0495618_0020319 | 3300046514 | Bacteria | 4087 |
| 667 | Ga0495618_0186199 | 3300046514 | Bacteria | 1318 |
| 668 | Ga0495628_0000053 | 3300046516 | Bacteria | 91080 |
| 669 | Ga0495628_0040356 | 3300046516 | Bacteria | 3729 |
| 670 | Ga0495628_0044642 | 3300046516 | Bacteria | 3524 |
| 671 | Ga0495628_0080679 | 3300046516 | Bacteria | 2528 |
| 672 | Ga0495628_0128125 | 3300046516 | Bacteria | 1943 |
| 673 | Ga0495628_0133676 | 3300046516 | Bacteria | 1896 |
| 674 | Ga0495630_0001359 | 3300046517 | Bacteria | 16817 |
| 675 | Ga0495630_0029186 | 3300046517 | Bacteria | 4099 |
| 676 | Ga0495630_0039687 | 3300046517 | Bacteria | 3519 |
| 677 | Ga0495630_0135422 | 3300046517 | Bacteria | 1872 |
| 678 | Ga0495648_0028013 | 3300046524 | Bacteria | 3760 |
| 679 | Ga0495666_0000806 | 3300046526 | Bacteria | 14505 |
| 680 | Ga0495666_0051119 | 3300046526 | Bacteria | 1986 |
| 681 | Ga0495652_0000163 | 3300046529 | Bacteria | 76177 |
| 682 | Ga0495652_0008769 | 3300046529 | Bacteria | 9204 |
| 683 | Ga0495652_0017359 | 3300046529 | Bacteria | 6422 |
| 684 | Ga0495652_0062468 | 3300046529 | Bacteria | 3140 |
| 685 | Ga0495652_0068593 | 3300046529 | Bacteria | 2970 |
| 686 | Ga0495652_0093442 | 3300046529 | Bacteria | 2455 |
| 687 | Ga0495665_0005717 | 3300046531 | Bacteria | 6711 |
| 688 | Ga0495640_0043428 | 3300046533 | Bacteria | 3130 |
| 689 | Ga0495640_0057082 | 3300046533 | Bacteria | 2665 |
| 690 | Ga0495640_0061441 | 3300046533 | Bacteria | 2552 |
| 691 | Ga0495586_0000988 | 3300046535 | Bacteria | 16075 |
| 692 | Ga0495587_0000027 | 3300046536 | Bacteria | 140741 |
| 693 | Ga0495587_0007610 | 3300046536 | Bacteria | 7010 |
| 694 | Ga0495587_0052309 | 3300046536 | Bacteria | 2410 |
| 695 | Ga0495587_0095508 | 3300046536 | Bacteria | 1715 |
| 696 | Ga0495645_0006188 | 3300046543 | Bacteria | 8286 |
| 697 | Ga0495645_0024024 | 3300046543 | Bacteria | 4418 |
| 698 | Ga0495645_0033500 | 3300046543 | Bacteria | 3748 |
| 699 | Ga0495645_0056217 | 3300046543 | Bacteria | 2857 |
| 700 | Ga0495645_0065395 | 3300046543 | Bacteria | 2630 |
| 701 | Ga0495645_0223985 | 3300046543 | Bacteria | 1263 |
| 702 | Ga0495667_0000074 | 3300046559 | Bacteria | 74078 |
| 703 | Ga0495667_0004210 | 3300046559 | Bacteria | 9696 |
| 704 | Ga0495667_0023900 | 3300046559 | Bacteria | 4116 |
| 705 | Ga0495667_0044706 | 3300046559 | Bacteria | 2932 |
| 706 | Ga0495667_0056587 | 3300046559 | Bacteria | 2579 |
| 707 | Ga0495667_0130888 | 3300046559 | Bacteria | 1618 |
| 708 | Ga0495668_0000182 | 3300046616 | Bacteria | 93763 |
| 709 | Ga0495634_0002568 | 3300046642 | Bacteria | 14990 |
| 710 | Ga0495634_0139587 | 3300046642 | Bacteria | 1539 |
| 711 | Ga0495625_0001990 | 3300046660 | Bacteria | 23065 |
| 712 | Ga0495635_0003562 | 3300046663 | Bacteria | 10775 |
| 713 | Ga0495635_0004360 | 3300046663 | Bacteria | 9795 |
| 714 | Ga0495635_0008090 | 3300046663 | Bacteria | 7347 |
| 715 | Ga0495635_0016444 | 3300046663 | Bacteria | 5167 |
| 716 | Ga0495635_0028853 | 3300046663 | Bacteria | 3857 |
| 717 | Ga0495635_0031140 | 3300046663 | Bacteria | 3705 |
| 718 | Ga0495635_0032993 | 3300046663 | Bacteria | 3592 |
| 719 | Ga0495635_0177172 | 3300046663 | Bacteria | 1449 |
| 720 | Ga0495657_0000025 | 3300046675 | Bacteria | 140749 |
| 721 | Ga0495657_0007174 | 3300046675 | Bacteria | 8647 |
| 722 | Ga0495657_0013347 | 3300046675 | Bacteria | 6066 |
| 723 | Ga0495599_0000026 | 3300046678 | Bacteria | 117515 |
| 724 | Ga0495599_0017607 | 3300046678 | Bacteria | 4443 |
| 725 | Ga0495599_0032847 | 3300046678 | Bacteria | 3258 |
| 726 | Ga0495599_0037334 | 3300046678 | Bacteria | 3051 |
| 727 | Ga0495599_0064516 | 3300046678 | Bacteria | 2287 |
| 728 | Ga0495599_0067518 | 3300046678 | Bacteria | 2233 |
| 729 | Ga0495599_0075516 | 3300046678 | Bacteria | 2104 |
| 730 | Ga0495599_0101605 | 3300046678 | Bacteria | 1792 |
| 731 | Ga0495599_0135054 | 3300046678 | Bacteria | 1531 |
| 732 | Ga0495623_0000181 | 3300046679 | Bacteria | 39838 |
| 733 | Ga0495623_0015258 | 3300046679 | Bacteria | 4964 |
| 734 | Ga0495623_0064209 | 3300046679 | Bacteria | 2297 |
| 735 | Ga0495646_0001454 | 3300046680 | Bacteria | 14074 |
| 736 | Ga0495646_0012816 | 3300046680 | Bacteria | 5329 |
| 737 | Ga0495646_0013096 | 3300046680 | Bacteria | 5270 |
| 738 | Ga0495646_0039423 | 3300046680 | Bacteria | 2912 |
| 739 | Ga0495646_0088445 | 3300046680 | Bacteria | 1794 |
| 740 | Ga0495658_0013106 | 3300046683 | Bacteria | 4216 |
| 741 | Ga0495613_0003573 | 3300046689 | Bacteria | 11654 |
| 742 | Ga0495613_0006912 | 3300046689 | Bacteria | 8466 |
| 743 | Ga0495613_0009693 | 3300046689 | Bacteria | 7155 |
| 744 | Ga0495624_0020763 | 3300046690 | Bacteria | 4364 |
| 745 | Ga0495624_0098248 | 3300046690 | Bacteria | 1803 |
| 746 | Ga0495600_0000789 | 3300046809 | Bacteria | 16734 |
| 747 | Ga0495600_0001653 | 3300046809 | Bacteria | 12429 |
| 748 | Ga0495600_0002721 | 3300046809 | Bacteria | 10229 |
| 749 | Ga0495600_0002960 | 3300046809 | Bacteria | 9906 |
| 750 | Ga0495600_0025950 | 3300046809 | Bacteria | 3779 |
| 751 | Ga0495581_0000249 | 3300047315 | Bacteria | 25767 |
| 752 | Ga0495581_0002580 | 3300047315 | Bacteria | 10300 |
| 753 | Ga0495604_0000029 | 3300047317 | Bacteria | 140740 |
| 754 | Ga0495604_0004486 | 3300047317 | Bacteria | 11057 |
| 755 | Ga0495604_0020691 | 3300047317 | Bacteria | 5253 |
| 756 | Ga0495604_0040637 | 3300047317 | Bacteria | 3651 |
| 757 | Ga0495604_0088120 | 3300047317 | Bacteria | 2309 |
| 758 | Ga0495674_0000245 | 3300047319 | Bacteria | 45797 |
| 759 | Ga0495674_0007661 | 3300047319 | Bacteria | 10313 |
| 760 | Ga0495674_0048170 | 3300047319 | Bacteria | 3773 |
| 761 | Ga0495674_0070927 | 3300047319 | Bacteria | 3009 |
| 762 | Ga0495674_0086075 | 3300047319 | Bacteria | 2691 |
| 763 | Ga0495674_0246952 | 3300047319 | Bacteria | 1469 |
| 764 | Ga0495676_0005249 | 3300047321 | Bacteria | 11854 |
| 765 | Ga0495676_0071597 | 3300047321 | Bacteria | 2665 |
| 766 | Ga0495680_0000011 | 3300047322 | Bacteria | 140733 |
| 767 | Ga0495680_0003354 | 3300047322 | Bacteria | 15816 |
| 768 | Ga0495680_0006351 | 3300047322 | Bacteria | 11005 |
| 769 | Ga0495680_0008112 | 3300047322 | Bacteria | 9571 |
| 770 | Ga0495680_0015821 | 3300047322 | Bacteria | 6494 |
| 771 | Ga0495680_0048041 | 3300047322 | Bacteria | 3353 |
| 772 | Ga0495680_0134147 | 3300047322 | Bacteria | 1816 |
| 773 | Ga0495680_0202216 | 3300047322 | Bacteria | 1424 |
| 774 | Ga0495675_0000172 | 3300047444 | Bacteria | 46844 |
| 775 | Ga0495675_0001732 | 3300047444 | Bacteria | 13050 |
| 776 | Ga0495675_0002028 | 3300047444 | Bacteria | 12102 |
| 777 | Ga0495675_0004540 | 3300047444 | Bacteria | 8416 |
| 778 | Ga0495675_0025404 | 3300047444 | Bacteria | 3777 |
| 779 | Ga0495675_0069232 | 3300047444 | Bacteria | 2228 |
| 780 | Ga0495684_0002083 | 3300047471 | Bacteria | 16082 |
| 781 | Ga0495684_0005702 | 3300047471 | Bacteria | 9682 |
| 782 | Ga0495684_0009265 | 3300047471 | Bacteria | 7602 |
| 783 | Ga0495684_0012380 | 3300047471 | Bacteria | 6578 |
| 784 | Ga0495684_0019055 | 3300047471 | Bacteria | 5283 |
| 785 | Ga0495684_0023576 | 3300047471 | Bacteria | 4731 |
| 786 | Ga0495684_0073597 | 3300047471 | Bacteria | 2595 |
| 787 | Ga0495684_0122856 | 3300047471 | Bacteria | 1954 |
| 788 | Ga0495593_0000843 | 3300047673 | Bacteria | 17787 |
| 789 | Ga0495593_0003291 | 3300047673 | Bacteria | 9691 |
| 790 | Ga0495593_0053844 | 3300047673 | Bacteria | 2122 |
| 791 | Ga0495593_0071433 | 3300047673 | Bacteria | 1802 |
| 792 | Ga0495602_0000033 | 3300048088 | Bacteria | 140750 |
| 793 | Ga0495602_0017852 | 3300048088 | Bacteria | 7102 |
| 794 | Ga0495602_0104780 | 3300048088 | Bacteria | 2313 |
| 795 | Ga0495602_0111432 | 3300048088 | Bacteria | 2222 |
| 796 | Ga0495614_0009740 | 3300048089 | Bacteria | 4246 |
| 797 | Ga0495626_0000286 | 3300048091 | Bacteria | 54819 |
| 798 | Ga0496100_0014210 | 3300048903 | Bacteria | 4616 |
| 799 | Ga0496100_0149186 | 3300048903 | Bacteria | 1665 |
| 800 | Ga0496101_0034817 | 3300048904 | Bacteria | 3560 |
| 801 | Ga0496101_0052208 | 3300048904 | Bacteria | 2947 |
| 802 | Ga0496102_0006518 | 3300048905 | Bacteria | 9959 |
| 803 | Ga0496102_0175503 | 3300048905 | Bacteria | 2017 |
| 804 | Ga0496102_0240148 | 3300048905 | Bacteria | 1708 |
| 805 | Ga0496103_0096672 | 3300048906 | Bacteria | 1866 |
| 806 | Ga0496103_0173917 | 3300048906 | Bacteria | 1383 |
| 807 | Ga0496104_0002235 | 3300048907 | Bacteria | 16698 |
| 808 | Ga0496104_0117036 | 3300048907 | Bacteria | 2557 |
| 809 | Ga0496105_0004813 | 3300048908 | Bacteria | 10198 |
| 810 | Ga0496105_0007134 | 3300048908 | Bacteria | 8619 |
| 811 | Ga0496105_0114708 | 3300048908 | Bacteria | 2222 |
| 812 | Ga0496106_0034912 | 3300048909 | Bacteria | 3758 |
| 813 | Ga0496106_0052920 | 3300048909 | Bacteria | 3065 |
| 814 | Ga0496107_0072646 | 3300048910 | Bacteria | 2501 |
| 815 | Ga0496108_0000016 | 3300048911 | Bacteria | 237051 |
| 816 | Ga0496108_0002160 | 3300048911 | Bacteria | 15757 |
| 817 | Ga0496108_0005669 | 3300048911 | Bacteria | 10108 |
| 818 | Ga0496108_0074729 | 3300048911 | Bacteria | 2862 |
| 819 | Ga0496108_0077574 | 3300048911 | Bacteria | 2810 |
| 820 | Ga0496108_0089230 | 3300048911 | Bacteria | 2620 |
| 821 | Ga0496108_0122248 | 3300048911 | Bacteria | 2233 |
| 822 | Ga0496109_0006542 | 3300048912 | Bacteria | 9808 |
| 823 | Ga0496109_0031948 | 3300048912 | Bacteria | 4729 |
| 824 | Ga0496109_0047058 | 3300048912 | Bacteria | 3920 |
| 825 | Ga0496109_0128775 | 3300048912 | Bacteria | 2361 |
| 826 | Ga0496109_0251175 | 3300048912 | Bacteria | 1665 |
| 827 | Ga0496110_0011403 | 3300048913 | Bacteria | 7273 |
| 828 | Ga0496110_0020154 | 3300048913 | Bacteria | 5626 |
| 829 | Ga0496110_0080324 | 3300048913 | Bacteria | 2905 |
| 830 | Ga0496110_0269908 | 3300048913 | Bacteria | 1549 |
| 831 | Ga0496111_0000525 | 3300048914 | Bacteria | 19825 |
| 832 | Ga0496111_0080383 | 3300048914 | Bacteria | 2378 |
| 833 | Ga0496112_0002256 | 3300048915 | Bacteria | 15399 |
| 834 | Ga0496112_0013474 | 3300048915 | Bacteria | 7549 |
| 835 | Ga0496112_0015264 | 3300048915 | Bacteria | 7161 |
| 836 | Ga0496112_0070068 | 3300048915 | Bacteria | 3464 |
| 837 | Ga0496112_0192221 | 3300048915 | Bacteria | 2002 |
| 838 | Ga0496113_0041238 | 3300048916 | Bacteria | 3405 |
| 839 | Ga0496113_0154469 | 3300048916 | Bacteria | 1811 |
| 840 | Ga0496114_0042235 | 3300048917 | Bacteria | 3779 |
| 841 | Ga0496114_0069401 | 3300048917 | Bacteria | 2959 |
| 842 | Ga0496114_0113750 | 3300048917 | Bacteria | 2320 |
| 843 | Ga0496115_0079484 | 3300048918 | Bacteria | 2669 |
| 844 | Ga0496115_0140644 | 3300048918 | Bacteria | 1991 |
| 845 | Ga0496115_0160610 | 3300048918 | Bacteria | 1857 |
| 846 | Ga0496116_0000192 | 3300048919 | Bacteria | 122270 |
| 847 | Ga0496117_0019119 | 3300048920 | Bacteria | 5640 |
| 848 | Ga0496117_0031740 | 3300048920 | Bacteria | 4028 |
| 849 | Ga0496118_0003054 | 3300048921 | Bacteria | 21531 |
| 850 | Ga0496118_0114757 | 3300048921 | Bacteria | 1775 |
| 851 | Ga0496119_0002564 | 3300048922 | Bacteria | 19763 |
| 852 | Ga0496119_0007202 | 3300048922 | Bacteria | 10076 |
| 853 | Ga0496119_0014413 | 3300048922 | Bacteria | 6191 |
| 854 | Ga0496120_0000050 | 3300048923 | Bacteria | 187078 |
| 855 | Ga0496121_0008981 | 3300048924 | Bacteria | 11592 |
| 856 | Ga0496121_0018636 | 3300048924 | Bacteria | 6988 |
| 857 | Ga0496122_0035353 | 3300048925 | Bacteria | 4067 |
| 858 | Ga0496123_0000142 | 3300048926 | Bacteria | 146932 |
| 859 | Ga0496124_0000420 | 3300048927 | Bacteria | 75761 |
| 860 | Ga0501031_0049769 | 3300049568 | Bacteria | 2731 |
| 861 | Ga0501032_0024223 | 3300049569 | Bacteria | 4193 |
| 862 | Ga0501037_0025472 | 3300049573 | Bacteria | 4371 |
| 863 | Ga0501037_0175756 | 3300049573 | Bacteria | 1521 |
| 864 | Ga0501038_0036197 | 3300049574 | Bacteria | 4332 |
| 865 | Ga0501040_0021935 | 3300049576 | Bacteria | 4270 |
| 866 | Ga0501041_0018601 | 3300049577 | Bacteria | 4138 |
| 867 | Ga0501043_0202536 | 3300049579 | Bacteria | 1540 |
| 868 | Ga0501047_0000170 | 3300049581 | Bacteria | 79815 |
| 869 | Ga0501047_0015438 | 3300049581 | Bacteria | 7277 |
| 870 | Ga0501047_0275491 | 3300049581 | Bacteria | 1528 |
| 871 | Ga0501047_0316401 | 3300049581 | Bacteria | 1401 |
| 872 | Ga0501048_0028474 | 3300049582 | Bacteria | 4055 |
| 873 | Ga0501069_0003390 | 3300049585 | Bacteria | 8182 |
| 874 | Ga0501070_0000776 | 3300049586 | Bacteria | 29084 |
| 875 | Ga0501070_0002547 | 3300049586 | Bacteria | 15964 |
| 876 | Ga0501070_0008238 | 3300049586 | Bacteria | 8812 |
| 877 | Ga0501070_0051300 | 3300049586 | Bacteria | 3425 |
| 878 | Ga0501070_0097343 | 3300049586 | Bacteria | 2434 |
| 879 | Ga0501072_0028411 | 3300049588 | Bacteria | 4367 |
| 880 | Ga0501073_0001322 | 3300049589 | Bacteria | 18252 |
| 881 | Ga0501073_0107578 | 3300049589 | Bacteria | 1935 |
| 882 | Ga0501074_0001371 | 3300049590 | Bacteria | 16150 |
| 883 | Ga0501074_0029042 | 3300049590 | Bacteria | 4006 |
| 884 | Ga0501074_0038017 | 3300049590 | Bacteria | 3489 |
| 885 | Ga0501075_0173542 | 3300049591 | Bacteria | 1645 |
| 886 | Ga0501077_0040313 | 3300049593 | Bacteria | 2976 |
| 887 | Ga0501079_0000029 | 3300049741 | Bacteria | 60538 |
| 888 | Ga0501080_0002688 | 3300049742 | Bacteria | 15576 |
| 889 | Ga0501080_0003657 | 3300049742 | Bacteria | 13569 |
| 890 | Ga0501080_0085799 | 3300049742 | Bacteria | 2925 |
| 891 | Ga0501035_0308814 | 3300049822 | Bacteria | 1331 |
| 892 | Ga0501044_0002655 | 3300049823 | Bacteria | 20338 |
| 893 | Ga0501044_0153998 | 3300049823 | Bacteria | 2279 |
| 894 | Ga0501044_0177348 | 3300049823 | Bacteria | 2099 |
| 895 | nmdc:mga05p37_115556_c1 | 3300050507 | Bacteria | 3299 |
| 896 | nmdc:mga05p37_154_c1 | 3300050507 | Bacteria | 65419 |
| 897 | nmdc:mga05p37_189174_c1 | 3300050507 | Bacteria | 2501 |
| 898 | nmdc:mga05p37_285091_c1 | 3300050507 | Bacteria | 1968 |
| 899 | nmdc:mga05p37_2885_c1 | 3300050507 | Bacteria | 19950 |
| 900 | nmdc:mga05p37_329126_c1 | 3300050507 | Bacteria | 1805 |
| 901 | nmdc:mga05p37_38321_c1 | 3300050507 | Bacteria | 5880 |
| 902 | nmdc:mga09592_10495_c1 | 3300050508 | Bacteria | 7536 |
| 903 | nmdc:mga09592_36_c3 | 3300050508 | Bacteria | 51356 |
| 904 | nmdc:mga09592_64933_c1 | 3300050508 | Bacteria | 3091 |
| 905 | nmdc:mga0qj67_134036_c1 | 3300050509 | Bacteria | 2007 |
| 906 | nmdc:mga0qj67_17774_c1 | 3300050509 | Bacteria | 5409 |
| 907 | nmdc:mga0qj67_42_c1 | 3300050509 | Bacteria | 46863 |
| 908 | nmdc:mga06r32_152059_c1 | 3300050510 | Bacteria | 2293 |
| 909 | nmdc:mga06r32_162431_c1 | 3300050510 | Bacteria | 2216 |
| 910 | nmdc:mga06r32_170671_c1 | 3300050510 | Bacteria | 2159 |
| 911 | nmdc:mga06r32_351449_c1 | 3300050510 | Bacteria | 1458 |
| 912 | nmdc:mga06r32_42425_c1 | 3300050510 | Bacteria | 4326 |
| 913 | nmdc:mga06r32_42_c2 | 3300050510 | Bacteria | 56690 |
| 914 | nmdc:mga06r32_87602_c1 | 3300050510 | Bacteria | 3038 |
| 915 | nmdc:mga08y16_272253_c1 | 3300050511 | Bacteria | 1748 |
| 916 | nmdc:mga0n895_2212_c1 | 3300050512 | Bacteria | 15040 |
| 917 | nmdc:mga0n895_386613_c1 | 3300050512 | Bacteria | 1416 |
| 918 | nmdc:mga0n895_98553_c1 | 3300050512 | Bacteria | 2930 |
| 919 | nmdc:mga0rr50_169327_c1 | 3300050513 | Bacteria | 1779 |
| 920 | nmdc:mga0rr50_278029_c1 | 3300050513 | Bacteria | 1397 |
| 921 | nmdc:mga08x19_44867_c1 | 3300050514 | Bacteria | 2823 |
| 922 | nmdc:mga08x19_865_c1 | 3300050514 | Bacteria | 18923 |
| 923 | nmdc:mga0a205_29220_c1 | 3300050515 | Bacteria | 5275 |
| 924 | nmdc:mga0a205_9008_c1 | 3300050515 | Bacteria | 9095 |
| 925 | Ga0495601_0002647 | 3300053077 | Bacteria | 10153 |
| 926 | Ga0495612_0008165 | 3300053078 | Bacteria | 4255 |
| 927 | Ga0495612_0008856 | 3300053078 | Bacteria | 4077 |
| 928 | Ga0495612_0044581 | 3300053078 | Bacteria | 1815 |
| 929 | Ga0495612_0048385 | 3300053078 | Bacteria | 1743 |
| 930 | Ga0495595_0007435 | 3300053084 | Bacteria | 4485 |
| 931 | Ga0495595_0008888 | 3300053084 | Bacteria | 4138 |
| 932 | Ga0495619_0002147 | 3300053085 | Bacteria | 13084 |
| 933 | Ga0495619_0010728 | 3300053085 | Bacteria | 5768 |
| 934 | Ga0495619_0026390 | 3300053085 | Bacteria | 3737 |
| 935 | Ga0500643_000413 | 3300053087 | Bacteria | 32620 |
| 936 | Ga0500646_0000860 | 3300053090 | Bacteria | 8415 |
| 937 | Ga0500583_0036495 | 3300053092 | Bacteria | 2201 |
| 938 | Ga0500594_0008757 | 3300053118 | Bacteria | 2314 |
| 939 | Ga0500568_0012243 | 3300053139 | Bacteria | 3951 |
| 940 | Ga0501084_0074286 | 3300054114 | Bacteria | 2847 |
| 941 | Ga0530510_0009308 | 3300061734 | Bacteria | 6892 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0163762 | Ga0495629_0163762_547_1527 | 314 |
| 2 | 3300005327 | Ga0070658_10001118 | Ga0070658_1000111821 | 321 |
| 3 | 3300005336 | Ga0070680_100013109 | Ga0070680_1000131095 | 321 |
| 4 | 3300025909 | Ga0207705_10000251 | Ga0207705_100002512 | 321 |
| 5 | 3300025917 | Ga0207660_10015498 | Ga0207660_100154984 | 321 |
| 6 | 3300044693 | Ga0466961_0020498 | Ga0466961_0020498_1225_2343 | 321 |
| 7 | 3300005336 | Ga0070680_100000019 | Ga0070680_10000001952 | 324 |
| 8 | 3300005458 | Ga0070681_10000017 | Ga0070681_1000001760 | 324 |
| 9 | 3300005530 | Ga0070679_100000009 | Ga0070679_10000000956 | 324 |
| 10 | 3300025912 | Ga0207707_10015071 | Ga0207707_100150716 | 324 |
| 11 | 3300025917 | Ga0207660_10000169 | Ga0207660_1000016927 | 324 |
| 12 | 3300025921 | Ga0207652_10000124 | Ga0207652_1000012418 | 324 |
| 13 | 3300005439 | Ga0070711_100009445 | Ga0070711_1000094453 | 329 |
| 14 | 3300006175 | Ga0070712_100022670 | Ga0070712_1000226702 | 329 |
| 15 | 3300025916 | Ga0207663_10065351 | Ga0207663_100653512 | 329 |
| 16 | 3300045049 | Ga0466959_0097225 | Ga0466959_0097225_847_2016 | 331 |
| 17 | 3300037853 | Ga0436364_0922907 | Ga0436364_0922907_515_1600 | 332 |
| 18 | 3300025933 | Ga0207706_10019224 | Ga0207706_100192244 | 335 |
| 19 | 3300021388 | Ga0213875_10007463 | Ga0213875_100074634 | 338 |
| 20 | 3300037853 | Ga0436364_1553651 | Ga0436364_1553651_2090_3241 | 338 |
| 21 | 3300020070 | Ga0206356_10605687 | Ga0206356_106056874 | 339 |
| 22 | 3300020075 | Ga0206349_1497504 | Ga0206349_14975041 | 339 |
| 23 | 3300013105 | Ga0157369_10510184 | Ga0157369_105101841 | 340 |
| 24 | 3300053090 | Ga0500646_0000860 | Ga0500646_0000860_6288_7313 | 340 |
| 25 | 3300053092 | Ga0500583_0036495 | Ga0500583_0036495_320_1345 | 340 |
| 26 | 3300013297 | Ga0157378_10257286 | Ga0157378_102572862 | 343 |
| 27 | 3300014968 | Ga0157379_10093503 | Ga0157379_100935032 | 343 |
| 28 | 3300021388 | Ga0213875_10028706 | Ga0213875_100287062 | 343 |
| 29 | 3300025986 | Ga0207658_10012594 | Ga0207658_100125944 | 343 |
| 30 | 3300035692 | Ga0373935_0062286 | Ga0373935_0062286_1071_2111 | 343 |
| 31 | 3300053118 | Ga0500594_0008757 | Ga0500594_0008757_824_1864 | 343 |
| 32 | 3300005336 | Ga0070680_100014672 | Ga0070680_1000146723 | 344 |
| 33 | 3300005339 | Ga0070660_100091712 | Ga0070660_1000917121 | 344 |
| 34 | 3300005458 | Ga0070681_10283710 | Ga0070681_102837102 | 344 |
| 35 | 3300005530 | Ga0070679_100207422 | Ga0070679_1002074222 | 344 |
| 36 | 3300025912 | Ga0207707_10013510 | Ga0207707_100135102 | 344 |
| 37 | 3300025917 | Ga0207660_10005501 | Ga0207660_100055014 | 344 |
| 38 | 3300025919 | Ga0207657_10115455 | Ga0207657_101154552 | 344 |
| 39 | 3300025921 | Ga0207652_10185400 | Ga0207652_101854002 | 344 |
| 40 | 3300025944 | Ga0207661_10031508 | Ga0207661_100315083 | 345 |
| 41 | 3300005458 | Ga0070681_10104459 | Ga0070681_101044592 | 346 |
| 42 | 3300005458 | Ga0070681_10301624 | Ga0070681_103016242 | 346 |
| 43 | 3300025912 | Ga0207707_10107891 | Ga0207707_101078912 | 346 |
| 44 | 3300025921 | Ga0207652_10060684 | Ga0207652_100606842 | 346 |
| 45 | 3300009147 | Ga0114129_10013018 | Ga0114129_1001301810 | 347 |
| 46 | 3300050507 | nmdc:mga05p37_115556_c1 | nmdc:mga05p37_115556_c1_1576_2628 | 347 |
| 47 | 3300050508 | nmdc:mga09592_10495_c1 | nmdc:mga09592_10495_c1_2521_3573 | 347 |
| 48 | 3300050509 | nmdc:mga0qj67_17774_c1 | nmdc:mga0qj67_17774_c1_128_1180 | 347 |
| 49 | 3300050510 | nmdc:mga06r32_42425_c1 | nmdc:mga06r32_42425_c1_1371_2423 | 347 |
| 50 | 3300046477 | Ga0495664_0033364 | Ga0495664_0033364_921_1970 | 348 |
| 51 | 3300048911 | Ga0496108_0002160 | Ga0496108_0002160_38_1084 | 348 |
| 52 | 3300050511 | nmdc:mga08y16_272253_c1 | nmdc:mga08y16_272253_c1_665_1711 | 348 |
| 53 | 3300050513 | nmdc:mga0rr50_169327_c1 | nmdc:mga0rr50_169327_c1_37_1083 | 348 |
| 54 | 3300013105 | Ga0157369_10001900 | Ga0157369_100019005 | 349 |
| 55 | 3300037853 | Ga0436364_0722685 | Ga0436364_0722685_7073_8191 | 350 |
| 56 | 3300050513 | nmdc:mga0rr50_278029_c1 | nmdc:mga0rr50_278029_c1_242_1300 | 351 |
| 57 | 3300050515 | nmdc:mga0a205_29220_c1 | nmdc:mga0a205_29220_c1_473_1531 | 351 |
| 58 | 3300020080 | Ga0206350_10827113 | Ga0206350_108271131 | 352 |
| 59 | 3300037466 | Ga0395898_0014304 | Ga0395898_0014304_4379_5446 | 352 |
| 60 | 3300048088 | Ga0495602_0017852 | Ga0495602_0017852_5133_6257 | 352 |
| 61 | 3300020069 | Ga0197907_10794598 | Ga0197907_107945981 | 353 |
| 62 | 3300022467 | Ga0224712_10019335 | Ga0224712_100193352 | 353 |
| 63 | 3300048915 | Ga0496112_0192221 | Ga0496112_0192221_582_1643 | 353 |
| 64 | 3300035089 | Ga0373944_0005699 | Ga0373944_0005699_703_1821 | 354 |
| 65 | 3300035170 | Ga0373943_0002709 | Ga0373943_0002709_6601_7719 | 354 |
| 66 | 3300035171 | Ga0373946_0000448 | Ga0373946_0000448_12218_13336 | 354 |
| 67 | 3300035695 | Ga0373927_0000290 | Ga0373927_0000290_12096_13214 | 354 |
| 68 | 3300035725 | Ga0373947_0008178 | Ga0373947_0008178_382_1500 | 354 |
| 69 | 3300037068 | Ga0373925_0000878 | Ga0373925_0000878_4250_5368 | 354 |
| 70 | 3300037418 | Ga0395900_0142162 | Ga0395900_0142162_521_1654 | 354 |
| 71 | 3300037853 | Ga0436364_1520802 | Ga0436364_1520802_1631_2782 | 354 |
| 72 | 3300038443 | Ga0395901_0142494 | Ga0395901_0142494_970_2103 | 354 |
| 73 | 3300046463 | Ga0495653_0003567 | Ga0495653_0003567_9247_10365 | 354 |
| 74 | 3300046477 | Ga0495664_0000511 | Ga0495664_0000511_14760_15878 | 354 |
| 75 | 3300046516 | Ga0495628_0080679 | Ga0495628_0080679_1312_2430 | 354 |
| 76 | 3300046529 | Ga0495652_0017359 | Ga0495652_0017359_4036_5154 | 354 |
| 77 | 3300046533 | Ga0495640_0061441 | Ga0495640_0061441_972_2090 | 354 |
| 78 | 3300046559 | Ga0495667_0023900 | Ga0495667_0023900_2379_3497 | 354 |
| 79 | 3300046663 | Ga0495635_0008090 | Ga0495635_0008090_3218_4336 | 354 |
| 80 | 3300046678 | Ga0495599_0067518 | Ga0495599_0067518_635_1753 | 354 |
| 81 | 3300046678 | Ga0495599_0075516 | Ga0495599_0075516_88_1206 | 354 |
| 82 | 3300046680 | Ga0495646_0088445 | Ga0495646_0088445_612_1730 | 354 |
| 83 | 3300046690 | Ga0495624_0098248 | Ga0495624_0098248_13_1131 | 354 |
| 84 | 3300047319 | Ga0495674_0000245 | Ga0495674_0000245_30421_31539 | 354 |
| 85 | 3300047321 | Ga0495676_0005249 | Ga0495676_0005249_8810_9928 | 354 |
| 86 | 3300047322 | Ga0495680_0003354 | Ga0495680_0003354_13884_15002 | 354 |
| 87 | 3300047471 | Ga0495684_0002083 | Ga0495684_0002083_8652_9770 | 354 |
| 88 | 3300035083 | Ga0373926_0000879 | Ga0373926_0000879_6798_7868 | 355 |
| 89 | 3300035692 | Ga0373935_0000992 | Ga0373935_0000992_3471_4541 | 355 |
| 90 | 3300035725 | Ga0373947_0000011 | Ga0373947_0000011_10809_11879 | 355 |
| 91 | 3300036242 | Ga0310104_04007 | Ga0310104_04007_52_1122 | 355 |
| 92 | 3300037853 | Ga0436364_1159643 | Ga0436364_1159643_315_1385 | 355 |
| 93 | 3300049573 | Ga0501037_0175756 | Ga0501037_0175756_26_1096 | 355 |
| 94 | 3300009148 | Ga0105243_10017634 | Ga0105243_100176342 | 356 |
| 95 | 3300011119 | Ga0105246_10026012 | Ga0105246_100260124 | 356 |
| 96 | 3300013297 | Ga0157378_10084496 | Ga0157378_100844962 | 356 |
| 97 | 3300014326 | Ga0157380_10070273 | Ga0157380_100702732 | 356 |
| 98 | 3300033545 | Ga0316214_1002497 | Ga0316214_10024972 | 356 |
| 99 | 3300035121 | Ga0373960_0002089 | Ga0373960_0002089_822_1940 | 356 |
| 100 | 3300035691 | Ga0373931_0013722 | Ga0373931_0013722_580_1698 | 356 |
| 101 | 3300046499 | Ga0495594_0006518 | Ga0495594_0006518_310_1428 | 356 |
| 102 | 3300047471 | Ga0495684_0122856 | Ga0495684_0122856_778_1896 | 356 |
| 103 | 3300048903 | Ga0496100_0149186 | Ga0496100_0149186_517_1635 | 356 |
| 104 | 3300048904 | Ga0496101_0052208 | Ga0496101_0052208_1712_2830 | 356 |
| 105 | 3300048905 | Ga0496102_0175503 | Ga0496102_0175503_118_1236 | 356 |
| 106 | 3300048906 | Ga0496103_0096672 | Ga0496103_0096672_605_1723 | 356 |
| 107 | 3300048917 | Ga0496114_0113750 | Ga0496114_0113750_1086_2204 | 356 |
| 108 | 3300012515 | Ga0157338_1002384 | Ga0157338_10023841 | 357 |
| 109 | 3300039437 | Ga0436365_1454613 | Ga0436365_1454613_21457_22530 | 357 |
| 110 | 3300046462 | Ga0495651_0062977 | Ga0495651_0062977_1248_2366 | 357 |
| 111 | 3300046463 | Ga0495653_0032382 | Ga0495653_0032382_1585_2703 | 357 |
| 112 | 3300046511 | Ga0495608_0052607 | Ga0495608_0052607_395_1513 | 357 |
| 113 | 3300046543 | Ga0495645_0223985 | Ga0495645_0223985_93_1211 | 357 |
| 114 | 3300046559 | Ga0495667_0130888 | Ga0495667_0130888_404_1522 | 357 |
| 115 | 3300047322 | Ga0495680_0008112 | Ga0495680_0008112_1406_2524 | 357 |
| 116 | 3300048088 | Ga0495602_0111432 | Ga0495602_0111432_454_1572 | 357 |
| 117 | 3300009177 | Ga0105248_10000108 | Ga0105248_1000010867 | 358 |
| 118 | 3300009553 | Ga0105249_10017845 | Ga0105249_100178451 | 358 |
| 119 | 3300045976 | Ga0466967_0536776 | Ga0466967_0536776_42_1127 | 358 |
| 120 | 3300048905 | Ga0496102_0006518 | Ga0496102_0006518_2545_3663 | 358 |
| 121 | 3300048919 | Ga0496116_0000192 | Ga0496116_0000192_1611_2729 | 358 |
| 122 | 3300048920 | Ga0496117_0019119 | Ga0496117_0019119_3734_4852 | 358 |
| 123 | 3300048920 | Ga0496117_0031740 | Ga0496117_0031740_2521_3639 | 358 |
| 124 | 3300048921 | Ga0496118_0003054 | Ga0496118_0003054_20385_21503 | 358 |
| 125 | 3300048921 | Ga0496118_0114757 | Ga0496118_0114757_360_1478 | 358 |
| 126 | 3300048922 | Ga0496119_0014413 | Ga0496119_0014413_2460_3578 | 358 |
| 127 | 3300048924 | Ga0496121_0018636 | Ga0496121_0018636_4456_5574 | 358 |
| 128 | 3300048925 | Ga0496122_0035353 | Ga0496122_0035353_1614_2699 | 358 |
| 129 | 3300048926 | Ga0496123_0000142 | Ga0496123_0000142_137252_138337 | 358 |
| 130 | 3300009094 | Ga0111539_10305187 | Ga0111539_103051871 | 359 |
| 131 | 3300009147 | Ga0114129_10009711 | Ga0114129_100097111 | 359 |
| 132 | 3300035084 | Ga0373928_0007702 | Ga0373928_0007702_231_1313 | 359 |
| 133 | 3300035086 | Ga0373934_0006628 | Ga0373934_0006628_2395_3477 | 359 |
| 134 | 3300035113 | Ga0373936_0036582 | Ga0373936_0036582_378_1460 | 359 |
| 135 | 3300035119 | Ga0373956_0030849 | Ga0373956_0030849_839_1921 | 359 |
| 136 | 3300035120 | Ga0373957_0009923 | Ga0373957_0009923_1217_2299 | 359 |
| 137 | 3300035120 | Ga0373957_0019829 | Ga0373957_0019829_214_1296 | 359 |
| 138 | 3300035172 | Ga0373955_0011175 | Ga0373955_0011175_1380_2462 | 359 |
| 139 | 3300035172 | Ga0373955_0053298 | Ga0373955_0053298_310_1392 | 359 |
| 140 | 3300035692 | Ga0373935_0068151 | Ga0373935_0068151_854_1936 | 359 |
| 141 | 3300035692 | Ga0373935_0128494 | Ga0373935_0128494_267_1349 | 359 |
| 142 | 3300035695 | Ga0373927_0129597 | Ga0373927_0129597_219_1301 | 359 |
| 143 | 3300035724 | Ga0373933_0001003 | Ga0373933_0001003_12650_13732 | 359 |
| 144 | 3300036401 | Ga0373937_0032325 | Ga0373937_0032325_1914_2996 | 359 |
| 145 | 3300037068 | Ga0373925_0170847 | Ga0373925_0170847_233_1315 | 359 |
| 146 | 3300037418 | Ga0395900_0024268 | Ga0395900_0024268_1432_2520 | 359 |
| 147 | 3300037466 | Ga0395898_0030902 | Ga0395898_0030902_2999_4087 | 359 |
| 148 | 3300038443 | Ga0395901_0051590 | Ga0395901_0051590_2602_3690 | 359 |
| 149 | 3300046454 | Ga0495592_0005327 | Ga0495592_0005327_7396_8478 | 359 |
| 150 | 3300046454 | Ga0495592_0073197 | Ga0495592_0073197_599_1681 | 359 |
| 151 | 3300046459 | Ga0495629_0091202 | Ga0495629_0091202_595_1677 | 359 |
| 152 | 3300046461 | Ga0495641_0022054 | Ga0495641_0022054_277_1359 | 359 |
| 153 | 3300046461 | Ga0495641_0085619 | Ga0495641_0085619_291_1373 | 359 |
| 154 | 3300046462 | Ga0495651_0042453 | Ga0495651_0042453_1988_3070 | 359 |
| 155 | 3300046473 | Ga0495582_0043694 | Ga0495582_0043694_1029_2111 | 359 |
| 156 | 3300046499 | Ga0495594_0028912 | Ga0495594_0028912_765_1847 | 359 |
| 157 | 3300046511 | Ga0495608_0027568 | Ga0495608_0027568_2286_3368 | 359 |
| 158 | 3300046517 | Ga0495630_0039687 | Ga0495630_0039687_445_1527 | 359 |
| 159 | 3300046529 | Ga0495652_0068593 | Ga0495652_0068593_1075_2157 | 359 |
| 160 | 3300046536 | Ga0495587_0007610 | Ga0495587_0007610_2797_3879 | 359 |
| 161 | 3300046543 | Ga0495645_0065395 | Ga0495645_0065395_1261_2343 | 359 |
| 162 | 3300046559 | Ga0495667_0044706 | Ga0495667_0044706_861_1943 | 359 |
| 163 | 3300046663 | Ga0495635_0028853 | Ga0495635_0028853_1100_2182 | 359 |
| 164 | 3300046675 | Ga0495657_0007174 | Ga0495657_0007174_4276_5358 | 359 |
| 165 | 3300046678 | Ga0495599_0064516 | Ga0495599_0064516_518_1600 | 359 |
| 166 | 3300046689 | Ga0495613_0009693 | Ga0495613_0009693_329_1411 | 359 |
| 167 | 3300047315 | Ga0495581_0002580 | Ga0495581_0002580_7425_8507 | 359 |
| 168 | 3300047322 | Ga0495680_0006351 | Ga0495680_0006351_2630_3712 | 359 |
| 169 | 3300047322 | Ga0495680_0134147 | Ga0495680_0134147_333_1415 | 359 |
| 170 | 3300047444 | Ga0495675_0025404 | Ga0495675_0025404_1621_2703 | 359 |
| 171 | 3300047444 | Ga0495675_0069232 | Ga0495675_0069232_293_1375 | 359 |
| 172 | 3300047471 | Ga0495684_0009265 | Ga0495684_0009265_1089_2171 | 359 |
| 173 | 3300047471 | Ga0495684_0012380 | Ga0495684_0012380_51_1133 | 359 |
| 174 | 3300047673 | Ga0495593_0003291 | Ga0495593_0003291_3676_4758 | 359 |
| 175 | 3300047673 | Ga0495593_0053844 | Ga0495593_0053844_613_1695 | 359 |
| 176 | 3300048911 | Ga0496108_0074729 | Ga0496108_0074729_1433_2596 | 359 |
| 177 | 3300050507 | nmdc:mga05p37_38321_c1 | nmdc:mga05p37_38321_c1_4642_5724 | 359 |
| 178 | 3300050512 | nmdc:mga0n895_386613_c1 | nmdc:mga0n895_386613_c1_316_1398 | 359 |
| 179 | 3300050512 | nmdc:mga0n895_98553_c1 | nmdc:mga0n895_98553_c1_1084_2166 | 359 |
| 180 | 3300050514 | nmdc:mga08x19_44867_c1 | nmdc:mga08x19_44867_c1_222_1304 | 359 |
| 181 | 3300053087 | Ga0500643_000413 | Ga0500643_000413_6811_7890 | 359 |
| 182 | 3300009553 | Ga0105249_10333492 | Ga0105249_103334922 | 360 |
| 183 | 3300035083 | Ga0373926_0000163 | Ga0373926_0000163_11723_12841 | 360 |
| 184 | 3300035089 | Ga0373944_0002760 | Ga0373944_0002760_3166_4284 | 360 |
| 185 | 3300035113 | Ga0373936_0000453 | Ga0373936_0000453_11066_12184 | 360 |
| 186 | 3300035116 | Ga0373945_0011696 | Ga0373945_0011696_206_1324 | 360 |
| 187 | 3300035117 | Ga0373953_0001254 | Ga0373953_0001254_6092_7210 | 360 |
| 188 | 3300035118 | Ga0373954_0059798 | Ga0373954_0059798_248_1366 | 360 |
| 189 | 3300035171 | Ga0373946_0000523 | Ga0373946_0000523_8492_9610 | 360 |
| 190 | 3300035410 | Ga0373924_0019187 | Ga0373924_0019187_1211_2329 | 360 |
| 191 | 3300035695 | Ga0373927_0134966 | Ga0373927_0134966_277_1395 | 360 |
| 192 | 3300035724 | Ga0373933_0005876 | Ga0373933_0005876_157_1275 | 360 |
| 193 | 3300035725 | Ga0373947_0002876 | Ga0373947_0002876_73_1191 | 360 |
| 194 | 3300037068 | Ga0373925_0150450 | Ga0373925_0150450_200_1318 | 360 |
| 195 | 3300046455 | Ga0495603_0026763 | Ga0495603_0026763_1871_2989 | 360 |
| 196 | 3300046461 | Ga0495641_0003679 | Ga0495641_0003679_1574_2692 | 360 |
| 197 | 3300046473 | Ga0495582_0001655 | Ga0495582_0001655_10983_12101 | 360 |
| 198 | 3300046475 | Ga0495639_0010076 | Ga0495639_0010076_1073_2191 | 360 |
| 199 | 3300046516 | Ga0495628_0133676 | Ga0495628_0133676_706_1824 | 360 |
| 200 | 3300046517 | Ga0495630_0001359 | Ga0495630_0001359_11078_12196 | 360 |
| 201 | 3300046524 | Ga0495648_0028013 | Ga0495648_0028013_115_1233 | 360 |
| 202 | 3300046526 | Ga0495666_0000806 | Ga0495666_0000806_11131_12249 | 360 |
| 203 | 3300046529 | Ga0495652_0062468 | Ga0495652_0062468_1950_3068 | 360 |
| 204 | 3300046531 | Ga0495665_0005717 | Ga0495665_0005717_4434_5552 | 360 |
| 205 | 3300046533 | Ga0495640_0043428 | Ga0495640_0043428_1073_2191 | 360 |
| 206 | 3300046535 | Ga0495586_0000988 | Ga0495586_0000988_7855_8973 | 360 |
| 207 | 3300046536 | Ga0495587_0052309 | Ga0495587_0052309_74_1192 | 360 |
| 208 | 3300046536 | Ga0495587_0095508 | Ga0495587_0095508_510_1628 | 360 |
| 209 | 3300046543 | Ga0495645_0006188 | Ga0495645_0006188_1950_3068 | 360 |
| 210 | 3300046559 | Ga0495667_0056587 | Ga0495667_0056587_1246_2364 | 360 |
| 211 | 3300046642 | Ga0495634_0002568 | Ga0495634_0002568_10930_12048 | 360 |
| 212 | 3300046663 | Ga0495635_0004360 | Ga0495635_0004360_5498_6616 | 360 |
| 213 | 3300046663 | Ga0495635_0177172 | Ga0495635_0177172_259_1377 | 360 |
| 214 | 3300046678 | Ga0495599_0037334 | Ga0495599_0037334_378_1496 | 360 |
| 215 | 3300046679 | Ga0495623_0064209 | Ga0495623_0064209_1024_2142 | 360 |
| 216 | 3300046680 | Ga0495646_0001454 | Ga0495646_0001454_2554_3672 | 360 |
| 217 | 3300046683 | Ga0495658_0013106 | Ga0495658_0013106_2816_3934 | 360 |
| 218 | 3300046689 | Ga0495613_0003573 | Ga0495613_0003573_9091_10209 | 360 |
| 219 | 3300046809 | Ga0495600_0000789 | Ga0495600_0000789_6654_7772 | 360 |
| 220 | 3300046809 | Ga0495600_0025950 | Ga0495600_0025950_2481_3599 | 360 |
| 221 | 3300047315 | Ga0495581_0000249 | Ga0495581_0000249_11038_12156 | 360 |
| 222 | 3300047317 | Ga0495604_0040637 | Ga0495604_0040637_1179_2297 | 360 |
| 223 | 3300047319 | Ga0495674_0070927 | Ga0495674_0070927_73_1191 | 360 |
| 224 | 3300047322 | Ga0495680_0202216 | Ga0495680_0202216_101_1219 | 360 |
| 225 | 3300047444 | Ga0495675_0002028 | Ga0495675_0002028_73_1191 | 360 |
| 226 | 3300047471 | Ga0495684_0005702 | Ga0495684_0005702_73_1191 | 360 |
| 227 | 3300047673 | Ga0495593_0000843 | Ga0495593_0000843_11672_12790 | 360 |
| 228 | 3300048088 | Ga0495602_0104780 | Ga0495602_0104780_280_1398 | 360 |
| 229 | 3300048089 | Ga0495614_0009740 | Ga0495614_0009740_2216_3334 | 360 |
| 230 | 3300053077 | Ga0495601_0002647 | Ga0495601_0002647_8963_10081 | 360 |
| 231 | 3300053078 | Ga0495612_0008165 | Ga0495612_0008165_2485_3603 | 360 |
| 232 | 3300053084 | Ga0495595_0008888 | Ga0495595_0008888_1072_2190 | 360 |
| 233 | 3300053085 | Ga0495619_0002147 | Ga0495619_0002147_10894_12012 | 360 |
| 234 | 3300021388 | Ga0213875_10004227 | Ga0213875_100042277 | 361 |
| 235 | 3300005467 | Ga0070706_100001284 | Ga0070706_1000012848 | 362 |
| 236 | 3300005471 | Ga0070698_100004456 | Ga0070698_1000044569 | 362 |
| 237 | 3300005617 | Ga0068859_100000293 | Ga0068859_1000002932 | 362 |
| 238 | 3300005844 | Ga0068862_100001926 | Ga0068862_1000019262 | 362 |
| 239 | 3300006931 | Ga0097620_100000293 | Ga0097620_1000002932 | 362 |
| 240 | 3300025910 | Ga0207684_10073463 | Ga0207684_100734632 | 362 |
| 241 | 3300025941 | Ga0207711_10000101 | Ga0207711_1000010121 | 362 |
| 242 | 3300028380 | Ga0268265_10000041 | Ga0268265_1000004138 | 362 |
| 243 | 3300049568 | Ga0501031_0049769 | Ga0501031_0049769_262_1422 | 362 |
| 244 | 3300049576 | Ga0501040_0021935 | Ga0501040_0021935_907_2067 | 362 |
| 245 | 3300049577 | Ga0501041_0018601 | Ga0501041_0018601_2373_3533 | 362 |
| 246 | 3300049579 | Ga0501043_0202536 | Ga0501043_0202536_17_1177 | 362 |
| 247 | 3300049582 | Ga0501048_0028474 | Ga0501048_0028474_860_2020 | 362 |
| 248 | 3300049588 | Ga0501072_0028411 | Ga0501072_0028411_2357_3517 | 362 |
| 249 | 3300049589 | Ga0501073_0107578 | Ga0501073_0107578_113_1273 | 362 |
| 250 | 3300049590 | Ga0501074_0038017 | Ga0501074_0038017_2249_3409 | 362 |
| 251 | 3300049591 | Ga0501075_0173542 | Ga0501075_0173542_17_1177 | 362 |
| 252 | 3300049593 | Ga0501077_0040313 | Ga0501077_0040313_698_1858 | 362 |
| 253 | 3300054114 | Ga0501084_0074286 | Ga0501084_0074286_1403_2563 | 362 |
| 254 | 3300061734 | Ga0530510_0009308 | Ga0530510_0009308_1209_2369 | 362 |
| 255 | 3300005435 | Ga0070714_100000877 | Ga0070714_1000008772 | 363 |
| 256 | 3300005436 | Ga0070713_100044557 | Ga0070713_1000445571 | 363 |
| 257 | 3300005445 | Ga0070708_100001990 | Ga0070708_10000199013 | 363 |
| 258 | 3300005468 | Ga0070707_100001962 | Ga0070707_10000196215 | 363 |
| 259 | 3300025928 | Ga0207700_10298686 | Ga0207700_102986861 | 363 |
| 260 | 3300025929 | Ga0207664_10002411 | Ga0207664_1000241110 | 363 |
| 261 | 3300046499 | Ga0495594_0086622 | Ga0495594_0086622_441_1544 | 363 |
| 262 | 3300005617 | Ga0068859_100004481 | Ga0068859_10000448110 | 364 |
| 263 | 3300005841 | Ga0068863_100000336 | Ga0068863_10000033618 | 364 |
| 264 | 3300005842 | Ga0068858_100076132 | Ga0068858_1000761322 | 364 |
| 265 | 3300006931 | Ga0097620_100004481 | Ga0097620_10000448110 | 364 |
| 266 | 3300024227 | Ga0228598_1011957 | Ga0228598_10119572 | 364 |
| 267 | 3300026035 | Ga0207703_10065822 | Ga0207703_100658221 | 364 |
| 268 | 3300026088 | Ga0207641_10007965 | Ga0207641_100079656 | 364 |
| 269 | 3300044684 | Ga0466966_0059011 | Ga0466966_0059011_1255_2370 | 364 |
| 270 | 3300047319 | Ga0495674_0246952 | Ga0495674_0246952_191_1294 | 366 |
| 271 | 3300003659 | JGI25404J52841_10000075 | JGI25404J52841_100000754 | 367 |
| 272 | 3300005329 | Ga0070683_100015194 | Ga0070683_1000151942 | 367 |
| 273 | 3300005330 | Ga0070690_100023328 | Ga0070690_1000233282 | 367 |
| 274 | 3300005334 | Ga0068869_100013739 | Ga0068869_1000137391 | 367 |
| 275 | 3300005335 | Ga0070666_10024666 | Ga0070666_100246663 | 367 |
| 276 | 3300005339 | Ga0070660_100058074 | Ga0070660_1000580742 | 367 |
| 277 | 3300005341 | Ga0070691_10030804 | Ga0070691_100308043 | 367 |
| 278 | 3300005344 | Ga0070661_100012709 | Ga0070661_1000127092 | 367 |
| 279 | 3300005355 | Ga0070671_100015566 | Ga0070671_1000155663 | 367 |
| 280 | 3300005366 | Ga0070659_100084291 | Ga0070659_1000842912 | 367 |
| 281 | 3300005406 | Ga0070703_10014363 | Ga0070703_100143633 | 367 |
| 282 | 3300005441 | Ga0070700_100096942 | Ga0070700_1000969422 | 367 |
| 283 | 3300005455 | Ga0070663_100079246 | Ga0070663_1000792462 | 367 |
| 284 | 3300005456 | Ga0070678_100036396 | Ga0070678_1000363962 | 367 |
| 285 | 3300005458 | Ga0070681_10028471 | Ga0070681_100284715 | 367 |
| 286 | 3300005466 | Ga0070685_10046254 | Ga0070685_100462542 | 367 |
| 287 | 3300005535 | Ga0070684_100029302 | Ga0070684_1000293024 | 367 |
| 288 | 3300005544 | Ga0070686_100020426 | Ga0070686_1000204263 | 367 |
| 289 | 3300005545 | Ga0070695_100064596 | Ga0070695_1000645961 | 367 |
| 290 | 3300005546 | Ga0070696_100017190 | Ga0070696_1000171904 | 367 |
| 291 | 3300005547 | Ga0070693_100006574 | Ga0070693_1000065744 | 367 |
| 292 | 3300005564 | Ga0070664_100050035 | Ga0070664_1000500353 | 367 |
| 293 | 3300005577 | Ga0068857_100042159 | Ga0068857_1000421592 | 367 |
| 294 | 3300005616 | Ga0068852_100052482 | Ga0068852_1000524822 | 367 |
| 295 | 3300005617 | Ga0068859_100054813 | Ga0068859_1000548133 | 367 |
| 296 | 3300005618 | Ga0068864_100062859 | Ga0068864_1000628593 | 367 |
| 297 | 3300005841 | Ga0068863_100025168 | Ga0068863_1000251684 | 367 |
| 298 | 3300005843 | Ga0068860_100097668 | Ga0068860_1000976682 | 367 |
| 299 | 3300005983 | Ga0081540_1000299 | Ga0081540_10002999 | 367 |
| 300 | 3300006237 | Ga0097621_100051471 | Ga0097621_1000514713 | 367 |
| 301 | 3300006358 | Ga0068871_100177428 | Ga0068871_1001774282 | 367 |
| 302 | 3300006931 | Ga0097620_100054815 | Ga0097620_1000548153 | 367 |
| 303 | 3300007076 | Ga0075435_100054010 | Ga0075435_1000540103 | 367 |
| 304 | 3300009093 | Ga0105240_10405914 | Ga0105240_104059141 | 367 |
| 305 | 3300009174 | Ga0105241_10172881 | Ga0105241_101728811 | 367 |
| 306 | 3300009177 | Ga0105248_10136281 | Ga0105248_101362811 | 367 |
| 307 | 3300009551 | Ga0105238_10162797 | Ga0105238_101627971 | 367 |
| 308 | 3300013296 | Ga0157374_10071248 | Ga0157374_100712482 | 367 |
| 309 | 3300013306 | Ga0163162_10082540 | Ga0163162_100825402 | 367 |
| 310 | 3300014325 | Ga0163163_10057393 | Ga0163163_100573932 | 367 |
| 311 | 3300025321 | Ga0207656_10039796 | Ga0207656_100397962 | 367 |
| 312 | 3300025885 | Ga0207653_10001531 | Ga0207653_100015311 | 367 |
| 313 | 3300025901 | Ga0207688_10012968 | Ga0207688_100129683 | 367 |
| 314 | 3300025907 | Ga0207645_10036604 | Ga0207645_100366043 | 367 |
| 315 | 3300025908 | Ga0207643_10022020 | Ga0207643_100220202 | 367 |
| 316 | 3300025909 | Ga0207705_10101214 | Ga0207705_101012142 | 367 |
| 317 | 3300025916 | Ga0207663_10094618 | Ga0207663_100946182 | 367 |
| 318 | 3300025918 | Ga0207662_10008115 | Ga0207662_100081154 | 367 |
| 319 | 3300025919 | Ga0207657_10015744 | Ga0207657_100157445 | 367 |
| 320 | 3300025921 | Ga0207652_10175687 | Ga0207652_101756872 | 367 |
| 321 | 3300025928 | Ga0207700_10005012 | Ga0207700_100050126 | 367 |
| 322 | 3300025929 | Ga0207664_10042787 | Ga0207664_100427872 | 367 |
| 323 | 3300025932 | Ga0207690_10207976 | Ga0207690_102079762 | 367 |
| 324 | 3300025937 | Ga0207669_10053731 | Ga0207669_100537312 | 367 |
| 325 | 3300025940 | Ga0207691_10033339 | Ga0207691_100333393 | 367 |
| 326 | 3300025941 | Ga0207711_10106390 | Ga0207711_101063901 | 367 |
| 327 | 3300025942 | Ga0207689_10006270 | Ga0207689_100062706 | 367 |
| 328 | 3300025960 | Ga0207651_10183394 | Ga0207651_101833941 | 367 |
| 329 | 3300026067 | Ga0207678_10012567 | Ga0207678_100125676 | 367 |
| 330 | 3300026075 | Ga0207708_10008319 | Ga0207708_100083193 | 367 |
| 331 | 3300026078 | Ga0207702_10011128 | Ga0207702_100111285 | 367 |
| 332 | 3300026088 | Ga0207641_10049245 | Ga0207641_100492451 | 367 |
| 333 | 3300026089 | Ga0207648_10026334 | Ga0207648_100263344 | 367 |
| 334 | 3300026095 | Ga0207676_10081216 | Ga0207676_100812162 | 367 |
| 335 | 3300026116 | Ga0207674_10003957 | Ga0207674_1000395712 | 367 |
| 336 | 3300026118 | Ga0207675_100020355 | Ga0207675_1000203554 | 367 |
| 337 | 3300026121 | Ga0207683_10006776 | Ga0207683_100067762 | 367 |
| 338 | 3300026142 | Ga0207698_10067185 | Ga0207698_100671853 | 367 |
| 339 | 3300028379 | Ga0268266_10056619 | Ga0268266_100566192 | 367 |
| 340 | 3300050510 | nmdc:mga06r32_87602_c1 | nmdc:mga06r32_87602_c1_903_2009 | 367 |
| 341 | iso_pu_bacteria | 2675903060 | 2676494335 | 367 |
| 342 | iso_pu_bacteria | 2884693830 | 2884695180 | 367 |
| 343 | iso_pu_bacteria | 2895427314 | 2895432498 | 367 |
| 344 | iso_pu_bacteria | 2895442618 | 2895446112 | 367 |
| 345 | 3300005518 | Ga0070699_100016925 | Ga0070699_1000169252 | 368 |
| 346 | 3300005530 | Ga0070679_100048561 | Ga0070679_1000485613 | 369 |
| 347 | 3300006173 | Ga0070716_100043553 | Ga0070716_1000435532 | 369 |
| 348 | 3300013105 | Ga0157369_10093927 | Ga0157369_100939272 | 369 |
| 349 | 3300020081 | Ga0206354_10912500 | Ga0206354_109125002 | 369 |
| 350 | 3300020082 | Ga0206353_11961061 | Ga0206353_119610614 | 369 |
| 351 | 3300025898 | Ga0207692_10016564 | Ga0207692_100165641 | 369 |
| 352 | 3300025921 | Ga0207652_10108861 | Ga0207652_101088612 | 369 |
| 353 | 3300026067 | Ga0207678_10016803 | Ga0207678_100168036 | 369 |
| 354 | iso_pu_bacteria | 8057568493 | 8057569644 | 369 |
| 355 | 3300005518 | Ga0070699_100013280 | Ga0070699_1000132804 | 370 |
| 356 | 3300005536 | Ga0070697_100002101 | Ga0070697_1000021014 | 370 |
| 357 | 3300009147 | Ga0114129_10110803 | Ga0114129_101108033 | 370 |
| 358 | 3300009147 | Ga0114129_10373314 | Ga0114129_103733142 | 370 |
| 359 | 3300025910 | Ga0207684_10054794 | Ga0207684_100547943 | 370 |
| 360 | 3300025922 | Ga0207646_10019370 | Ga0207646_100193702 | 370 |
| 361 | 3300037418 | Ga0395900_0024531 | Ga0395900_0024531_2818_3939 | 370 |
| 362 | 3300037471 | Ga0395905_0006998 | Ga0395905_0006998_9705_10826 | 370 |
| 363 | 3300038443 | Ga0395901_0041350 | Ga0395901_0041350_2137_3258 | 370 |
| 364 | 3300041512 | Ga0451853_0837750 | Ga0451853_0837750_1366_2487 | 370 |
| 365 | 3300050507 | nmdc:mga05p37_189174_c1 | nmdc:mga05p37_189174_c1_773_1894 | 370 |
| 366 | 3300050507 | nmdc:mga05p37_329126_c1 | nmdc:mga05p37_329126_c1_120_1235 | 370 |
| 367 | 3300050508 | nmdc:mga09592_64933_c1 | nmdc:mga09592_64933_c1_404_1525 | 370 |
| 368 | 3300050510 | nmdc:mga06r32_170671_c1 | nmdc:mga06r32_170671_c1_959_2074 | 370 |
| 369 | 3300005329 | Ga0070683_100278666 | Ga0070683_1002786662 | 371 |
| 370 | 3300005535 | Ga0070684_100074848 | Ga0070684_1000748482 | 371 |
| 371 | 3300009098 | Ga0105245_10461533 | Ga0105245_104615331 | 371 |
| 372 | 3300009147 | Ga0114129_10000459 | Ga0114129_1000045935 | 371 |
| 373 | 3300009147 | Ga0114129_10002321 | Ga0114129_100023212 | 371 |
| 374 | 3300009177 | Ga0105248_10031587 | Ga0105248_100315876 | 371 |
| 375 | 3300009545 | Ga0105237_10074165 | Ga0105237_100741653 | 371 |
| 376 | 3300013105 | Ga0157369_10007835 | Ga0157369_100078356 | 371 |
| 377 | 3300013105 | Ga0157369_10364095 | Ga0157369_103640952 | 371 |
| 378 | 3300013306 | Ga0163162_10167824 | Ga0163162_101678242 | 371 |
| 379 | 3300013308 | Ga0157375_10017783 | Ga0157375_100177832 | 371 |
| 380 | 3300014325 | Ga0163163_10011970 | Ga0163163_100119702 | 371 |
| 381 | 3300014325 | Ga0163163_10055451 | Ga0163163_100554514 | 371 |
| 382 | 3300014968 | Ga0157379_10259284 | Ga0157379_102592842 | 371 |
| 383 | 3300025944 | Ga0207661_10161798 | Ga0207661_101617981 | 371 |
| 384 | 3300025945 | Ga0207679_10191433 | Ga0207679_101914332 | 371 |
| 385 | 3300026023 | Ga0207677_10148512 | Ga0207677_101485122 | 371 |
| 386 | 3300035088 | Ga0373940_0013628 | Ga0373940_0013628_285_1409 | 371 |
| 387 | 3300035115 | Ga0373941_0007679 | Ga0373941_0007679_490_1614 | 371 |
| 388 | 3300035170 | Ga0373943_0166925 | Ga0373943_0166925_48_1166 | 371 |
| 389 | 3300035207 | Ga0373942_0001340 | Ga0373942_0001340_4857_5981 | 371 |
| 390 | 3300037068 | Ga0373925_0119052 | Ga0373925_0119052_59_1177 | 371 |
| 391 | 3300037853 | Ga0436364_0280596 | Ga0436364_0280596_949_2070 | 371 |
| 392 | 3300039450 | Ga0436363_0196300 | Ga0436363_0196300_686_1801 | 371 |
| 393 | 3300044693 | Ga0466961_0010687 | Ga0466961_0010687_4398_5513 | 371 |
| 394 | 3300044694 | Ga0466963_0017021 | Ga0466963_0017021_210_1325 | 371 |
| 395 | 3300044694 | Ga0466963_0216881 | Ga0466963_0216881_211_1326 | 371 |
| 396 | 3300045049 | Ga0466959_0099477 | Ga0466959_0099477_644_1759 | 371 |
| 397 | 3300045836 | Ga0466958_0005490 | Ga0466958_0005490_4535_5650 | 371 |
| 398 | 3300045976 | Ga0466967_0008838 | Ga0466967_0008838_4003_5118 | 371 |
| 399 | 3300045976 | Ga0466967_0117782 | Ga0466967_0117782_821_1936 | 371 |
| 400 | 3300046459 | Ga0495629_0064450 | Ga0495629_0064450_490_1608 | 371 |
| 401 | 3300048904 | Ga0496101_0034817 | Ga0496101_0034817_890_2020 | 371 |
| 402 | 3300048911 | Ga0496108_0000016 | Ga0496108_0000016_210631_211755 | 371 |
| 403 | 3300048911 | Ga0496108_0122248 | Ga0496108_0122248_166_1296 | 371 |
| 404 | 3300048912 | Ga0496109_0006542 | Ga0496109_0006542_603_1721 | 371 |
| 405 | 3300048912 | Ga0496109_0128775 | Ga0496109_0128775_156_1286 | 371 |
| 406 | 3300048913 | Ga0496110_0011403 | Ga0496110_0011403_4988_6106 | 371 |
| 407 | 3300048913 | Ga0496110_0020154 | Ga0496110_0020154_1589_2704 | 371 |
| 408 | 3300048913 | Ga0496110_0080324 | Ga0496110_0080324_1063_2193 | 371 |
| 409 | 3300048913 | Ga0496110_0269908 | Ga0496110_0269908_348_1472 | 371 |
| 410 | 3300048914 | Ga0496111_0080383 | Ga0496111_0080383_883_2001 | 371 |
| 411 | 3300048915 | Ga0496112_0013474 | Ga0496112_0013474_1455_2585 | 371 |
| 412 | 3300048915 | Ga0496112_0070068 | Ga0496112_0070068_2214_3332 | 371 |
| 413 | 3300048916 | Ga0496113_0041238 | Ga0496113_0041238_1606_2724 | 371 |
| 414 | 3300048917 | Ga0496114_0069401 | Ga0496114_0069401_677_1807 | 371 |
| 415 | 3300048918 | Ga0496115_0140644 | Ga0496115_0140644_168_1283 | 371 |
| 416 | 3300049569 | Ga0501032_0024223 | Ga0501032_0024223_2602_3717 | 371 |
| 417 | 3300049573 | Ga0501037_0025472 | Ga0501037_0025472_1465_2580 | 371 |
| 418 | 3300049581 | Ga0501047_0275491 | Ga0501047_0275491_331_1446 | 371 |
| 419 | 3300049585 | Ga0501069_0003390 | Ga0501069_0003390_6897_8012 | 371 |
| 420 | 3300049586 | Ga0501070_0000776 | Ga0501070_0000776_21704_22819 | 371 |
| 421 | 3300049586 | Ga0501070_0002547 | Ga0501070_0002547_4726_5841 | 371 |
| 422 | 3300049586 | Ga0501070_0008238 | Ga0501070_0008238_5288_6403 | 371 |
| 423 | 3300049586 | Ga0501070_0051300 | Ga0501070_0051300_1269_2384 | 371 |
| 424 | 3300049586 | Ga0501070_0097343 | Ga0501070_0097343_919_2034 | 371 |
| 425 | 3300049589 | Ga0501073_0001322 | Ga0501073_0001322_14929_16044 | 371 |
| 426 | 3300049590 | Ga0501074_0001371 | Ga0501074_0001371_7485_8600 | 371 |
| 427 | 3300049741 | Ga0501079_0000029 | Ga0501079_0000029_50484_51599 | 371 |
| 428 | 3300049742 | Ga0501080_0002688 | Ga0501080_0002688_7871_8986 | 371 |
| 429 | 3300049742 | Ga0501080_0003657 | Ga0501080_0003657_900_2015 | 371 |
| 430 | 3300049742 | Ga0501080_0085799 | Ga0501080_0085799_614_1729 | 371 |
| 431 | 3300049822 | Ga0501035_0308814 | Ga0501035_0308814_47_1186 | 371 |
| 432 | 3300049823 | Ga0501044_0002655 | Ga0501044_0002655_4918_6033 | 371 |
| 433 | 3300049823 | Ga0501044_0153998 | Ga0501044_0153998_358_1473 | 371 |
| 434 | 3300050507 | nmdc:mga05p37_154_c1 | nmdc:mga05p37_154_c1_47669_48793 | 371 |
| 435 | 3300050507 | nmdc:mga05p37_2885_c1 | nmdc:mga05p37_2885_c1_3773_4888 | 371 |
| 436 | 3300050508 | nmdc:mga09592_36_c3 | nmdc:mga09592_36_c3_47617_48741 | 371 |
| 437 | 3300050509 | nmdc:mga0qj67_42_c1 | nmdc:mga0qj67_42_c1_42657_43781 | 371 |
| 438 | 3300050510 | nmdc:mga06r32_42_c2 | nmdc:mga06r32_42_c2_27829_28953 | 371 |
| 439 | iso_pu_bacteria | 2506783011 | 2506865622 | 371 |
| 440 | iso_pu_bacteria | 2773857933 | 2774903567 | 371 |
| 441 | 3300009011 | Ga0105251_10038138 | Ga0105251_100381382 | 372 |
| 442 | 3300009101 | Ga0105247_10000016 | Ga0105247_1000001674 | 372 |
| 443 | 3300009101 | Ga0105247_10001099 | Ga0105247_100010998 | 372 |
| 444 | 3300009177 | Ga0105248_10010886 | Ga0105248_100108868 | 372 |
| 445 | 3300014325 | Ga0163163_10006537 | Ga0163163_100065374 | 372 |
| 446 | 3300014968 | Ga0157379_10003427 | Ga0157379_100034278 | 372 |
| 447 | 3300014968 | Ga0157379_10099047 | Ga0157379_100990472 | 372 |
| 448 | 3300025906 | Ga0207699_10033262 | Ga0207699_100332622 | 372 |
| 449 | 3300031995 | Ga0307409_100025998 | Ga0307409_1000259982 | 372 |
| 450 | 3300044694 | Ga0466963_0024825 | Ga0466963_0024825_1405_2523 | 372 |
| 451 | 3300048922 | Ga0496119_0002564 | Ga0496119_0002564_1770_2888 | 372 |
| 452 | 3300048922 | Ga0496119_0007202 | Ga0496119_0007202_4739_5857 | 372 |
| 453 | 3300048923 | Ga0496120_0000050 | Ga0496120_0000050_89124_90242 | 372 |
| 454 | 3300048924 | Ga0496121_0008981 | Ga0496121_0008981_1337_2455 | 372 |
| 455 | 3300050509 | nmdc:mga0qj67_134036_c1 | nmdc:mga0qj67_134036_c1_406_1533 | 372 |
| 456 | iso_pu_bacteria | 2501939600 | 2501943223 | 372 |
| 457 | iso_pu_bacteria | 2508501039 | 2508670469 | 372 |
| 458 | iso_pu_bacteria | 2515154088 | 2515493698 | 372 |
| 459 | iso_pu_bacteria | 2515154129 | 2515720548 | 372 |
| 460 | iso_pu_bacteria | 2515154137 | 2515755087 | 372 |
| 461 | iso_pu_bacteria | 2515154202 | 2516084115 | 372 |
| 462 | iso_pu_bacteria | 2515154203 | 2516087770 | 372 |
| 463 | iso_pu_bacteria | 2517572101 | 2517762687 | 372 |
| 464 | iso_pu_bacteria | 2527291627 | 2528202514 | 372 |
| 465 | iso_pu_bacteria | 2527291629 | 2528212455 | 372 |
| 466 | iso_pu_bacteria | 2546825537 | 2546947167 | 372 |
| 467 | iso_pu_bacteria | 2576861822 | 2579747331 | 372 |
| 468 | iso_pu_bacteria | 2579778521 | 2579854055 | 372 |
| 469 | iso_pu_bacteria | 2619618881 | 2619854281 | 372 |
| 470 | iso_pu_bacteria | 2619619003 | 2620350261 | 372 |
| 471 | iso_pu_bacteria | 2622736626 | 2623586706 | 372 |
| 472 | iso_pu_bacteria | 2626541554 | 2626635991 | 372 |
| 473 | iso_pu_bacteria | 2671180195 | 2671835549 | 372 |
| 474 | iso_pu_bacteria | 2675902999 | 2676199306 | 372 |
| 475 | iso_pu_bacteria | 2675903059 | 2676480372 | 372 |
| 476 | iso_pu_bacteria | 2684623035 | 2686540291 | 372 |
| 477 | iso_pu_bacteria | 2684623036 | 2686541335 | 372 |
| 478 | iso_pu_bacteria | 2687453737 | 2689962489 | 372 |
| 479 | iso_pu_bacteria | 2687453743 | 2689994692 | 372 |
| 480 | iso_pu_bacteria | 2710264753 | 2710602233 | 372 |
| 481 | iso_pu_bacteria | 2772190715 | 2772641906 | 372 |
| 482 | iso_pu_bacteria | 2773857921 | 2774843884 | 372 |
| 483 | iso_pu_bacteria | 2773857922 | 2774853705 | 372 |
| 484 | iso_pu_bacteria | 2773857924 | 2774868201 | 372 |
| 485 | iso_pu_bacteria | 2831935698 | 2831938812 | 372 |
| 486 | iso_pu_bacteria | 2832004796 | 2832006339 | 372 |
| 487 | iso_pu_bacteria | 2855670206 | 2855671494 | 372 |
| 488 | iso_pu_bacteria | 2855676851 | 2855680604 | 372 |
| 489 | iso_pu_bacteria | 2855683550 | 2855684884 | 372 |
| 490 | iso_pu_bacteria | 2856858025 | 2856860621 | 372 |
| 491 | iso_pu_bacteria | 2857288857 | 2857292190 | 372 |
| 492 | iso_pu_bacteria | 2858848962 | 2858853384 | 372 |
| 493 | iso_pu_bacteria | 2858868258 | 2858868721 | 372 |
| 494 | iso_pu_bacteria | 2858882152 | 2858883653 | 372 |
| 495 | iso_pu_bacteria | 2858888857 | 2858890506 | 372 |
| 496 | iso_pu_bacteria | 2858895516 | 2858901135 | 372 |
| 497 | iso_pu_bacteria | 2858902515 | 2858903366 | 372 |
| 498 | iso_pu_bacteria | 2866065130 | 2866069178 | 372 |
| 499 | iso_pu_bacteria | 2867302475 | 2867304059 | 372 |
| 500 | iso_pu_bacteria | 2867312974 | 2867313096 | 372 |
| 501 | iso_pu_bacteria | 2867319477 | 2867325120 | 372 |
| 502 | iso_pu_bacteria | 2867507094 | 2867509565 | 372 |
| 503 | iso_pu_bacteria | 2869048445 | 2869048601 | 372 |
| 504 | iso_pu_bacteria | 2869061728 | 2869063745 | 372 |
| 505 | iso_pu_bacteria | 2869068681 | 2869070368 | 372 |
| 506 | iso_pu_bacteria | 2880489317 | 2880493487 | 372 |
| 507 | iso_pu_bacteria | 2880495981 | 2880498821 | 372 |
| 508 | iso_pu_bacteria | 2895880812 | 2895885082 | 372 |
| 509 | iso_pu_bacteria | 2902582711 | 2902586120 | 372 |
| 510 | iso_pu_bacteria | 2929219909 | 2929220820 | 372 |
| 511 | iso_pu_bacteria | 2929226422 | 2929227408 | 372 |
| 512 | iso_pu_bacteria | 2996221748 | 2996227092 | 372 |
| 513 | iso_pu_bacteria | 637000116 | 637878068 | 372 |
| 514 | iso_pu_bacteria | 649633069 | 649811356 | 372 |
| 515 | iso_pu_bacteria | 8002775197 | 8002784078 | 372 |
| 516 | iso_pu_bacteria | 8002784119 | 8002788598 | 372 |
| 517 | iso_pu_bacteria | 8003830390 | 8003832069 | 372 |
| 518 | iso_pu_bacteria | 8003870546 | 8003871442 | 372 |
| 519 | iso_pu_bacteria | 8054704163 | 8054709898 | 372 |
| 520 | iso_pu_bacteria | 8054727385 | 8054727594 | 372 |
| 521 | iso_pu_bacteria | 8054734606 | 8054738076 | 372 |
| 522 | iso_pu_bacteria | 8054913762 | 8054920412 | 372 |
| 523 | iso_pu_bacteria | 8054920844 | 8054924655 | 372 |
| 524 | iso_pu_bacteria | 8055157932 | 8055160056 | 372 |
| 525 | iso_pu_bacteria | 8055412473 | 8055414122 | 372 |
| 526 | 3300005467 | Ga0070706_100025572 | Ga0070706_1000255722 | 373 |
| 527 | 3300005535 | Ga0070684_100130270 | Ga0070684_1001302702 | 373 |
| 528 | 3300005937 | Ga0081455_10000144 | Ga0081455_1000014460 | 373 |
| 529 | 3300005937 | Ga0081455_10103387 | Ga0081455_101033872 | 373 |
| 530 | 3300009094 | Ga0111539_10014972 | Ga0111539_100149724 | 373 |
| 531 | 3300009094 | Ga0111539_10022132 | Ga0111539_100221326 | 373 |
| 532 | 3300009148 | Ga0105243_10220030 | Ga0105243_102200302 | 373 |
| 533 | 3300009174 | Ga0105241_10005369 | Ga0105241_100053699 | 373 |
| 534 | 3300009177 | Ga0105248_10182631 | Ga0105248_101826311 | 373 |
| 535 | 3300009177 | Ga0105248_10222528 | Ga0105248_102225282 | 373 |
| 536 | 3300009545 | Ga0105237_10333854 | Ga0105237_103338541 | 373 |
| 537 | 3300011119 | Ga0105246_10035616 | Ga0105246_100356163 | 373 |
| 538 | 3300011119 | Ga0105246_10145282 | Ga0105246_101452821 | 373 |
| 539 | 3300013100 | Ga0157373_10177094 | Ga0157373_101770941 | 373 |
| 540 | 3300013104 | Ga0157370_10033518 | Ga0157370_100335184 | 373 |
| 541 | 3300013105 | Ga0157369_10210689 | Ga0157369_102106892 | 373 |
| 542 | 3300013308 | Ga0157375_10293875 | Ga0157375_102938752 | 373 |
| 543 | 3300014745 | Ga0157377_10003028 | Ga0157377_100030284 | 373 |
| 544 | 3300014968 | Ga0157379_10137096 | Ga0157379_101370962 | 373 |
| 545 | 3300025944 | Ga0207661_10008312 | Ga0207661_100083127 | 373 |
| 546 | 3300033180 | Ga0307510_10131081 | Ga0307510_101310812 | 373 |
| 547 | 3300035091 | Ga0373951_0000053 | Ga0373951_0000053_37276_38406 | 373 |
| 548 | 3300035111 | Ga0373923_0014873 | Ga0373923_0014873_1331_2455 | 373 |
| 549 | 3300035117 | Ga0373953_0000203 | Ga0373953_0000203_2523_3647 | 373 |
| 550 | 3300035118 | Ga0373954_0004129 | Ga0373954_0004129_3862_4986 | 373 |
| 551 | 3300035119 | Ga0373956_0017516 | Ga0373956_0017516_1080_2204 | 373 |
| 552 | 3300035120 | Ga0373957_0000063 | Ga0373957_0000063_24633_25757 | 373 |
| 553 | 3300035172 | Ga0373955_0000011 | Ga0373955_0000011_54654_55778 | 373 |
| 554 | 3300035172 | Ga0373955_0024170 | Ga0373955_0024170_895_2019 | 373 |
| 555 | 3300035207 | Ga0373942_0027342 | Ga0373942_0027342_122_1246 | 373 |
| 556 | 3300035410 | Ga0373924_0000153 | Ga0373924_0000153_2349_3473 | 373 |
| 557 | 3300035410 | Ga0373924_0074675 | Ga0373924_0074675_85_1209 | 373 |
| 558 | 3300035724 | Ga0373933_0000027 | Ga0373933_0000027_34233_35357 | 373 |
| 559 | 3300036401 | Ga0373937_0000159 | Ga0373937_0000159_9430_10554 | 373 |
| 560 | 3300036401 | Ga0373937_0011182 | Ga0373937_0011182_2498_3622 | 373 |
| 561 | 3300036401 | Ga0373937_0180492 | Ga0373937_0180492_205_1329 | 373 |
| 562 | 3300037068 | Ga0373925_0004238 | Ga0373925_0004238_7314_8438 | 373 |
| 563 | 3300037466 | Ga0395898_0375076 | Ga0395898_0375076_32_1153 | 373 |
| 564 | 3300042005 | Ga0439448_0010651 | Ga0439448_0010651_713_1834 | 373 |
| 565 | 3300046454 | Ga0495592_0000019 | Ga0495592_0000019_84944_86068 | 373 |
| 566 | 3300046454 | Ga0495592_0092868 | Ga0495592_0092868_380_1504 | 373 |
| 567 | 3300046462 | Ga0495651_0000012 | Ga0495651_0000012_82475_83599 | 373 |
| 568 | 3300046462 | Ga0495651_0003573 | Ga0495651_0003573_2643_3767 | 373 |
| 569 | 3300046463 | Ga0495653_0003237 | Ga0495653_0003237_9525_10649 | 373 |
| 570 | 3300046463 | Ga0495653_0003779 | Ga0495653_0003779_86_1210 | 373 |
| 571 | 3300046477 | Ga0495664_0027295 | Ga0495664_0027295_446_1570 | 373 |
| 572 | 3300046511 | Ga0495608_0000048 | Ga0495608_0000048_84944_86068 | 373 |
| 573 | 3300046511 | Ga0495608_0003833 | Ga0495608_0003833_7165_8289 | 373 |
| 574 | 3300046514 | Ga0495618_0020319 | Ga0495618_0020319_1283_2407 | 373 |
| 575 | 3300046514 | Ga0495618_0186199 | Ga0495618_0186199_181_1305 | 373 |
| 576 | 3300046516 | Ga0495628_0000053 | Ga0495628_0000053_5042_6166 | 373 |
| 577 | 3300046516 | Ga0495628_0044642 | Ga0495628_0044642_998_2122 | 373 |
| 578 | 3300046516 | Ga0495628_0128125 | Ga0495628_0128125_434_1558 | 373 |
| 579 | 3300046517 | Ga0495630_0135422 | Ga0495630_0135422_714_1841 | 373 |
| 580 | 3300046529 | Ga0495652_0000163 | Ga0495652_0000163_54682_55806 | 373 |
| 581 | 3300046529 | Ga0495652_0008769 | Ga0495652_0008769_6334_7458 | 373 |
| 582 | 3300046533 | Ga0495640_0057082 | Ga0495640_0057082_355_1479 | 373 |
| 583 | 3300046536 | Ga0495587_0000027 | Ga0495587_0000027_84944_86068 | 373 |
| 584 | 3300046543 | Ga0495645_0033500 | Ga0495645_0033500_1677_2801 | 373 |
| 585 | 3300046559 | Ga0495667_0000074 | Ga0495667_0000074_54682_55806 | 373 |
| 586 | 3300046559 | Ga0495667_0004210 | Ga0495667_0004210_2473_3597 | 373 |
| 587 | 3300046663 | Ga0495635_0016444 | Ga0495635_0016444_1026_2150 | 373 |
| 588 | 3300046663 | Ga0495635_0032993 | Ga0495635_0032993_1297_2421 | 373 |
| 589 | 3300046675 | Ga0495657_0000025 | Ga0495657_0000025_84944_86068 | 373 |
| 590 | 3300046675 | Ga0495657_0013347 | Ga0495657_0013347_2357_3481 | 373 |
| 591 | 3300046678 | Ga0495599_0000026 | Ga0495599_0000026_84945_86069 | 373 |
| 592 | 3300046678 | Ga0495599_0017607 | Ga0495599_0017607_902_2026 | 373 |
| 593 | 3300046678 | Ga0495599_0101605 | Ga0495599_0101605_631_1755 | 373 |
| 594 | 3300046679 | Ga0495623_0000181 | Ga0495623_0000181_28603_29727 | 373 |
| 595 | 3300046679 | Ga0495623_0015258 | Ga0495623_0015258_1514_2638 | 373 |
| 596 | 3300046680 | Ga0495646_0012816 | Ga0495646_0012816_510_1634 | 373 |
| 597 | 3300046680 | Ga0495646_0039423 | Ga0495646_0039423_343_1467 | 373 |
| 598 | 3300046809 | Ga0495600_0001653 | Ga0495600_0001653_9133_10257 | 373 |
| 599 | 3300047317 | Ga0495604_0000029 | Ga0495604_0000029_54682_55806 | 373 |
| 600 | 3300047317 | Ga0495604_0004486 | Ga0495604_0004486_8112_9236 | 373 |
| 601 | 3300047319 | Ga0495674_0007661 | Ga0495674_0007661_7634_8758 | 373 |
| 602 | 3300047319 | Ga0495674_0048170 | Ga0495674_0048170_1735_2859 | 373 |
| 603 | 3300047321 | Ga0495676_0071597 | Ga0495676_0071597_633_1757 | 373 |
| 604 | 3300047322 | Ga0495680_0000011 | Ga0495680_0000011_54682_55806 | 373 |
| 605 | 3300047322 | Ga0495680_0015821 | Ga0495680_0015821_2435_3559 | 373 |
| 606 | 3300047444 | Ga0495675_0000172 | Ga0495675_0000172_25424_26548 | 373 |
| 607 | 3300047444 | Ga0495675_0004540 | Ga0495675_0004540_6675_7799 | 373 |
| 608 | 3300047471 | Ga0495684_0023576 | Ga0495684_0023576_1667_2791 | 373 |
| 609 | 3300048088 | Ga0495602_0000033 | Ga0495602_0000033_84945_86069 | 373 |
| 610 | 3300048903 | Ga0496100_0014210 | Ga0496100_0014210_810_1934 | 373 |
| 611 | 3300048905 | Ga0496102_0240148 | Ga0496102_0240148_278_1399 | 373 |
| 612 | 3300048906 | Ga0496103_0173917 | Ga0496103_0173917_37_1158 | 373 |
| 613 | 3300048907 | Ga0496104_0002235 | Ga0496104_0002235_5097_6221 | 373 |
| 614 | 3300048907 | Ga0496104_0117036 | Ga0496104_0117036_164_1288 | 373 |
| 615 | 3300048908 | Ga0496105_0004813 | Ga0496105_0004813_8378_9502 | 373 |
| 616 | 3300048908 | Ga0496105_0007134 | Ga0496105_0007134_4358_5482 | 373 |
| 617 | 3300048908 | Ga0496105_0114708 | Ga0496105_0114708_837_1958 | 373 |
| 618 | 3300048909 | Ga0496106_0034912 | Ga0496106_0034912_342_1463 | 373 |
| 619 | 3300048909 | Ga0496106_0052920 | Ga0496106_0052920_1018_2142 | 373 |
| 620 | 3300048910 | Ga0496107_0072646 | Ga0496107_0072646_1284_2405 | 373 |
| 621 | 3300048911 | Ga0496108_0005669 | Ga0496108_0005669_8118_9242 | 373 |
| 622 | 3300048911 | Ga0496108_0077574 | Ga0496108_0077574_172_1296 | 373 |
| 623 | 3300048912 | Ga0496109_0031948 | Ga0496109_0031948_1199_2323 | 373 |
| 624 | 3300048912 | Ga0496109_0047058 | Ga0496109_0047058_2309_3433 | 373 |
| 625 | 3300048912 | Ga0496109_0251175 | Ga0496109_0251175_515_1636 | 373 |
| 626 | 3300048914 | Ga0496111_0000525 | Ga0496111_0000525_10769_11890 | 373 |
| 627 | 3300048915 | Ga0496112_0002256 | Ga0496112_0002256_5886_7010 | 373 |
| 628 | 3300048916 | Ga0496113_0154469 | Ga0496113_0154469_595_1716 | 373 |
| 629 | 3300048917 | Ga0496114_0042235 | Ga0496114_0042235_502_1626 | 373 |
| 630 | 3300048918 | Ga0496115_0079484 | Ga0496115_0079484_1186_2310 | 373 |
| 631 | 3300048918 | Ga0496115_0160610 | Ga0496115_0160610_707_1828 | 373 |
| 632 | 3300048927 | Ga0496124_0000420 | Ga0496124_0000420_50220_51341 | 373 |
| 633 | 3300050507 | nmdc:mga05p37_285091_c1 | nmdc:mga05p37_285091_c1_677_1798 | 373 |
| 634 | 3300050510 | nmdc:mga06r32_351449_c1 | nmdc:mga06r32_351449_c1_32_1183 | 373 |
| 635 | 3300050512 | nmdc:mga0n895_2212_c1 | nmdc:mga0n895_2212_c1_8916_10037 | 373 |
| 636 | 3300050514 | nmdc:mga08x19_865_c1 | nmdc:mga08x19_865_c1_9962_11083 | 373 |
| 637 | 3300050515 | nmdc:mga0a205_9008_c1 | nmdc:mga0a205_9008_c1_7708_8829 | 373 |
| 638 | 3300053078 | Ga0495612_0048385 | Ga0495612_0048385_197_1321 | 373 |
| 639 | 3300053085 | Ga0495619_0026390 | Ga0495619_0026390_935_2059 | 373 |
| 640 | iso_pu_bacteria | 2751185782 | 2753263579 | 373 |
| 641 | 3300006844 | Ga0075428_100000425 | Ga0075428_10000042517 | 374 |
| 642 | 3300006847 | Ga0075431_100063606 | Ga0075431_1000636061 | 374 |
| 643 | 3300006847 | Ga0075431_100109311 | Ga0075431_1001093112 | 374 |
| 644 | 3300050510 | nmdc:mga06r32_152059_c1 | nmdc:mga06r32_152059_c1_486_1619 | 374 |
| 645 | iso_pu_bacteria | 2861520306 | 2861524606 | 374 |
| 646 | 3300003203 | JGI25406J46586_10004614 | JGI25406J46586_100046144 | 375 |
| 647 | 3300005327 | Ga0070658_10009930 | Ga0070658_100099303 | 375 |
| 648 | 3300005330 | Ga0070690_100033297 | Ga0070690_1000332972 | 375 |
| 649 | 3300005336 | Ga0070680_100003813 | Ga0070680_1000038136 | 375 |
| 650 | 3300005336 | Ga0070680_100182631 | Ga0070680_1001826311 | 375 |
| 651 | 3300005339 | Ga0070660_100022161 | Ga0070660_1000221614 | 375 |
| 652 | 3300005366 | Ga0070659_100001638 | Ga0070659_1000016387 | 375 |
| 653 | 3300005366 | Ga0070659_100039025 | Ga0070659_1000390252 | 375 |
| 654 | 3300005530 | Ga0070679_100009553 | Ga0070679_1000095537 | 375 |
| 655 | 3300005985 | Ga0081539_10000213 | Ga0081539_1000021322 | 375 |
| 656 | 3300005985 | Ga0081539_10027270 | Ga0081539_100272705 | 375 |
| 657 | 3300006051 | Ga0075364_10079214 | Ga0075364_100792142 | 375 |
| 658 | 3300006844 | Ga0075428_100059868 | Ga0075428_1000598682 | 375 |
| 659 | 3300006844 | Ga0075428_100300235 | Ga0075428_1003002351 | 375 |
| 660 | 3300006847 | Ga0075431_100189136 | Ga0075431_1001891362 | 375 |
| 661 | 3300006880 | Ga0075429_100283044 | Ga0075429_1002830442 | 375 |
| 662 | 3300020070 | Ga0206356_11585499 | Ga0206356_115854991 | 375 |
| 663 | 3300020077 | Ga0206351_11016986 | Ga0206351_110169862 | 375 |
| 664 | 3300020081 | Ga0206354_10329808 | Ga0206354_103298084 | 375 |
| 665 | 3300020081 | Ga0206354_10945499 | Ga0206354_109454991 | 375 |
| 666 | 3300020082 | Ga0206353_10378610 | Ga0206353_103786107 | 375 |
| 667 | 3300020082 | Ga0206353_11220165 | Ga0206353_112201652 | 375 |
| 668 | 3300022467 | Ga0224712_10000779 | Ga0224712_100007793 | 375 |
| 669 | 3300022467 | Ga0224712_10083263 | Ga0224712_100832631 | 375 |
| 670 | 3300025904 | Ga0207647_10066059 | Ga0207647_100660592 | 375 |
| 671 | 3300025912 | Ga0207707_10000831 | Ga0207707_1000083121 | 375 |
| 672 | 3300025914 | Ga0207671_10104769 | Ga0207671_101047692 | 375 |
| 673 | 3300025917 | Ga0207660_10010403 | Ga0207660_100104033 | 375 |
| 674 | 3300025917 | Ga0207660_10116690 | Ga0207660_101166902 | 375 |
| 675 | 3300025919 | Ga0207657_10020177 | Ga0207657_100201772 | 375 |
| 676 | 3300025932 | Ga0207690_10000189 | Ga0207690_1000018940 | 375 |
| 677 | 3300025932 | Ga0207690_10024372 | Ga0207690_100243722 | 375 |
| 678 | 3300025945 | Ga0207679_10271579 | Ga0207679_102715791 | 375 |
| 679 | 3300028379 | Ga0268266_10343666 | Ga0268266_103436662 | 375 |
| 680 | 3300028786 | Ga0307517_10078602 | Ga0307517_100786023 | 375 |
| 681 | 3300028794 | Ga0307515_10000668 | Ga0307515_1000066844 | 375 |
| 682 | 3300028794 | Ga0307515_10002310 | Ga0307515_1000231033 | 375 |
| 683 | 3300028794 | Ga0307515_10052102 | Ga0307515_100521024 | 375 |
| 684 | 3300028794 | Ga0307515_10142854 | Ga0307515_101428542 | 375 |
| 685 | 3300028800 | Ga0265338_10003387 | Ga0265338_1000338711 | 375 |
| 686 | 3300030522 | Ga0307512_10001051 | Ga0307512_1000105124 | 375 |
| 687 | 3300031241 | Ga0265325_10000147 | Ga0265325_1000014745 | 375 |
| 688 | 3300031247 | Ga0265340_10001511 | Ga0265340_100015116 | 375 |
| 689 | 3300031249 | Ga0265339_10008228 | Ga0265339_100082282 | 375 |
| 690 | 3300031456 | Ga0307513_10007756 | Ga0307513_1000775612 | 375 |
| 691 | 3300031507 | Ga0307509_10110655 | Ga0307509_101106553 | 375 |
| 692 | 3300031616 | Ga0307508_10057552 | Ga0307508_100575522 | 375 |
| 693 | 3300031730 | Ga0307516_10000909 | Ga0307516_100009098 | 375 |
| 694 | 3300031730 | Ga0307516_10018087 | Ga0307516_100180873 | 375 |
| 695 | 3300031730 | Ga0307516_10021159 | Ga0307516_100211593 | 375 |
| 696 | 3300031730 | Ga0307516_10112781 | Ga0307516_101127813 | 375 |
| 697 | 3300041512 | Ga0451853_2391966 | Ga0451853_2391966_33_1178 | 375 |
| 698 | iso_pu_bacteria | 2887478801 | 2887484016 | 375 |
| 699 | iso_pu_bacteria | 8001781756 | 8001783763 | 375 |
| 700 | iso_pu_bacteria | 8001781756 | 8001784883 | 375 |
| 701 | 3300005327 | Ga0070658_10003470 | Ga0070658_100034709 | 376 |
| 702 | 3300005329 | Ga0070683_100087942 | Ga0070683_1000879423 | 376 |
| 703 | 3300005336 | Ga0070680_100068565 | Ga0070680_1000685651 | 376 |
| 704 | 3300005338 | Ga0068868_100221969 | Ga0068868_1002219691 | 376 |
| 705 | 3300005344 | Ga0070661_100241375 | Ga0070661_1002413751 | 376 |
| 706 | 3300005347 | Ga0070668_100013693 | Ga0070668_1000136933 | 376 |
| 707 | 3300005436 | Ga0070713_100142731 | Ga0070713_1001427312 | 376 |
| 708 | 3300005458 | Ga0070681_10053546 | Ga0070681_100535463 | 376 |
| 709 | 3300005530 | Ga0070679_100086963 | Ga0070679_1000869632 | 376 |
| 710 | 3300005535 | Ga0070684_100033699 | Ga0070684_1000336994 | 376 |
| 711 | 3300005563 | Ga0068855_100386873 | Ga0068855_1003868732 | 376 |
| 712 | 3300005577 | Ga0068857_100019231 | Ga0068857_1000192315 | 376 |
| 713 | 3300005618 | Ga0068864_100022577 | Ga0068864_1000225775 | 376 |
| 714 | 3300005841 | Ga0068863_100055511 | Ga0068863_1000555112 | 376 |
| 715 | 3300005842 | Ga0068858_100000013 | Ga0068858_100000013193 | 376 |
| 716 | 3300005842 | Ga0068858_100000337 | Ga0068858_10000033745 | 376 |
| 717 | 3300005842 | Ga0068858_100154807 | Ga0068858_1001548073 | 376 |
| 718 | 3300005983 | Ga0081540_1002226 | Ga0081540_10022268 | 376 |
| 719 | 3300005983 | Ga0081540_1003289 | Ga0081540_10032892 | 376 |
| 720 | 3300005985 | Ga0081539_10002741 | Ga0081539_100027419 | 376 |
| 721 | 3300006844 | Ga0075428_100001119 | Ga0075428_10000111921 | 376 |
| 722 | 3300006844 | Ga0075428_100024241 | Ga0075428_1000242412 | 376 |
| 723 | 3300006846 | Ga0075430_100030199 | Ga0075430_1000301994 | 376 |
| 724 | 3300006846 | Ga0075430_100032748 | Ga0075430_1000327484 | 376 |
| 725 | 3300006847 | Ga0075431_100018040 | Ga0075431_1000180403 | 376 |
| 726 | 3300006847 | Ga0075431_100047815 | Ga0075431_1000478154 | 376 |
| 727 | 3300006880 | Ga0075429_100019498 | Ga0075429_1000194985 | 376 |
| 728 | 3300006880 | Ga0075429_100087546 | Ga0075429_1000875463 | 376 |
| 729 | 3300014968 | Ga0157379_10000006 | Ga0157379_1000000670 | 376 |
| 730 | 3300020069 | Ga0197907_10792685 | Ga0197907_107926852 | 376 |
| 731 | 3300020070 | Ga0206356_11080813 | Ga0206356_110808131 | 376 |
| 732 | 3300020082 | Ga0206353_10178569 | Ga0206353_101785693 | 376 |
| 733 | 3300025900 | Ga0207710_10000017 | Ga0207710_10000017258 | 376 |
| 734 | 3300025900 | Ga0207710_10000062 | Ga0207710_1000006257 | 376 |
| 735 | 3300025909 | Ga0207705_10139447 | Ga0207705_101394472 | 376 |
| 736 | 3300025909 | Ga0207705_10220573 | Ga0207705_102205731 | 376 |
| 737 | 3300025912 | Ga0207707_10079236 | Ga0207707_100792363 | 376 |
| 738 | 3300025915 | Ga0207693_10053781 | Ga0207693_100537813 | 376 |
| 739 | 3300025919 | Ga0207657_10014063 | Ga0207657_100140634 | 376 |
| 740 | 3300025920 | Ga0207649_10051801 | Ga0207649_100518012 | 376 |
| 741 | 3300025921 | Ga0207652_10085358 | Ga0207652_100853582 | 376 |
| 742 | 3300025928 | Ga0207700_10157573 | Ga0207700_101575731 | 376 |
| 743 | 3300025929 | Ga0207664_10262355 | Ga0207664_102623551 | 376 |
| 744 | 3300025941 | Ga0207711_10044426 | Ga0207711_100444262 | 376 |
| 745 | 3300025941 | Ga0207711_10112432 | Ga0207711_101124321 | 376 |
| 746 | 3300025944 | Ga0207661_10024922 | Ga0207661_100249222 | 376 |
| 747 | 3300025972 | Ga0207668_10005044 | Ga0207668_100050443 | 376 |
| 748 | 3300026035 | Ga0207703_10000006 | Ga0207703_1000000678 | 376 |
| 749 | 3300026035 | Ga0207703_10000009 | Ga0207703_10000009191 | 376 |
| 750 | 3300026088 | Ga0207641_10144458 | Ga0207641_101444582 | 376 |
| 751 | 3300026095 | Ga0207676_10010572 | Ga0207676_100105722 | 376 |
| 752 | 3300026095 | Ga0207676_10022346 | Ga0207676_100223462 | 376 |
| 753 | 3300026116 | Ga0207674_10033285 | Ga0207674_100332855 | 376 |
| 754 | 3300026116 | Ga0207674_10264051 | Ga0207674_102640512 | 376 |
| 755 | 3300026121 | Ga0207683_10068473 | Ga0207683_100684732 | 376 |
| 756 | 3300030522 | Ga0307512_10056605 | Ga0307512_100566052 | 376 |
| 757 | 3300031507 | Ga0307509_10029457 | Ga0307509_100294572 | 376 |
| 758 | 3300031616 | Ga0307508_10001073 | Ga0307508_100010739 | 376 |
| 759 | 3300031731 | Ga0307405_10012062 | Ga0307405_100120622 | 376 |
| 760 | 3300031824 | Ga0307413_10066592 | Ga0307413_100665922 | 376 |
| 761 | 3300031901 | Ga0307406_10048881 | Ga0307406_100488812 | 376 |
| 762 | 3300031903 | Ga0307407_10059388 | Ga0307407_100593882 | 376 |
| 763 | 3300031911 | Ga0307412_10038615 | Ga0307412_100386152 | 376 |
| 764 | 3300032002 | Ga0307416_100014053 | Ga0307416_1000140534 | 376 |
| 765 | 3300032126 | Ga0307415_100000137 | Ga0307415_10000013724 | 376 |
| 766 | 3300032126 | Ga0307415_100077547 | Ga0307415_1000775472 | 376 |
| 767 | 3300032126 | Ga0307415_100150007 | Ga0307415_1001500072 | 376 |
| 768 | 3300033179 | Ga0307507_10075995 | Ga0307507_100759953 | 376 |
| 769 | 3300046459 | Ga0495629_0163313 | Ga0495629_0163313_327_1496 | 376 |
| 770 | 3300049581 | Ga0501047_0015438 | Ga0501047_0015438_5346_6500 | 376 |
| 771 | 3300005434 | Ga0070709_10004634 | Ga0070709_100046342 | 377 |
| 772 | 3300005435 | Ga0070714_100002785 | Ga0070714_1000027855 | 377 |
| 773 | 3300005435 | Ga0070714_100053543 | Ga0070714_1000535432 | 377 |
| 774 | 3300005436 | Ga0070713_100177256 | Ga0070713_1001772562 | 377 |
| 775 | 3300005437 | Ga0070710_10004969 | Ga0070710_100049695 | 377 |
| 776 | 3300005437 | Ga0070710_10013610 | Ga0070710_100136102 | 377 |
| 777 | 3300005437 | Ga0070710_10015852 | Ga0070710_100158522 | 377 |
| 778 | 3300005439 | Ga0070711_100013224 | Ga0070711_1000132242 | 377 |
| 779 | 3300005445 | Ga0070708_100038743 | Ga0070708_1000387433 | 377 |
| 780 | 3300005445 | Ga0070708_100215491 | Ga0070708_1002154912 | 377 |
| 781 | 3300005456 | Ga0070678_100267617 | Ga0070678_1002676171 | 377 |
| 782 | 3300005458 | Ga0070681_10166530 | Ga0070681_101665302 | 377 |
| 783 | 3300005467 | Ga0070706_100001029 | Ga0070706_10000102913 | 377 |
| 784 | 3300005467 | Ga0070706_100001929 | Ga0070706_1000019293 | 377 |
| 785 | 3300005467 | Ga0070706_100007327 | Ga0070706_1000073275 | 377 |
| 786 | 3300005467 | Ga0070706_100419422 | Ga0070706_1004194221 | 377 |
| 787 | 3300005468 | Ga0070707_100000401 | Ga0070707_10000040139 | 377 |
| 788 | 3300005468 | Ga0070707_100005223 | Ga0070707_1000052233 | 377 |
| 789 | 3300005468 | Ga0070707_100008725 | Ga0070707_1000087252 | 377 |
| 790 | 3300005468 | Ga0070707_100063475 | Ga0070707_1000634753 | 377 |
| 791 | 3300005471 | Ga0070698_100000080 | Ga0070698_10000008039 | 377 |
| 792 | 3300005471 | Ga0070698_100000923 | Ga0070698_10000092315 | 377 |
| 793 | 3300005471 | Ga0070698_100007681 | Ga0070698_1000076817 | 377 |
| 794 | 3300005471 | Ga0070698_100020077 | Ga0070698_1000200774 | 377 |
| 795 | 3300005471 | Ga0070698_100026316 | Ga0070698_1000263163 | 377 |
| 796 | 3300005471 | Ga0070698_100035301 | Ga0070698_1000353012 | 377 |
| 797 | 3300005471 | Ga0070698_100125068 | Ga0070698_1001250682 | 377 |
| 798 | 3300005518 | Ga0070699_100347768 | Ga0070699_1003477681 | 377 |
| 799 | 3300005535 | Ga0070684_100167150 | Ga0070684_1001671502 | 377 |
| 800 | 3300005546 | Ga0070696_100066308 | Ga0070696_1000663082 | 377 |
| 801 | 3300005563 | Ga0068855_100075065 | Ga0068855_1000750653 | 377 |
| 802 | 3300005614 | Ga0068856_100015360 | Ga0068856_1000153602 | 377 |
| 803 | 3300005841 | Ga0068863_100121010 | Ga0068863_1001210103 | 377 |
| 804 | 3300005983 | Ga0081540_1007479 | Ga0081540_10074795 | 377 |
| 805 | 3300006028 | Ga0070717_10003011 | Ga0070717_100030113 | 377 |
| 806 | 3300006028 | Ga0070717_10011738 | Ga0070717_100117382 | 377 |
| 807 | 3300006173 | Ga0070716_100005898 | Ga0070716_1000058985 | 377 |
| 808 | 3300006175 | Ga0070712_100056772 | Ga0070712_1000567722 | 377 |
| 809 | 3300006175 | Ga0070712_100061032 | Ga0070712_1000610322 | 377 |
| 810 | 3300006844 | Ga0075428_100241040 | Ga0075428_1002410402 | 377 |
| 811 | 3300006846 | Ga0075430_100003247 | Ga0075430_10000324711 | 377 |
| 812 | 3300007076 | Ga0075435_100001372 | Ga0075435_1000013722 | 377 |
| 813 | 3300007076 | Ga0075435_100043180 | Ga0075435_1000431803 | 377 |
| 814 | 3300009177 | Ga0105248_10109486 | Ga0105248_101094863 | 377 |
| 815 | 3300013105 | Ga0157369_10318845 | Ga0157369_103188452 | 377 |
| 816 | 3300020069 | Ga0197907_10115527 | Ga0197907_101155272 | 377 |
| 817 | 3300020070 | Ga0206356_10284254 | Ga0206356_102842542 | 377 |
| 818 | 3300022467 | Ga0224712_10028877 | Ga0224712_100288772 | 377 |
| 819 | 3300022467 | Ga0224712_10049097 | Ga0224712_100490971 | 377 |
| 820 | 3300025898 | Ga0207692_10004000 | Ga0207692_100040005 | 377 |
| 821 | 3300025898 | Ga0207692_10007720 | Ga0207692_100077203 | 377 |
| 822 | 3300025906 | Ga0207699_10030097 | Ga0207699_100300973 | 377 |
| 823 | 3300025906 | Ga0207699_10075186 | Ga0207699_100751862 | 377 |
| 824 | 3300025910 | Ga0207684_10004433 | Ga0207684_1000443310 | 377 |
| 825 | 3300025910 | Ga0207684_10006577 | Ga0207684_100065774 | 377 |
| 826 | 3300025910 | Ga0207684_10017472 | Ga0207684_100174723 | 377 |
| 827 | 3300025910 | Ga0207684_10046467 | Ga0207684_100464671 | 377 |
| 828 | 3300025910 | Ga0207684_10257802 | Ga0207684_102578021 | 377 |
| 829 | 3300025915 | Ga0207693_10009698 | Ga0207693_100096982 | 377 |
| 830 | 3300025915 | Ga0207693_10022281 | Ga0207693_100222812 | 377 |
| 831 | 3300025915 | Ga0207693_10049686 | Ga0207693_100496862 | 377 |
| 832 | 3300025916 | Ga0207663_10002199 | Ga0207663_100021995 | 377 |
| 833 | 3300025916 | Ga0207663_10012258 | Ga0207663_100122582 | 377 |
| 834 | 3300025916 | Ga0207663_10115691 | Ga0207663_101156912 | 377 |
| 835 | 3300025921 | Ga0207652_10113643 | Ga0207652_101136432 | 377 |
| 836 | 3300025922 | Ga0207646_10000589 | Ga0207646_100005893 | 377 |
| 837 | 3300025922 | Ga0207646_10000691 | Ga0207646_1000069138 | 377 |
| 838 | 3300025922 | Ga0207646_10010303 | Ga0207646_100103036 | 377 |
| 839 | 3300025922 | Ga0207646_10201062 | Ga0207646_102010621 | 377 |
| 840 | 3300025927 | Ga0207687_10047620 | Ga0207687_100476202 | 377 |
| 841 | 3300025928 | Ga0207700_10018326 | Ga0207700_100183263 | 377 |
| 842 | 3300025928 | Ga0207700_10024035 | Ga0207700_100240352 | 377 |
| 843 | 3300025929 | Ga0207664_10015282 | Ga0207664_100152824 | 377 |
| 844 | 3300025929 | Ga0207664_10022658 | Ga0207664_100226582 | 377 |
| 845 | 3300025929 | Ga0207664_10248924 | Ga0207664_102489241 | 377 |
| 846 | 3300025939 | Ga0207665_10005099 | Ga0207665_100050995 | 377 |
| 847 | 3300025939 | Ga0207665_10007526 | Ga0207665_100075262 | 377 |
| 848 | 3300025944 | Ga0207661_10028998 | Ga0207661_100289983 | 377 |
| 849 | 3300026023 | Ga0207677_10213095 | Ga0207677_102130952 | 377 |
| 850 | 3300026116 | Ga0207674_10101680 | Ga0207674_101016802 | 377 |
| 851 | 3300026121 | Ga0207683_10198412 | Ga0207683_101984122 | 377 |
| 852 | 3300028794 | Ga0307515_10075893 | Ga0307515_100758933 | 377 |
| 853 | 3300031616 | Ga0307508_10100251 | Ga0307508_101002512 | 377 |
| 854 | 3300035111 | Ga0373923_0027720 | Ga0373923_0027720_238_1389 | 377 |
| 855 | 3300035117 | Ga0373953_0019143 | Ga0373953_0019143_1000_2151 | 377 |
| 856 | 3300035118 | Ga0373954_0004734 | Ga0373954_0004734_849_2000 | 377 |
| 857 | 3300035119 | Ga0373956_0019106 | Ga0373956_0019106_673_1824 | 377 |
| 858 | 3300035170 | Ga0373943_0053483 | Ga0373943_0053483_38_1174 | 377 |
| 859 | 3300035172 | Ga0373955_0009396 | Ga0373955_0009396_3079_4230 | 377 |
| 860 | 3300035692 | Ga0373935_0003522 | Ga0373935_0003522_546_1682 | 377 |
| 861 | 3300035724 | Ga0373933_0011863 | Ga0373933_0011863_1137_2288 | 377 |
| 862 | 3300035725 | Ga0373947_0141135 | Ga0373947_0141135_163_1314 | 377 |
| 863 | 3300037853 | Ga0436364_0149270 | Ga0436364_0149270_1199_2350 | 377 |
| 864 | 3300044694 | Ga0466963_0058706 | Ga0466963_0058706_665_1807 | 377 |
| 865 | 3300045836 | Ga0466958_0078079 | Ga0466958_0078079_467_1609 | 377 |
| 866 | 3300046454 | Ga0495592_0043869 | Ga0495592_0043869_506_1642 | 377 |
| 867 | 3300046459 | Ga0495629_0001359 | Ga0495629_0001359_7142_8278 | 377 |
| 868 | 3300046461 | Ga0495641_0007998 | Ga0495641_0007998_3978_5114 | 377 |
| 869 | 3300046462 | Ga0495651_0194711 | Ga0495651_0194711_193_1344 | 377 |
| 870 | 3300046463 | Ga0495653_0012324 | Ga0495653_0012324_1634_2785 | 377 |
| 871 | 3300046463 | Ga0495653_0070691 | Ga0495653_0070691_506_1642 | 377 |
| 872 | 3300046473 | Ga0495582_0027792 | Ga0495582_0027792_1686_2822 | 377 |
| 873 | 3300046475 | Ga0495639_0002648 | Ga0495639_0002648_2852_3988 | 377 |
| 874 | 3300046476 | Ga0495662_0027650 | Ga0495662_0027650_970_2106 | 377 |
| 875 | 3300046477 | Ga0495664_0109916 | Ga0495664_0109916_38_1174 | 377 |
| 876 | 3300046511 | Ga0495608_0026238 | Ga0495608_0026238_1537_2673 | 377 |
| 877 | 3300046514 | Ga0495618_0014608 | Ga0495618_0014608_296_1432 | 377 |
| 878 | 3300046516 | Ga0495628_0040356 | Ga0495628_0040356_2498_3649 | 377 |
| 879 | 3300046517 | Ga0495630_0029186 | Ga0495630_0029186_800_1936 | 377 |
| 880 | 3300046526 | Ga0495666_0051119 | Ga0495666_0051119_401_1537 | 377 |
| 881 | 3300046529 | Ga0495652_0093442 | Ga0495652_0093442_970_2106 | 377 |
| 882 | 3300046543 | Ga0495645_0024024 | Ga0495645_0024024_490_1626 | 377 |
| 883 | 3300046543 | Ga0495645_0056217 | Ga0495645_0056217_1042_2193 | 377 |
| 884 | 3300046642 | Ga0495634_0139587 | Ga0495634_0139587_109_1245 | 377 |
| 885 | 3300046663 | Ga0495635_0003562 | Ga0495635_0003562_5045_6196 | 377 |
| 886 | 3300046663 | Ga0495635_0031140 | Ga0495635_0031140_2206_3342 | 377 |
| 887 | 3300046678 | Ga0495599_0032847 | Ga0495599_0032847_399_1535 | 377 |
| 888 | 3300046678 | Ga0495599_0135054 | Ga0495599_0135054_147_1298 | 377 |
| 889 | 3300046680 | Ga0495646_0013096 | Ga0495646_0013096_4040_5191 | 377 |
| 890 | 3300046689 | Ga0495613_0006912 | Ga0495613_0006912_3609_4745 | 377 |
| 891 | 3300046690 | Ga0495624_0020763 | Ga0495624_0020763_2888_4024 | 377 |
| 892 | 3300046809 | Ga0495600_0002721 | Ga0495600_0002721_4193_5344 | 377 |
| 893 | 3300046809 | Ga0495600_0002960 | Ga0495600_0002960_516_1652 | 377 |
| 894 | 3300047317 | Ga0495604_0020691 | Ga0495604_0020691_256_1392 | 377 |
| 895 | 3300047317 | Ga0495604_0088120 | Ga0495604_0088120_1111_2262 | 377 |
| 896 | 3300047319 | Ga0495674_0086075 | Ga0495674_0086075_1312_2463 | 377 |
| 897 | 3300047322 | Ga0495680_0048041 | Ga0495680_0048041_1349_2500 | 377 |
| 898 | 3300047444 | Ga0495675_0001732 | Ga0495675_0001732_9024_10160 | 377 |
| 899 | 3300047471 | Ga0495684_0019055 | Ga0495684_0019055_463_1614 | 377 |
| 900 | 3300047471 | Ga0495684_0073597 | Ga0495684_0073597_970_2106 | 377 |
| 901 | 3300047673 | Ga0495593_0071433 | Ga0495593_0071433_378_1514 | 377 |
| 902 | 3300049581 | Ga0501047_0000170 | Ga0501047_0000170_37313_38452 | 377 |
| 903 | 3300053078 | Ga0495612_0008856 | Ga0495612_0008856_300_1436 | 377 |
| 904 | 3300053078 | Ga0495612_0044581 | Ga0495612_0044581_407_1558 | 377 |
| 905 | 3300053084 | Ga0495595_0007435 | Ga0495595_0007435_1944_3080 | 377 |
| 906 | 3300053085 | Ga0495619_0010728 | Ga0495619_0010728_3676_4812 | 377 |
| 907 | 3300053139 | Ga0500568_0012243 | Ga0500568_0012243_2569_3711 | 377 |
| 908 | 3300005327 | Ga0070658_10017982 | Ga0070658_100179823 | 378 |
| 909 | 3300005329 | Ga0070683_100018197 | Ga0070683_1000181974 | 378 |
| 910 | 3300005329 | Ga0070683_100044057 | Ga0070683_1000440573 | 378 |
| 911 | 3300005334 | Ga0068869_100015407 | Ga0068869_1000154072 | 378 |
| 912 | 3300005441 | Ga0070700_100013919 | Ga0070700_1000139194 | 378 |
| 913 | 3300005457 | Ga0070662_100182529 | Ga0070662_1001825291 | 378 |
| 914 | 3300005458 | Ga0070681_10199900 | Ga0070681_101999002 | 378 |
| 915 | 3300005535 | Ga0070684_100027727 | Ga0070684_1000277272 | 378 |
| 916 | 3300005535 | Ga0070684_100035706 | Ga0070684_1000357062 | 378 |
| 917 | 3300005577 | Ga0068857_100006962 | Ga0068857_1000069624 | 378 |
| 918 | 3300005616 | Ga0068852_100144517 | Ga0068852_1001445172 | 378 |
| 919 | 3300005844 | Ga0068862_100090901 | Ga0068862_1000909012 | 378 |
| 920 | 3300005985 | Ga0081539_10002986 | Ga0081539_100029864 | 378 |
| 921 | 3300005985 | Ga0081539_10012936 | Ga0081539_100129364 | 378 |
| 922 | 3300006847 | Ga0075431_100339620 | Ga0075431_1003396201 | 378 |
| 923 | 3300021384 | Ga0213876_10001920 | Ga0213876_100019208 | 378 |
| 924 | 3300025901 | Ga0207688_10080748 | Ga0207688_100807482 | 378 |
| 925 | 3300025909 | Ga0207705_10099474 | Ga0207705_100994742 | 378 |
| 926 | 3300025942 | Ga0207689_10017361 | Ga0207689_100173614 | 378 |
| 927 | 3300025944 | Ga0207661_10103845 | Ga0207661_101038451 | 378 |
| 928 | 3300025945 | Ga0207679_10032798 | Ga0207679_100327982 | 378 |
| 929 | 3300026067 | Ga0207678_10010176 | Ga0207678_100101765 | 378 |
| 930 | 3300026075 | Ga0207708_10003131 | Ga0207708_100031315 | 378 |
| 931 | 3300026116 | Ga0207674_10009912 | Ga0207674_100099126 | 378 |
| 932 | 3300031240 | Ga0265320_10005227 | Ga0265320_100052274 | 378 |
| 933 | 3300031344 | Ga0265316_10060639 | Ga0265316_100606392 | 378 |
| 934 | 3300031548 | Ga0307408_100125412 | Ga0307408_1001254122 | 378 |
| 935 | 3300031649 | Ga0307514_10057500 | Ga0307514_100575002 | 378 |
| 936 | 3300031711 | Ga0265314_10013888 | Ga0265314_100138883 | 378 |
| 937 | 3300031852 | Ga0307410_10030743 | Ga0307410_100307432 | 378 |
| 938 | 3300031889 | Ga0326468_10000415 | Ga0326468_100004153 | 378 |
| 939 | 3300031901 | Ga0307406_10031194 | Ga0307406_100311943 | 378 |
| 940 | 3300031901 | Ga0307406_10040262 | Ga0307406_100402622 | 378 |
| 941 | 3300031995 | Ga0307409_100015923 | Ga0307409_1000159232 | 378 |
| 942 | 3300031995 | Ga0307409_100021071 | Ga0307409_1000210713 | 378 |
| 943 | 3300031995 | Ga0307409_100132310 | Ga0307409_1001323102 | 378 |
| 944 | 3300032002 | Ga0307416_100032279 | Ga0307416_1000322793 | 378 |
| 945 | 3300032002 | Ga0307416_100303777 | Ga0307416_1003037772 | 378 |
| 946 | 3300032126 | Ga0307415_100017053 | Ga0307415_1000170532 | 378 |
| 947 | 3300032126 | Ga0307415_100063093 | Ga0307415_1000630932 | 378 |
| 948 | 3300032126 | Ga0307415_100259497 | Ga0307415_1002594971 | 378 |
| 949 | 3300046507 | Ga0495606_0001302 | Ga0495606_0001302_29295_30452 | 378 |
| 950 | 3300046616 | Ga0495668_0000182 | Ga0495668_0000182_49938_51095 | 378 |
| 951 | 3300046660 | Ga0495625_0001990 | Ga0495625_0001990_12434_13591 | 378 |
| 952 | 3300048091 | Ga0495626_0000286 | Ga0495626_0000286_26281_27438 | 378 |
| 953 | 3300048915 | Ga0496112_0015264 | Ga0496112_0015264_1196_2401 | 378 |
| 954 | 3300005467 | Ga0070706_100040802 | Ga0070706_1000408023 | 379 |
| 955 | 3300005471 | Ga0070698_100000919 | Ga0070698_1000009197 | 379 |
| 956 | 3300031824 | Ga0307413_10070336 | Ga0307413_100703362 | 379 |
| 957 | 3300002459 | JGI24751J29686_10002018 | JGI24751J29686_100020181 | 380 |
| 958 | 3300005335 | Ga0070666_10058171 | Ga0070666_100581713 | 380 |
| 959 | 3300005337 | Ga0070682_100006794 | Ga0070682_1000067946 | 380 |
| 960 | 3300005338 | Ga0068868_100142844 | Ga0068868_1001428442 | 380 |
| 961 | 3300005339 | Ga0070660_100061951 | Ga0070660_1000619513 | 380 |
| 962 | 3300005341 | Ga0070691_10006356 | Ga0070691_100063562 | 380 |
| 963 | 3300005354 | Ga0070675_100135349 | Ga0070675_1001353492 | 380 |
| 964 | 3300005355 | Ga0070671_100002204 | Ga0070671_1000022046 | 380 |
| 965 | 3300005364 | Ga0070673_100156302 | Ga0070673_1001563022 | 380 |
| 966 | 3300005455 | Ga0070663_100003873 | Ga0070663_1000038734 | 380 |
| 967 | 3300005456 | Ga0070678_100001742 | Ga0070678_1000017422 | 380 |
| 968 | 3300005543 | Ga0070672_100200979 | Ga0070672_1002009791 | 380 |
| 969 | 3300005547 | Ga0070693_100001537 | Ga0070693_1000015373 | 380 |
| 970 | 3300005615 | Ga0070702_100000711 | Ga0070702_1000007116 | 380 |
| 971 | 3300005834 | Ga0068851_10015915 | Ga0068851_100159151 | 380 |
| 972 | 3300005840 | Ga0068870_10000902 | Ga0068870_100009029 | 380 |
| 973 | 3300005843 | Ga0068860_100231992 | Ga0068860_1002319922 | 380 |
| 974 | 3300006028 | Ga0070717_10193787 | Ga0070717_101937871 | 380 |
| 975 | 3300006058 | Ga0075432_10002675 | Ga0075432_100026752 | 380 |
| 976 | 3300006844 | Ga0075428_100373660 | Ga0075428_1003736601 | 380 |
| 977 | 3300006847 | Ga0075431_100387872 | Ga0075431_1003878721 | 380 |
| 978 | 3300006852 | Ga0075433_10006006 | Ga0075433_100060065 | 380 |
| 979 | 3300006871 | Ga0075434_100007362 | Ga0075434_1000073626 | 380 |
| 980 | 3300006914 | Ga0075436_100043678 | Ga0075436_1000436782 | 380 |
| 981 | 3300007076 | Ga0075435_100001745 | Ga0075435_1000017456 | 380 |
| 982 | 3300025898 | Ga0207692_10099768 | Ga0207692_100997681 | 380 |
| 983 | 3300025906 | Ga0207699_10029310 | Ga0207699_100293102 | 380 |
| 984 | 3300025906 | Ga0207699_10061872 | Ga0207699_100618721 | 380 |
| 985 | 3300025908 | Ga0207643_10000275 | Ga0207643_100002759 | 380 |
| 986 | 3300025909 | Ga0207705_10007287 | Ga0207705_100072873 | 380 |
| 987 | 3300025911 | Ga0207654_10024844 | Ga0207654_100248442 | 380 |
| 988 | 3300025912 | Ga0207707_10015846 | Ga0207707_100158462 | 380 |
| 989 | 3300025917 | Ga0207660_10114500 | Ga0207660_101145002 | 380 |
| 990 | 3300025919 | Ga0207657_10032462 | Ga0207657_100324624 | 380 |
| 991 | 3300025920 | Ga0207649_10005696 | Ga0207649_100056964 | 380 |
| 992 | 3300025921 | Ga0207652_10046759 | Ga0207652_100467591 | 380 |
| 993 | 3300025925 | Ga0207650_10001561 | Ga0207650_100015612 | 380 |
| 994 | 3300025926 | Ga0207659_10002333 | Ga0207659_100023335 | 380 |
| 995 | 3300025928 | Ga0207700_10020783 | Ga0207700_100207832 | 380 |
| 996 | 3300025928 | Ga0207700_10049010 | Ga0207700_100490102 | 380 |
| 997 | 3300025929 | Ga0207664_10071983 | Ga0207664_100719832 | 380 |
| 998 | 3300025933 | Ga0207706_10050008 | Ga0207706_100500084 | 380 |
| 999 | 3300025940 | Ga0207691_10113017 | Ga0207691_101130171 | 380 |
| 1000 | 3300025942 | Ga0207689_10001392 | Ga0207689_1000139216 | 380 |
| 1001 | 3300025944 | Ga0207661_10001624 | Ga0207661_100016245 | 380 |
| 1002 | 3300025945 | Ga0207679_10000388 | Ga0207679_1000038810 | 380 |
| 1003 | 3300026023 | Ga0207677_10001030 | Ga0207677_100010302 | 380 |
| 1004 | 3300026067 | Ga0207678_10002799 | Ga0207678_100027997 | 380 |
| 1005 | 3300026078 | Ga0207702_10001952 | Ga0207702_1000195210 | 380 |
| 1006 | 3300026078 | Ga0207702_10010057 | Ga0207702_100100575 | 380 |
| 1007 | 3300026078 | Ga0207702_10020010 | Ga0207702_100200102 | 380 |
| 1008 | 3300026095 | Ga0207676_10000955 | Ga0207676_1000095515 | 380 |
| 1009 | 3300026116 | Ga0207674_10023553 | Ga0207674_100235533 | 380 |
| 1010 | 3300026121 | Ga0207683_10002054 | Ga0207683_100020549 | 380 |
| 1011 | 3300027907 | Ga0207428_10006365 | Ga0207428_1000636510 | 380 |
| 1012 | 3300028666 | Ga0265336_10010667 | Ga0265336_100106672 | 380 |
| 1013 | 3300028800 | Ga0265338_10023839 | Ga0265338_100238393 | 380 |
| 1014 | 3300031727 | Ga0316576_10008132 | Ga0316576_100081323 | 380 |
| 1015 | 3300031728 | Ga0316578_10103644 | Ga0316578_101036442 | 380 |
| 1016 | 3300035398 | Ga0316574_0032463 | Ga0316574_0032463_836_1996 | 380 |
| 1017 | 3300036712 | Ga0316584_0057010 | Ga0316584_0057010_634_1794 | 380 |
| 1018 | 3300048911 | Ga0496108_0089230 | Ga0496108_0089230_230_1375 | 380 |
| 1019 | 3300049574 | Ga0501038_0036197 | Ga0501038_0036197_2961_4109 | 380 |
| 1020 | 3300049581 | Ga0501047_0316401 | Ga0501047_0316401_37_1185 | 380 |
| 1021 | 3300049590 | Ga0501074_0029042 | Ga0501074_0029042_2066_3214 | 380 |
| 1022 | 3300049823 | Ga0501044_0177348 | Ga0501044_0177348_759_1907 | 380 |
| 1023 | 3300050510 | nmdc:mga06r32_162431_c1 | nmdc:mga06r32_162431_c1_564_1712 | 380 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i45-assembly1.cif.gz_A | 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. | 0.8304 | 175 | 358 |
| 5d00-assembly1.cif.gz_A | crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate and ump | 0.8141 | 4 | 375 |
| 3c4q-assembly1.cif.gz_A | structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp | 0.8133 | 7 | 377 |
| 5d01-assembly1.cif.gz_B | crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate | 0.8128 | 4 | 375 |
| 5d01-assembly1.cif.gz_A | crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate | 0.8126 | 4 | 374 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMZ1_187_386_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8896 | 192 | 374 | 3.40.50.2000 |
| 3okaA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8886 | 177 | 357 | 3.40.50.2000 |
| af_Q59002_191_368_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8851 | 185 | 358 | 3.40.50.2000 |
| af_P9WMZ3_200_365_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8804 | 204 | 358 | 3.40.50.2000 |
| af_P9WMY7_260_428_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8636 | 200 | 359 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5XD62-F1-model_v4 | Glycosyltransferase | 0.925 | 7 | 380 |
GO:0009103
GO:0016757 GO:0045226 |
| AF-A0A3A9SMX4-F1-model_v4 | Glycosyltransferase family 1 protein | 0.919 | 7 | 376 |
GO:0009103
GO:0016757 GO:0045226 |
| AF-A0A0S8DN91-F1-model_v4 | Glycosyl transferase family 1 domain-containing protein | 0.9181 | 4 | 376 |
GO:0009103
GO:0016757 GO:0045226 |
| AF-A0A7W1FA95-F1-model_v4 | Glycosyltransferase family 4 protein | 0.9171 | 6 | 376 |
GO:0009103
GO:0016757 GO:0045226 |
| AF-A0A136P3K8-F1-model_v4 | deleted | 0.9158 | 56 | 372 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar