F488374

General Info

Members Datasets Scaffolds Average Seq Length
1020 424 1016 162

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0211714|Ga0495650_0211714_20_616
Length 198
Sequence MYTKKALQPVVCCVEPHFAMRAQRTESGNTFEDARMADSDTHFASSEGTRWKHDGVRVVTGDRLDPNTAQTPGMDRKAAIDFARVGAQKLWAGTVHIHPDAKTGAHHHGPLESVIYVVKGRARMRWGEKLEFTAEAGPGDFIYVPPFVPHQEINASPTEVLECVLVRSDGQAIAVNLDIEPVEPPEDVRWIDPTHPEG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2791355199
3 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
4 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
256 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
257 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
275 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
276 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
277 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
278 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
279 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
286 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
405 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
406 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
407 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
410 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
414 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
415 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
416 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
417 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
418 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
419 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
420 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.63
Nodule 0.2
Rhizoplane 6.57
Rhizosphere 80.59
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1010479 3300002126 Bacteria 922
2 JGI25156J39149_1000441 3300002705 Bacteria 25512
3 JGI25156J39149_1009487 3300002705 Bacteria 2358
4 JGI25154J39366_1001707 3300002738 Bacteria 7190
5 JGI25157J39369_1000029 3300002741 Bacteria 146928
6 JGI25406J46586_10003368 3300003203 Bacteria 7528
7 Ga0055539_1000310 3300003752 Bacteria 25571
8 Ga0055533_1000010 3300003756 Bacteria 491196
9 Ga0055535_1010849 3300003761 Bacteria 1474
10 Ga0055530_10000090 3300003791 Bacteria 78168
11 Ga0055531_10011587 3300003794 Bacteria 4231
12 Ga0065712_10200379 3300005290 Bacteria 1111
13 Ga0065715_10111173 3300005293 Bacteria 2584
14 Ga0070658_10029468 3300005327 Bacteria 4409
15 Ga0070658_10098608 3300005327 Bacteria 2414
16 Ga0070658_10723216 3300005327 Bacteria 864
17 Ga0070676_10037404 3300005328 Bacteria 2799
18 Ga0070676_10254885 3300005328 Bacteria 1172
19 Ga0070676_10295820 3300005328 Bacteria 1096
20 Ga0070676_10655148 3300005328 Bacteria 762
21 Ga0070683_100012316 3300005329 Bacteria 7429
22 Ga0070683_100352552 3300005329 Bacteria 1401
23 Ga0070683_100404610 3300005329 Bacteria 1302
24 Ga0070690_100043087 3300005330 Bacteria 2861
25 Ga0070670_100001996 3300005331 Bacteria 16678
26 Ga0070670_100019051 3300005331 Bacteria 5885
27 Ga0070670_100317037 3300005331 Bacteria 1365
28 Ga0070670_100371798 3300005331 Bacteria 1258
29 Ga0070670_100499518 3300005331 Bacteria 1081
30 Ga0070670_101364923 3300005331 Bacteria 649
31 Ga0070677_10007631 3300005333 Bacteria 3619
32 Ga0070677_10035705 3300005333 Bacteria 1929
33 Ga0068869_100002609 3300005334 Bacteria 10881
34 Ga0068869_100050299 3300005334 Bacteria 3020
35 Ga0068869_100104367 3300005334 Bacteria 2148
36 Ga0068869_100240696 3300005334 Bacteria 1442
37 Ga0068869_101024787 3300005334 Bacteria 719
38 Ga0070666_10001744 3300005335 Bacteria 13267
39 Ga0070666_10067577 3300005335 Bacteria 2427
40 Ga0070680_100006496 3300005336 Bacteria 8895
41 Ga0070680_100006948 3300005336 Bacteria 8626
42 Ga0070682_100286063 3300005337 Bacteria 1204
43 Ga0068868_100050964 3300005338 Bacteria 3253
44 Ga0068868_100065715 3300005338 Bacteria 2882
45 Ga0068868_100563350 3300005338 Bacteria 1005
46 Ga0068868_100889774 3300005338 Bacteria 809
47 Ga0070660_100034252 3300005339 Bacteria 3835
48 Ga0070660_100066556 3300005339 Bacteria 2805
49 Ga0070660_100142089 3300005339 Bacteria 1926
50 Ga0070660_100208653 3300005339 Unclassified 1585
51 Ga0070660_100257459 3300005339 Bacteria 1424
52 Ga0070660_100383487 3300005339 Bacteria 1160
53 Ga0070660_100611554 3300005339 Bacteria 911
54 Ga0070689_100298032 3300005340 Bacteria 1341
55 Ga0070691_10006435 3300005341 Bacteria 5368
56 Ga0070687_100105042 3300005343 Bacteria 1589
57 Ga0070661_100076457 3300005344 Bacteria 2467
58 Ga0070661_100141353 3300005344 Bacteria 1814
59 Ga0070661_100497429 3300005344 Bacteria 975
60 Ga0070661_100743402 3300005344 Bacteria 802
61 Ga0070661_100832769 3300005344 Bacteria 758
62 Ga0070661_100844233 3300005344 Bacteria 753
63 Ga0070668_100001912 3300005347 Bacteria 15233
64 Ga0070668_100018414 3300005347 Bacteria 5243
65 Ga0070668_100130277 3300005347 Bacteria 2018
66 Ga0070669_100005334 3300005353 Bacteria 9281
67 Ga0070669_100017046 3300005353 Bacteria 5184
68 Ga0070669_100017767 3300005353 Bacteria 5075
69 Ga0070669_100664583 3300005353 Bacteria 877
70 Ga0070669_100750962 3300005353 Bacteria 827
71 Ga0070669_100877340 3300005353 Bacteria 765
72 Ga0070669_100956205 3300005353 Bacteria 733
73 Ga0070675_100005042 3300005354 Bacteria 10079
74 Ga0070675_100018417 3300005354 Bacteria 5557
75 Ga0070675_100034949 3300005354 Bacteria 4081
76 Ga0070675_100129939 3300005354 Bacteria 2146
77 Ga0070675_100194931 3300005354 Bacteria 1757
78 Ga0070675_100271144 3300005354 Bacteria 1489
79 Ga0070671_100011841 3300005355 Bacteria 7017
80 Ga0070671_100045432 3300005355 Bacteria 3651
81 Ga0070671_100092111 3300005355 Bacteria 2539
82 Ga0070671_100233877 3300005355 Bacteria 1560
83 Ga0070671_100332322 3300005355 Bacteria 1295
84 Ga0070671_100599977 3300005355 Bacteria 951
85 Ga0070671_100617343 3300005355 Bacteria 937
86 Ga0070671_100618580 3300005355 Bacteria 936
87 Ga0070671_100622389 3300005355 Bacteria 934
88 Ga0070671_100694395 3300005355 Bacteria 882
89 Ga0070674_100023639 3300005356 Bacteria 3980
90 Ga0070674_100065144 3300005356 Bacteria 2556
91 Ga0070674_100092494 3300005356 Bacteria 2186
92 Ga0070674_100748185 3300005356 Bacteria 840
93 Ga0070674_100836145 3300005356 Bacteria 797
94 Ga0070673_100029265 3300005364 Bacteria 4106
95 Ga0070673_100247511 3300005364 Bacteria 1552
96 Ga0070673_100376247 3300005364 Bacteria 1265
97 Ga0070673_100404315 3300005364 Bacteria 1221
98 Ga0070673_100500610 3300005364 Bacteria 1099
99 Ga0070673_100826492 3300005364 Bacteria 856
100 Ga0070688_100943877 3300005365 Bacteria 682
101 Ga0070659_100092787 3300005366 Bacteria 2421
102 Ga0070659_100104449 3300005366 Bacteria 2282
103 Ga0070659_100115723 3300005366 Bacteria 2167
104 Ga0070659_100164583 3300005366 Bacteria 1814
105 Ga0070659_100190091 3300005366 Bacteria 1687
106 Ga0070659_100645141 3300005366 Bacteria 912
107 Ga0070659_101041513 3300005366 Bacteria 719
108 Ga0070667_100013141 3300005367 Bacteria 6844
109 Ga0070667_100046171 3300005367 Bacteria 3663
110 Ga0070667_100197297 3300005367 Bacteria 1785
111 Ga0070667_100364933 3300005367 Bacteria 1309
112 Ga0070703_10004941 3300005406 Bacteria 3721
113 Ga0070714_100080128 3300005435 Bacteria 2841
114 Ga0070714_100208211 3300005435 Bacteria 1792
115 Ga0070714_101387840 3300005435 Bacteria 686
116 Ga0070701_10016708 3300005438 Bacteria 3418
117 Ga0070701_10873952 3300005438 Bacteria 619
118 Ga0070705_100000274 3300005440 Bacteria 31250
119 Ga0070700_100008253 3300005441 Bacteria 5670
120 Ga0070700_100230905 3300005441 Bacteria 1317
121 Ga0070694_100017655 3300005444 Bacteria 4510
122 Ga0070708_100207858 3300005445 Bacteria 1834
123 Ga0070708_100542613 3300005445 Bacteria 1097
124 Ga0070663_100008842 3300005455 Bacteria 6216
125 Ga0070663_100076689 3300005455 Bacteria 2445
126 Ga0070663_100094830 3300005455 Bacteria 2217
127 Ga0070663_100425029 3300005455 Bacteria 1090
128 Ga0070678_100024510 3300005456 Bacteria 4041
129 Ga0070678_100058487 3300005456 Bacteria 2829
130 Ga0070678_100114485 3300005456 Bacteria 2116
131 Ga0070678_100137173 3300005456 Bacteria 1952
132 Ga0070678_100301671 3300005456 Bacteria 1361
133 Ga0070678_100470944 3300005456 Bacteria 1104
134 Ga0070678_100626886 3300005456 Bacteria 962
135 Ga0070678_100629240 3300005456 Bacteria 961
136 Ga0070678_100637208 3300005456 Bacteria 955
137 Ga0070678_100702022 3300005456 Bacteria 911
138 Ga0070662_100042086 3300005457 Bacteria 3262
139 Ga0070662_100132740 3300005457 Bacteria 1922
140 Ga0070662_100650011 3300005457 Bacteria 889
141 Ga0070681_10074065 3300005458 Bacteria 3367
142 Ga0070681_10162733 3300005458 Bacteria 2155
143 Ga0068867_100017625 3300005459 Bacteria 5071
144 Ga0068867_100102645 3300005459 Bacteria 2186
145 Ga0068867_100133182 3300005459 Bacteria 1934
146 Ga0068867_100812925 3300005459 Bacteria 834
147 Ga0070706_100001589 3300005467 Bacteria 23687
148 Ga0070706_100115678 3300005467 Bacteria 2497
149 Ga0070707_100032827 3300005468 Bacteria 4946
150 Ga0070707_100115367 3300005468 Bacteria 2607
151 Ga0070698_100016443 3300005471 Bacteria 7806
152 Ga0070698_100095479 3300005471 Bacteria 2951
153 Ga0070699_100001895 3300005518 Bacteria 18874
154 Ga0070679_100005291 3300005530 Bacteria 11945
155 Ga0070679_100085996 3300005530 Bacteria 3131
156 Ga0070684_100020787 3300005535 Bacteria 5446
157 Ga0070684_100307910 3300005535 Bacteria 1454
158 Ga0070684_100684755 3300005535 Bacteria 955
159 Ga0070697_100083215 3300005536 Bacteria 2639
160 Ga0070697_100167989 3300005536 Bacteria 1856
161 Ga0068853_100000534 3300005539 Bacteria 25841
162 Ga0068853_100051167 3300005539 Bacteria 3555
163 Ga0068853_100089424 3300005539 Bacteria 2705
164 Ga0068853_100171601 3300005539 Bacteria 1962
165 Ga0068853_100353396 3300005539 Bacteria 1367
166 Ga0068853_100373643 3300005539 Bacteria 1330
167 Ga0068853_100782521 3300005539 Bacteria 913
168 Ga0070672_100000138 3300005543 Bacteria 38912
169 Ga0070672_100033366 3300005543 Bacteria 3898
170 Ga0070672_100044460 3300005543 Bacteria 3430
171 Ga0070672_100282598 3300005543 Bacteria 1403
172 Ga0070672_100781184 3300005543 Bacteria 839
173 Ga0070686_100189641 3300005544 Bacteria 1466
174 Ga0070686_100237719 3300005544 Bacteria 1325
175 Ga0070695_100009399 3300005545 Bacteria 5819
176 Ga0070696_100000144 3300005546 Bacteria 39344
177 Ga0070693_100335695 3300005547 Bacteria 1030
178 Ga0070693_100529227 3300005547 Bacteria 840
179 Ga0070665_100000015 3300005548 Bacteria 462744
180 Ga0070665_100095104 3300005548 Bacteria 2984
181 Ga0070665_100554362 3300005548 Bacteria 1162
182 Ga0070704_100001504 3300005549 Bacteria 12551
183 Ga0068855_100030535 3300005563 Bacteria 6444
184 Ga0068855_100160366 3300005563 Bacteria 2553
185 Ga0068855_100179051 3300005563 Bacteria 2398
186 Ga0068855_100209328 3300005563 Bacteria 2192
187 Ga0068855_100580577 3300005563 Bacteria 1211
188 Ga0070664_100020489 3300005564 Bacteria 5445
189 Ga0070664_100146650 3300005564 Bacteria 2081
190 Ga0070664_100392951 3300005564 Bacteria 1267
191 Ga0070664_101015478 3300005564 Bacteria 780
192 Ga0070664_101389635 3300005564 Bacteria 664
193 Ga0068857_100002542 3300005577 Bacteria 14936
194 Ga0068857_100075687 3300005577 Bacteria 3001
195 Ga0068857_100117657 3300005577 Bacteria 2391
196 Ga0068857_100514128 3300005577 Bacteria 1125
197 Ga0068857_100991210 3300005577 Bacteria 808
198 Ga0068854_100012169 3300005578 Bacteria 5630
199 Ga0068854_100060190 3300005578 Bacteria 2746
200 Ga0068854_100088278 3300005578 Bacteria 2302
201 Ga0068854_100146967 3300005578 Bacteria 1814
202 Ga0068854_100182664 3300005578 Bacteria 1639
203 Ga0068854_100301987 3300005578 Bacteria 1295
204 Ga0068854_100768018 3300005578 Bacteria 837
205 Ga0068856_100003174 3300005614 Bacteria 16729
206 Ga0068856_100021624 3300005614 Bacteria 6252
207 Ga0068856_100329386 3300005614 Bacteria 1545
208 Ga0068856_101089069 3300005614 Bacteria 816
209 Ga0070702_100385695 3300005615 Bacteria 998
210 Ga0068852_100094445 3300005616 Bacteria 2683
211 Ga0068852_100178858 3300005616 Bacteria 1993
212 Ga0068852_100201137 3300005616 Bacteria 1885
213 Ga0068852_100238240 3300005616 Bacteria 1737
214 Ga0068852_100541139 3300005616 Bacteria 1164
215 Ga0068852_100989743 3300005616 Bacteria 859
216 Ga0068852_101449339 3300005616 Bacteria 709
217 Ga0068859_100010211 3300005617 Bacteria 9449
218 Ga0068859_100567876 3300005617 Bacteria 1228
219 Ga0068859_101335082 3300005617 Bacteria 790
220 Ga0068864_100001915 3300005618 Bacteria 17082
221 Ga0068864_100005578 3300005618 Bacteria 10318
222 Ga0068864_100047489 3300005618 Bacteria 3688
223 Ga0068864_100062295 3300005618 Bacteria 3232
224 Ga0068864_100663254 3300005618 Bacteria 1016
225 Ga0068866_10005777 3300005718 Bacteria 5130
226 Ga0068866_10857448 3300005718 Bacteria 636
227 Ga0068861_100003183 3300005719 Bacteria 10860
228 Ga0068861_100072447 3300005719 Bacteria 2673
229 Ga0068861_100124412 3300005719 Bacteria 2085
230 Ga0068861_100200015 3300005719 Bacteria 1676
231 Ga0068861_100554935 3300005719 Bacteria 1047
232 Ga0068851_10102836 3300005834 Bacteria 1517
233 Ga0068851_10152401 3300005834 Bacteria 1264
234 Ga0068851_10327412 3300005834 Bacteria 886
235 Ga0068851_10391892 3300005834 Bacteria 816
236 Ga0068863_100011347 3300005841 Bacteria 8627
237 Ga0068863_100089212 3300005841 Bacteria 2923
238 Ga0068863_100389617 3300005841 Bacteria 1361
239 Ga0068863_100616797 3300005841 Bacteria 1074
240 Ga0068858_100159495 3300005842 Bacteria 2124
241 Ga0068858_101140953 3300005842 Bacteria 766
242 Ga0068860_100002707 3300005843 Bacteria 18439
243 Ga0068860_100267957 3300005843 Bacteria 1666
244 Ga0068862_100006297 3300005844 Bacteria 9873
245 Ga0068862_100033250 3300005844 Bacteria 4358
246 Ga0068862_100041742 3300005844 Bacteria 3904
247 Ga0068862_100154048 3300005844 Bacteria 2047
248 Ga0081538_10021290 3300005981 Bacteria 4738
249 Ga0081540_1035958 3300005983 Bacteria 2648
250 Ga0081539_10000617 3300005985 Bacteria 72003
251 Ga0070717_10028434 3300006028 Bacteria 4476
252 Ga0070717_10358474 3300006028 Bacteria 1305
253 Ga0075368_10077518 3300006042 Bacteria 1349
254 Ga0075368_10212506 3300006042 Bacteria 820
255 Ga0075363_100010223 3300006048 Bacteria 4442
256 Ga0075364_10048232 3300006051 Bacteria 2775
257 Ga0075364_10398089 3300006051 Bacteria 939
258 Ga0075364_11125140 3300006051 Bacteria 533
259 Ga0075432_10086362 3300006058 Bacteria 1143
260 Ga0070715_10013898 3300006163 Bacteria 2968
261 Ga0075362_10021552 3300006177 Bacteria 2706
262 Ga0075362_10069344 3300006177 Bacteria 1607
263 Ga0075362_10212690 3300006177 Bacteria 943
264 Ga0075367_10042370 3300006178 Bacteria 2663
265 Ga0075367_10139526 3300006178 Bacteria 1501
266 Ga0075369_10031758 3300006186 Bacteria 2231
267 Ga0075366_10008494 3300006195 Bacteria 5713
268 Ga0075366_10012080 3300006195 Bacteria 4890
269 Ga0075366_10040468 3300006195 Bacteria 2757
270 Ga0075366_10085820 3300006195 Bacteria 1883
271 Ga0075366_10161106 3300006195 Bacteria 1359
272 Ga0075366_10192843 3300006195 Bacteria 1238
273 Ga0075366_10220835 3300006195 Bacteria 1154
274 Ga0097621_100072627 3300006237 Bacteria 2846
275 Ga0097621_100105115 3300006237 Bacteria 2380
276 Ga0097621_100126855 3300006237 Bacteria 2168
277 Ga0097621_100229999 3300006237 Bacteria 1618
278 Ga0097621_100326286 3300006237 Bacteria 1360
279 Ga0097621_100603024 3300006237 Bacteria 1004
280 Ga0097621_101356393 3300006237 Bacteria 673
281 Ga0097621_101519783 3300006237 Bacteria 635
282 Ga0075370_10006621 3300006353 Bacteria 5840
283 Ga0075370_10006736 3300006353 Bacteria 5798
284 Ga0075370_10018502 3300006353 Bacteria 3781
285 Ga0075370_10084819 3300006353 Bacteria 1823
286 Ga0068871_100006827 3300006358 Bacteria 8119
287 Ga0068871_100046827 3300006358 Bacteria 3484
288 Ga0068871_100049854 3300006358 Bacteria 3385
289 Ga0075428_100037961 3300006844 Bacteria 5301
290 Ga0075430_100141446 3300006846 Bacteria 2004
291 Ga0075431_100056480 3300006847 Bacteria 4049
292 Ga0068865_100010326 3300006881 Bacteria 5808
293 Ga0068865_100013714 3300006881 Bacteria 5133
294 Ga0097620_100010212 3300006931 Bacteria 9449
295 Ga0097620_100567860 3300006931 Bacteria 1228
296 Ga0097620_101335072 3300006931 Bacteria 790
297 Ga0105240_10013171 3300009093 Bacteria 11376
298 Ga0105240_10051215 3300009093 Bacteria 5198
299 Ga0105240_10085474 3300009093 Bacteria 3864
300 Ga0105240_10098021 3300009093 Bacteria 3571
301 Ga0105240_10118401 3300009093 Bacteria 3192
302 Ga0105240_10503646 3300009093 Bacteria 1346
303 Ga0111539_10239408 3300009094 Bacteria 2112
304 Ga0105245_10033929 3300009098 Bacteria 4523
305 Ga0105245_10081246 3300009098 Bacteria 2963
306 Ga0105245_10100259 3300009098 Bacteria 2679
307 Ga0105245_10491786 3300009098 Bacteria 1241
308 Ga0105247_10722166 3300009101 Bacteria 752
309 Ga0105243_10004595 3300009148 Bacteria 10881
310 Ga0105243_10230023 3300009148 Bacteria 1644
311 Ga0105243_10248324 3300009148 Bacteria 1587
312 Ga0105243_10322215 3300009148 Bacteria 1409
313 Ga0105241_10259293 3300009174 Bacteria 1477
314 Ga0105241_10284041 3300009174 Bacteria 1414
315 Ga0105242_10127617 3300009176 Bacteria 2191
316 Ga0105242_11380649 3300009176 Bacteria 731
317 Ga0105248_10008033 3300009177 Bacteria 11587
318 Ga0105248_10081205 3300009177 Bacteria 3644
319 Ga0105248_10834043 3300009177 Bacteria 1041
320 Ga0105237_10037720 3300009545 Bacteria 4884
321 Ga0105237_10062076 3300009545 Bacteria 3736
322 Ga0105237_10085690 3300009545 Bacteria 3140
323 Ga0105237_10136637 3300009545 Bacteria 2446
324 Ga0105237_10633881 3300009545 Bacteria 1076
325 Ga0105238_10013227 3300009551 Bacteria 8326
326 Ga0105238_10034659 3300009551 Bacteria 5135
327 Ga0105238_10053983 3300009551 Bacteria 4037
328 Ga0105238_10091391 3300009551 Bacteria 3031
329 Ga0105238_10167006 3300009551 Bacteria 2177
330 Ga0105238_10269970 3300009551 Bacteria 1681
331 Ga0105238_10300930 3300009551 Bacteria 1587
332 Ga0105238_10687003 3300009551 Bacteria 1035
333 Ga0105238_10835669 3300009551 Bacteria 938
334 Ga0105238_11361673 3300009551 Bacteria 736
335 Ga0105249_10088620 3300009553 Bacteria 2890
336 Ga0105249_10134118 3300009553 Bacteria 2367
337 Ga0105249_10172734 3300009553 Bacteria 2097
338 Ga0105249_10303720 3300009553 Bacteria 1602
339 Ga0105249_10536865 3300009553 Bacteria 1219
340 Ga0105249_11162630 3300009553 Bacteria 842
341 Ga0105239_10002730 3300010375 Bacteria 22163
342 Ga0105239_10029727 3300010375 Bacteria 6008
343 Ga0105239_10033427 3300010375 Bacteria 5648
344 Ga0105239_10138849 3300010375 Bacteria 2707
345 Ga0105239_10241157 3300010375 Bacteria 2029
346 Ga0105246_10142595 3300011119 Bacteria 1803
347 Ga0105246_10321268 3300011119 Bacteria 1258
348 Ga0157341_1013590 3300012494 Bacteria 730
349 Ga0157373_10012235 3300013100 Bacteria 6309
350 Ga0157369_10004416 3300013105 Bacteria 16597
351 Ga0157369_10233802 3300013105 Bacteria 1921
352 Ga0157369_11168944 3300013105 Bacteria 786
353 Ga0157374_10007118 3300013296 Bacteria 9528
354 Ga0157374_10095353 3300013296 Bacteria 2845
355 Ga0157374_10268968 3300013296 Bacteria 1680
356 Ga0157374_10653393 3300013296 Bacteria 1063
357 Ga0157378_10247821 3300013297 Bacteria 1704
358 Ga0157378_10282318 3300013297 Bacteria 1601
359 Ga0157378_10286921 3300013297 Bacteria 1588
360 Ga0157378_10804753 3300013297 Bacteria 966
361 Ga0163162_10011386 3300013306 Bacteria 8673
362 Ga0163162_10013440 3300013306 Bacteria 7990
363 Ga0163162_10082936 3300013306 Bacteria 3279
364 Ga0163162_10173972 3300013306 Bacteria 2278
365 Ga0157372_10010659 3300013307 Bacteria 9778
366 Ga0157372_10252013 3300013307 Bacteria 2049
367 Ga0157372_11067182 3300013307 Bacteria 935
368 Ga0157375_10004510 3300013308 Bacteria 12107
369 Ga0157375_10092181 3300013308 Bacteria 3093
370 Ga0157375_10097366 3300013308 Bacteria 3016
371 Ga0157375_10126249 3300013308 Bacteria 2673
372 Ga0157375_11069189 3300013308 Bacteria 944
373 Ga0157375_11167751 3300013308 Bacteria 902
374 Ga0157375_12201351 3300013308 Bacteria 657
375 Ga0163163_10052942 3300014325 Bacteria 4006
376 Ga0163163_10084865 3300014325 Bacteria 3174
377 Ga0163163_10095599 3300014325 Bacteria 2991
378 Ga0163163_10330491 3300014325 Bacteria 1579
379 Ga0163163_11186221 3300014325 Bacteria 826
380 Ga0157380_10439715 3300014326 Bacteria 1249
381 Ga0157380_11103385 3300014326 Bacteria 833
382 Ga0182008_10807465 3300014497 Bacteria 545
383 Ga0157377_10352414 3300014745 Bacteria 988
384 Ga0157377_10575874 3300014745 Bacteria 799
385 Ga0157379_10010452 3300014968 Bacteria 8090
386 Ga0157379_10330220 3300014968 Bacteria 1393
387 Ga0157379_10348252 3300014968 Bacteria 1356
388 Ga0157379_10480377 3300014968 Bacteria 1150
389 Ga0157379_10600370 3300014968 Bacteria 1028
390 Ga0157379_11119126 3300014968 Bacteria 755
391 Ga0157376_10004195 3300014969 Bacteria 9999
392 Ga0157376_10071755 3300014969 Bacteria 2944
393 Ga0157376_10081366 3300014969 Bacteria 2781
394 Ga0157376_10309586 3300014969 Bacteria 1498
395 Ga0157376_10933886 3300014969 Bacteria 887
396 Ga0182007_10028336 3300015262 Bacteria 1925
397 Ga0163161_10029214 3300017792 Bacteria 3919
398 Ga0163161_10148429 3300017792 Bacteria 1780
399 Ga0163161_10312557 3300017792 Bacteria 1240
400 Ga0213872_10020494 3300021361 Bacteria 3048
401 Ga0213874_10013909 3300021377 Bacteria 2095
402 Ga0213876_10000320 3300021384 Bacteria 42027
403 Ga0213876_10013845 3300021384 Bacteria 4275
404 Ga0213876_10078214 3300021384 Bacteria 1748
405 Ga0213875_10145273 3300021388 Bacteria 1111
406 Ga0228598_1079813 3300024227 Bacteria 656
407 Ga0209674_100003 3300025226 Bacteria 2196646
408 Ga0209563_100049 3300025230 Bacteria 358472
409 Ga0209258_100700 3300025242 Bacteria 22801
410 Ga0209646_1000257 3300025246 Bacteria 52257
411 Ga0209026_1000054 3300025250 Bacteria 242508
412 Ga0209026_1029234 3300025250 Bacteria 822
413 Ga0209677_100050 3300025253 Bacteria 176828
414 Ga0209677_100316 3300025253 Bacteria 31473
415 Ga0209759_1000043 3300025256 Bacteria 242513
416 Ga0209759_1001086 3300025256 Bacteria 17708
417 Ga0209759_1007199 3300025256 Bacteria 3616
418 Ga0209759_1007372 3300025256 Bacteria 3545
419 Ga0209759_1020122 3300025256 Bacteria 1560
420 Ga0207666_1034245 3300025271 Bacteria 785
421 Ga0209257_1020862 3300025304 Bacteria 2403
422 Ga0207697_10011255 3300025315 Bacteria 3790
423 Ga0207697_10051694 3300025315 Bacteria 1699
424 Ga0207697_10072947 3300025315 Bacteria 1440
425 Ga0207656_10056547 3300025321 Bacteria 1710
426 Ga0207656_10079392 3300025321 Bacteria 1472
427 Ga0207656_10106025 3300025321 Bacteria 1293
428 Ga0207656_10123197 3300025321 Bacteria 1209
429 Ga0207682_10002713 3300025893 Bacteria 7857
430 Ga0207710_10023200 3300025900 Bacteria 2666
431 Ga0207688_10021261 3300025901 Bacteria 3544
432 Ga0207688_10035566 3300025901 Bacteria 2760
433 Ga0207680_10574620 3300025903 Bacteria 805
434 Ga0207645_10013318 3300025907 Bacteria 5548
435 Ga0207645_10033535 3300025907 Bacteria 3300
436 Ga0207645_10389387 3300025907 Bacteria 936
437 Ga0207643_10073334 3300025908 Bacteria 1973
438 Ga0207643_10140986 3300025908 Bacteria 1440
439 Ga0207643_10284330 3300025908 Bacteria 1026
440 Ga0207705_10063288 3300025909 Bacteria 2673
441 Ga0207705_10377252 3300025909 Bacteria 1095
442 Ga0207705_10455173 3300025909 Bacteria 992
443 Ga0207705_10761505 3300025909 Bacteria 752
444 Ga0207684_10006317 3300025910 Bacteria 10809
445 Ga0207684_10092637 3300025910 Bacteria 2576
446 Ga0207654_10140240 3300025911 Bacteria 1541
447 Ga0207707_10168156 3300025912 Bacteria 1916
448 Ga0207671_10111436 3300025914 Bacteria 2082
449 Ga0207671_10173436 3300025914 Bacteria 1675
450 Ga0207671_10278855 3300025914 Bacteria 1318
451 Ga0207671_10598003 3300025914 Bacteria 879
452 Ga0207693_10210518 3300025915 Bacteria 1528
453 Ga0207660_10013863 3300025917 Bacteria 5289
454 Ga0207660_10014201 3300025917 Bacteria 5230
455 Ga0207660_10025665 3300025917 Bacteria 4003
456 Ga0207657_10017177 3300025919 Bacteria 6951
457 Ga0207657_10029996 3300025919 Bacteria 4942
458 Ga0207657_10077341 3300025919 Bacteria 2804
459 Ga0207657_10175173 3300025919 Bacteria 1736
460 Ga0207657_10363682 3300025919 Bacteria 1140
461 Ga0207657_10689728 3300025919 Bacteria 794
462 Ga0207649_10087335 3300025920 Bacteria 2034
463 Ga0207649_10701527 3300025920 Bacteria 785
464 Ga0207652_10096240 3300025921 Bacteria 2608
465 Ga0207646_10052114 3300025922 Bacteria 3661
466 Ga0207646_10174411 3300025922 Bacteria 1942
467 Ga0207646_11569991 3300025922 Bacteria 568
468 Ga0207681_10006059 3300025923 Bacteria 7417
469 Ga0207681_10112035 3300025923 Bacteria 1986
470 Ga0207681_10124516 3300025923 Bacteria 1895
471 Ga0207681_10291164 3300025923 Bacteria 1289
472 Ga0207694_10013700 3300025924 Bacteria 6111
473 Ga0207694_10031813 3300025924 Bacteria 4033
474 Ga0207694_10449771 3300025924 Bacteria 1075
475 Ga0207694_10674823 3300025924 Bacteria 871
476 Ga0207694_10767015 3300025924 Bacteria 814
477 Ga0207650_10000408 3300025925 Bacteria 38515
478 Ga0207650_10008713 3300025925 Bacteria 6926
479 Ga0207650_10021070 3300025925 Bacteria 4605
480 Ga0207650_10524697 3300025925 Bacteria 991
481 Ga0207659_10000775 3300025926 Bacteria 18918
482 Ga0207659_10027360 3300025926 Bacteria 3861
483 Ga0207659_10455249 3300025926 Bacteria 1078
484 Ga0207687_10028883 3300025927 Bacteria 3727
485 Ga0207687_10140822 3300025927 Bacteria 1830
486 Ga0207687_10145092 3300025927 Bacteria 1805
487 Ga0207687_10684489 3300025927 Bacteria 869
488 Ga0207700_10251354 3300025928 Bacteria 1510
489 Ga0207664_10093577 3300025929 Bacteria 2469
490 Ga0207664_10719386 3300025929 Bacteria 898
491 Ga0207644_10011177 3300025931 Bacteria 5932
492 Ga0207644_10111536 3300025931 Bacteria 2069
493 Ga0207644_10372927 3300025931 Bacteria 1163
494 Ga0207644_10424186 3300025931 Bacteria 1090
495 Ga0207644_10475583 3300025931 Bacteria 1028
496 Ga0207644_10548773 3300025931 Bacteria 956
497 Ga0207644_10774640 3300025931 Bacteria 802
498 Ga0207644_11000790 3300025931 Bacteria 702
499 Ga0207644_11012014 3300025931 Bacteria 697
500 Ga0207690_10154689 3300025932 Bacteria 1703
501 Ga0207690_10212660 3300025932 Bacteria 1475
502 Ga0207690_10228431 3300025932 Bacteria 1427
503 Ga0207690_10531001 3300025932 Bacteria 955
504 Ga0207690_10586255 3300025932 Bacteria 909
505 Ga0207706_10005446 3300025933 Bacteria 11860
506 Ga0207706_10114233 3300025933 Bacteria 2375
507 Ga0207706_10256036 3300025933 Bacteria 1528
508 Ga0207686_11531673 3300025934 Bacteria 550
509 Ga0207709_10063345 3300025935 Bacteria 2317
510 Ga0207709_10164485 3300025935 Bacteria 1551
511 Ga0207709_10374788 3300025935 Bacteria 1081
512 Ga0207670_10527379 3300025936 Bacteria 962
513 Ga0207669_10005530 3300025937 Bacteria 5680
514 Ga0207669_10060349 3300025937 Bacteria 2324
515 Ga0207669_10083324 3300025937 Bacteria 2056
516 Ga0207669_10454684 3300025937 Bacteria 1015
517 Ga0207704_10009803 3300025938 Bacteria 4638
518 Ga0207691_10000360 3300025940 Bacteria 45895
519 Ga0207691_10028023 3300025940 Bacteria 5278
520 Ga0207691_10055485 3300025940 Bacteria 3610
521 Ga0207691_10191803 3300025940 Bacteria 1782
522 Ga0207691_10208810 3300025940 Bacteria 1697
523 Ga0207691_10374450 3300025940 Bacteria 1216
524 Ga0207691_10382534 3300025940 Bacteria 1201
525 Ga0207711_10060901 3300025941 Bacteria 3254
526 Ga0207711_10179546 3300025941 Bacteria 1924
527 Ga0207711_11017865 3300025941 Bacteria 768
528 Ga0207689_10000550 3300025942 Bacteria 35746
529 Ga0207689_10005418 3300025942 Bacteria 11422
530 Ga0207689_10045901 3300025942 Bacteria 3612
531 Ga0207689_10232972 3300025942 Bacteria 1522
532 Ga0207689_10300263 3300025942 Bacteria 1331
533 Ga0207689_10414685 3300025942 Bacteria 1123
534 Ga0207661_10009060 3300025944 Bacteria 7131
535 Ga0207661_10134005 3300025944 Bacteria 2126
536 Ga0207661_10170343 3300025944 Bacteria 1895
537 Ga0207661_10246521 3300025944 Bacteria 1586
538 Ga0207661_10679394 3300025944 Bacteria 947
539 Ga0207679_10003726 3300025945 Bacteria 9451
540 Ga0207679_10361897 3300025945 Bacteria 1267
541 Ga0207679_11592574 3300025945 Bacteria 599
542 Ga0207667_10012561 3300025949 Bacteria 9742
543 Ga0207667_10047907 3300025949 Bacteria 4521
544 Ga0207667_10180435 3300025949 Bacteria 2168
545 Ga0207651_10007721 3300025960 Bacteria 5748
546 Ga0207651_10083499 3300025960 Bacteria 2310
547 Ga0207651_10104845 3300025960 Bacteria 2107
548 Ga0207651_10245587 3300025960 Bacteria 1461
549 Ga0207651_10347699 3300025960 Bacteria 1247
550 Ga0207651_11168467 3300025960 Bacteria 690
551 Ga0207651_11690149 3300025960 Bacteria 570
552 Ga0207712_10018795 3300025961 Bacteria 4506
553 Ga0207712_10119023 3300025961 Bacteria 1995
554 Ga0207712_10986626 3300025961 Bacteria 747
555 Ga0207668_10036498 3300025972 Bacteria 3280
556 Ga0207668_10050945 3300025972 Bacteria 2856
557 Ga0207668_10121772 3300025972 Bacteria 1976
558 Ga0207668_10428276 3300025972 Bacteria 1124
559 Ga0207640_10061934 3300025981 Bacteria 2480
560 Ga0207640_10126093 3300025981 Bacteria 1843
561 Ga0207640_10138846 3300025981 Bacteria 1768
562 Ga0207640_10167522 3300025981 Bacteria 1633
563 Ga0207640_10313059 3300025981 Bacteria 1247
564 Ga0207640_10355629 3300025981 Bacteria 1178
565 Ga0207658_10013819 3300025986 Bacteria 5524
566 Ga0207658_10218590 3300025986 Bacteria 1601
567 Ga0207677_10005039 3300026023 Bacteria 7138
568 Ga0207677_10040495 3300026023 Bacteria 3072
569 Ga0207677_10040938 3300026023 Bacteria 3060
570 Ga0207677_10125339 3300026023 Bacteria 1940
571 Ga0207677_10766819 3300026023 Bacteria 861
572 Ga0207703_10021520 3300026035 Bacteria 5049
573 Ga0207703_10140792 3300026035 Bacteria 2093
574 Ga0207703_10406747 3300026035 Bacteria 1264
575 Ga0207703_10833961 3300026035 Bacteria 881
576 Ga0207639_10028942 3300026041 Bacteria 4050
577 Ga0207639_10048460 3300026041 Bacteria 3216
578 Ga0207639_10648705 3300026041 Bacteria 976
579 Ga0207639_10897623 3300026041 Bacteria 828
580 Ga0207678_10040307 3300026067 Bacteria 4051
581 Ga0207678_10057806 3300026067 Bacteria 3338
582 Ga0207678_10067677 3300026067 Bacteria 3065
583 Ga0207708_10012007 3300026075 Bacteria 6453
584 Ga0207708_10021407 3300026075 Bacteria 4877
585 Ga0207708_10025472 3300026075 Bacteria 4474
586 Ga0207708_10176849 3300026075 Bacteria 1693
587 Ga0207702_10004454 3300026078 Bacteria 12446
588 Ga0207702_10011854 3300026078 Bacteria 7255
589 Ga0207702_10609855 3300026078 Bacteria 1071
590 Ga0207702_10683692 3300026078 Bacteria 1011
591 Ga0207641_10002779 3300026088 Bacteria 15944
592 Ga0207641_10040743 3300026088 Bacteria 3890
593 Ga0207641_10068611 3300026088 Bacteria 3041
594 Ga0207648_10018173 3300026089 Bacteria 6369
595 Ga0207648_10077377 3300026089 Bacteria 2900
596 Ga0207648_10772546 3300026089 Bacteria 893
597 Ga0207648_11191882 3300026089 Bacteria 715
598 Ga0207676_10011759 3300026095 Bacteria 6259
599 Ga0207676_10101927 3300026095 Bacteria 2381
600 Ga0207676_10105250 3300026095 Bacteria 2348
601 Ga0207676_10342893 3300026095 Bacteria 1379
602 Ga0207676_10795142 3300026095 Bacteria 922
603 Ga0207674_10021066 3300026116 Bacteria 7031
604 Ga0207674_10024173 3300026116 Bacteria 6496
605 Ga0207674_10732725 3300026116 Bacteria 954
606 Ga0207674_11115352 3300026116 Bacteria 758
607 Ga0207675_100000576 3300026118 Bacteria 35873
608 Ga0207675_100002372 3300026118 Bacteria 18650
609 Ga0207675_100027403 3300026118 Bacteria 5307
610 Ga0207675_100160619 3300026118 Bacteria 2143
611 Ga0207675_100332382 3300026118 Bacteria 1486
612 Ga0207675_101208499 3300026118 Bacteria 776
613 Ga0207683_10006928 3300026121 Bacteria 9707
614 Ga0207683_10046461 3300026121 Bacteria 3800
615 Ga0207683_10066278 3300026121 Bacteria 3184
616 Ga0207683_10088749 3300026121 Bacteria 2752
617 Ga0207683_10201427 3300026121 Bacteria 1810
618 Ga0207683_10814249 3300026121 Bacteria 867
619 Ga0207698_10007575 3300026142 Bacteria 6805
620 Ga0207698_10009788 3300026142 Bacteria 6123
621 Ga0207698_10675002 3300026142 Bacteria 1026
622 Ga0207698_10941339 3300026142 Bacteria 873
623 Ga0207698_11025973 3300026142 Bacteria 836
624 Ga0207698_11875927 3300026142 Bacteria 614
625 Ga0209813_10071989 3300027866 Bacteria 1126
626 Ga0207428_10000098 3300027907 Bacteria 120181
627 Ga0268266_10177715 3300028379 Bacteria 1936
628 Ga0268266_10441477 3300028379 Bacteria 1236
629 Ga0268265_10025046 3300028380 Bacteria 4229
630 Ga0268265_10063188 3300028380 Bacteria 2847
631 Ga0268265_10067092 3300028380 Bacteria 2776
632 Ga0268264_10002728 3300028381 Bacteria 15415
633 Ga0268264_10004187 3300028381 Bacteria 12320
634 Ga0268264_10032705 3300028381 Bacteria 4268
635 Ga0265334_10144263 3300028573 Bacteria 842
636 Ga0265336_10000006 3300028666 Bacteria 348453
637 Ga0307517_10090491 3300028786 Bacteria 2510
638 Ga0265324_10005524 3300029957 Bacteria 5447
639 Ga0265324_10024172 3300029957 Bacteria 2160
640 Ga0307511_10207407 3300030521 Bacteria 1006
641 Ga0265330_10014154 3300031235 Bacteria 3703
642 Ga0265330_10036812 3300031235 Bacteria 2180
643 Ga0265332_10020329 3300031238 Bacteria 2931
644 Ga0265328_10057981 3300031239 Bacteria 1422
645 Ga0265328_10093175 3300031239 Bacteria 1113
646 Ga0265325_10014378 3300031241 Bacteria 4476
647 Ga0265339_10090733 3300031249 Bacteria 1602
648 Ga0265331_10111470 3300031250 Bacteria 1255
649 Ga0265331_10167807 3300031250 Bacteria 994
650 Ga0265327_10001569 3300031251 Bacteria 27986
651 Ga0265316_10343810 3300031344 Bacteria 1081
652 Ga0265316_10633125 3300031344 Bacteria 757
653 Ga0307513_10104370 3300031456 Bacteria 2848
654 Ga0307513_10346743 3300031456 Bacteria 1234
655 Ga0307509_10005866 3300031507 Bacteria 16842
656 Ga0307408_100073952 3300031548 Bacteria 2527
657 Ga0307408_100437667 3300031548 Bacteria 1131
658 Ga0307408_100484356 3300031548 Bacteria 1080
659 Ga0307508_10236935 3300031616 Bacteria 1423
660 Ga0265342_10160601 3300031712 Bacteria 1242
661 Ga0265342_10243393 3300031712 Bacteria 962
662 Ga0307516_10000360 3300031730 Bacteria 59179
663 Ga0307516_10001515 3300031730 Bacteria 31972
664 Ga0307516_10242632 3300031730 Bacteria 1500
665 Ga0307405_10244883 3300031731 Bacteria 1330
666 Ga0307413_10116625 3300031824 Bacteria 1799
667 Ga0307410_10010373 3300031852 Bacteria 5273
668 Ga0307410_10416064 3300031852 Bacteria 1089
669 Ga0307410_10630510 3300031852 Bacteria 897
670 Ga0307406_10007409 3300031901 Bacteria 6084
671 Ga0307406_10390720 3300031901 Bacteria 1100
672 Ga0307407_10021342 3300031903 Bacteria 3337
673 Ga0307412_10017797 3300031911 Bacteria 4259
674 Ga0307412_10724317 3300031911 Bacteria 856
675 Ga0307409_100096445 3300031995 Bacteria 2440
676 Ga0307409_100422996 3300031995 Bacteria 1278
677 Ga0307409_100727726 3300031995 Bacteria 994
678 Ga0307416_100092178 3300032002 Bacteria 2605
679 Ga0307416_100289203 3300032002 Bacteria 1621
680 Ga0307414_10187493 3300032004 Bacteria 1670
681 Ga0307411_10046117 3300032005 Bacteria 2807
682 Ga0307415_100420861 3300032126 Bacteria 1146
683 Ga0307415_100939739 3300032126 Bacteria 800
684 Ga0373958_0118009 3300034819 Bacteria 638
685 Ga0373929_0036554 3300035085 Bacteria 1073
686 Ga0373934_0015252 3300035086 Bacteria 2914
687 Ga0373934_0017850 3300035086 Bacteria 2711
688 Ga0373944_0019778 3300035089 Bacteria 1935
689 Ga0373944_0046640 3300035089 Bacteria 1355
690 Ga0373932_0112300 3300035112 Bacteria 899
691 Ga0373936_0121615 3300035113 Bacteria 1115
692 Ga0373936_0302194 3300035113 Bacteria 722
693 Ga0373939_0025744 3300035114 Bacteria 1652
694 Ga0373939_0068988 3300035114 Bacteria 1146
695 Ga0373939_0201822 3300035114 Bacteria 752
696 Ga0373941_0016087 3300035115 Bacteria 2027
697 Ga0373953_0001844 3300035117 Bacteria 6271
698 Ga0373953_0021843 3300035117 Bacteria 2406
699 Ga0373954_0036066 3300035118 Bacteria 2294
700 Ga0373954_0064007 3300035118 Bacteria 1738
701 Ga0373954_0354612 3300035118 Bacteria 724
702 Ga0373956_0139555 3300035119 Bacteria 1137
703 Ga0373957_0027091 3300035120 Bacteria 2079
704 Ga0373957_0201631 3300035120 Bacteria 829
705 Ga0373943_0286310 3300035170 Bacteria 933
706 Ga0373955_0011070 3300035172 Bacteria 4283
707 Ga0373955_0128365 3300035172 Bacteria 1478
708 Ga0373955_0234314 3300035172 Bacteria 1099
709 Ga0373942_0044805 3300035207 Bacteria 1220
710 Ga0373962_0004177 3300035242 Bacteria 3481
711 Ga0373924_0093407 3300035410 Bacteria 1288
712 Ga0373931_0004059 3300035691 Bacteria 6635
713 Ga0373931_0006509 3300035691 Bacteria 5459
714 Ga0373935_0258046 3300035692 Bacteria 1222
715 Ga0373935_0278951 3300035692 Bacteria 1176
716 Ga0373935_0489627 3300035692 Bacteria 892
717 Ga0373927_0072709 3300035695 Bacteria 2226
718 Ga0373933_0000272 3300035724 Bacteria 33654
719 Ga0373933_0060893 3300035724 Bacteria 2276
720 Ga0373933_0080796 3300035724 Bacteria 1993
721 Ga0373937_0014381 3300036401 Bacteria 6987
722 Ga0373937_0036056 3300036401 Bacteria 4506
723 Ga0373925_0637208 3300037068 Bacteria 878
724 Ga0373925_1402071 3300037068 Bacteria 572
725 Ga0395899_0237362 3300037312 Bacteria 1256
726 Ga0395899_0331913 3300037312 Bacteria 1022
727 Ga0395900_0251576 3300037418 Bacteria 1768
728 Ga0395898_0012212 3300037466 Bacteria 8884
729 Ga0395905_0004450 3300037471 Bacteria 14564
730 Ga0395905_0481794 3300037471 Bacteria 1140
731 Ga0395905_1121043 3300037471 Bacteria 690
732 Ga0436364_0482689 3300037853 Bacteria 1241
733 Ga0395901_0002847 3300038443 Bacteria 17464
734 Ga0436365_0274646 3300039437 Bacteria 16277
735 Ga0436365_1345740 3300039437 Bacteria 5788
736 Ga0436365_1773448 3300039437 Bacteria 8854
737 Ga0436361_0256361 3300039447 Bacteria 5094
738 Ga0436361_1015175 3300039447 Bacteria 4895
739 Ga0436363_1257368 3300039450 Bacteria 4028
740 Ga0436362_0531272 3300039453 Bacteria 815
741 Ga0451797_0909590 3300041453 Bacteria 1048
742 Ga0451795_0486996 3300041456 Bacteria 918
743 Ga0451795_1224247 3300041456 Bacteria 643
744 Ga0451798_0388718 3300041458 Bacteria 614
745 Ga0451843_0349938 3300041509 Bacteria 724
746 Ga0450898_085726 3300042134 Bacteria 645
747 Ga0439464_0002912 3300042439 Bacteria 4262
748 Ga0466969_0058948 3300044656 Bacteria 1867
749 Ga0466965_0052459 3300044683 Bacteria 2025
750 Ga0466965_0064290 3300044683 Bacteria 1836
751 Ga0466966_0011578 3300044684 Bacteria 5848
752 Ga0466966_0027088 3300044684 Bacteria 3738
753 Ga0466961_0010761 3300044693 Bacteria 5843
754 Ga0466961_0157290 3300044693 Bacteria 1417
755 Ga0466963_0513052 3300044694 Bacteria 846
756 Ga0466964_0007682 3300044706 Bacteria 4036
757 Ga0466964_0279146 3300044706 Bacteria 834
758 Ga0466971_0008613 3300044719 Bacteria 4449
759 Ga0466971_0028527 3300044719 Bacteria 2496
760 Ga0466968_0039786 3300044735 Bacteria 1980
761 Ga0466970_0058122 3300044765 Bacteria 2069
762 Ga0466957_0020706 3300044842 Bacteria 3872
763 Ga0466957_0067419 3300044842 Bacteria 2208
764 Ga0466957_0127429 3300044842 Bacteria 1627
765 Ga0466967_0066022 3300045976 Bacteria 3223
766 Ga0466967_0776087 3300045976 Bacteria 951
767 Ga0495592_0039033 3300046454 Bacteria 3569
768 Ga0495590_0053145 3300046457 Bacteria 1415
769 Ga0495629_0030791 3300046459 Bacteria 3801
770 Ga0495629_0042353 3300046459 Bacteria 3200
771 Ga0495629_0153929 3300046459 Bacteria 1598
772 Ga0495651_0009538 3300046462 Bacteria 7456
773 Ga0495651_0256178 3300046462 Bacteria 1192
774 Ga0495653_0021947 3300046463 Bacteria 5167
775 Ga0495653_0088251 3300046463 Bacteria 2275
776 Ga0495653_0437458 3300046463 Bacteria 825
777 Ga0495650_0211714 3300046471 Bacteria 670
778 Ga0495582_0762436 3300046473 Bacteria 560
779 Ga0495639_0021367 3300046475 Bacteria 2833
780 Ga0495664_0020652 3300046477 Bacteria 3800
781 Ga0495585_0091519 3300046492 Bacteria 1637
782 Ga0495596_0064933 3300046500 Bacteria 1420
783 Ga0495583_0000717 3300046506 Bacteria 42460
784 Ga0495606_0001165 3300046507 Bacteria 37175
785 Ga0495606_0001828 3300046507 Bacteria 26968
786 Ga0495606_0108705 3300046507 Bacteria 1676
787 Ga0495606_0598471 3300046507 Bacteria 541
788 Ga0495608_0041349 3300046511 Bacteria 3085
789 Ga0495608_0246984 3300046511 Bacteria 1113
790 Ga0495618_0021531 3300046514 Bacteria 3976
791 Ga0495620_0111324 3300046515 Bacteria 1085
792 Ga0495628_0252247 3300046516 Bacteria 1317
793 Ga0495628_0420283 3300046516 Bacteria 974
794 Ga0495630_0140350 3300046517 Bacteria 1837
795 Ga0495630_0871841 3300046517 Bacteria 686
796 Ga0495631_0100935 3300046518 Bacteria 1242
797 Ga0495632_0002264 3300046519 Bacteria 14832
798 Ga0495648_0241600 3300046524 Bacteria 877
799 Ga0495652_0022074 3300046529 Bacteria 5652
800 Ga0495640_0095188 3300046533 Bacteria 1960
801 Ga0495640_0225433 3300046533 Bacteria 1180
802 Ga0495586_0010203 3300046535 Bacteria 4997
803 Ga0495587_0023347 3300046536 Bacteria 3800
804 Ga0495598_0019860 3300046537 Bacteria 1767
805 Ga0495598_0055549 3300046537 Bacteria 1206
806 Ga0495621_0057524 3300046539 Bacteria 1404
807 Ga0495597_0010500 3300046542 Bacteria 4523
808 Ga0495645_0008575 3300046543 Bacteria 7139
809 Ga0495645_0106584 3300046543 Bacteria 1987
810 Ga0495667_0038481 3300046559 Bacteria 3184
811 Ga0495667_0116418 3300046559 Bacteria 1726
812 Ga0495656_0224299 3300046615 Bacteria 941
813 Ga0495668_0057333 3300046616 Bacteria 2150
814 Ga0495668_0170657 3300046616 Bacteria 1192
815 Ga0495634_0026497 3300046642 Bacteria 4044
816 Ga0495634_0048984 3300046642 Bacteria 2842
817 Ga0495611_0176079 3300046648 Bacteria 1000
818 Ga0495625_0004769 3300046660 Bacteria 12683
819 Ga0495625_0032244 3300046660 Bacteria 3888
820 Ga0495635_0054202 3300046663 Bacteria 2762
821 Ga0495657_0082376 3300046675 Bacteria 2079
822 Ga0495657_0266238 3300046675 Bacteria 1028
823 Ga0495599_0026974 3300046678 Bacteria 3599
824 Ga0495599_0091927 3300046678 Bacteria 1893
825 Ga0495623_0000341 3300046679 Bacteria 30684
826 Ga0495623_0056506 3300046679 Bacteria 2470
827 Ga0495623_0503271 3300046679 Bacteria 639
828 Ga0495646_0051164 3300046680 Bacteria 2501
829 Ga0495647_0113192 3300046681 Bacteria 1134
830 Ga0495647_0454440 3300046681 Bacteria 593
831 Ga0495613_0079173 3300046689 Bacteria 2390
832 Ga0495613_0449294 3300046689 Bacteria 873
833 Ga0495649_0000314 3300046694 Bacteria 42490
834 Ga0495649_0003800 3300046694 Bacteria 10003
835 Ga0495589_0017299 3300046794 Bacteria 3700
836 Ga0495600_0004899 3300046809 Bacteria 8041
837 Ga0495600_0021231 3300046809 Bacteria 4156
838 Ga0495660_0237968 3300046810 Bacteria 850
839 Ga0495604_0073588 3300047317 Bacteria 2578
840 Ga0495604_0817886 3300047317 Bacteria 586
841 Ga0495636_0448666 3300047318 Bacteria 619
842 Ga0495672_0163529 3300047320 Bacteria 1142
843 Ga0495680_0011531 3300047322 Bacteria 7817
844 Ga0495680_0070998 3300047322 Bacteria 2652
845 Ga0495680_0134503 3300047322 Bacteria 1813
846 Ga0495687_000500 3300047443 Bacteria 47248
847 Ga0495687_081066 3300047443 Bacteria 1270
848 Ga0495687_081148 3300047443 Bacteria 1269
849 Ga0495675_0025108 3300047444 Bacteria 3800
850 Ga0495675_0451011 3300047444 Bacteria 744
851 Ga0495684_0006898 3300047471 Bacteria 8816
852 Ga0495684_0141527 3300047471 Bacteria 1803
853 Ga0495686_0009986 3300047472 Bacteria 6786
854 Ga0495593_0049844 3300047673 Bacteria 2220
855 Ga0495593_0388925 3300047673 Bacteria 697
856 Ga0495602_0077100 3300048088 Bacteria 2821
857 Ga0495602_0093108 3300048088 Bacteria 2494
858 Ga0495626_0060994 3300048091 Bacteria 1717
859 Ga0496100_0001742 3300048903 Bacteria 10853
860 Ga0496100_0310792 3300048903 Bacteria 1182
861 Ga0496100_0550174 3300048903 Bacteria 893
862 Ga0496100_0762313 3300048903 Bacteria 757
863 Ga0496100_1034811 3300048903 Bacteria 646
864 Ga0496101_0017477 3300048904 Bacteria 4866
865 Ga0496101_0079654 3300048904 Bacteria 2418
866 Ga0496101_0166311 3300048904 Bacteria 1693
867 Ga0496101_0854767 3300048904 Bacteria 717
868 Ga0496102_0007582 3300048905 Bacteria 9270
869 Ga0496102_0015979 3300048905 Bacteria 6551
870 Ga0496102_0175593 3300048905 Bacteria 2017
871 Ga0496102_0856937 3300048905 Bacteria 831
872 Ga0496102_1074809 3300048905 Bacteria 725
873 Ga0496103_0012760 3300048906 Bacteria 4983
874 Ga0496103_0026277 3300048906 Bacteria 3525
875 Ga0496103_0099130 3300048906 Bacteria 1843
876 Ga0496104_0040323 3300048907 Bacteria 4376
877 Ga0496104_0041031 3300048907 Bacteria 4338
878 Ga0496104_0190843 3300048907 Bacteria 1960
879 Ga0496104_0742583 3300048907 Bacteria 889
880 Ga0496104_1259910 3300048907 Bacteria 643
881 Ga0496105_0052096 3300048908 Bacteria 3379
882 Ga0496105_0068158 3300048908 Bacteria 2938
883 Ga0496105_0076564 3300048908 Bacteria 2763
884 Ga0496105_0101187 3300048908 Bacteria 2380
885 Ga0496106_0000560 3300048909 Bacteria 26498
886 Ga0496106_0005275 3300048909 Bacteria 9573
887 Ga0496106_0008322 3300048909 Bacteria 7676
888 Ga0496106_0037455 3300048909 Bacteria 3629
889 Ga0496106_0479362 3300048909 Bacteria 999
890 Ga0496107_0014344 3300048910 Bacteria 5548
891 Ga0496107_0785578 3300048910 Bacteria 697
892 Ga0496108_0071481 3300048911 Bacteria 2928
893 Ga0496108_0213026 3300048911 Bacteria 1677
894 Ga0496108_0734787 3300048911 Bacteria 854
895 Ga0496108_0749983 3300048911 Bacteria 844
896 Ga0496109_0059173 3300048912 Bacteria 3500
897 Ga0496109_0628642 3300048912 Bacteria 1010
898 Ga0496109_1235856 3300048912 Bacteria 683
899 Ga0496109_1276508 3300048912 Bacteria 670
900 Ga0496110_0002997 3300048913 Bacteria 12811
901 Ga0496110_0041098 3300048913 Bacteria 4033
902 Ga0496110_0042554 3300048913 Bacteria 3964
903 Ga0496111_0028911 3300048914 Bacteria 3931
904 Ga0496111_0206895 3300048914 Bacteria 1458
905 Ga0496112_0035167 3300048915 Bacteria 4877
906 Ga0496112_0086130 3300048915 Bacteria 3108
907 Ga0496112_0157544 3300048915 Bacteria 2237
908 Ga0496112_0489775 3300048915 Bacteria 1165
909 Ga0496112_0651940 3300048915 Bacteria 982
910 Ga0496112_0731559 3300048915 Bacteria 916
911 Ga0496113_0004759 3300048916 Bacteria 8382
912 Ga0496113_0043328 3300048916 Bacteria 3330
913 Ga0496113_0110260 3300048916 Bacteria 2141
914 Ga0496113_0151546 3300048916 Bacteria 1829
915 Ga0496113_0236481 3300048916 Bacteria 1457
916 Ga0496114_0008471 3300048917 Bacteria 8147
917 Ga0496114_0055488 3300048917 Bacteria 3304
918 Ga0496114_0314103 3300048917 Bacteria 1384
919 Ga0496115_0002892 3300048918 Bacteria 12380
920 Ga0496115_0085405 3300048918 Bacteria 2574
921 Ga0496115_0239650 3300048918 Bacteria 1495
922 Ga0496117_0017580 3300048920 Bacteria 5967
923 Ga0496118_0035996 3300048921 Bacteria 4010
924 Ga0496121_0000099 3300048924 Bacteria 200160
925 Ga0496121_0255839 3300048924 Bacteria 1212
926 Ga0496124_0000788 3300048927 Bacteria 51794
927 Ga0496125_0053711 3300048928 Bacteria 3300
928 Ga0496126_0029319 3300048929 Bacteria 5229
929 Ga0501039_0293243 3300049575 Bacteria 1279
930 Ga0501040_0126934 3300049576 Bacteria 1792
931 Ga0501041_0045854 3300049577 Bacteria 2659
932 Ga0501042_0188245 3300049578 Bacteria 1489
933 Ga0501042_0489903 3300049578 Bacteria 892
934 Ga0501043_0000072 3300049579 Bacteria 89021
935 Ga0501046_0000112 3300049580 Bacteria 86313
936 Ga0501047_0000138 3300049581 Bacteria 89028
937 Ga0501048_0001221 3300049582 Bacteria 19469
938 Ga0501071_0578945 3300049587 Bacteria 863
939 Ga0501072_0724123 3300049588 Bacteria 781
940 Ga0501075_0215615 3300049591 Bacteria 1464
941 Ga0501075_0777819 3300049591 Bacteria 728
942 Ga0501076_0108269 3300049592 Bacteria 2245
943 Ga0501077_0439517 3300049593 Bacteria 835
944 Ga0501081_0018831 3300049743 Bacteria 4586
945 Ga0501045_0001874 3300049824 Bacteria 14253
946 nmdc:mga03683_126189_c1 3300050489 Bacteria 1142
947 nmdc:mga03683_351134_c1 3300050489 Bacteria 698
948 nmdc:mga03683_59909_c1 3300050489 Bacteria 1607
949 nmdc:mga03n38_69771_c1 3300050490 Bacteria 1624
950 nmdc:mga00v17_117322_c1 3300050491 Bacteria 1693
951 nmdc:mga0yw44_191524_c1 3300050492 Bacteria 1349
952 nmdc:mga0yw44_289056_c1 3300050492 Bacteria 1097
953 nmdc:mga0yw44_33386_c1 3300050492 Bacteria 3006
954 nmdc:mga0k408_110896_c1 3300050493 Bacteria 1622
955 nmdc:mga0k408_14148_c1 3300050493 Bacteria 4391
956 nmdc:mga0k408_156211_c1 3300050493 Bacteria 1359
957 nmdc:mga0k408_18465_c1 3300050493 Bacteria 3894
958 nmdc:mga0k408_27324_c1 3300050493 Bacteria 3241
959 nmdc:mga0k408_373534_c1 3300050493 Bacteria 850
960 nmdc:mga0k408_52971_c1 3300050493 Bacteria 2352
961 nmdc:mga0k408_593108_c1 3300050493 Bacteria 654
962 nmdc:mga06z11_111437_c1 3300050494 Bacteria 1516
963 nmdc:mga06z11_111603_c1 3300050494 Bacteria 1515
964 nmdc:mga06z11_51205_c1 3300050494 Bacteria 2114
965 nmdc:mga06z11_575132_c1 3300050494 Bacteria 685
966 nmdc:mga04h51_114287_c1 3300050495 Bacteria 999
967 nmdc:mga04h51_47957_c1 3300050495 Bacteria 1421
968 nmdc:mga07m45_13868_c1 3300050496 Bacteria 4283
969 nmdc:mga07m45_2631_c1 3300050496 Bacteria 8451
970 nmdc:mga07m45_53421_c1 3300050496 Bacteria 2283
971 nmdc:mga07m45_5517_c1 3300050496 Bacteria 6304
972 nmdc:mga07m45_6941_c1 3300050496 Bacteria 5758
973 nmdc:mga07m45_7349_c1 3300050496 Bacteria 5624
974 nmdc:mga05p37_69451_c1 3300050507 Bacteria 4333
975 nmdc:mga09592_381116_c1 3300050508 Bacteria 1219
976 nmdc:mga0qj67_133129_c1 3300050509 Bacteria 2014
977 nmdc:mga06r32_9686_c1 3300050510 Bacteria 8705
978 nmdc:mga08y16_71_c1 3300050511 Bacteria 84502
979 Ga0495601_0101590 3300053077 Bacteria 1857
980 Ga0495601_0124329 3300053077 Bacteria 1677
981 Ga0495612_0010858 3300053078 Bacteria 3680
982 Ga0500635_0011934 3300053080 Bacteria 2482
983 Ga0495595_0001806 3300053084 Bacteria 8340
984 Ga0495595_0075033 3300053084 Bacteria 1604
985 Ga0495595_0139953 3300053084 Bacteria 1187
986 Ga0495619_0059753 3300053085 Bacteria 2533
987 Ga0495619_0108585 3300053085 Bacteria 1894
988 Ga0495619_0124241 3300053085 Bacteria 1770
989 Ga0495619_0154852 3300053085 Bacteria 1581
990 Ga0500578_0094750 3300053086 Bacteria 1894
991 Ga0500583_0546241 3300053092 Bacteria 539
992 Ga0500566_0000072 3300053094 Bacteria 48857
993 Ga0500566_0003307 3300053094 Bacteria 9641
994 Ga0500554_004194 3300053102 Bacteria 3032
995 Ga0500595_000589 3300053119 Bacteria 21663
996 Ga0500595_002741 3300053119 Bacteria 8519
997 Ga0500595_096104 3300053119 Bacteria 853
998 Ga0500608_022018 3300053122 Bacteria 2952
999 Ga0500614_019971 3300053123 Bacteria 1541
1000 Ga0500559_0094526 3300053136 Bacteria 1372
1001 Ga0500568_0018322 3300053139 Bacteria 3067
1002 Ga0500568_0059007 3300053139 Bacteria 1489
1003 Ga0500590_017800 3300053148 Bacteria 3674
1004 Ga0500603_000091 3300053150 Bacteria 21606
1005 Ga0500630_002125 3300053159 Bacteria 9567
1006 Ga0500638_004644 3300053162 Bacteria 5335
1007 Ga0500638_107978 3300053162 Bacteria 1289
1008 Ga0500639_000478 3300053163 Bacteria 19952
1009 Ga0500636_0136038 3300053177 Bacteria 1364
1010 Ga0500637_0000302 3300053178 Bacteria 18681
1011 Ga0500637_0342028 3300053178 Bacteria 799
1012 Ga0500645_021713 3300053730 Bacteria 1979
1013 Ga0501084_0258132 3300054114 Bacteria 1471
1014 Ga0500661_003847 3300055283 Bacteria 2820
1015 Ga0466962_0025069 3300061719 Bacteria 2862
1016 Ga0530510_0380218 3300061734 Bacteria 1063

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0045854 Ga0501041_0045854_1546_2112 147
2 3300049576 Ga0501040_0126934 Ga0501040_0126934_437_997 152
3 3300049578 Ga0501042_0489903 Ga0501042_0489903_209_769 152
4 3300049591 Ga0501075_0215615 Ga0501075_0215615_469_1029 152
5 3300049743 Ga0501081_0018831 Ga0501081_0018831_2022_2582 152
6 3300054114 Ga0501084_0258132 Ga0501084_0258132_143_703 152
7 3300061734 Ga0530510_0380218 Ga0530510_0380218_356_916 152
8 3300005544 Ga0070686_100237719 Ga0070686_1002377193 153
9 3300005983 Ga0081540_1035958 Ga0081540_10359581 153
10 3300014326 Ga0157380_11103385 Ga0157380_111033852 154
11 3300047320 Ga0495672_0163529 Ga0495672_0163529_290_769 154
12 3300005329 Ga0070683_100404610 Ga0070683_1004046101 155
13 3300005616 Ga0068852_100094445 Ga0068852_1000944453 155
14 3300005842 Ga0068858_100159495 Ga0068858_1001594953 155
15 3300006163 Ga0070715_10013898 Ga0070715_100138982 155
16 3300006237 Ga0097621_100229999 Ga0097621_1002299993 155
17 3300009177 Ga0105248_10081205 Ga0105248_100812053 155
18 3300009551 Ga0105238_10269970 Ga0105238_102699702 155
19 3300010375 Ga0105239_10002730 Ga0105239_1000273010 155
20 3300025321 Ga0207656_10123197 Ga0207656_101231972 155
21 3300025924 Ga0207694_10449771 Ga0207694_104497712 155
22 3300025931 Ga0207644_10372927 Ga0207644_103729271 155
23 3300026035 Ga0207703_10833961 Ga0207703_108339611 155
24 3300035085 Ga0373929_0036554 Ga0373929_0036554_149_697 155
25 3300035113 Ga0373936_0121615 Ga0373936_0121615_439_981 155
26 3300035114 Ga0373939_0068988 Ga0373939_0068988_117_665 155
27 3300035691 Ga0373931_0004059 Ga0373931_0004059_2819_3367 155
28 3300035692 Ga0373935_0258046 Ga0373935_0258046_598_1146 155
29 3300048903 Ga0496100_1034811 Ga0496100_1034811_40_588 155
30 3300048904 Ga0496101_0166311 Ga0496101_0166311_262_810 155
31 3300048906 Ga0496103_0026277 Ga0496103_0026277_17_565 155
32 3300048907 Ga0496104_0041031 Ga0496104_0041031_2746_3294 155
33 3300048907 Ga0496104_0190843 Ga0496104_0190843_1350_1931 155
34 3300048908 Ga0496105_0052096 Ga0496105_0052096_1806_2354 155
35 3300048909 Ga0496106_0008322 Ga0496106_0008322_2199_2747 155
36 3300048910 Ga0496107_0014344 Ga0496107_0014344_265_813 155
37 3300048911 Ga0496108_0071481 Ga0496108_0071481_149_730 155
38 3300048912 Ga0496109_0059173 Ga0496109_0059173_172_720 155
39 3300048912 Ga0496109_1235856 Ga0496109_1235856_91_672 155
40 3300048913 Ga0496110_0042554 Ga0496110_0042554_2465_3013 155
41 3300048914 Ga0496111_0206895 Ga0496111_0206895_752_1300 155
42 3300048915 Ga0496112_0086130 Ga0496112_0086130_1448_1996 155
43 3300048915 Ga0496112_0157544 Ga0496112_0157544_1163_1744 155
44 3300048916 Ga0496113_0004759 Ga0496113_0004759_4585_5133 155
45 3300048916 Ga0496113_0110260 Ga0496113_0110260_167_748 155
46 3300053080 Ga0500635_0011934 Ga0500635_0011934_449_991 155
47 3300053094 Ga0500566_0000072 Ga0500566_0000072_33791_34333 155
48 3300053123 Ga0500614_019971 Ga0500614_019971_141_683 155
49 3300053150 Ga0500603_000091 Ga0500603_000091_475_1017 155
50 3300053159 Ga0500630_002125 Ga0500630_002125_8646_9188 155
51 3300053162 Ga0500638_107978 Ga0500638_107978_442_984 155
52 3300053163 Ga0500639_000478 Ga0500639_000478_18080_18622 155
53 3300053178 Ga0500637_0342028 Ga0500637_0342028_14_556 155
54 iso_pu_bacteria 2876808645 2876810313 155
55 iso_pu_bacteria 2879110137 2879114313 155
56 3300003791 Ga0055530_10000090 Ga0055530_1000009014 156
57 3300003794 Ga0055531_10011587 Ga0055531_100115873 156
58 3300005338 Ga0068868_100065715 Ga0068868_1000657155 156
59 3300005339 Ga0070660_100034252 Ga0070660_1000342524 156
60 3300005339 Ga0070660_100208653 Ga0070660_1002086532 156
61 3300005355 Ga0070671_100233877 Ga0070671_1002338773 156
62 3300005355 Ga0070671_100622389 Ga0070671_1006223891 156
63 3300005364 Ga0070673_100500610 Ga0070673_1005006102 156
64 3300005366 Ga0070659_100092787 Ga0070659_1000927875 156
65 3300005456 Ga0070678_100637208 Ga0070678_1006372081 156
66 3300005457 Ga0070662_100042086 Ga0070662_1000420865 156
67 3300005458 Ga0070681_10162733 Ga0070681_101627332 156
68 3300005530 Ga0070679_100085996 Ga0070679_1000859963 156
69 3300005539 Ga0068853_100000534 Ga0068853_1000005347 156
70 3300005539 Ga0068853_100089424 Ga0068853_1000894242 156
71 3300005539 Ga0068853_100782521 Ga0068853_1007825212 156
72 3300005548 Ga0070665_100000015 Ga0070665_100000015426 156
73 3300005563 Ga0068855_100209328 Ga0068855_1002093283 156
74 3300005614 Ga0068856_100329386 Ga0068856_1003293862 156
75 3300005616 Ga0068852_100541139 Ga0068852_1005411392 156
76 3300005616 Ga0068852_101449339 Ga0068852_1014493391 156
77 3300005618 Ga0068864_100005578 Ga0068864_10000557810 156
78 3300005841 Ga0068863_100089212 Ga0068863_1000892125 156
79 3300005842 Ga0068858_101140953 Ga0068858_1011409532 156
80 3300006051 Ga0075364_11125140 Ga0075364_111251401 156
81 3300006058 Ga0075432_10086362 Ga0075432_100863621 156
82 3300006195 Ga0075366_10012080 Ga0075366_100120806 156
83 3300006237 Ga0097621_100603024 Ga0097621_1006030242 156
84 3300006353 Ga0075370_10084819 Ga0075370_100848193 156
85 3300006881 Ga0068865_100010326 Ga0068865_10001032611 156
86 3300009093 Ga0105240_10013171 Ga0105240_1001317111 156
87 3300009093 Ga0105240_10085474 Ga0105240_100854744 156
88 3300009093 Ga0105240_10098021 Ga0105240_100980216 156
89 3300009174 Ga0105241_10259293 Ga0105241_102592932 156
90 3300009551 Ga0105238_10034659 Ga0105238_100346592 156
91 3300009551 Ga0105238_10053983 Ga0105238_100539836 156
92 3300009551 Ga0105238_10091391 Ga0105238_100913912 156
93 3300009551 Ga0105238_10687003 Ga0105238_106870031 156
94 3300009553 Ga0105249_10303720 Ga0105249_103037204 156
95 3300013306 Ga0163162_10082936 Ga0163162_100829367 156
96 3300013308 Ga0157375_10097366 Ga0157375_100973663 156
97 3300014325 Ga0163163_10052942 Ga0163163_100529425 156
98 3300014325 Ga0163163_10095599 Ga0163163_100955994 156
99 3300014325 Ga0163163_11186221 Ga0163163_111862212 156
100 3300025909 Ga0207705_10455173 Ga0207705_104551732 156
101 3300025919 Ga0207657_10029996 Ga0207657_100299962 156
102 3300027907 Ga0207428_10000098 Ga0207428_10000098105 156
103 3300039447 Ga0436361_0256361 Ga0436361_0256361_1202_1687 156
104 3300050493 nmdc:mga0k408_18465_c1 nmdc:mga0k408_18465_c1_2143_2622 156
105 3300050511 nmdc:mga08y16_71_c1 nmdc:mga08y16_71_c1_59660_60139 156
106 iso_pu_bacteria 2508501128 2509147075 156
107 3300005328 Ga0070676_10295820 Ga0070676_102958202 157
108 3300005336 Ga0070680_100006948 Ga0070680_1000069487 157
109 3300005341 Ga0070691_10006435 Ga0070691_100064353 157
110 3300005343 Ga0070687_100105042 Ga0070687_1001050421 157
111 3300005353 Ga0070669_100750962 Ga0070669_1007509621 157
112 3300005355 Ga0070671_100694395 Ga0070671_1006943952 157
113 3300005406 Ga0070703_10004941 Ga0070703_100049413 157
114 3300005435 Ga0070714_101387840 Ga0070714_1013878401 157
115 3300005438 Ga0070701_10016708 Ga0070701_100167083 157
116 3300005440 Ga0070705_100000274 Ga0070705_10000027428 157
117 3300005441 Ga0070700_100008253 Ga0070700_1000082535 157
118 3300005444 Ga0070694_100017655 Ga0070694_1000176554 157
119 3300005445 Ga0070708_100207858 Ga0070708_1002078582 157
120 3300005457 Ga0070662_100132740 Ga0070662_1001327402 157
121 3300005471 Ga0070698_100095479 Ga0070698_1000954791 157
122 3300005518 Ga0070699_100001895 Ga0070699_1000018957 157
123 3300005536 Ga0070697_100083215 Ga0070697_1000832152 157
124 3300005543 Ga0070672_100282598 Ga0070672_1002825981 157
125 3300005545 Ga0070695_100009399 Ga0070695_1000093993 157
126 3300005546 Ga0070696_100000144 Ga0070696_10000014436 157
127 3300005549 Ga0070704_100001504 Ga0070704_1000015048 157
128 3300005564 Ga0070664_101015478 Ga0070664_1010154782 157
129 3300005577 Ga0068857_100514128 Ga0068857_1005141282 157
130 3300005617 Ga0068859_100010211 Ga0068859_1000102118 157
131 3300005618 Ga0068864_100062295 Ga0068864_1000622952 157
132 3300005719 Ga0068861_100124412 Ga0068861_1001244122 157
133 3300005719 Ga0068861_100554935 Ga0068861_1005549352 157
134 3300005843 Ga0068860_100002707 Ga0068860_10000270719 157
135 3300005844 Ga0068862_100006297 Ga0068862_1000062979 157
136 3300005981 Ga0081538_10021290 Ga0081538_100212906 157
137 3300006237 Ga0097621_101356393 Ga0097621_1013563932 157
138 3300006844 Ga0075428_100037961 Ga0075428_1000379617 157
139 3300006846 Ga0075430_100141446 Ga0075430_1001414463 157
140 3300006847 Ga0075431_100056480 Ga0075431_1000564805 157
141 3300006931 Ga0097620_100010212 Ga0097620_1000102128 157
142 3300009098 Ga0105245_10491786 Ga0105245_104917861 157
143 3300009553 Ga0105249_10134118 Ga0105249_101341181 157
144 3300009553 Ga0105249_10172734 Ga0105249_101727343 157
145 3300011119 Ga0105246_10321268 Ga0105246_103212682 157
146 3300013105 Ga0157369_11168944 Ga0157369_111689442 157
147 3300013296 Ga0157374_10268968 Ga0157374_102689682 157
148 3300013297 Ga0157378_10804753 Ga0157378_108047531 157
149 3300014968 Ga0157379_10348252 Ga0157379_103482522 157
150 3300021361 Ga0213872_10020494 Ga0213872_100204942 157
151 3300021377 Ga0213874_10013909 Ga0213874_100139093 157
152 3300021384 Ga0213876_10000320 Ga0213876_1000032021 157
153 3300021384 Ga0213876_10078214 Ga0213876_100782142 157
154 3300021388 Ga0213875_10145273 Ga0213875_101452732 157
155 3300025917 Ga0207660_10014201 Ga0207660_100142013 157
156 3300025927 Ga0207687_10684489 Ga0207687_106844892 157
157 3300025933 Ga0207706_10114233 Ga0207706_101142331 157
158 3300025935 Ga0207709_10374788 Ga0207709_103747882 157
159 3300025942 Ga0207689_10300263 Ga0207689_103002631 157
160 3300025961 Ga0207712_10119023 Ga0207712_101190233 157
161 3300025961 Ga0207712_10986626 Ga0207712_109866262 157
162 3300025972 Ga0207668_10050945 Ga0207668_100509455 157
163 3300026075 Ga0207708_10012007 Ga0207708_100120076 157
164 3300026088 Ga0207641_10068611 Ga0207641_100686113 157
165 3300026095 Ga0207676_10101927 Ga0207676_101019272 157
166 3300026116 Ga0207674_10024173 Ga0207674_100241737 157
167 3300026118 Ga0207675_100160619 Ga0207675_1001606192 157
168 3300026118 Ga0207675_100332382 Ga0207675_1003323822 157
169 3300028380 Ga0268265_10025046 Ga0268265_100250465 157
170 3300028381 Ga0268264_10004187 Ga0268264_1000418711 157
171 3300031250 Ga0265331_10111470 Ga0265331_101114702 157
172 3300031251 Ga0265327_10001569 Ga0265327_1000156922 157
173 3300031507 Ga0307509_10005866 Ga0307509_100058664 157
174 3300034819 Ga0373958_0118009 Ga0373958_0118009_95_604 157
175 3300035089 Ga0373944_0019778 Ga0373944_0019778_475_1014 157
176 3300037312 Ga0395899_0331913 Ga0395899_0331913_307_789 157
177 3300037418 Ga0395900_0251576 Ga0395900_0251576_1004_1486 157
178 3300037466 Ga0395898_0012212 Ga0395898_0012212_2505_2987 157
179 3300037853 Ga0436364_0482689 Ga0436364_0482689_420_908 157
180 3300039437 Ga0436365_0274646 Ga0436365_0274646_3588_4076 157
181 3300039437 Ga0436365_1345740 Ga0436365_1345740_4117_4596 157
182 3300039447 Ga0436361_1015175 Ga0436361_1015175_2038_2523 157
183 3300039450 Ga0436363_1257368 Ga0436363_1257368_628_1107 157
184 3300041456 Ga0451795_1224247 Ga0451795_1224247_77_574 157
185 3300042134 Ga0450898_085726 Ga0450898_085726_54_608 157
186 3300046473 Ga0495582_0762436 Ga0495582_0762436_27_506 157
187 3300046515 Ga0495620_0111324 Ga0495620_0111324_145_627 157
188 3300047444 Ga0495675_0451011 Ga0495675_0451011_170_700 157
189 3300048905 Ga0496102_0007582 Ga0496102_0007582_6479_6988 157
190 3300048905 Ga0496102_1074809 Ga0496102_1074809_132_626 157
191 3300048906 Ga0496103_0012760 Ga0496103_0012760_2656_3165 157
192 3300048908 Ga0496105_0076564 Ga0496105_0076564_1572_2081 157
193 3300048909 Ga0496106_0005275 Ga0496106_0005275_5511_6020 157
194 3300048915 Ga0496112_0035167 Ga0496112_0035167_2797_3330 157
195 3300048916 Ga0496113_0151546 Ga0496113_0151546_917_1450 157
196 3300050492 nmdc:mga0yw44_191524_c1 nmdc:mga0yw44_191524_c1_201_764 157
197 3300050507 nmdc:mga05p37_69451_c1 nmdc:mga05p37_69451_c1_2427_2981 157
198 3300050508 nmdc:mga09592_381116_c1 nmdc:mga09592_381116_c1_219_773 157
199 3300050509 nmdc:mga0qj67_133129_c1 nmdc:mga0qj67_133129_c1_393_947 157
200 3300050510 nmdc:mga06r32_9686_c1 nmdc:mga06r32_9686_c1_1745_2299 157
201 3300053085 Ga0495619_0108585 Ga0495619_0108585_1273_1803 157
202 3300053119 Ga0500595_096104 Ga0500595_096104_227_706 157
203 3300003203 JGI25406J46586_10003368 JGI25406J46586_100033683 158
204 3300003752 Ga0055539_1000310 Ga0055539_100031016 158
205 3300003756 Ga0055533_1000010 Ga0055533_1000010385 158
206 3300005327 Ga0070658_10029468 Ga0070658_100294684 158
207 3300005329 Ga0070683_100012316 Ga0070683_1000123161 158
208 3300005329 Ga0070683_100352552 Ga0070683_1003525522 158
209 3300005334 Ga0068869_100002609 Ga0068869_10000260911 158
210 3300005335 Ga0070666_10067577 Ga0070666_100675774 158
211 3300005336 Ga0070680_100006496 Ga0070680_1000064964 158
212 3300005339 Ga0070660_100066556 Ga0070660_1000665563 158
213 3300005339 Ga0070660_100383487 Ga0070660_1003834872 158
214 3300005344 Ga0070661_100141353 Ga0070661_1001413531 158
215 3300005344 Ga0070661_100844233 Ga0070661_1008442332 158
216 3300005347 Ga0070668_100018414 Ga0070668_1000184146 158
217 3300005347 Ga0070668_100130277 Ga0070668_1001302773 158
218 3300005353 Ga0070669_100005334 Ga0070669_1000053343 158
219 3300005354 Ga0070675_100034949 Ga0070675_1000349494 158
220 3300005355 Ga0070671_100092111 Ga0070671_1000921112 158
221 3300005366 Ga0070659_100115723 Ga0070659_1001157231 158
222 3300005366 Ga0070659_100164583 Ga0070659_1001645831 158
223 3300005367 Ga0070667_100197297 Ga0070667_1001972972 158
224 3300005438 Ga0070701_10873952 Ga0070701_108739521 158
225 3300005455 Ga0070663_100008842 Ga0070663_1000088422 158
226 3300005456 Ga0070678_100629240 Ga0070678_1006292401 158
227 3300005457 Ga0070662_100650011 Ga0070662_1006500112 158
228 3300005458 Ga0070681_10074065 Ga0070681_100740653 158
229 3300005530 Ga0070679_100005291 Ga0070679_1000052913 158
230 3300005535 Ga0070684_100307910 Ga0070684_1003079101 158
231 3300005535 Ga0070684_100684755 Ga0070684_1006847552 158
232 3300005539 Ga0068853_100373643 Ga0068853_1003736431 158
233 3300005547 Ga0070693_100529227 Ga0070693_1005292272 158
234 3300005563 Ga0068855_100179051 Ga0068855_1001790513 158
235 3300005564 Ga0070664_100020489 Ga0070664_1000204897 158
236 3300005577 Ga0068857_100075687 Ga0068857_1000756873 158
237 3300005577 Ga0068857_100991210 Ga0068857_1009912101 158
238 3300005578 Ga0068854_100060190 Ga0068854_1000601903 158
239 3300005578 Ga0068854_100146967 Ga0068854_1001469671 158
240 3300005614 Ga0068856_100021624 Ga0068856_1000216241 158
241 3300005614 Ga0068856_101089069 Ga0068856_1010890692 158
242 3300005616 Ga0068852_100178858 Ga0068852_1001788581 158
243 3300005616 Ga0068852_100201137 Ga0068852_1002011371 158
244 3300005618 Ga0068864_100663254 Ga0068864_1006632541 158
245 3300005719 Ga0068861_100003183 Ga0068861_10000318311 158
246 3300005834 Ga0068851_10152401 Ga0068851_101524011 158
247 3300005841 Ga0068863_100389617 Ga0068863_1003896172 158
248 3300005844 Ga0068862_100033250 Ga0068862_1000332503 158
249 3300005985 Ga0081539_10000617 Ga0081539_1000061711 158
250 3300006237 Ga0097621_100326286 Ga0097621_1003262861 158
251 3300006358 Ga0068871_100049854 Ga0068871_1000498543 158
252 3300009093 Ga0105240_10503646 Ga0105240_105036462 158
253 3300009094 Ga0111539_10239408 Ga0111539_102394083 158
254 3300009098 Ga0105245_10033929 Ga0105245_100339294 158
255 3300009174 Ga0105241_10284041 Ga0105241_102840411 158
256 3300009177 Ga0105248_10008033 Ga0105248_1000803311 158
257 3300009545 Ga0105237_10136637 Ga0105237_101366372 158
258 3300009551 Ga0105238_10013227 Ga0105238_100132271 158
259 3300009551 Ga0105238_10835669 Ga0105238_108356691 158
260 3300009551 Ga0105238_11361673 Ga0105238_113616732 158
261 3300010375 Ga0105239_10241157 Ga0105239_102411572 158
262 3300013100 Ga0157373_10012235 Ga0157373_100122354 158
263 3300013105 Ga0157369_10004416 Ga0157369_1000441611 158
264 3300013296 Ga0157374_10007118 Ga0157374_1000711811 158
265 3300013306 Ga0163162_10011386 Ga0163162_100113865 158
266 3300013307 Ga0157372_10010659 Ga0157372_1001065911 158
267 3300013307 Ga0157372_10252013 Ga0157372_102520131 158
268 3300013308 Ga0157375_11167751 Ga0157375_111677512 158
269 3300014745 Ga0157377_10352414 Ga0157377_103524142 158
270 3300014968 Ga0157379_10010452 Ga0157379_100104527 158
271 3300014969 Ga0157376_10081366 Ga0157376_100813663 158
272 3300017792 Ga0163161_10029214 Ga0163161_100292143 158
273 3300025226 Ga0209674_100003 Ga0209674_1000031719 158
274 3300025230 Ga0209563_100049 Ga0209563_100049181 158
275 3300025253 Ga0209677_100050 Ga0209677_100050138 158
276 3300025315 Ga0207697_10051694 Ga0207697_100516942 158
277 3300025321 Ga0207656_10106025 Ga0207656_101060252 158
278 3300025900 Ga0207710_10023200 Ga0207710_100232002 158
279 3300025901 Ga0207688_10035566 Ga0207688_100355662 158
280 3300025909 Ga0207705_10063288 Ga0207705_100632882 158
281 3300025911 Ga0207654_10140240 Ga0207654_101402403 158
282 3300025912 Ga0207707_10168156 Ga0207707_101681561 158
283 3300025917 Ga0207660_10025665 Ga0207660_100256652 158
284 3300025919 Ga0207657_10363682 Ga0207657_103636821 158
285 3300025919 Ga0207657_10689728 Ga0207657_106897282 158
286 3300025920 Ga0207649_10087335 Ga0207649_100873352 158
287 3300025921 Ga0207652_10096240 Ga0207652_100962403 158
288 3300025923 Ga0207681_10112035 Ga0207681_101120352 158
289 3300025924 Ga0207694_10031813 Ga0207694_100318134 158
290 3300025924 Ga0207694_10767015 Ga0207694_107670152 158
291 3300025926 Ga0207659_10455249 Ga0207659_104552491 158
292 3300025927 Ga0207687_10028883 Ga0207687_100288833 158
293 3300025931 Ga0207644_10475583 Ga0207644_104755832 158
294 3300025932 Ga0207690_10228431 Ga0207690_102284311 158
295 3300025932 Ga0207690_10531001 Ga0207690_105310011 158
296 3300025933 Ga0207706_10005446 Ga0207706_100054462 158
297 3300025941 Ga0207711_10179546 Ga0207711_101795463 158
298 3300025942 Ga0207689_10000550 Ga0207689_1000055024 158
299 3300025944 Ga0207661_10009060 Ga0207661_100090603 158
300 3300025944 Ga0207661_10246521 Ga0207661_102465212 158
301 3300025945 Ga0207679_10003726 Ga0207679_1000372612 158
302 3300025945 Ga0207679_10361897 Ga0207679_103618971 158
303 3300025949 Ga0207667_10180435 Ga0207667_101804352 158
304 3300025972 Ga0207668_10428276 Ga0207668_104282761 158
305 3300025981 Ga0207640_10138846 Ga0207640_101388463 158
306 3300025981 Ga0207640_10167522 Ga0207640_101675221 158
307 3300026023 Ga0207677_10005039 Ga0207677_100050395 158
308 3300026035 Ga0207703_10140792 Ga0207703_101407923 158
309 3300026041 Ga0207639_10048460 Ga0207639_100484603 158
310 3300026078 Ga0207702_10004454 Ga0207702_1000445412 158
311 3300026078 Ga0207702_10609855 Ga0207702_106098552 158
312 3300026078 Ga0207702_10683692 Ga0207702_106836922 158
313 3300026088 Ga0207641_10040743 Ga0207641_100407432 158
314 3300026095 Ga0207676_10105250 Ga0207676_101052502 158
315 3300026116 Ga0207674_10732725 Ga0207674_107327251 158
316 3300026116 Ga0207674_11115352 Ga0207674_111153522 158
317 3300026118 Ga0207675_100000576 Ga0207675_10000057624 158
318 3300026121 Ga0207683_10088749 Ga0207683_100887493 158
319 3300026142 Ga0207698_10007575 Ga0207698_100075752 158
320 3300026142 Ga0207698_10009788 Ga0207698_100097884 158
321 3300028380 Ga0268265_10067092 Ga0268265_100670923 158
322 3300028381 Ga0268264_10032705 Ga0268264_100327052 158
323 3300031901 Ga0307406_10390720 Ga0307406_103907202 158
324 3300032002 Ga0307416_100092178 Ga0307416_1000921784 158
325 3300035112 Ga0373932_0112300 Ga0373932_0112300_325_804 158
326 3300035114 Ga0373939_0025744 Ga0373939_0025744_836_1315 158
327 3300035114 Ga0373939_0201822 Ga0373939_0201822_236_727 158
328 3300035115 Ga0373941_0016087 Ga0373941_0016087_607_1086 158
329 3300035117 Ga0373953_0001844 Ga0373953_0001844_3700_4212 158
330 3300035118 Ga0373954_0036066 Ga0373954_0036066_938_1450 158
331 3300035120 Ga0373957_0201631 Ga0373957_0201631_245_766 158
332 3300035172 Ga0373955_0011070 Ga0373955_0011070_1783_2295 158
333 3300035242 Ga0373962_0004177 Ga0373962_0004177_1100_1579 158
334 3300035692 Ga0373935_0278951 Ga0373935_0278951_333_845 158
335 3300039453 Ga0436362_0531272 Ga0436362_0531272_42_527 158
336 3300041453 Ga0451797_0909590 Ga0451797_0909590_423_971 158
337 3300046459 Ga0495629_0153929 Ga0495629_0153929_453_965 158
338 3300046462 Ga0495651_0009538 Ga0495651_0009538_2333_2845 158
339 3300046463 Ga0495653_0021947 Ga0495653_0021947_2724_3236 158
340 3300046477 Ga0495664_0020652 Ga0495664_0020652_1223_1735 158
341 3300046507 Ga0495606_0001165 Ga0495606_0001165_13838_14320 158
342 3300046511 Ga0495608_0041349 Ga0495608_0041349_22_534 158
343 3300046514 Ga0495618_0021531 Ga0495618_0021531_2263_2775 158
344 3300046517 Ga0495630_0140350 Ga0495630_0140350_1239_1751 158
345 3300046533 Ga0495640_0095188 Ga0495640_0095188_1250_1762 158
346 3300046535 Ga0495586_0010203 Ga0495586_0010203_1659_2171 158
347 3300046536 Ga0495587_0023347 Ga0495587_0023347_1506_2018 158
348 3300046543 Ga0495645_0008575 Ga0495645_0008575_2657_3169 158
349 3300046559 Ga0495667_0038481 Ga0495667_0038481_1089_1601 158
350 3300046642 Ga0495634_0026497 Ga0495634_0026497_2722_3234 158
351 3300046663 Ga0495635_0054202 Ga0495635_0054202_992_1504 158
352 3300046675 Ga0495657_0082376 Ga0495657_0082376_566_1078 158
353 3300046678 Ga0495599_0091927 Ga0495599_0091927_519_1031 158
354 3300046679 Ga0495623_0056506 Ga0495623_0056506_1783_2295 158
355 3300046679 Ga0495623_0503271 Ga0495623_0503271_21_554 158
356 3300046680 Ga0495646_0051164 Ga0495646_0051164_1427_1939 158
357 3300046689 Ga0495613_0079173 Ga0495613_0079173_1012_1524 158
358 3300046809 Ga0495600_0021231 Ga0495600_0021231_1102_1614 158
359 3300047317 Ga0495604_0073588 Ga0495604_0073588_1081_1593 158
360 3300047322 Ga0495680_0011531 Ga0495680_0011531_2688_3200 158
361 3300047444 Ga0495675_0025108 Ga0495675_0025108_1084_1596 158
362 3300047471 Ga0495684_0141527 Ga0495684_0141527_84_596 158
363 3300048088 Ga0495602_0077100 Ga0495602_0077100_1452_1964 158
364 3300048904 Ga0496101_0079654 Ga0496101_0079654_1182_1661 158
365 3300048905 Ga0496102_0175593 Ga0496102_0175593_1222_1701 158
366 3300048909 Ga0496106_0479362 Ga0496106_0479362_209_688 158
367 3300048910 Ga0496107_0785578 Ga0496107_0785578_161_640 158
368 3300048911 Ga0496108_0213026 Ga0496108_0213026_25_504 158
369 3300048912 Ga0496109_0628642 Ga0496109_0628642_173_652 158
370 3300048913 Ga0496110_0002997 Ga0496110_0002997_4122_4601 158
371 3300048915 Ga0496112_0731559 Ga0496112_0731559_156_635 158
372 3300048916 Ga0496113_0043328 Ga0496113_0043328_1448_1927 158
373 3300048917 Ga0496114_0314103 Ga0496114_0314103_843_1322 158
374 3300048918 Ga0496115_0085405 Ga0496115_0085405_670_1149 158
375 3300049575 Ga0501039_0293243 Ga0501039_0293243_452_985 158
376 3300049587 Ga0501071_0578945 Ga0501071_0578945_51_542 158
377 3300049588 Ga0501072_0724123 Ga0501072_0724123_36_569 158
378 3300049591 Ga0501075_0777819 Ga0501075_0777819_177_710 158
379 3300049592 Ga0501076_0108269 Ga0501076_0108269_298_789 158
380 3300049593 Ga0501077_0439517 Ga0501077_0439517_269_802 158
381 3300050493 nmdc:mga0k408_27324_c1 nmdc:mga0k408_27324_c1_16_495 158
382 3300053077 Ga0495601_0101590 Ga0495601_0101590_1220_1732 158
383 3300053078 Ga0495612_0010858 Ga0495612_0010858_2011_2523 158
384 3300053085 Ga0495619_0124241 Ga0495619_0124241_39_551 158
385 3300053094 Ga0500566_0003307 Ga0500566_0003307_2048_2623 158
386 3300053102 Ga0500554_004194 Ga0500554_004194_338_913 158
387 3300053119 Ga0500595_000589 Ga0500595_000589_10120_10662 158
388 3300053119 Ga0500595_002741 Ga0500595_002741_5912_6487 158
389 3300053136 Ga0500559_0094526 Ga0500559_0094526_15_620 158
390 3300053162 Ga0500638_004644 Ga0500638_004644_4095_4670 158
391 3300053178 Ga0500637_0000302 Ga0500637_0000302_13126_13701 158
392 3300055283 Ga0500661_003847 Ga0500661_003847_771_1346 158
393 3300002705 JGI25156J39149_1000441 JGI25156J39149_100044119 159
394 3300002738 JGI25154J39366_1001707 JGI25154J39366_10017073 159
395 3300002741 JGI25157J39369_1000029 JGI25157J39369_1000029116 159
396 3300005327 Ga0070658_10723216 Ga0070658_107232161 159
397 3300005328 Ga0070676_10254885 Ga0070676_102548852 159
398 3300005328 Ga0070676_10655148 Ga0070676_106551481 159
399 3300005330 Ga0070690_100043087 Ga0070690_1000430871 159
400 3300005331 Ga0070670_100001996 Ga0070670_1000019965 159
401 3300005331 Ga0070670_100317037 Ga0070670_1003170372 159
402 3300005331 Ga0070670_100371798 Ga0070670_1003717981 159
403 3300005331 Ga0070670_100499518 Ga0070670_1004995181 159
404 3300005331 Ga0070670_101364923 Ga0070670_1013649231 159
405 3300005333 Ga0070677_10035705 Ga0070677_100357052 159
406 3300005334 Ga0068869_100104367 Ga0068869_1001043671 159
407 3300005334 Ga0068869_101024787 Ga0068869_1010247871 159
408 3300005335 Ga0070666_10001744 Ga0070666_100017442 159
409 3300005337 Ga0070682_100286063 Ga0070682_1002860632 159
410 3300005338 Ga0068868_100050964 Ga0068868_1000509641 159
411 3300005338 Ga0068868_100563350 Ga0068868_1005633502 159
412 3300005339 Ga0070660_100142089 Ga0070660_1001420892 159
413 3300005340 Ga0070689_100298032 Ga0070689_1002980322 159
414 3300005344 Ga0070661_100076457 Ga0070661_1000764573 159
415 3300005344 Ga0070661_100497429 Ga0070661_1004974292 159
416 3300005344 Ga0070661_100743402 Ga0070661_1007434021 159
417 3300005344 Ga0070661_100832769 Ga0070661_1008327691 159
418 3300005347 Ga0070668_100001912 Ga0070668_1000019121 159
419 3300005353 Ga0070669_100017767 Ga0070669_1000177671 159
420 3300005353 Ga0070669_100664583 Ga0070669_1006645832 159
421 3300005353 Ga0070669_100956205 Ga0070669_1009562051 159
422 3300005354 Ga0070675_100018417 Ga0070675_1000184174 159
423 3300005354 Ga0070675_100129939 Ga0070675_1001299393 159
424 3300005354 Ga0070675_100271144 Ga0070675_1002711442 159
425 3300005355 Ga0070671_100045432 Ga0070671_1000454325 159
426 3300005355 Ga0070671_100332322 Ga0070671_1003323222 159
427 3300005355 Ga0070671_100599977 Ga0070671_1005999771 159
428 3300005355 Ga0070671_100617343 Ga0070671_1006173432 159
429 3300005355 Ga0070671_100618580 Ga0070671_1006185801 159
430 3300005356 Ga0070674_100065144 Ga0070674_1000651441 159
431 3300005356 Ga0070674_100748185 Ga0070674_1007481852 159
432 3300005364 Ga0070673_100247511 Ga0070673_1002475112 159
433 3300005364 Ga0070673_100376247 Ga0070673_1003762471 159
434 3300005364 Ga0070673_100404315 Ga0070673_1004043152 159
435 3300005364 Ga0070673_100826492 Ga0070673_1008264922 159
436 3300005365 Ga0070688_100943877 Ga0070688_1009438771 159
437 3300005366 Ga0070659_101041513 Ga0070659_1010415131 159
438 3300005367 Ga0070667_100013141 Ga0070667_1000131418 159
439 3300005367 Ga0070667_100364933 Ga0070667_1003649331 159
440 3300005435 Ga0070714_100080128 Ga0070714_1000801282 159
441 3300005455 Ga0070663_100076689 Ga0070663_1000766894 159
442 3300005455 Ga0070663_100425029 Ga0070663_1004250292 159
443 3300005456 Ga0070678_100114485 Ga0070678_1001144852 159
444 3300005456 Ga0070678_100137173 Ga0070678_1001371733 159
445 3300005456 Ga0070678_100301671 Ga0070678_1003016712 159
446 3300005456 Ga0070678_100470944 Ga0070678_1004709442 159
447 3300005456 Ga0070678_100702022 Ga0070678_1007020222 159
448 3300005459 Ga0068867_100017625 Ga0068867_1000176256 159
449 3300005459 Ga0068867_100812925 Ga0068867_1008129252 159
450 3300005467 Ga0070706_100115678 Ga0070706_1001156782 159
451 3300005468 Ga0070707_100115367 Ga0070707_1001153672 159
452 3300005471 Ga0070698_100016443 Ga0070698_1000164431 159
453 3300005535 Ga0070684_100020787 Ga0070684_1000207877 159
454 3300005536 Ga0070697_100167989 Ga0070697_1001679891 159
455 3300005543 Ga0070672_100033366 Ga0070672_1000333662 159
456 3300005543 Ga0070672_100781184 Ga0070672_1007811841 159
457 3300005544 Ga0070686_100189641 Ga0070686_1001896413 159
458 3300005547 Ga0070693_100335695 Ga0070693_1003356952 159
459 3300005548 Ga0070665_100095104 Ga0070665_1000951043 159
460 3300005548 Ga0070665_100554362 Ga0070665_1005543622 159
461 3300005563 Ga0068855_100030535 Ga0068855_1000305352 159
462 3300005564 Ga0070664_100146650 Ga0070664_1001466502 159
463 3300005564 Ga0070664_100392951 Ga0070664_1003929511 159
464 3300005564 Ga0070664_101389635 Ga0070664_1013896351 159
465 3300005577 Ga0068857_100002542 Ga0068857_1000025425 159
466 3300005578 Ga0068854_100012169 Ga0068854_1000121697 159
467 3300005578 Ga0068854_100088278 Ga0068854_1000882781 159
468 3300005578 Ga0068854_100182664 Ga0068854_1001826642 159
469 3300005578 Ga0068854_100768018 Ga0068854_1007680182 159
470 3300005614 Ga0068856_100003174 Ga0068856_1000031745 159
471 3300005615 Ga0070702_100385695 Ga0070702_1003856951 159
472 3300005616 Ga0068852_100238240 Ga0068852_1002382401 159
473 3300005616 Ga0068852_100989743 Ga0068852_1009897432 159
474 3300005617 Ga0068859_100567876 Ga0068859_1005678762 159
475 3300005618 Ga0068864_100001915 Ga0068864_10000191512 159
476 3300005618 Ga0068864_100047489 Ga0068864_1000474895 159
477 3300005718 Ga0068866_10005777 Ga0068866_100057772 159
478 3300005718 Ga0068866_10857448 Ga0068866_108574481 159
479 3300005719 Ga0068861_100200015 Ga0068861_1002000152 159
480 3300005834 Ga0068851_10102836 Ga0068851_101028362 159
481 3300005834 Ga0068851_10327412 Ga0068851_103274122 159
482 3300005841 Ga0068863_100011347 Ga0068863_1000113479 159
483 3300005841 Ga0068863_100616797 Ga0068863_1006167971 159
484 3300005843 Ga0068860_100267957 Ga0068860_1002679572 159
485 3300005844 Ga0068862_100041742 Ga0068862_1000417424 159
486 3300006028 Ga0070717_10358474 Ga0070717_103584742 159
487 3300006195 Ga0075366_10192843 Ga0075366_101928433 159
488 3300006195 Ga0075366_10220835 Ga0075366_102208352 159
489 3300006237 Ga0097621_100072627 Ga0097621_1000726273 159
490 3300006237 Ga0097621_100105115 Ga0097621_1001051153 159
491 3300006237 Ga0097621_100126855 Ga0097621_1001268553 159
492 3300006237 Ga0097621_101519783 Ga0097621_1015197831 159
493 3300006358 Ga0068871_100006827 Ga0068871_1000068275 159
494 3300006358 Ga0068871_100046827 Ga0068871_1000468274 159
495 3300006881 Ga0068865_100013714 Ga0068865_1000137146 159
496 3300006931 Ga0097620_100567860 Ga0097620_1005678602 159
497 3300009093 Ga0105240_10051215 Ga0105240_100512155 159
498 3300009093 Ga0105240_10118401 Ga0105240_101184011 159
499 3300009098 Ga0105245_10081246 Ga0105245_100812463 159
500 3300009098 Ga0105245_10100259 Ga0105245_101002592 159
501 3300009101 Ga0105247_10722166 Ga0105247_107221661 159
502 3300009148 Ga0105243_10004595 Ga0105243_100045955 159
503 3300009177 Ga0105248_10834043 Ga0105248_108340431 159
504 3300009545 Ga0105237_10037720 Ga0105237_100377204 159
505 3300009545 Ga0105237_10085690 Ga0105237_100856902 159
506 3300009551 Ga0105238_10167006 Ga0105238_101670062 159
507 3300009553 Ga0105249_10536865 Ga0105249_105368651 159
508 3300009553 Ga0105249_11162630 Ga0105249_111626301 159
509 3300010375 Ga0105239_10029727 Ga0105239_100297275 159
510 3300010375 Ga0105239_10033427 Ga0105239_100334275 159
511 3300011119 Ga0105246_10142595 Ga0105246_101425953 159
512 3300013105 Ga0157369_10233802 Ga0157369_102338023 159
513 3300013296 Ga0157374_10095353 Ga0157374_100953535 159
514 3300013296 Ga0157374_10653393 Ga0157374_106533932 159
515 3300013297 Ga0157378_10247821 Ga0157378_102478212 159
516 3300013297 Ga0157378_10282318 Ga0157378_102823181 159
517 3300013297 Ga0157378_10286921 Ga0157378_102869212 159
518 3300013306 Ga0163162_10013440 Ga0163162_1001344012 159
519 3300013307 Ga0157372_11067182 Ga0157372_110671822 159
520 3300013308 Ga0157375_10004510 Ga0157375_1000451012 159
521 3300013308 Ga0157375_10092181 Ga0157375_100921812 159
522 3300013308 Ga0157375_10126249 Ga0157375_101262492 159
523 3300013308 Ga0157375_11069189 Ga0157375_110691892 159
524 3300013308 Ga0157375_12201351 Ga0157375_122013511 159
525 3300014325 Ga0163163_10084865 Ga0163163_100848654 159
526 3300014325 Ga0163163_10330491 Ga0163163_103304912 159
527 3300014497 Ga0182008_10807465 Ga0182008_108074651 159
528 3300014745 Ga0157377_10575874 Ga0157377_105758742 159
529 3300014968 Ga0157379_10330220 Ga0157379_103302202 159
530 3300014968 Ga0157379_10480377 Ga0157379_104803772 159
531 3300014968 Ga0157379_10600370 Ga0157379_106003701 159
532 3300014968 Ga0157379_11119126 Ga0157379_111191261 159
533 3300014969 Ga0157376_10004195 Ga0157376_100041958 159
534 3300014969 Ga0157376_10933886 Ga0157376_109338861 159
535 3300017792 Ga0163161_10148429 Ga0163161_101484293 159
536 3300021384 Ga0213876_10013845 Ga0213876_100138454 159
537 3300025246 Ga0209646_1000257 Ga0209646_100025737 159
538 3300025250 Ga0209026_1000054 Ga0209026_100005471 159
539 3300025253 Ga0209677_100316 Ga0209677_1003169 159
540 3300025256 Ga0209759_1000043 Ga0209759_1000043156 159
541 3300025256 Ga0209759_1007372 Ga0209759_10073723 159
542 3300025271 Ga0207666_1034245 Ga0207666_10342451 159
543 3300025315 Ga0207697_10072947 Ga0207697_100729472 159
544 3300025321 Ga0207656_10079392 Ga0207656_100793922 159
545 3300025901 Ga0207688_10021261 Ga0207688_100212614 159
546 3300025903 Ga0207680_10574620 Ga0207680_105746202 159
547 3300025907 Ga0207645_10013318 Ga0207645_100133182 159
548 3300025907 Ga0207645_10033535 Ga0207645_100335354 159
549 3300025907 Ga0207645_10389387 Ga0207645_103893871 159
550 3300025908 Ga0207643_10140986 Ga0207643_101409863 159
551 3300025908 Ga0207643_10284330 Ga0207643_102843301 159
552 3300025909 Ga0207705_10377252 Ga0207705_103772522 159
553 3300025909 Ga0207705_10761505 Ga0207705_107615051 159
554 3300025910 Ga0207684_10092637 Ga0207684_100926371 159
555 3300025914 Ga0207671_10111436 Ga0207671_101114362 159
556 3300025914 Ga0207671_10598003 Ga0207671_105980031 159
557 3300025917 Ga0207660_10013863 Ga0207660_100138633 159
558 3300025919 Ga0207657_10017177 Ga0207657_100171778 159
559 3300025920 Ga0207649_10701527 Ga0207649_107015272 159
560 3300025922 Ga0207646_10174411 Ga0207646_101744111 159
561 3300025922 Ga0207646_11569991 Ga0207646_115699911 159
562 3300025923 Ga0207681_10006059 Ga0207681_100060595 159
563 3300025924 Ga0207694_10013700 Ga0207694_100137008 159
564 3300025925 Ga0207650_10008713 Ga0207650_100087134 159
565 3300025925 Ga0207650_10021070 Ga0207650_100210701 159
566 3300025925 Ga0207650_10524697 Ga0207650_105246971 159
567 3300025926 Ga0207659_10027360 Ga0207659_100273604 159
568 3300025927 Ga0207687_10140822 Ga0207687_101408222 159
569 3300025927 Ga0207687_10145092 Ga0207687_101450921 159
570 3300025928 Ga0207700_10251354 Ga0207700_102513543 159
571 3300025929 Ga0207664_10093577 Ga0207664_100935772 159
572 3300025931 Ga0207644_10111536 Ga0207644_101115361 159
573 3300025931 Ga0207644_10424186 Ga0207644_104241862 159
574 3300025931 Ga0207644_10548773 Ga0207644_105487731 159
575 3300025931 Ga0207644_10774640 Ga0207644_107746401 159
576 3300025931 Ga0207644_11000790 Ga0207644_110007901 159
577 3300025931 Ga0207644_11012014 Ga0207644_110120142 159
578 3300025932 Ga0207690_10586255 Ga0207690_105862552 159
579 3300025933 Ga0207706_10256036 Ga0207706_102560363 159
580 3300025935 Ga0207709_10164485 Ga0207709_101644852 159
581 3300025936 Ga0207670_10527379 Ga0207670_105273792 159
582 3300025937 Ga0207669_10005530 Ga0207669_100055305 159
583 3300025938 Ga0207704_10009803 Ga0207704_100098033 159
584 3300025940 Ga0207691_10055485 Ga0207691_100554854 159
585 3300025940 Ga0207691_10191803 Ga0207691_101918033 159
586 3300025940 Ga0207691_10208810 Ga0207691_102088102 159
587 3300025940 Ga0207691_10374450 Ga0207691_103744501 159
588 3300025940 Ga0207691_10382534 Ga0207691_103825342 159
589 3300025941 Ga0207711_10060901 Ga0207711_100609011 159
590 3300025941 Ga0207711_11017865 Ga0207711_110178651 159
591 3300025942 Ga0207689_10005418 Ga0207689_100054183 159
592 3300025942 Ga0207689_10232972 Ga0207689_102329722 159
593 3300025944 Ga0207661_10134005 Ga0207661_101340052 159
594 3300025944 Ga0207661_10170343 Ga0207661_101703431 159
595 3300025944 Ga0207661_10679394 Ga0207661_106793942 159
596 3300025945 Ga0207679_11592574 Ga0207679_115925741 159
597 3300025949 Ga0207667_10047907 Ga0207667_100479073 159
598 3300025960 Ga0207651_10083499 Ga0207651_100834992 159
599 3300025960 Ga0207651_10104845 Ga0207651_101048453 159
600 3300025960 Ga0207651_10245587 Ga0207651_102455871 159
601 3300025960 Ga0207651_10347699 Ga0207651_103476992 159
602 3300025960 Ga0207651_11168467 Ga0207651_111684671 159
603 3300025961 Ga0207712_10018795 Ga0207712_100187953 159
604 3300025972 Ga0207668_10121772 Ga0207668_101217723 159
605 3300025981 Ga0207640_10061934 Ga0207640_100619343 159
606 3300025981 Ga0207640_10126093 Ga0207640_101260932 159
607 3300025981 Ga0207640_10313059 Ga0207640_103130592 159
608 3300025986 Ga0207658_10218590 Ga0207658_102185902 159
609 3300026023 Ga0207677_10040495 Ga0207677_100404953 159
610 3300026023 Ga0207677_10766819 Ga0207677_107668192 159
611 3300026035 Ga0207703_10021520 Ga0207703_100215204 159
612 3300026035 Ga0207703_10406747 Ga0207703_104067472 159
613 3300026041 Ga0207639_10028942 Ga0207639_100289423 159
614 3300026041 Ga0207639_10897623 Ga0207639_108976232 159
615 3300026067 Ga0207678_10040307 Ga0207678_100403072 159
616 3300026067 Ga0207678_10057806 Ga0207678_100578064 159
617 3300026075 Ga0207708_10025472 Ga0207708_100254722 159
618 3300026075 Ga0207708_10176849 Ga0207708_101768491 159
619 3300026078 Ga0207702_10011854 Ga0207702_100118543 159
620 3300026088 Ga0207641_10002779 Ga0207641_100027793 159
621 3300026089 Ga0207648_10018173 Ga0207648_100181738 159
622 3300026089 Ga0207648_10772546 Ga0207648_107725461 159
623 3300026089 Ga0207648_11191882 Ga0207648_111918822 159
624 3300026095 Ga0207676_10011759 Ga0207676_100117595 159
625 3300026095 Ga0207676_10342893 Ga0207676_103428932 159
626 3300026116 Ga0207674_10021066 Ga0207674_100210665 159
627 3300026118 Ga0207675_100002372 Ga0207675_1000023724 159
628 3300026118 Ga0207675_101208499 Ga0207675_1012084992 159
629 3300026121 Ga0207683_10046461 Ga0207683_100464614 159
630 3300026121 Ga0207683_10066278 Ga0207683_100662782 159
631 3300026121 Ga0207683_10814249 Ga0207683_108142492 159
632 3300026142 Ga0207698_10675002 Ga0207698_106750022 159
633 3300026142 Ga0207698_10941339 Ga0207698_109413391 159
634 3300026142 Ga0207698_11025973 Ga0207698_110259731 159
635 3300026142 Ga0207698_11875927 Ga0207698_118759271 159
636 3300028379 Ga0268266_10177715 Ga0268266_101777153 159
637 3300028379 Ga0268266_10441477 Ga0268266_104414772 159
638 3300028380 Ga0268265_10063188 Ga0268265_100631883 159
639 3300028381 Ga0268264_10002728 Ga0268264_1000272814 159
640 3300028573 Ga0265334_10144263 Ga0265334_101442632 159
641 3300028666 Ga0265336_10000006 Ga0265336_10000006180 159
642 3300029957 Ga0265324_10005524 Ga0265324_100055245 159
643 3300031235 Ga0265330_10014154 Ga0265330_100141544 159
644 3300031235 Ga0265330_10036812 Ga0265330_100368124 159
645 3300031238 Ga0265332_10020329 Ga0265332_100203292 159
646 3300031239 Ga0265328_10057981 Ga0265328_100579812 159
647 3300031239 Ga0265328_10093175 Ga0265328_100931752 159
648 3300031241 Ga0265325_10014378 Ga0265325_100143782 159
649 3300031249 Ga0265339_10090733 Ga0265339_100907332 159
650 3300031344 Ga0265316_10343810 Ga0265316_103438102 159
651 3300031456 Ga0307513_10104370 Ga0307513_101043703 159
652 3300031712 Ga0265342_10160601 Ga0265342_101606012 159
653 3300031712 Ga0265342_10243393 Ga0265342_102433932 159
654 3300035086 Ga0373934_0015252 Ga0373934_0015252_780_1316 159
655 3300035089 Ga0373944_0046640 Ga0373944_0046640_22_504 159
656 3300035113 Ga0373936_0302194 Ga0373936_0302194_59_595 159
657 3300035117 Ga0373953_0021843 Ga0373953_0021843_1199_1735 159
658 3300035118 Ga0373954_0064007 Ga0373954_0064007_198_734 159
659 3300035118 Ga0373954_0354612 Ga0373954_0354612_164_694 159
660 3300035119 Ga0373956_0139555 Ga0373956_0139555_524_1060 159
661 3300035120 Ga0373957_0027091 Ga0373957_0027091_723_1259 159
662 3300035170 Ga0373943_0286310 Ga0373943_0286310_124_612 159
663 3300035172 Ga0373955_0128365 Ga0373955_0128365_379_915 159
664 3300035172 Ga0373955_0234314 Ga0373955_0234314_522_1031 159
665 3300035207 Ga0373942_0044805 Ga0373942_0044805_170_652 159
666 3300035410 Ga0373924_0093407 Ga0373924_0093407_19_555 159
667 3300035691 Ga0373931_0006509 Ga0373931_0006509_4257_4742 159
668 3300035692 Ga0373935_0489627 Ga0373935_0489627_59_595 159
669 3300035695 Ga0373927_0072709 Ga0373927_0072709_408_935 159
670 3300035724 Ga0373933_0060893 Ga0373933_0060893_289_825 159
671 3300035724 Ga0373933_0080796 Ga0373933_0080796_520_1002 159
672 3300036401 Ga0373937_0014381 Ga0373937_0014381_4596_5132 159
673 3300036401 Ga0373937_0036056 Ga0373937_0036056_3054_3536 159
674 3300037068 Ga0373925_0637208 Ga0373925_0637208_102_584 159
675 3300037068 Ga0373925_1402071 Ga0373925_1402071_50_559 159
676 3300037471 Ga0395905_0004450 Ga0395905_0004450_13924_14406 159
677 3300037471 Ga0395905_1121043 Ga0395905_1121043_100_591 159
678 3300039437 Ga0436365_1773448 Ga0436365_1773448_3651_4166 159
679 3300041509 Ga0451843_0349938 Ga0451843_0349938_54_533 159
680 3300045976 Ga0466967_0066022 Ga0466967_0066022_1729_2247 159
681 3300046454 Ga0495592_0039033 Ga0495592_0039033_2022_2558 159
682 3300046459 Ga0495629_0030791 Ga0495629_0030791_2009_2491 159
683 3300046459 Ga0495629_0042353 Ga0495629_0042353_950_1486 159
684 3300046462 Ga0495651_0256178 Ga0495651_0256178_577_1113 159
685 3300046463 Ga0495653_0088251 Ga0495653_0088251_25_561 159
686 3300046463 Ga0495653_0437458 Ga0495653_0437458_28_510 159
687 3300046492 Ga0495585_0091519 Ga0495585_0091519_143_628 159
688 3300046500 Ga0495596_0064933 Ga0495596_0064933_553_1035 159
689 3300046507 Ga0495606_0108705 Ga0495606_0108705_387_866 159
690 3300046511 Ga0495608_0246984 Ga0495608_0246984_382_918 159
691 3300046516 Ga0495628_0252247 Ga0495628_0252247_570_1052 159
692 3300046516 Ga0495628_0420283 Ga0495628_0420283_172_708 159
693 3300046517 Ga0495630_0871841 Ga0495630_0871841_63_599 159
694 3300046529 Ga0495652_0022074 Ga0495652_0022074_3389_3925 159
695 3300046533 Ga0495640_0225433 Ga0495640_0225433_157_693 159
696 3300046537 Ga0495598_0019860 Ga0495598_0019860_357_839 159
697 3300046539 Ga0495621_0057524 Ga0495621_0057524_40_522 159
698 3300046543 Ga0495645_0106584 Ga0495645_0106584_79_615 159
699 3300046559 Ga0495667_0116418 Ga0495667_0116418_1167_1703 159
700 3300046615 Ga0495656_0224299 Ga0495656_0224299_43_540 159
701 3300046616 Ga0495668_0057333 Ga0495668_0057333_449_934 159
702 3300046642 Ga0495634_0048984 Ga0495634_0048984_296_832 159
703 3300046675 Ga0495657_0266238 Ga0495657_0266238_324_860 159
704 3300046678 Ga0495599_0026974 Ga0495599_0026974_308_844 159
705 3300046679 Ga0495623_0000341 Ga0495623_0000341_24633_25169 159
706 3300046681 Ga0495647_0113192 Ga0495647_0113192_45_527 159
707 3300046681 Ga0495647_0454440 Ga0495647_0454440_68_577 159
708 3300046689 Ga0495613_0449294 Ga0495613_0449294_31_567 159
709 3300046809 Ga0495600_0004899 Ga0495600_0004899_6054_6590 159
710 3300047317 Ga0495604_0817886 Ga0495604_0817886_81_563 159
711 3300047322 Ga0495680_0070998 Ga0495680_0070998_1167_1703 159
712 3300047322 Ga0495680_0134503 Ga0495680_0134503_1231_1713 159
713 3300047471 Ga0495684_0006898 Ga0495684_0006898_6804_7340 159
714 3300047673 Ga0495593_0049844 Ga0495593_0049844_1512_2048 159
715 3300047673 Ga0495593_0388925 Ga0495593_0388925_40_576 159
716 3300048088 Ga0495602_0093108 Ga0495602_0093108_1580_2116 159
717 3300048903 Ga0496100_0001742 Ga0496100_0001742_9398_9934 159
718 3300048903 Ga0496100_0310792 Ga0496100_0310792_121_600 159
719 3300048903 Ga0496100_0550174 Ga0496100_0550174_230_751 159
720 3300048904 Ga0496101_0017477 Ga0496101_0017477_3739_4275 159
721 3300048905 Ga0496102_0015979 Ga0496102_0015979_5626_6162 159
722 3300048906 Ga0496103_0099130 Ga0496103_0099130_666_1202 159
723 3300048907 Ga0496104_0040323 Ga0496104_0040323_810_1346 159
724 3300048908 Ga0496105_0068158 Ga0496105_0068158_899_1435 159
725 3300048908 Ga0496105_0101187 Ga0496105_0101187_170_652 159
726 3300048909 Ga0496106_0000560 Ga0496106_0000560_11474_11995 159
727 3300048909 Ga0496106_0037455 Ga0496106_0037455_513_992 159
728 3300048911 Ga0496108_0734787 Ga0496108_0734787_306_842 159
729 3300048911 Ga0496108_0749983 Ga0496108_0749983_315_797 159
730 3300048912 Ga0496109_1276508 Ga0496109_1276508_42_524 159
731 3300048913 Ga0496110_0041098 Ga0496110_0041098_2943_3479 159
732 3300048914 Ga0496111_0028911 Ga0496111_0028911_122_658 159
733 3300048915 Ga0496112_0489775 Ga0496112_0489775_246_782 159
734 3300048916 Ga0496113_0236481 Ga0496113_0236481_189_725 159
735 3300048917 Ga0496114_0008471 Ga0496114_0008471_293_829 159
736 3300048917 Ga0496114_0055488 Ga0496114_0055488_162_644 159
737 3300048918 Ga0496115_0002892 Ga0496115_0002892_9893_10429 159
738 3300048920 Ga0496117_0017580 Ga0496117_0017580_1407_1928 159
739 3300048921 Ga0496118_0035996 Ga0496118_0035996_3403_3924 159
740 3300048924 Ga0496121_0000099 Ga0496121_0000099_161339_161860 159
741 3300048924 Ga0496121_0255839 Ga0496121_0255839_386_865 159
742 3300048928 Ga0496125_0053711 Ga0496125_0053711_681_1202 159
743 3300048929 Ga0496126_0029319 Ga0496126_0029319_4396_4917 159
744 3300049578 Ga0501042_0188245 Ga0501042_0188245_754_1242 159
745 3300049579 Ga0501043_0000072 Ga0501043_0000072_79385_79873 159
746 3300049580 Ga0501046_0000112 Ga0501046_0000112_76736_77224 159
747 3300049581 Ga0501047_0000138 Ga0501047_0000138_9149_9637 159
748 3300049582 Ga0501048_0001221 Ga0501048_0001221_16837_17325 159
749 3300049824 Ga0501045_0001874 Ga0501045_0001874_4862_5350 159
750 3300050496 nmdc:mga07m45_6941_c1 nmdc:mga07m45_6941_c1_533_1012 159
751 3300053077 Ga0495601_0124329 Ga0495601_0124329_118_636 159
752 3300053084 Ga0495595_0001806 Ga0495595_0001806_577_1113 159
753 3300053084 Ga0495595_0075033 Ga0495595_0075033_710_1240 159
754 3300053084 Ga0495595_0139953 Ga0495595_0139953_582_1064 159
755 3300053085 Ga0495619_0059753 Ga0495619_0059753_1953_2483 159
756 3300053085 Ga0495619_0154852 Ga0495619_0154852_212_694 159
757 3300053086 Ga0500578_0094750 Ga0500578_0094750_809_1288 159
758 3300053148 Ga0500590_017800 Ga0500590_017800_304_786 159
759 3300053730 Ga0500645_021713 Ga0500645_021713_1032_1511 159
760 iso_pu_bacteria 2791355199 2793080150 159
761 3300002705 JGI25156J39149_1009487 JGI25156J39149_10094872 160
762 3300003761 Ga0055535_1010849 Ga0055535_10108492 160
763 3300005327 Ga0070658_10098608 Ga0070658_100986082 160
764 3300005334 Ga0068869_100240696 Ga0068869_1002406962 160
765 3300005338 Ga0068868_100889774 Ga0068868_1008897742 160
766 3300005339 Ga0070660_100257459 Ga0070660_1002574592 160
767 3300005339 Ga0070660_100611554 Ga0070660_1006115542 160
768 3300005353 Ga0070669_100877340 Ga0070669_1008773402 160
769 3300005356 Ga0070674_100836145 Ga0070674_1008361451 160
770 3300005366 Ga0070659_100104449 Ga0070659_1001044492 160
771 3300005366 Ga0070659_100190091 Ga0070659_1001900911 160
772 3300005366 Ga0070659_100645141 Ga0070659_1006451412 160
773 3300005435 Ga0070714_100208211 Ga0070714_1002082111 160
774 3300005459 Ga0068867_100133182 Ga0068867_1001331821 160
775 3300005539 Ga0068853_100051167 Ga0068853_1000511675 160
776 3300005543 Ga0070672_100044460 Ga0070672_1000444603 160
777 3300005563 Ga0068855_100160366 Ga0068855_1001603662 160
778 3300005563 Ga0068855_100580577 Ga0068855_1005805772 160
779 3300005719 Ga0068861_100072447 Ga0068861_1000724473 160
780 3300005844 Ga0068862_100154048 Ga0068862_1001540481 160
781 3300006028 Ga0070717_10028434 Ga0070717_100284343 160
782 3300006195 Ga0075366_10008494 Ga0075366_100084941 160
783 3300006353 Ga0075370_10006736 Ga0075370_100067361 160
784 3300009148 Ga0105243_10230023 Ga0105243_102300233 160
785 3300009148 Ga0105243_10248324 Ga0105243_102483242 160
786 3300009176 Ga0105242_11380649 Ga0105242_113806492 160
787 3300009545 Ga0105237_10633881 Ga0105237_106338811 160
788 3300009553 Ga0105249_10088620 Ga0105249_100886204 160
789 3300014326 Ga0157380_10439715 Ga0157380_104397151 160
790 3300015262 Ga0182007_10028336 Ga0182007_100283363 160
791 3300017792 Ga0163161_10312557 Ga0163161_103125572 160
792 3300024227 Ga0228598_1079813 Ga0228598_10798132 160
793 3300025242 Ga0209258_100700 Ga0209258_10070016 160
794 3300025250 Ga0209026_1029234 Ga0209026_10292342 160
795 3300025256 Ga0209759_1001086 Ga0209759_100108612 160
796 3300025256 Ga0209759_1007199 Ga0209759_10071993 160
797 3300025256 Ga0209759_1020122 Ga0209759_10201222 160
798 3300025914 Ga0207671_10173436 Ga0207671_101734362 160
799 3300025915 Ga0207693_10210518 Ga0207693_102105182 160
800 3300025919 Ga0207657_10077341 Ga0207657_100773412 160
801 3300025919 Ga0207657_10175173 Ga0207657_101751732 160
802 3300025923 Ga0207681_10124516 Ga0207681_101245163 160
803 3300025929 Ga0207664_10719386 Ga0207664_107193861 160
804 3300025932 Ga0207690_10154689 Ga0207690_101546892 160
805 3300025932 Ga0207690_10212660 Ga0207690_102126602 160
806 3300025935 Ga0207709_10063345 Ga0207709_100633452 160
807 3300025937 Ga0207669_10083324 Ga0207669_100833243 160
808 3300025940 Ga0207691_10028023 Ga0207691_100280234 160
809 3300025942 Ga0207689_10045901 Ga0207689_100459012 160
810 3300025949 Ga0207667_10012561 Ga0207667_100125615 160
811 3300025960 Ga0207651_11690149 Ga0207651_116901491 160
812 3300025972 Ga0207668_10036498 Ga0207668_100364982 160
813 3300026075 Ga0207708_10021407 Ga0207708_100214074 160
814 3300026118 Ga0207675_100027403 Ga0207675_1000274036 160
815 3300030521 Ga0307511_10207407 Ga0307511_102074072 160
816 3300031250 Ga0265331_10167807 Ga0265331_101678071 160
817 3300031344 Ga0265316_10633125 Ga0265316_106331251 160
818 3300031548 Ga0307408_100437667 Ga0307408_1004376672 160
819 3300031730 Ga0307516_10000360 Ga0307516_100003603 160
820 3300031730 Ga0307516_10001515 Ga0307516_1000151511 160
821 3300031730 Ga0307516_10242632 Ga0307516_102426322 160
822 3300031852 Ga0307410_10416064 Ga0307410_104160642 160
823 3300031852 Ga0307410_10630510 Ga0307410_106305101 160
824 3300031995 Ga0307409_100727726 Ga0307409_1007277262 160
825 3300035086 Ga0373934_0017850 Ga0373934_0017850_691_1197 160
826 3300035724 Ga0373933_0000272 Ga0373933_0000272_32917_33426 160
827 3300037312 Ga0395899_0237362 Ga0395899_0237362_508_990 160
828 3300037471 Ga0395905_0481794 Ga0395905_0481794_178_663 160
829 3300038443 Ga0395901_0002847 Ga0395901_0002847_6208_6690 160
830 3300041456 Ga0451795_0486996 Ga0451795_0486996_100_627 160
831 3300042439 Ga0439464_0002912 Ga0439464_0002912_203_691 160
832 3300044656 Ga0466969_0058948 Ga0466969_0058948_137_619 160
833 3300044683 Ga0466965_0064290 Ga0466965_0064290_1143_1649 160
834 3300044684 Ga0466966_0011578 Ga0466966_0011578_5252_5758 160
835 3300044684 Ga0466966_0027088 Ga0466966_0027088_1963_2445 160
836 3300044693 Ga0466961_0010761 Ga0466961_0010761_5026_5532 160
837 3300044693 Ga0466961_0157290 Ga0466961_0157290_873_1355 160
838 3300044694 Ga0466963_0513052 Ga0466963_0513052_125_631 160
839 3300044706 Ga0466964_0007682 Ga0466964_0007682_2392_2898 160
840 3300044706 Ga0466964_0279146 Ga0466964_0279146_160_642 160
841 3300044719 Ga0466971_0008613 Ga0466971_0008613_197_679 160
842 3300044719 Ga0466971_0028527 Ga0466971_0028527_1123_1629 160
843 3300044735 Ga0466968_0039786 Ga0466968_0039786_176_682 160
844 3300044765 Ga0466970_0058122 Ga0466970_0058122_1294_1800 160
845 3300044842 Ga0466957_0020706 Ga0466957_0020706_1178_1660 160
846 3300044842 Ga0466957_0067419 Ga0466957_0067419_486_968 160
847 3300044842 Ga0466957_0127429 Ga0466957_0127429_1023_1529 160
848 3300045976 Ga0466967_0776087 Ga0466967_0776087_305_811 160
849 3300046475 Ga0495639_0021367 Ga0495639_0021367_1680_2174 160
850 3300046506 Ga0495583_0000717 Ga0495583_0000717_25168_25662 160
851 3300046507 Ga0495606_0001828 Ga0495606_0001828_14562_15056 160
852 3300046524 Ga0495648_0241600 Ga0495648_0241600_129_623 160
853 3300046537 Ga0495598_0055549 Ga0495598_0055549_123_611 160
854 3300046660 Ga0495625_0004769 Ga0495625_0004769_1128_1622 160
855 3300046694 Ga0495649_0000314 Ga0495649_0000314_16819_17313 160
856 3300046794 Ga0495589_0017299 Ga0495589_0017299_2062_2556 160
857 3300047318 Ga0495636_0448666 Ga0495636_0448666_110_598 160
858 3300047472 Ga0495686_0009986 Ga0495686_0009986_5503_5997 160
859 3300048903 Ga0496100_0762313 Ga0496100_0762313_98_595 160
860 3300048905 Ga0496102_0856937 Ga0496102_0856937_164_661 160
861 3300048907 Ga0496104_1259910 Ga0496104_1259910_13_498 160
862 3300048918 Ga0496115_0239650 Ga0496115_0239650_464_955 160
863 3300048927 Ga0496124_0000788 Ga0496124_0000788_37399_37920 160
864 3300050492 nmdc:mga0yw44_33386_c1 nmdc:mga0yw44_33386_c1_2012_2647 160
865 3300050494 nmdc:mga06z11_575132_c1 nmdc:mga06z11_575132_c1_20_502 160
866 3300050496 nmdc:mga07m45_5517_c1 nmdc:mga07m45_5517_c1_5476_5958 160
867 3300053122 Ga0500608_022018 Ga0500608_022018_1230_1724 160
868 3300053139 Ga0500568_0059007 Ga0500568_0059007_277_777 160
869 3300053177 Ga0500636_0136038 Ga0500636_0136038_164_658 160
870 3300061719 Ga0466962_0025069 Ga0466962_0025069_1396_1902 160
871 3300002126 JGI24035J26624_1010479 JGI24035J26624_10104791 161
872 3300005290 Ga0065712_10200379 Ga0065712_102003791 161
873 3300005293 Ga0065715_10111173 Ga0065715_101111732 161
874 3300005328 Ga0070676_10037404 Ga0070676_100374042 161
875 3300005331 Ga0070670_100019051 Ga0070670_1000190511 161
876 3300005333 Ga0070677_10007631 Ga0070677_100076312 161
877 3300005334 Ga0068869_100050299 Ga0068869_1000502993 161
878 3300005353 Ga0070669_100017046 Ga0070669_1000170464 161
879 3300005354 Ga0070675_100005042 Ga0070675_1000050421 161
880 3300005354 Ga0070675_100194931 Ga0070675_1001949312 161
881 3300005355 Ga0070671_100011841 Ga0070671_1000118411 161
882 3300005356 Ga0070674_100023639 Ga0070674_1000236391 161
883 3300005356 Ga0070674_100092494 Ga0070674_1000924941 161
884 3300005364 Ga0070673_100029265 Ga0070673_1000292652 161
885 3300005367 Ga0070667_100046171 Ga0070667_1000461713 161
886 3300005441 Ga0070700_100230905 Ga0070700_1002309052 161
887 3300005445 Ga0070708_100542613 Ga0070708_1005426131 161
888 3300005455 Ga0070663_100094830 Ga0070663_1000948302 161
889 3300005456 Ga0070678_100024510 Ga0070678_1000245101 161
890 3300005456 Ga0070678_100058487 Ga0070678_1000584871 161
891 3300005456 Ga0070678_100626886 Ga0070678_1006268862 161
892 3300005459 Ga0068867_100102645 Ga0068867_1001026451 161
893 3300005467 Ga0070706_100001589 Ga0070706_10000158911 161
894 3300005468 Ga0070707_100032827 Ga0070707_1000328275 161
895 3300005539 Ga0068853_100171601 Ga0068853_1001716013 161
896 3300005539 Ga0068853_100353396 Ga0068853_1003533962 161
897 3300005543 Ga0070672_100000138 Ga0070672_10000013833 161
898 3300005577 Ga0068857_100117657 Ga0068857_1001176572 161
899 3300005578 Ga0068854_100301987 Ga0068854_1003019872 161
900 3300005617 Ga0068859_101335082 Ga0068859_1013350821 161
901 3300005834 Ga0068851_10391892 Ga0068851_103918922 161
902 3300006042 Ga0075368_10077518 Ga0075368_100775182 161
903 3300006042 Ga0075368_10212506 Ga0075368_102125062 161
904 3300006048 Ga0075363_100010223 Ga0075363_1000102231 161
905 3300006051 Ga0075364_10048232 Ga0075364_100482324 161
906 3300006051 Ga0075364_10398089 Ga0075364_103980891 161
907 3300006177 Ga0075362_10021552 Ga0075362_100215524 161
908 3300006177 Ga0075362_10069344 Ga0075362_100693443 161
909 3300006177 Ga0075362_10212690 Ga0075362_102126901 161
910 3300006178 Ga0075367_10042370 Ga0075367_100423701 161
911 3300006178 Ga0075367_10139526 Ga0075367_101395263 161
912 3300006186 Ga0075369_10031758 Ga0075369_100317581 161
913 3300006195 Ga0075366_10040468 Ga0075366_100404685 161
914 3300006195 Ga0075366_10085820 Ga0075366_100858201 161
915 3300006195 Ga0075366_10161106 Ga0075366_101611062 161
916 3300006353 Ga0075370_10006621 Ga0075370_100066212 161
917 3300006353 Ga0075370_10018502 Ga0075370_100185023 161
918 3300006931 Ga0097620_101335072 Ga0097620_1013350721 161
919 3300009148 Ga0105243_10322215 Ga0105243_103222151 161
920 3300009176 Ga0105242_10127617 Ga0105242_101276171 161
921 3300009545 Ga0105237_10062076 Ga0105237_100620765 161
922 3300009551 Ga0105238_10300930 Ga0105238_103009303 161
923 3300010375 Ga0105239_10138849 Ga0105239_101388493 161
924 3300012494 Ga0157341_1013590 Ga0157341_10135901 161
925 3300013306 Ga0163162_10173972 Ga0163162_101739723 161
926 3300014969 Ga0157376_10071755 Ga0157376_100717555 161
927 3300014969 Ga0157376_10309586 Ga0157376_103095861 161
928 3300025304 Ga0209257_1020862 Ga0209257_10208624 161
929 3300025315 Ga0207697_10011255 Ga0207697_100112552 161
930 3300025321 Ga0207656_10056547 Ga0207656_100565473 161
931 3300025893 Ga0207682_10002713 Ga0207682_100027131 161
932 3300025908 Ga0207643_10073334 Ga0207643_100733342 161
933 3300025910 Ga0207684_10006317 Ga0207684_100063179 161
934 3300025914 Ga0207671_10278855 Ga0207671_102788553 161
935 3300025922 Ga0207646_10052114 Ga0207646_100521142 161
936 3300025923 Ga0207681_10291164 Ga0207681_102911642 161
937 3300025924 Ga0207694_10674823 Ga0207694_106748232 161
938 3300025925 Ga0207650_10000408 Ga0207650_1000040830 161
939 3300025926 Ga0207659_10000775 Ga0207659_1000077512 161
940 3300025931 Ga0207644_10011177 Ga0207644_100111777 161
941 3300025934 Ga0207686_11531673 Ga0207686_115316731 161
942 3300025937 Ga0207669_10060349 Ga0207669_100603491 161
943 3300025937 Ga0207669_10454684 Ga0207669_104546842 161
944 3300025940 Ga0207691_10000360 Ga0207691_100003607 161
945 3300025942 Ga0207689_10414685 Ga0207689_104146852 161
946 3300025960 Ga0207651_10007721 Ga0207651_100077216 161
947 3300025981 Ga0207640_10355629 Ga0207640_103556292 161
948 3300025986 Ga0207658_10013819 Ga0207658_100138194 161
949 3300026023 Ga0207677_10040938 Ga0207677_100409384 161
950 3300026023 Ga0207677_10125339 Ga0207677_101253392 161
951 3300026041 Ga0207639_10648705 Ga0207639_106487051 161
952 3300026067 Ga0207678_10067677 Ga0207678_100676772 161
953 3300026089 Ga0207648_10077377 Ga0207648_100773771 161
954 3300026095 Ga0207676_10795142 Ga0207676_107951421 161
955 3300026121 Ga0207683_10006928 Ga0207683_100069281 161
956 3300026121 Ga0207683_10201427 Ga0207683_102014271 161
957 3300027866 Ga0209813_10071989 Ga0209813_100719892 161
958 3300028786 Ga0307517_10090491 Ga0307517_100904913 161
959 3300029957 Ga0265324_10024172 Ga0265324_100241722 161
960 3300031456 Ga0307513_10346743 Ga0307513_103467432 161
961 3300031548 Ga0307408_100073952 Ga0307408_1000739521 161
962 3300031548 Ga0307408_100484356 Ga0307408_1004843561 161
963 3300031616 Ga0307508_10236935 Ga0307508_102369352 161
964 3300031731 Ga0307405_10244883 Ga0307405_102448832 161
965 3300031824 Ga0307413_10116625 Ga0307413_101166252 161
966 3300031852 Ga0307410_10010373 Ga0307410_100103734 161
967 3300031901 Ga0307406_10007409 Ga0307406_100074097 161
968 3300031903 Ga0307407_10021342 Ga0307407_100213425 161
969 3300031911 Ga0307412_10017797 Ga0307412_100177972 161
970 3300031911 Ga0307412_10724317 Ga0307412_107243171 161
971 3300031995 Ga0307409_100096445 Ga0307409_1000964454 161
972 3300031995 Ga0307409_100422996 Ga0307409_1004229962 161
973 3300032002 Ga0307416_100289203 Ga0307416_1002892032 161
974 3300032004 Ga0307414_10187493 Ga0307414_101874933 161
975 3300032005 Ga0307411_10046117 Ga0307411_100461174 161
976 3300032126 Ga0307415_100420861 Ga0307415_1004208612 161
977 3300032126 Ga0307415_100939739 Ga0307415_1009397391 161
978 3300041458 Ga0451798_0388718 Ga0451798_0388718_107_595 161
979 3300044683 Ga0466965_0052459 Ga0466965_0052459_1495_1986 161
980 3300046457 Ga0495590_0053145 Ga0495590_0053145_516_1001 161
981 3300046471 Ga0495650_0211714 Ga0495650_0211714_20_616 161
982 3300046507 Ga0495606_0598471 Ga0495606_0598471_46_531 161
983 3300046518 Ga0495631_0100935 Ga0495631_0100935_605_1090 161
984 3300046519 Ga0495632_0002264 Ga0495632_0002264_6413_6898 161
985 3300046542 Ga0495597_0010500 Ga0495597_0010500_2534_3019 161
986 3300046616 Ga0495668_0170657 Ga0495668_0170657_296_781 161
987 3300046648 Ga0495611_0176079 Ga0495611_0176079_248_733 161
988 3300046660 Ga0495625_0032244 Ga0495625_0032244_1038_1523 161
989 3300046694 Ga0495649_0003800 Ga0495649_0003800_6390_6875 161
990 3300046810 Ga0495660_0237968 Ga0495660_0237968_300_785 161
991 3300047443 Ga0495687_000500 Ga0495687_000500_4708_5193 161
992 3300047443 Ga0495687_081066 Ga0495687_081066_136_621 161
993 3300047443 Ga0495687_081148 Ga0495687_081148_136_621 161
994 3300048091 Ga0495626_0060994 Ga0495626_0060994_707_1198 161
995 3300048904 Ga0496101_0854767 Ga0496101_0854767_44_544 161
996 3300048907 Ga0496104_0742583 Ga0496104_0742583_40_540 161
997 3300048915 Ga0496112_0651940 Ga0496112_0651940_438_938 161
998 3300050489 nmdc:mga03683_126189_c1 nmdc:mga03683_126189_c1_473_958 161
999 3300050489 nmdc:mga03683_351134_c1 nmdc:mga03683_351134_c1_63_548 161
1000 3300050489 nmdc:mga03683_59909_c1 nmdc:mga03683_59909_c1_251_736 161
1001 3300050490 nmdc:mga03n38_69771_c1 nmdc:mga03n38_69771_c1_885_1370 161
1002 3300050491 nmdc:mga00v17_117322_c1 nmdc:mga00v17_117322_c1_251_736 161
1003 3300050492 nmdc:mga0yw44_289056_c1 nmdc:mga0yw44_289056_c1_352_837 161
1004 3300050493 nmdc:mga0k408_110896_c1 nmdc:mga0k408_110896_c1_198_683 161
1005 3300050493 nmdc:mga0k408_14148_c1 nmdc:mga0k408_14148_c1_779_1264 161
1006 3300050493 nmdc:mga0k408_156211_c1 nmdc:mga0k408_156211_c1_199_684 161
1007 3300050493 nmdc:mga0k408_373534_c1 nmdc:mga0k408_373534_c1_323_817 161
1008 3300050493 nmdc:mga0k408_52971_c1 nmdc:mga0k408_52971_c1_1673_2158 161
1009 3300050493 nmdc:mga0k408_593108_c1 nmdc:mga0k408_593108_c1_81_566 161
1010 3300050494 nmdc:mga06z11_111437_c1 nmdc:mga06z11_111437_c1_872_1357 161
1011 3300050494 nmdc:mga06z11_111603_c1 nmdc:mga06z11_111603_c1_419_913 161
1012 3300050494 nmdc:mga06z11_51205_c1 nmdc:mga06z11_51205_c1_1375_1860 161
1013 3300050495 nmdc:mga04h51_114287_c1 nmdc:mga04h51_114287_c1_251_736 161
1014 3300050495 nmdc:mga04h51_47957_c1 nmdc:mga04h51_47957_c1_770_1255 161
1015 3300050496 nmdc:mga07m45_13868_c1 nmdc:mga07m45_13868_c1_173_658 161
1016 3300050496 nmdc:mga07m45_2631_c1 nmdc:mga07m45_2631_c1_7913_8398 161
1017 3300050496 nmdc:mga07m45_53421_c1 nmdc:mga07m45_53421_c1_195_680 161
1018 3300050496 nmdc:mga07m45_7349_c1 nmdc:mga07m45_7349_c1_1409_1903 161
1019 3300053092 Ga0500583_0546241 Ga0500583_0546241_26_511 161
1020 3300053139 Ga0500568_0018322 Ga0500568_0018322_1421_1906 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

93

166

0.89

PF00190

Cupin_1

Cupin

86

181

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q29-assembly1.cif.gz_B ensemble refinement of plu4264 protein from photorhabdus luminescens 0.9054 50 132
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8937 51 130
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8781 52 133
8hjz-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a/h58q mutant) in copper (cu) substituted form 0.8778 50 130
8hjx-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a/h58e mutant) in copper (cu) substituted form 0.876 50 130
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8921 51 130 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8902 51 130 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8798 52 130 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8755 51 130 2.60.120.10
2gu9B01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8715 51 130 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3B9BXB3-F1-model_v4 Cupin 0.903 52 134
AF-A0A388RQ61-F1-model_v4 deleted 0.8973 54 132
AF-A0A841M4E9-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.8943 53 134 GO:0051213
AF-A0A538NES1-F1-model_v4 Cupin domain-containing protein 0.8937 54 134
AF-A0A523FIC8-F1-model_v4 Cupin domain-containing protein 0.8909 52 130

Feature Viewer

pLDDT pTM Quality
64.08 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map