F488374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 424 | 1016 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0211714|Ga0495650_0211714_20_616 |
| Length | 198 |
| Sequence | MYTKKALQPVVCCVEPHFAMRAQRTESGNTFEDARMADSDTHFASSEGTRWKHDGVRVVTGDRLDPNTAQTPGMDRKAAIDFARVGAQKLWAGTVHIHPDAKTGAHHHGPLESVIYVVKGRARMRWGEKLEFTAEAGPGDFIYVPPFVPHQEINASPTEVLECVLVRSDGQAIAVNLDIEPVEPPEDVRWIDPTHPEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2791355199 | |||
| 3 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 4 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 139 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 140 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 274 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 275 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 279 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 280 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 281 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 406 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 416 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 420 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 423 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.63 |
| Nodule | 0.2 |
| Rhizoplane | 6.57 |
| Rhizosphere | 80.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24035J26624_1010479 | 3300002126 | Bacteria | 922 |
| 2 | JGI25156J39149_1000441 | 3300002705 | Bacteria | 25512 |
| 3 | JGI25156J39149_1009487 | 3300002705 | Bacteria | 2358 |
| 4 | JGI25154J39366_1001707 | 3300002738 | Bacteria | 7190 |
| 5 | JGI25157J39369_1000029 | 3300002741 | Bacteria | 146928 |
| 6 | JGI25406J46586_10003368 | 3300003203 | Bacteria | 7528 |
| 7 | Ga0055539_1000310 | 3300003752 | Bacteria | 25571 |
| 8 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 9 | Ga0055535_1010849 | 3300003761 | Bacteria | 1474 |
| 10 | Ga0055530_10000090 | 3300003791 | Bacteria | 78168 |
| 11 | Ga0055531_10011587 | 3300003794 | Bacteria | 4231 |
| 12 | Ga0065712_10200379 | 3300005290 | Bacteria | 1111 |
| 13 | Ga0065715_10111173 | 3300005293 | Bacteria | 2584 |
| 14 | Ga0070658_10029468 | 3300005327 | Bacteria | 4409 |
| 15 | Ga0070658_10098608 | 3300005327 | Bacteria | 2414 |
| 16 | Ga0070658_10723216 | 3300005327 | Bacteria | 864 |
| 17 | Ga0070676_10037404 | 3300005328 | Bacteria | 2799 |
| 18 | Ga0070676_10254885 | 3300005328 | Bacteria | 1172 |
| 19 | Ga0070676_10295820 | 3300005328 | Bacteria | 1096 |
| 20 | Ga0070676_10655148 | 3300005328 | Bacteria | 762 |
| 21 | Ga0070683_100012316 | 3300005329 | Bacteria | 7429 |
| 22 | Ga0070683_100352552 | 3300005329 | Bacteria | 1401 |
| 23 | Ga0070683_100404610 | 3300005329 | Bacteria | 1302 |
| 24 | Ga0070690_100043087 | 3300005330 | Bacteria | 2861 |
| 25 | Ga0070670_100001996 | 3300005331 | Bacteria | 16678 |
| 26 | Ga0070670_100019051 | 3300005331 | Bacteria | 5885 |
| 27 | Ga0070670_100317037 | 3300005331 | Bacteria | 1365 |
| 28 | Ga0070670_100371798 | 3300005331 | Bacteria | 1258 |
| 29 | Ga0070670_100499518 | 3300005331 | Bacteria | 1081 |
| 30 | Ga0070670_101364923 | 3300005331 | Bacteria | 649 |
| 31 | Ga0070677_10007631 | 3300005333 | Bacteria | 3619 |
| 32 | Ga0070677_10035705 | 3300005333 | Bacteria | 1929 |
| 33 | Ga0068869_100002609 | 3300005334 | Bacteria | 10881 |
| 34 | Ga0068869_100050299 | 3300005334 | Bacteria | 3020 |
| 35 | Ga0068869_100104367 | 3300005334 | Bacteria | 2148 |
| 36 | Ga0068869_100240696 | 3300005334 | Bacteria | 1442 |
| 37 | Ga0068869_101024787 | 3300005334 | Bacteria | 719 |
| 38 | Ga0070666_10001744 | 3300005335 | Bacteria | 13267 |
| 39 | Ga0070666_10067577 | 3300005335 | Bacteria | 2427 |
| 40 | Ga0070680_100006496 | 3300005336 | Bacteria | 8895 |
| 41 | Ga0070680_100006948 | 3300005336 | Bacteria | 8626 |
| 42 | Ga0070682_100286063 | 3300005337 | Bacteria | 1204 |
| 43 | Ga0068868_100050964 | 3300005338 | Bacteria | 3253 |
| 44 | Ga0068868_100065715 | 3300005338 | Bacteria | 2882 |
| 45 | Ga0068868_100563350 | 3300005338 | Bacteria | 1005 |
| 46 | Ga0068868_100889774 | 3300005338 | Bacteria | 809 |
| 47 | Ga0070660_100034252 | 3300005339 | Bacteria | 3835 |
| 48 | Ga0070660_100066556 | 3300005339 | Bacteria | 2805 |
| 49 | Ga0070660_100142089 | 3300005339 | Bacteria | 1926 |
| 50 | Ga0070660_100208653 | 3300005339 | Unclassified | 1585 |
| 51 | Ga0070660_100257459 | 3300005339 | Bacteria | 1424 |
| 52 | Ga0070660_100383487 | 3300005339 | Bacteria | 1160 |
| 53 | Ga0070660_100611554 | 3300005339 | Bacteria | 911 |
| 54 | Ga0070689_100298032 | 3300005340 | Bacteria | 1341 |
| 55 | Ga0070691_10006435 | 3300005341 | Bacteria | 5368 |
| 56 | Ga0070687_100105042 | 3300005343 | Bacteria | 1589 |
| 57 | Ga0070661_100076457 | 3300005344 | Bacteria | 2467 |
| 58 | Ga0070661_100141353 | 3300005344 | Bacteria | 1814 |
| 59 | Ga0070661_100497429 | 3300005344 | Bacteria | 975 |
| 60 | Ga0070661_100743402 | 3300005344 | Bacteria | 802 |
| 61 | Ga0070661_100832769 | 3300005344 | Bacteria | 758 |
| 62 | Ga0070661_100844233 | 3300005344 | Bacteria | 753 |
| 63 | Ga0070668_100001912 | 3300005347 | Bacteria | 15233 |
| 64 | Ga0070668_100018414 | 3300005347 | Bacteria | 5243 |
| 65 | Ga0070668_100130277 | 3300005347 | Bacteria | 2018 |
| 66 | Ga0070669_100005334 | 3300005353 | Bacteria | 9281 |
| 67 | Ga0070669_100017046 | 3300005353 | Bacteria | 5184 |
| 68 | Ga0070669_100017767 | 3300005353 | Bacteria | 5075 |
| 69 | Ga0070669_100664583 | 3300005353 | Bacteria | 877 |
| 70 | Ga0070669_100750962 | 3300005353 | Bacteria | 827 |
| 71 | Ga0070669_100877340 | 3300005353 | Bacteria | 765 |
| 72 | Ga0070669_100956205 | 3300005353 | Bacteria | 733 |
| 73 | Ga0070675_100005042 | 3300005354 | Bacteria | 10079 |
| 74 | Ga0070675_100018417 | 3300005354 | Bacteria | 5557 |
| 75 | Ga0070675_100034949 | 3300005354 | Bacteria | 4081 |
| 76 | Ga0070675_100129939 | 3300005354 | Bacteria | 2146 |
| 77 | Ga0070675_100194931 | 3300005354 | Bacteria | 1757 |
| 78 | Ga0070675_100271144 | 3300005354 | Bacteria | 1489 |
| 79 | Ga0070671_100011841 | 3300005355 | Bacteria | 7017 |
| 80 | Ga0070671_100045432 | 3300005355 | Bacteria | 3651 |
| 81 | Ga0070671_100092111 | 3300005355 | Bacteria | 2539 |
| 82 | Ga0070671_100233877 | 3300005355 | Bacteria | 1560 |
| 83 | Ga0070671_100332322 | 3300005355 | Bacteria | 1295 |
| 84 | Ga0070671_100599977 | 3300005355 | Bacteria | 951 |
| 85 | Ga0070671_100617343 | 3300005355 | Bacteria | 937 |
| 86 | Ga0070671_100618580 | 3300005355 | Bacteria | 936 |
| 87 | Ga0070671_100622389 | 3300005355 | Bacteria | 934 |
| 88 | Ga0070671_100694395 | 3300005355 | Bacteria | 882 |
| 89 | Ga0070674_100023639 | 3300005356 | Bacteria | 3980 |
| 90 | Ga0070674_100065144 | 3300005356 | Bacteria | 2556 |
| 91 | Ga0070674_100092494 | 3300005356 | Bacteria | 2186 |
| 92 | Ga0070674_100748185 | 3300005356 | Bacteria | 840 |
| 93 | Ga0070674_100836145 | 3300005356 | Bacteria | 797 |
| 94 | Ga0070673_100029265 | 3300005364 | Bacteria | 4106 |
| 95 | Ga0070673_100247511 | 3300005364 | Bacteria | 1552 |
| 96 | Ga0070673_100376247 | 3300005364 | Bacteria | 1265 |
| 97 | Ga0070673_100404315 | 3300005364 | Bacteria | 1221 |
| 98 | Ga0070673_100500610 | 3300005364 | Bacteria | 1099 |
| 99 | Ga0070673_100826492 | 3300005364 | Bacteria | 856 |
| 100 | Ga0070688_100943877 | 3300005365 | Bacteria | 682 |
| 101 | Ga0070659_100092787 | 3300005366 | Bacteria | 2421 |
| 102 | Ga0070659_100104449 | 3300005366 | Bacteria | 2282 |
| 103 | Ga0070659_100115723 | 3300005366 | Bacteria | 2167 |
| 104 | Ga0070659_100164583 | 3300005366 | Bacteria | 1814 |
| 105 | Ga0070659_100190091 | 3300005366 | Bacteria | 1687 |
| 106 | Ga0070659_100645141 | 3300005366 | Bacteria | 912 |
| 107 | Ga0070659_101041513 | 3300005366 | Bacteria | 719 |
| 108 | Ga0070667_100013141 | 3300005367 | Bacteria | 6844 |
| 109 | Ga0070667_100046171 | 3300005367 | Bacteria | 3663 |
| 110 | Ga0070667_100197297 | 3300005367 | Bacteria | 1785 |
| 111 | Ga0070667_100364933 | 3300005367 | Bacteria | 1309 |
| 112 | Ga0070703_10004941 | 3300005406 | Bacteria | 3721 |
| 113 | Ga0070714_100080128 | 3300005435 | Bacteria | 2841 |
| 114 | Ga0070714_100208211 | 3300005435 | Bacteria | 1792 |
| 115 | Ga0070714_101387840 | 3300005435 | Bacteria | 686 |
| 116 | Ga0070701_10016708 | 3300005438 | Bacteria | 3418 |
| 117 | Ga0070701_10873952 | 3300005438 | Bacteria | 619 |
| 118 | Ga0070705_100000274 | 3300005440 | Bacteria | 31250 |
| 119 | Ga0070700_100008253 | 3300005441 | Bacteria | 5670 |
| 120 | Ga0070700_100230905 | 3300005441 | Bacteria | 1317 |
| 121 | Ga0070694_100017655 | 3300005444 | Bacteria | 4510 |
| 122 | Ga0070708_100207858 | 3300005445 | Bacteria | 1834 |
| 123 | Ga0070708_100542613 | 3300005445 | Bacteria | 1097 |
| 124 | Ga0070663_100008842 | 3300005455 | Bacteria | 6216 |
| 125 | Ga0070663_100076689 | 3300005455 | Bacteria | 2445 |
| 126 | Ga0070663_100094830 | 3300005455 | Bacteria | 2217 |
| 127 | Ga0070663_100425029 | 3300005455 | Bacteria | 1090 |
| 128 | Ga0070678_100024510 | 3300005456 | Bacteria | 4041 |
| 129 | Ga0070678_100058487 | 3300005456 | Bacteria | 2829 |
| 130 | Ga0070678_100114485 | 3300005456 | Bacteria | 2116 |
| 131 | Ga0070678_100137173 | 3300005456 | Bacteria | 1952 |
| 132 | Ga0070678_100301671 | 3300005456 | Bacteria | 1361 |
| 133 | Ga0070678_100470944 | 3300005456 | Bacteria | 1104 |
| 134 | Ga0070678_100626886 | 3300005456 | Bacteria | 962 |
| 135 | Ga0070678_100629240 | 3300005456 | Bacteria | 961 |
| 136 | Ga0070678_100637208 | 3300005456 | Bacteria | 955 |
| 137 | Ga0070678_100702022 | 3300005456 | Bacteria | 911 |
| 138 | Ga0070662_100042086 | 3300005457 | Bacteria | 3262 |
| 139 | Ga0070662_100132740 | 3300005457 | Bacteria | 1922 |
| 140 | Ga0070662_100650011 | 3300005457 | Bacteria | 889 |
| 141 | Ga0070681_10074065 | 3300005458 | Bacteria | 3367 |
| 142 | Ga0070681_10162733 | 3300005458 | Bacteria | 2155 |
| 143 | Ga0068867_100017625 | 3300005459 | Bacteria | 5071 |
| 144 | Ga0068867_100102645 | 3300005459 | Bacteria | 2186 |
| 145 | Ga0068867_100133182 | 3300005459 | Bacteria | 1934 |
| 146 | Ga0068867_100812925 | 3300005459 | Bacteria | 834 |
| 147 | Ga0070706_100001589 | 3300005467 | Bacteria | 23687 |
| 148 | Ga0070706_100115678 | 3300005467 | Bacteria | 2497 |
| 149 | Ga0070707_100032827 | 3300005468 | Bacteria | 4946 |
| 150 | Ga0070707_100115367 | 3300005468 | Bacteria | 2607 |
| 151 | Ga0070698_100016443 | 3300005471 | Bacteria | 7806 |
| 152 | Ga0070698_100095479 | 3300005471 | Bacteria | 2951 |
| 153 | Ga0070699_100001895 | 3300005518 | Bacteria | 18874 |
| 154 | Ga0070679_100005291 | 3300005530 | Bacteria | 11945 |
| 155 | Ga0070679_100085996 | 3300005530 | Bacteria | 3131 |
| 156 | Ga0070684_100020787 | 3300005535 | Bacteria | 5446 |
| 157 | Ga0070684_100307910 | 3300005535 | Bacteria | 1454 |
| 158 | Ga0070684_100684755 | 3300005535 | Bacteria | 955 |
| 159 | Ga0070697_100083215 | 3300005536 | Bacteria | 2639 |
| 160 | Ga0070697_100167989 | 3300005536 | Bacteria | 1856 |
| 161 | Ga0068853_100000534 | 3300005539 | Bacteria | 25841 |
| 162 | Ga0068853_100051167 | 3300005539 | Bacteria | 3555 |
| 163 | Ga0068853_100089424 | 3300005539 | Bacteria | 2705 |
| 164 | Ga0068853_100171601 | 3300005539 | Bacteria | 1962 |
| 165 | Ga0068853_100353396 | 3300005539 | Bacteria | 1367 |
| 166 | Ga0068853_100373643 | 3300005539 | Bacteria | 1330 |
| 167 | Ga0068853_100782521 | 3300005539 | Bacteria | 913 |
| 168 | Ga0070672_100000138 | 3300005543 | Bacteria | 38912 |
| 169 | Ga0070672_100033366 | 3300005543 | Bacteria | 3898 |
| 170 | Ga0070672_100044460 | 3300005543 | Bacteria | 3430 |
| 171 | Ga0070672_100282598 | 3300005543 | Bacteria | 1403 |
| 172 | Ga0070672_100781184 | 3300005543 | Bacteria | 839 |
| 173 | Ga0070686_100189641 | 3300005544 | Bacteria | 1466 |
| 174 | Ga0070686_100237719 | 3300005544 | Bacteria | 1325 |
| 175 | Ga0070695_100009399 | 3300005545 | Bacteria | 5819 |
| 176 | Ga0070696_100000144 | 3300005546 | Bacteria | 39344 |
| 177 | Ga0070693_100335695 | 3300005547 | Bacteria | 1030 |
| 178 | Ga0070693_100529227 | 3300005547 | Bacteria | 840 |
| 179 | Ga0070665_100000015 | 3300005548 | Bacteria | 462744 |
| 180 | Ga0070665_100095104 | 3300005548 | Bacteria | 2984 |
| 181 | Ga0070665_100554362 | 3300005548 | Bacteria | 1162 |
| 182 | Ga0070704_100001504 | 3300005549 | Bacteria | 12551 |
| 183 | Ga0068855_100030535 | 3300005563 | Bacteria | 6444 |
| 184 | Ga0068855_100160366 | 3300005563 | Bacteria | 2553 |
| 185 | Ga0068855_100179051 | 3300005563 | Bacteria | 2398 |
| 186 | Ga0068855_100209328 | 3300005563 | Bacteria | 2192 |
| 187 | Ga0068855_100580577 | 3300005563 | Bacteria | 1211 |
| 188 | Ga0070664_100020489 | 3300005564 | Bacteria | 5445 |
| 189 | Ga0070664_100146650 | 3300005564 | Bacteria | 2081 |
| 190 | Ga0070664_100392951 | 3300005564 | Bacteria | 1267 |
| 191 | Ga0070664_101015478 | 3300005564 | Bacteria | 780 |
| 192 | Ga0070664_101389635 | 3300005564 | Bacteria | 664 |
| 193 | Ga0068857_100002542 | 3300005577 | Bacteria | 14936 |
| 194 | Ga0068857_100075687 | 3300005577 | Bacteria | 3001 |
| 195 | Ga0068857_100117657 | 3300005577 | Bacteria | 2391 |
| 196 | Ga0068857_100514128 | 3300005577 | Bacteria | 1125 |
| 197 | Ga0068857_100991210 | 3300005577 | Bacteria | 808 |
| 198 | Ga0068854_100012169 | 3300005578 | Bacteria | 5630 |
| 199 | Ga0068854_100060190 | 3300005578 | Bacteria | 2746 |
| 200 | Ga0068854_100088278 | 3300005578 | Bacteria | 2302 |
| 201 | Ga0068854_100146967 | 3300005578 | Bacteria | 1814 |
| 202 | Ga0068854_100182664 | 3300005578 | Bacteria | 1639 |
| 203 | Ga0068854_100301987 | 3300005578 | Bacteria | 1295 |
| 204 | Ga0068854_100768018 | 3300005578 | Bacteria | 837 |
| 205 | Ga0068856_100003174 | 3300005614 | Bacteria | 16729 |
| 206 | Ga0068856_100021624 | 3300005614 | Bacteria | 6252 |
| 207 | Ga0068856_100329386 | 3300005614 | Bacteria | 1545 |
| 208 | Ga0068856_101089069 | 3300005614 | Bacteria | 816 |
| 209 | Ga0070702_100385695 | 3300005615 | Bacteria | 998 |
| 210 | Ga0068852_100094445 | 3300005616 | Bacteria | 2683 |
| 211 | Ga0068852_100178858 | 3300005616 | Bacteria | 1993 |
| 212 | Ga0068852_100201137 | 3300005616 | Bacteria | 1885 |
| 213 | Ga0068852_100238240 | 3300005616 | Bacteria | 1737 |
| 214 | Ga0068852_100541139 | 3300005616 | Bacteria | 1164 |
| 215 | Ga0068852_100989743 | 3300005616 | Bacteria | 859 |
| 216 | Ga0068852_101449339 | 3300005616 | Bacteria | 709 |
| 217 | Ga0068859_100010211 | 3300005617 | Bacteria | 9449 |
| 218 | Ga0068859_100567876 | 3300005617 | Bacteria | 1228 |
| 219 | Ga0068859_101335082 | 3300005617 | Bacteria | 790 |
| 220 | Ga0068864_100001915 | 3300005618 | Bacteria | 17082 |
| 221 | Ga0068864_100005578 | 3300005618 | Bacteria | 10318 |
| 222 | Ga0068864_100047489 | 3300005618 | Bacteria | 3688 |
| 223 | Ga0068864_100062295 | 3300005618 | Bacteria | 3232 |
| 224 | Ga0068864_100663254 | 3300005618 | Bacteria | 1016 |
| 225 | Ga0068866_10005777 | 3300005718 | Bacteria | 5130 |
| 226 | Ga0068866_10857448 | 3300005718 | Bacteria | 636 |
| 227 | Ga0068861_100003183 | 3300005719 | Bacteria | 10860 |
| 228 | Ga0068861_100072447 | 3300005719 | Bacteria | 2673 |
| 229 | Ga0068861_100124412 | 3300005719 | Bacteria | 2085 |
| 230 | Ga0068861_100200015 | 3300005719 | Bacteria | 1676 |
| 231 | Ga0068861_100554935 | 3300005719 | Bacteria | 1047 |
| 232 | Ga0068851_10102836 | 3300005834 | Bacteria | 1517 |
| 233 | Ga0068851_10152401 | 3300005834 | Bacteria | 1264 |
| 234 | Ga0068851_10327412 | 3300005834 | Bacteria | 886 |
| 235 | Ga0068851_10391892 | 3300005834 | Bacteria | 816 |
| 236 | Ga0068863_100011347 | 3300005841 | Bacteria | 8627 |
| 237 | Ga0068863_100089212 | 3300005841 | Bacteria | 2923 |
| 238 | Ga0068863_100389617 | 3300005841 | Bacteria | 1361 |
| 239 | Ga0068863_100616797 | 3300005841 | Bacteria | 1074 |
| 240 | Ga0068858_100159495 | 3300005842 | Bacteria | 2124 |
| 241 | Ga0068858_101140953 | 3300005842 | Bacteria | 766 |
| 242 | Ga0068860_100002707 | 3300005843 | Bacteria | 18439 |
| 243 | Ga0068860_100267957 | 3300005843 | Bacteria | 1666 |
| 244 | Ga0068862_100006297 | 3300005844 | Bacteria | 9873 |
| 245 | Ga0068862_100033250 | 3300005844 | Bacteria | 4358 |
| 246 | Ga0068862_100041742 | 3300005844 | Bacteria | 3904 |
| 247 | Ga0068862_100154048 | 3300005844 | Bacteria | 2047 |
| 248 | Ga0081538_10021290 | 3300005981 | Bacteria | 4738 |
| 249 | Ga0081540_1035958 | 3300005983 | Bacteria | 2648 |
| 250 | Ga0081539_10000617 | 3300005985 | Bacteria | 72003 |
| 251 | Ga0070717_10028434 | 3300006028 | Bacteria | 4476 |
| 252 | Ga0070717_10358474 | 3300006028 | Bacteria | 1305 |
| 253 | Ga0075368_10077518 | 3300006042 | Bacteria | 1349 |
| 254 | Ga0075368_10212506 | 3300006042 | Bacteria | 820 |
| 255 | Ga0075363_100010223 | 3300006048 | Bacteria | 4442 |
| 256 | Ga0075364_10048232 | 3300006051 | Bacteria | 2775 |
| 257 | Ga0075364_10398089 | 3300006051 | Bacteria | 939 |
| 258 | Ga0075364_11125140 | 3300006051 | Bacteria | 533 |
| 259 | Ga0075432_10086362 | 3300006058 | Bacteria | 1143 |
| 260 | Ga0070715_10013898 | 3300006163 | Bacteria | 2968 |
| 261 | Ga0075362_10021552 | 3300006177 | Bacteria | 2706 |
| 262 | Ga0075362_10069344 | 3300006177 | Bacteria | 1607 |
| 263 | Ga0075362_10212690 | 3300006177 | Bacteria | 943 |
| 264 | Ga0075367_10042370 | 3300006178 | Bacteria | 2663 |
| 265 | Ga0075367_10139526 | 3300006178 | Bacteria | 1501 |
| 266 | Ga0075369_10031758 | 3300006186 | Bacteria | 2231 |
| 267 | Ga0075366_10008494 | 3300006195 | Bacteria | 5713 |
| 268 | Ga0075366_10012080 | 3300006195 | Bacteria | 4890 |
| 269 | Ga0075366_10040468 | 3300006195 | Bacteria | 2757 |
| 270 | Ga0075366_10085820 | 3300006195 | Bacteria | 1883 |
| 271 | Ga0075366_10161106 | 3300006195 | Bacteria | 1359 |
| 272 | Ga0075366_10192843 | 3300006195 | Bacteria | 1238 |
| 273 | Ga0075366_10220835 | 3300006195 | Bacteria | 1154 |
| 274 | Ga0097621_100072627 | 3300006237 | Bacteria | 2846 |
| 275 | Ga0097621_100105115 | 3300006237 | Bacteria | 2380 |
| 276 | Ga0097621_100126855 | 3300006237 | Bacteria | 2168 |
| 277 | Ga0097621_100229999 | 3300006237 | Bacteria | 1618 |
| 278 | Ga0097621_100326286 | 3300006237 | Bacteria | 1360 |
| 279 | Ga0097621_100603024 | 3300006237 | Bacteria | 1004 |
| 280 | Ga0097621_101356393 | 3300006237 | Bacteria | 673 |
| 281 | Ga0097621_101519783 | 3300006237 | Bacteria | 635 |
| 282 | Ga0075370_10006621 | 3300006353 | Bacteria | 5840 |
| 283 | Ga0075370_10006736 | 3300006353 | Bacteria | 5798 |
| 284 | Ga0075370_10018502 | 3300006353 | Bacteria | 3781 |
| 285 | Ga0075370_10084819 | 3300006353 | Bacteria | 1823 |
| 286 | Ga0068871_100006827 | 3300006358 | Bacteria | 8119 |
| 287 | Ga0068871_100046827 | 3300006358 | Bacteria | 3484 |
| 288 | Ga0068871_100049854 | 3300006358 | Bacteria | 3385 |
| 289 | Ga0075428_100037961 | 3300006844 | Bacteria | 5301 |
| 290 | Ga0075430_100141446 | 3300006846 | Bacteria | 2004 |
| 291 | Ga0075431_100056480 | 3300006847 | Bacteria | 4049 |
| 292 | Ga0068865_100010326 | 3300006881 | Bacteria | 5808 |
| 293 | Ga0068865_100013714 | 3300006881 | Bacteria | 5133 |
| 294 | Ga0097620_100010212 | 3300006931 | Bacteria | 9449 |
| 295 | Ga0097620_100567860 | 3300006931 | Bacteria | 1228 |
| 296 | Ga0097620_101335072 | 3300006931 | Bacteria | 790 |
| 297 | Ga0105240_10013171 | 3300009093 | Bacteria | 11376 |
| 298 | Ga0105240_10051215 | 3300009093 | Bacteria | 5198 |
| 299 | Ga0105240_10085474 | 3300009093 | Bacteria | 3864 |
| 300 | Ga0105240_10098021 | 3300009093 | Bacteria | 3571 |
| 301 | Ga0105240_10118401 | 3300009093 | Bacteria | 3192 |
| 302 | Ga0105240_10503646 | 3300009093 | Bacteria | 1346 |
| 303 | Ga0111539_10239408 | 3300009094 | Bacteria | 2112 |
| 304 | Ga0105245_10033929 | 3300009098 | Bacteria | 4523 |
| 305 | Ga0105245_10081246 | 3300009098 | Bacteria | 2963 |
| 306 | Ga0105245_10100259 | 3300009098 | Bacteria | 2679 |
| 307 | Ga0105245_10491786 | 3300009098 | Bacteria | 1241 |
| 308 | Ga0105247_10722166 | 3300009101 | Bacteria | 752 |
| 309 | Ga0105243_10004595 | 3300009148 | Bacteria | 10881 |
| 310 | Ga0105243_10230023 | 3300009148 | Bacteria | 1644 |
| 311 | Ga0105243_10248324 | 3300009148 | Bacteria | 1587 |
| 312 | Ga0105243_10322215 | 3300009148 | Bacteria | 1409 |
| 313 | Ga0105241_10259293 | 3300009174 | Bacteria | 1477 |
| 314 | Ga0105241_10284041 | 3300009174 | Bacteria | 1414 |
| 315 | Ga0105242_10127617 | 3300009176 | Bacteria | 2191 |
| 316 | Ga0105242_11380649 | 3300009176 | Bacteria | 731 |
| 317 | Ga0105248_10008033 | 3300009177 | Bacteria | 11587 |
| 318 | Ga0105248_10081205 | 3300009177 | Bacteria | 3644 |
| 319 | Ga0105248_10834043 | 3300009177 | Bacteria | 1041 |
| 320 | Ga0105237_10037720 | 3300009545 | Bacteria | 4884 |
| 321 | Ga0105237_10062076 | 3300009545 | Bacteria | 3736 |
| 322 | Ga0105237_10085690 | 3300009545 | Bacteria | 3140 |
| 323 | Ga0105237_10136637 | 3300009545 | Bacteria | 2446 |
| 324 | Ga0105237_10633881 | 3300009545 | Bacteria | 1076 |
| 325 | Ga0105238_10013227 | 3300009551 | Bacteria | 8326 |
| 326 | Ga0105238_10034659 | 3300009551 | Bacteria | 5135 |
| 327 | Ga0105238_10053983 | 3300009551 | Bacteria | 4037 |
| 328 | Ga0105238_10091391 | 3300009551 | Bacteria | 3031 |
| 329 | Ga0105238_10167006 | 3300009551 | Bacteria | 2177 |
| 330 | Ga0105238_10269970 | 3300009551 | Bacteria | 1681 |
| 331 | Ga0105238_10300930 | 3300009551 | Bacteria | 1587 |
| 332 | Ga0105238_10687003 | 3300009551 | Bacteria | 1035 |
| 333 | Ga0105238_10835669 | 3300009551 | Bacteria | 938 |
| 334 | Ga0105238_11361673 | 3300009551 | Bacteria | 736 |
| 335 | Ga0105249_10088620 | 3300009553 | Bacteria | 2890 |
| 336 | Ga0105249_10134118 | 3300009553 | Bacteria | 2367 |
| 337 | Ga0105249_10172734 | 3300009553 | Bacteria | 2097 |
| 338 | Ga0105249_10303720 | 3300009553 | Bacteria | 1602 |
| 339 | Ga0105249_10536865 | 3300009553 | Bacteria | 1219 |
| 340 | Ga0105249_11162630 | 3300009553 | Bacteria | 842 |
| 341 | Ga0105239_10002730 | 3300010375 | Bacteria | 22163 |
| 342 | Ga0105239_10029727 | 3300010375 | Bacteria | 6008 |
| 343 | Ga0105239_10033427 | 3300010375 | Bacteria | 5648 |
| 344 | Ga0105239_10138849 | 3300010375 | Bacteria | 2707 |
| 345 | Ga0105239_10241157 | 3300010375 | Bacteria | 2029 |
| 346 | Ga0105246_10142595 | 3300011119 | Bacteria | 1803 |
| 347 | Ga0105246_10321268 | 3300011119 | Bacteria | 1258 |
| 348 | Ga0157341_1013590 | 3300012494 | Bacteria | 730 |
| 349 | Ga0157373_10012235 | 3300013100 | Bacteria | 6309 |
| 350 | Ga0157369_10004416 | 3300013105 | Bacteria | 16597 |
| 351 | Ga0157369_10233802 | 3300013105 | Bacteria | 1921 |
| 352 | Ga0157369_11168944 | 3300013105 | Bacteria | 786 |
| 353 | Ga0157374_10007118 | 3300013296 | Bacteria | 9528 |
| 354 | Ga0157374_10095353 | 3300013296 | Bacteria | 2845 |
| 355 | Ga0157374_10268968 | 3300013296 | Bacteria | 1680 |
| 356 | Ga0157374_10653393 | 3300013296 | Bacteria | 1063 |
| 357 | Ga0157378_10247821 | 3300013297 | Bacteria | 1704 |
| 358 | Ga0157378_10282318 | 3300013297 | Bacteria | 1601 |
| 359 | Ga0157378_10286921 | 3300013297 | Bacteria | 1588 |
| 360 | Ga0157378_10804753 | 3300013297 | Bacteria | 966 |
| 361 | Ga0163162_10011386 | 3300013306 | Bacteria | 8673 |
| 362 | Ga0163162_10013440 | 3300013306 | Bacteria | 7990 |
| 363 | Ga0163162_10082936 | 3300013306 | Bacteria | 3279 |
| 364 | Ga0163162_10173972 | 3300013306 | Bacteria | 2278 |
| 365 | Ga0157372_10010659 | 3300013307 | Bacteria | 9778 |
| 366 | Ga0157372_10252013 | 3300013307 | Bacteria | 2049 |
| 367 | Ga0157372_11067182 | 3300013307 | Bacteria | 935 |
| 368 | Ga0157375_10004510 | 3300013308 | Bacteria | 12107 |
| 369 | Ga0157375_10092181 | 3300013308 | Bacteria | 3093 |
| 370 | Ga0157375_10097366 | 3300013308 | Bacteria | 3016 |
| 371 | Ga0157375_10126249 | 3300013308 | Bacteria | 2673 |
| 372 | Ga0157375_11069189 | 3300013308 | Bacteria | 944 |
| 373 | Ga0157375_11167751 | 3300013308 | Bacteria | 902 |
| 374 | Ga0157375_12201351 | 3300013308 | Bacteria | 657 |
| 375 | Ga0163163_10052942 | 3300014325 | Bacteria | 4006 |
| 376 | Ga0163163_10084865 | 3300014325 | Bacteria | 3174 |
| 377 | Ga0163163_10095599 | 3300014325 | Bacteria | 2991 |
| 378 | Ga0163163_10330491 | 3300014325 | Bacteria | 1579 |
| 379 | Ga0163163_11186221 | 3300014325 | Bacteria | 826 |
| 380 | Ga0157380_10439715 | 3300014326 | Bacteria | 1249 |
| 381 | Ga0157380_11103385 | 3300014326 | Bacteria | 833 |
| 382 | Ga0182008_10807465 | 3300014497 | Bacteria | 545 |
| 383 | Ga0157377_10352414 | 3300014745 | Bacteria | 988 |
| 384 | Ga0157377_10575874 | 3300014745 | Bacteria | 799 |
| 385 | Ga0157379_10010452 | 3300014968 | Bacteria | 8090 |
| 386 | Ga0157379_10330220 | 3300014968 | Bacteria | 1393 |
| 387 | Ga0157379_10348252 | 3300014968 | Bacteria | 1356 |
| 388 | Ga0157379_10480377 | 3300014968 | Bacteria | 1150 |
| 389 | Ga0157379_10600370 | 3300014968 | Bacteria | 1028 |
| 390 | Ga0157379_11119126 | 3300014968 | Bacteria | 755 |
| 391 | Ga0157376_10004195 | 3300014969 | Bacteria | 9999 |
| 392 | Ga0157376_10071755 | 3300014969 | Bacteria | 2944 |
| 393 | Ga0157376_10081366 | 3300014969 | Bacteria | 2781 |
| 394 | Ga0157376_10309586 | 3300014969 | Bacteria | 1498 |
| 395 | Ga0157376_10933886 | 3300014969 | Bacteria | 887 |
| 396 | Ga0182007_10028336 | 3300015262 | Bacteria | 1925 |
| 397 | Ga0163161_10029214 | 3300017792 | Bacteria | 3919 |
| 398 | Ga0163161_10148429 | 3300017792 | Bacteria | 1780 |
| 399 | Ga0163161_10312557 | 3300017792 | Bacteria | 1240 |
| 400 | Ga0213872_10020494 | 3300021361 | Bacteria | 3048 |
| 401 | Ga0213874_10013909 | 3300021377 | Bacteria | 2095 |
| 402 | Ga0213876_10000320 | 3300021384 | Bacteria | 42027 |
| 403 | Ga0213876_10013845 | 3300021384 | Bacteria | 4275 |
| 404 | Ga0213876_10078214 | 3300021384 | Bacteria | 1748 |
| 405 | Ga0213875_10145273 | 3300021388 | Bacteria | 1111 |
| 406 | Ga0228598_1079813 | 3300024227 | Bacteria | 656 |
| 407 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 408 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 409 | Ga0209258_100700 | 3300025242 | Bacteria | 22801 |
| 410 | Ga0209646_1000257 | 3300025246 | Bacteria | 52257 |
| 411 | Ga0209026_1000054 | 3300025250 | Bacteria | 242508 |
| 412 | Ga0209026_1029234 | 3300025250 | Bacteria | 822 |
| 413 | Ga0209677_100050 | 3300025253 | Bacteria | 176828 |
| 414 | Ga0209677_100316 | 3300025253 | Bacteria | 31473 |
| 415 | Ga0209759_1000043 | 3300025256 | Bacteria | 242513 |
| 416 | Ga0209759_1001086 | 3300025256 | Bacteria | 17708 |
| 417 | Ga0209759_1007199 | 3300025256 | Bacteria | 3616 |
| 418 | Ga0209759_1007372 | 3300025256 | Bacteria | 3545 |
| 419 | Ga0209759_1020122 | 3300025256 | Bacteria | 1560 |
| 420 | Ga0207666_1034245 | 3300025271 | Bacteria | 785 |
| 421 | Ga0209257_1020862 | 3300025304 | Bacteria | 2403 |
| 422 | Ga0207697_10011255 | 3300025315 | Bacteria | 3790 |
| 423 | Ga0207697_10051694 | 3300025315 | Bacteria | 1699 |
| 424 | Ga0207697_10072947 | 3300025315 | Bacteria | 1440 |
| 425 | Ga0207656_10056547 | 3300025321 | Bacteria | 1710 |
| 426 | Ga0207656_10079392 | 3300025321 | Bacteria | 1472 |
| 427 | Ga0207656_10106025 | 3300025321 | Bacteria | 1293 |
| 428 | Ga0207656_10123197 | 3300025321 | Bacteria | 1209 |
| 429 | Ga0207682_10002713 | 3300025893 | Bacteria | 7857 |
| 430 | Ga0207710_10023200 | 3300025900 | Bacteria | 2666 |
| 431 | Ga0207688_10021261 | 3300025901 | Bacteria | 3544 |
| 432 | Ga0207688_10035566 | 3300025901 | Bacteria | 2760 |
| 433 | Ga0207680_10574620 | 3300025903 | Bacteria | 805 |
| 434 | Ga0207645_10013318 | 3300025907 | Bacteria | 5548 |
| 435 | Ga0207645_10033535 | 3300025907 | Bacteria | 3300 |
| 436 | Ga0207645_10389387 | 3300025907 | Bacteria | 936 |
| 437 | Ga0207643_10073334 | 3300025908 | Bacteria | 1973 |
| 438 | Ga0207643_10140986 | 3300025908 | Bacteria | 1440 |
| 439 | Ga0207643_10284330 | 3300025908 | Bacteria | 1026 |
| 440 | Ga0207705_10063288 | 3300025909 | Bacteria | 2673 |
| 441 | Ga0207705_10377252 | 3300025909 | Bacteria | 1095 |
| 442 | Ga0207705_10455173 | 3300025909 | Bacteria | 992 |
| 443 | Ga0207705_10761505 | 3300025909 | Bacteria | 752 |
| 444 | Ga0207684_10006317 | 3300025910 | Bacteria | 10809 |
| 445 | Ga0207684_10092637 | 3300025910 | Bacteria | 2576 |
| 446 | Ga0207654_10140240 | 3300025911 | Bacteria | 1541 |
| 447 | Ga0207707_10168156 | 3300025912 | Bacteria | 1916 |
| 448 | Ga0207671_10111436 | 3300025914 | Bacteria | 2082 |
| 449 | Ga0207671_10173436 | 3300025914 | Bacteria | 1675 |
| 450 | Ga0207671_10278855 | 3300025914 | Bacteria | 1318 |
| 451 | Ga0207671_10598003 | 3300025914 | Bacteria | 879 |
| 452 | Ga0207693_10210518 | 3300025915 | Bacteria | 1528 |
| 453 | Ga0207660_10013863 | 3300025917 | Bacteria | 5289 |
| 454 | Ga0207660_10014201 | 3300025917 | Bacteria | 5230 |
| 455 | Ga0207660_10025665 | 3300025917 | Bacteria | 4003 |
| 456 | Ga0207657_10017177 | 3300025919 | Bacteria | 6951 |
| 457 | Ga0207657_10029996 | 3300025919 | Bacteria | 4942 |
| 458 | Ga0207657_10077341 | 3300025919 | Bacteria | 2804 |
| 459 | Ga0207657_10175173 | 3300025919 | Bacteria | 1736 |
| 460 | Ga0207657_10363682 | 3300025919 | Bacteria | 1140 |
| 461 | Ga0207657_10689728 | 3300025919 | Bacteria | 794 |
| 462 | Ga0207649_10087335 | 3300025920 | Bacteria | 2034 |
| 463 | Ga0207649_10701527 | 3300025920 | Bacteria | 785 |
| 464 | Ga0207652_10096240 | 3300025921 | Bacteria | 2608 |
| 465 | Ga0207646_10052114 | 3300025922 | Bacteria | 3661 |
| 466 | Ga0207646_10174411 | 3300025922 | Bacteria | 1942 |
| 467 | Ga0207646_11569991 | 3300025922 | Bacteria | 568 |
| 468 | Ga0207681_10006059 | 3300025923 | Bacteria | 7417 |
| 469 | Ga0207681_10112035 | 3300025923 | Bacteria | 1986 |
| 470 | Ga0207681_10124516 | 3300025923 | Bacteria | 1895 |
| 471 | Ga0207681_10291164 | 3300025923 | Bacteria | 1289 |
| 472 | Ga0207694_10013700 | 3300025924 | Bacteria | 6111 |
| 473 | Ga0207694_10031813 | 3300025924 | Bacteria | 4033 |
| 474 | Ga0207694_10449771 | 3300025924 | Bacteria | 1075 |
| 475 | Ga0207694_10674823 | 3300025924 | Bacteria | 871 |
| 476 | Ga0207694_10767015 | 3300025924 | Bacteria | 814 |
| 477 | Ga0207650_10000408 | 3300025925 | Bacteria | 38515 |
| 478 | Ga0207650_10008713 | 3300025925 | Bacteria | 6926 |
| 479 | Ga0207650_10021070 | 3300025925 | Bacteria | 4605 |
| 480 | Ga0207650_10524697 | 3300025925 | Bacteria | 991 |
| 481 | Ga0207659_10000775 | 3300025926 | Bacteria | 18918 |
| 482 | Ga0207659_10027360 | 3300025926 | Bacteria | 3861 |
| 483 | Ga0207659_10455249 | 3300025926 | Bacteria | 1078 |
| 484 | Ga0207687_10028883 | 3300025927 | Bacteria | 3727 |
| 485 | Ga0207687_10140822 | 3300025927 | Bacteria | 1830 |
| 486 | Ga0207687_10145092 | 3300025927 | Bacteria | 1805 |
| 487 | Ga0207687_10684489 | 3300025927 | Bacteria | 869 |
| 488 | Ga0207700_10251354 | 3300025928 | Bacteria | 1510 |
| 489 | Ga0207664_10093577 | 3300025929 | Bacteria | 2469 |
| 490 | Ga0207664_10719386 | 3300025929 | Bacteria | 898 |
| 491 | Ga0207644_10011177 | 3300025931 | Bacteria | 5932 |
| 492 | Ga0207644_10111536 | 3300025931 | Bacteria | 2069 |
| 493 | Ga0207644_10372927 | 3300025931 | Bacteria | 1163 |
| 494 | Ga0207644_10424186 | 3300025931 | Bacteria | 1090 |
| 495 | Ga0207644_10475583 | 3300025931 | Bacteria | 1028 |
| 496 | Ga0207644_10548773 | 3300025931 | Bacteria | 956 |
| 497 | Ga0207644_10774640 | 3300025931 | Bacteria | 802 |
| 498 | Ga0207644_11000790 | 3300025931 | Bacteria | 702 |
| 499 | Ga0207644_11012014 | 3300025931 | Bacteria | 697 |
| 500 | Ga0207690_10154689 | 3300025932 | Bacteria | 1703 |
| 501 | Ga0207690_10212660 | 3300025932 | Bacteria | 1475 |
| 502 | Ga0207690_10228431 | 3300025932 | Bacteria | 1427 |
| 503 | Ga0207690_10531001 | 3300025932 | Bacteria | 955 |
| 504 | Ga0207690_10586255 | 3300025932 | Bacteria | 909 |
| 505 | Ga0207706_10005446 | 3300025933 | Bacteria | 11860 |
| 506 | Ga0207706_10114233 | 3300025933 | Bacteria | 2375 |
| 507 | Ga0207706_10256036 | 3300025933 | Bacteria | 1528 |
| 508 | Ga0207686_11531673 | 3300025934 | Bacteria | 550 |
| 509 | Ga0207709_10063345 | 3300025935 | Bacteria | 2317 |
| 510 | Ga0207709_10164485 | 3300025935 | Bacteria | 1551 |
| 511 | Ga0207709_10374788 | 3300025935 | Bacteria | 1081 |
| 512 | Ga0207670_10527379 | 3300025936 | Bacteria | 962 |
| 513 | Ga0207669_10005530 | 3300025937 | Bacteria | 5680 |
| 514 | Ga0207669_10060349 | 3300025937 | Bacteria | 2324 |
| 515 | Ga0207669_10083324 | 3300025937 | Bacteria | 2056 |
| 516 | Ga0207669_10454684 | 3300025937 | Bacteria | 1015 |
| 517 | Ga0207704_10009803 | 3300025938 | Bacteria | 4638 |
| 518 | Ga0207691_10000360 | 3300025940 | Bacteria | 45895 |
| 519 | Ga0207691_10028023 | 3300025940 | Bacteria | 5278 |
| 520 | Ga0207691_10055485 | 3300025940 | Bacteria | 3610 |
| 521 | Ga0207691_10191803 | 3300025940 | Bacteria | 1782 |
| 522 | Ga0207691_10208810 | 3300025940 | Bacteria | 1697 |
| 523 | Ga0207691_10374450 | 3300025940 | Bacteria | 1216 |
| 524 | Ga0207691_10382534 | 3300025940 | Bacteria | 1201 |
| 525 | Ga0207711_10060901 | 3300025941 | Bacteria | 3254 |
| 526 | Ga0207711_10179546 | 3300025941 | Bacteria | 1924 |
| 527 | Ga0207711_11017865 | 3300025941 | Bacteria | 768 |
| 528 | Ga0207689_10000550 | 3300025942 | Bacteria | 35746 |
| 529 | Ga0207689_10005418 | 3300025942 | Bacteria | 11422 |
| 530 | Ga0207689_10045901 | 3300025942 | Bacteria | 3612 |
| 531 | Ga0207689_10232972 | 3300025942 | Bacteria | 1522 |
| 532 | Ga0207689_10300263 | 3300025942 | Bacteria | 1331 |
| 533 | Ga0207689_10414685 | 3300025942 | Bacteria | 1123 |
| 534 | Ga0207661_10009060 | 3300025944 | Bacteria | 7131 |
| 535 | Ga0207661_10134005 | 3300025944 | Bacteria | 2126 |
| 536 | Ga0207661_10170343 | 3300025944 | Bacteria | 1895 |
| 537 | Ga0207661_10246521 | 3300025944 | Bacteria | 1586 |
| 538 | Ga0207661_10679394 | 3300025944 | Bacteria | 947 |
| 539 | Ga0207679_10003726 | 3300025945 | Bacteria | 9451 |
| 540 | Ga0207679_10361897 | 3300025945 | Bacteria | 1267 |
| 541 | Ga0207679_11592574 | 3300025945 | Bacteria | 599 |
| 542 | Ga0207667_10012561 | 3300025949 | Bacteria | 9742 |
| 543 | Ga0207667_10047907 | 3300025949 | Bacteria | 4521 |
| 544 | Ga0207667_10180435 | 3300025949 | Bacteria | 2168 |
| 545 | Ga0207651_10007721 | 3300025960 | Bacteria | 5748 |
| 546 | Ga0207651_10083499 | 3300025960 | Bacteria | 2310 |
| 547 | Ga0207651_10104845 | 3300025960 | Bacteria | 2107 |
| 548 | Ga0207651_10245587 | 3300025960 | Bacteria | 1461 |
| 549 | Ga0207651_10347699 | 3300025960 | Bacteria | 1247 |
| 550 | Ga0207651_11168467 | 3300025960 | Bacteria | 690 |
| 551 | Ga0207651_11690149 | 3300025960 | Bacteria | 570 |
| 552 | Ga0207712_10018795 | 3300025961 | Bacteria | 4506 |
| 553 | Ga0207712_10119023 | 3300025961 | Bacteria | 1995 |
| 554 | Ga0207712_10986626 | 3300025961 | Bacteria | 747 |
| 555 | Ga0207668_10036498 | 3300025972 | Bacteria | 3280 |
| 556 | Ga0207668_10050945 | 3300025972 | Bacteria | 2856 |
| 557 | Ga0207668_10121772 | 3300025972 | Bacteria | 1976 |
| 558 | Ga0207668_10428276 | 3300025972 | Bacteria | 1124 |
| 559 | Ga0207640_10061934 | 3300025981 | Bacteria | 2480 |
| 560 | Ga0207640_10126093 | 3300025981 | Bacteria | 1843 |
| 561 | Ga0207640_10138846 | 3300025981 | Bacteria | 1768 |
| 562 | Ga0207640_10167522 | 3300025981 | Bacteria | 1633 |
| 563 | Ga0207640_10313059 | 3300025981 | Bacteria | 1247 |
| 564 | Ga0207640_10355629 | 3300025981 | Bacteria | 1178 |
| 565 | Ga0207658_10013819 | 3300025986 | Bacteria | 5524 |
| 566 | Ga0207658_10218590 | 3300025986 | Bacteria | 1601 |
| 567 | Ga0207677_10005039 | 3300026023 | Bacteria | 7138 |
| 568 | Ga0207677_10040495 | 3300026023 | Bacteria | 3072 |
| 569 | Ga0207677_10040938 | 3300026023 | Bacteria | 3060 |
| 570 | Ga0207677_10125339 | 3300026023 | Bacteria | 1940 |
| 571 | Ga0207677_10766819 | 3300026023 | Bacteria | 861 |
| 572 | Ga0207703_10021520 | 3300026035 | Bacteria | 5049 |
| 573 | Ga0207703_10140792 | 3300026035 | Bacteria | 2093 |
| 574 | Ga0207703_10406747 | 3300026035 | Bacteria | 1264 |
| 575 | Ga0207703_10833961 | 3300026035 | Bacteria | 881 |
| 576 | Ga0207639_10028942 | 3300026041 | Bacteria | 4050 |
| 577 | Ga0207639_10048460 | 3300026041 | Bacteria | 3216 |
| 578 | Ga0207639_10648705 | 3300026041 | Bacteria | 976 |
| 579 | Ga0207639_10897623 | 3300026041 | Bacteria | 828 |
| 580 | Ga0207678_10040307 | 3300026067 | Bacteria | 4051 |
| 581 | Ga0207678_10057806 | 3300026067 | Bacteria | 3338 |
| 582 | Ga0207678_10067677 | 3300026067 | Bacteria | 3065 |
| 583 | Ga0207708_10012007 | 3300026075 | Bacteria | 6453 |
| 584 | Ga0207708_10021407 | 3300026075 | Bacteria | 4877 |
| 585 | Ga0207708_10025472 | 3300026075 | Bacteria | 4474 |
| 586 | Ga0207708_10176849 | 3300026075 | Bacteria | 1693 |
| 587 | Ga0207702_10004454 | 3300026078 | Bacteria | 12446 |
| 588 | Ga0207702_10011854 | 3300026078 | Bacteria | 7255 |
| 589 | Ga0207702_10609855 | 3300026078 | Bacteria | 1071 |
| 590 | Ga0207702_10683692 | 3300026078 | Bacteria | 1011 |
| 591 | Ga0207641_10002779 | 3300026088 | Bacteria | 15944 |
| 592 | Ga0207641_10040743 | 3300026088 | Bacteria | 3890 |
| 593 | Ga0207641_10068611 | 3300026088 | Bacteria | 3041 |
| 594 | Ga0207648_10018173 | 3300026089 | Bacteria | 6369 |
| 595 | Ga0207648_10077377 | 3300026089 | Bacteria | 2900 |
| 596 | Ga0207648_10772546 | 3300026089 | Bacteria | 893 |
| 597 | Ga0207648_11191882 | 3300026089 | Bacteria | 715 |
| 598 | Ga0207676_10011759 | 3300026095 | Bacteria | 6259 |
| 599 | Ga0207676_10101927 | 3300026095 | Bacteria | 2381 |
| 600 | Ga0207676_10105250 | 3300026095 | Bacteria | 2348 |
| 601 | Ga0207676_10342893 | 3300026095 | Bacteria | 1379 |
| 602 | Ga0207676_10795142 | 3300026095 | Bacteria | 922 |
| 603 | Ga0207674_10021066 | 3300026116 | Bacteria | 7031 |
| 604 | Ga0207674_10024173 | 3300026116 | Bacteria | 6496 |
| 605 | Ga0207674_10732725 | 3300026116 | Bacteria | 954 |
| 606 | Ga0207674_11115352 | 3300026116 | Bacteria | 758 |
| 607 | Ga0207675_100000576 | 3300026118 | Bacteria | 35873 |
| 608 | Ga0207675_100002372 | 3300026118 | Bacteria | 18650 |
| 609 | Ga0207675_100027403 | 3300026118 | Bacteria | 5307 |
| 610 | Ga0207675_100160619 | 3300026118 | Bacteria | 2143 |
| 611 | Ga0207675_100332382 | 3300026118 | Bacteria | 1486 |
| 612 | Ga0207675_101208499 | 3300026118 | Bacteria | 776 |
| 613 | Ga0207683_10006928 | 3300026121 | Bacteria | 9707 |
| 614 | Ga0207683_10046461 | 3300026121 | Bacteria | 3800 |
| 615 | Ga0207683_10066278 | 3300026121 | Bacteria | 3184 |
| 616 | Ga0207683_10088749 | 3300026121 | Bacteria | 2752 |
| 617 | Ga0207683_10201427 | 3300026121 | Bacteria | 1810 |
| 618 | Ga0207683_10814249 | 3300026121 | Bacteria | 867 |
| 619 | Ga0207698_10007575 | 3300026142 | Bacteria | 6805 |
| 620 | Ga0207698_10009788 | 3300026142 | Bacteria | 6123 |
| 621 | Ga0207698_10675002 | 3300026142 | Bacteria | 1026 |
| 622 | Ga0207698_10941339 | 3300026142 | Bacteria | 873 |
| 623 | Ga0207698_11025973 | 3300026142 | Bacteria | 836 |
| 624 | Ga0207698_11875927 | 3300026142 | Bacteria | 614 |
| 625 | Ga0209813_10071989 | 3300027866 | Bacteria | 1126 |
| 626 | Ga0207428_10000098 | 3300027907 | Bacteria | 120181 |
| 627 | Ga0268266_10177715 | 3300028379 | Bacteria | 1936 |
| 628 | Ga0268266_10441477 | 3300028379 | Bacteria | 1236 |
| 629 | Ga0268265_10025046 | 3300028380 | Bacteria | 4229 |
| 630 | Ga0268265_10063188 | 3300028380 | Bacteria | 2847 |
| 631 | Ga0268265_10067092 | 3300028380 | Bacteria | 2776 |
| 632 | Ga0268264_10002728 | 3300028381 | Bacteria | 15415 |
| 633 | Ga0268264_10004187 | 3300028381 | Bacteria | 12320 |
| 634 | Ga0268264_10032705 | 3300028381 | Bacteria | 4268 |
| 635 | Ga0265334_10144263 | 3300028573 | Bacteria | 842 |
| 636 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 637 | Ga0307517_10090491 | 3300028786 | Bacteria | 2510 |
| 638 | Ga0265324_10005524 | 3300029957 | Bacteria | 5447 |
| 639 | Ga0265324_10024172 | 3300029957 | Bacteria | 2160 |
| 640 | Ga0307511_10207407 | 3300030521 | Bacteria | 1006 |
| 641 | Ga0265330_10014154 | 3300031235 | Bacteria | 3703 |
| 642 | Ga0265330_10036812 | 3300031235 | Bacteria | 2180 |
| 643 | Ga0265332_10020329 | 3300031238 | Bacteria | 2931 |
| 644 | Ga0265328_10057981 | 3300031239 | Bacteria | 1422 |
| 645 | Ga0265328_10093175 | 3300031239 | Bacteria | 1113 |
| 646 | Ga0265325_10014378 | 3300031241 | Bacteria | 4476 |
| 647 | Ga0265339_10090733 | 3300031249 | Bacteria | 1602 |
| 648 | Ga0265331_10111470 | 3300031250 | Bacteria | 1255 |
| 649 | Ga0265331_10167807 | 3300031250 | Bacteria | 994 |
| 650 | Ga0265327_10001569 | 3300031251 | Bacteria | 27986 |
| 651 | Ga0265316_10343810 | 3300031344 | Bacteria | 1081 |
| 652 | Ga0265316_10633125 | 3300031344 | Bacteria | 757 |
| 653 | Ga0307513_10104370 | 3300031456 | Bacteria | 2848 |
| 654 | Ga0307513_10346743 | 3300031456 | Bacteria | 1234 |
| 655 | Ga0307509_10005866 | 3300031507 | Bacteria | 16842 |
| 656 | Ga0307408_100073952 | 3300031548 | Bacteria | 2527 |
| 657 | Ga0307408_100437667 | 3300031548 | Bacteria | 1131 |
| 658 | Ga0307408_100484356 | 3300031548 | Bacteria | 1080 |
| 659 | Ga0307508_10236935 | 3300031616 | Bacteria | 1423 |
| 660 | Ga0265342_10160601 | 3300031712 | Bacteria | 1242 |
| 661 | Ga0265342_10243393 | 3300031712 | Bacteria | 962 |
| 662 | Ga0307516_10000360 | 3300031730 | Bacteria | 59179 |
| 663 | Ga0307516_10001515 | 3300031730 | Bacteria | 31972 |
| 664 | Ga0307516_10242632 | 3300031730 | Bacteria | 1500 |
| 665 | Ga0307405_10244883 | 3300031731 | Bacteria | 1330 |
| 666 | Ga0307413_10116625 | 3300031824 | Bacteria | 1799 |
| 667 | Ga0307410_10010373 | 3300031852 | Bacteria | 5273 |
| 668 | Ga0307410_10416064 | 3300031852 | Bacteria | 1089 |
| 669 | Ga0307410_10630510 | 3300031852 | Bacteria | 897 |
| 670 | Ga0307406_10007409 | 3300031901 | Bacteria | 6084 |
| 671 | Ga0307406_10390720 | 3300031901 | Bacteria | 1100 |
| 672 | Ga0307407_10021342 | 3300031903 | Bacteria | 3337 |
| 673 | Ga0307412_10017797 | 3300031911 | Bacteria | 4259 |
| 674 | Ga0307412_10724317 | 3300031911 | Bacteria | 856 |
| 675 | Ga0307409_100096445 | 3300031995 | Bacteria | 2440 |
| 676 | Ga0307409_100422996 | 3300031995 | Bacteria | 1278 |
| 677 | Ga0307409_100727726 | 3300031995 | Bacteria | 994 |
| 678 | Ga0307416_100092178 | 3300032002 | Bacteria | 2605 |
| 679 | Ga0307416_100289203 | 3300032002 | Bacteria | 1621 |
| 680 | Ga0307414_10187493 | 3300032004 | Bacteria | 1670 |
| 681 | Ga0307411_10046117 | 3300032005 | Bacteria | 2807 |
| 682 | Ga0307415_100420861 | 3300032126 | Bacteria | 1146 |
| 683 | Ga0307415_100939739 | 3300032126 | Bacteria | 800 |
| 684 | Ga0373958_0118009 | 3300034819 | Bacteria | 638 |
| 685 | Ga0373929_0036554 | 3300035085 | Bacteria | 1073 |
| 686 | Ga0373934_0015252 | 3300035086 | Bacteria | 2914 |
| 687 | Ga0373934_0017850 | 3300035086 | Bacteria | 2711 |
| 688 | Ga0373944_0019778 | 3300035089 | Bacteria | 1935 |
| 689 | Ga0373944_0046640 | 3300035089 | Bacteria | 1355 |
| 690 | Ga0373932_0112300 | 3300035112 | Bacteria | 899 |
| 691 | Ga0373936_0121615 | 3300035113 | Bacteria | 1115 |
| 692 | Ga0373936_0302194 | 3300035113 | Bacteria | 722 |
| 693 | Ga0373939_0025744 | 3300035114 | Bacteria | 1652 |
| 694 | Ga0373939_0068988 | 3300035114 | Bacteria | 1146 |
| 695 | Ga0373939_0201822 | 3300035114 | Bacteria | 752 |
| 696 | Ga0373941_0016087 | 3300035115 | Bacteria | 2027 |
| 697 | Ga0373953_0001844 | 3300035117 | Bacteria | 6271 |
| 698 | Ga0373953_0021843 | 3300035117 | Bacteria | 2406 |
| 699 | Ga0373954_0036066 | 3300035118 | Bacteria | 2294 |
| 700 | Ga0373954_0064007 | 3300035118 | Bacteria | 1738 |
| 701 | Ga0373954_0354612 | 3300035118 | Bacteria | 724 |
| 702 | Ga0373956_0139555 | 3300035119 | Bacteria | 1137 |
| 703 | Ga0373957_0027091 | 3300035120 | Bacteria | 2079 |
| 704 | Ga0373957_0201631 | 3300035120 | Bacteria | 829 |
| 705 | Ga0373943_0286310 | 3300035170 | Bacteria | 933 |
| 706 | Ga0373955_0011070 | 3300035172 | Bacteria | 4283 |
| 707 | Ga0373955_0128365 | 3300035172 | Bacteria | 1478 |
| 708 | Ga0373955_0234314 | 3300035172 | Bacteria | 1099 |
| 709 | Ga0373942_0044805 | 3300035207 | Bacteria | 1220 |
| 710 | Ga0373962_0004177 | 3300035242 | Bacteria | 3481 |
| 711 | Ga0373924_0093407 | 3300035410 | Bacteria | 1288 |
| 712 | Ga0373931_0004059 | 3300035691 | Bacteria | 6635 |
| 713 | Ga0373931_0006509 | 3300035691 | Bacteria | 5459 |
| 714 | Ga0373935_0258046 | 3300035692 | Bacteria | 1222 |
| 715 | Ga0373935_0278951 | 3300035692 | Bacteria | 1176 |
| 716 | Ga0373935_0489627 | 3300035692 | Bacteria | 892 |
| 717 | Ga0373927_0072709 | 3300035695 | Bacteria | 2226 |
| 718 | Ga0373933_0000272 | 3300035724 | Bacteria | 33654 |
| 719 | Ga0373933_0060893 | 3300035724 | Bacteria | 2276 |
| 720 | Ga0373933_0080796 | 3300035724 | Bacteria | 1993 |
| 721 | Ga0373937_0014381 | 3300036401 | Bacteria | 6987 |
| 722 | Ga0373937_0036056 | 3300036401 | Bacteria | 4506 |
| 723 | Ga0373925_0637208 | 3300037068 | Bacteria | 878 |
| 724 | Ga0373925_1402071 | 3300037068 | Bacteria | 572 |
| 725 | Ga0395899_0237362 | 3300037312 | Bacteria | 1256 |
| 726 | Ga0395899_0331913 | 3300037312 | Bacteria | 1022 |
| 727 | Ga0395900_0251576 | 3300037418 | Bacteria | 1768 |
| 728 | Ga0395898_0012212 | 3300037466 | Bacteria | 8884 |
| 729 | Ga0395905_0004450 | 3300037471 | Bacteria | 14564 |
| 730 | Ga0395905_0481794 | 3300037471 | Bacteria | 1140 |
| 731 | Ga0395905_1121043 | 3300037471 | Bacteria | 690 |
| 732 | Ga0436364_0482689 | 3300037853 | Bacteria | 1241 |
| 733 | Ga0395901_0002847 | 3300038443 | Bacteria | 17464 |
| 734 | Ga0436365_0274646 | 3300039437 | Bacteria | 16277 |
| 735 | Ga0436365_1345740 | 3300039437 | Bacteria | 5788 |
| 736 | Ga0436365_1773448 | 3300039437 | Bacteria | 8854 |
| 737 | Ga0436361_0256361 | 3300039447 | Bacteria | 5094 |
| 738 | Ga0436361_1015175 | 3300039447 | Bacteria | 4895 |
| 739 | Ga0436363_1257368 | 3300039450 | Bacteria | 4028 |
| 740 | Ga0436362_0531272 | 3300039453 | Bacteria | 815 |
| 741 | Ga0451797_0909590 | 3300041453 | Bacteria | 1048 |
| 742 | Ga0451795_0486996 | 3300041456 | Bacteria | 918 |
| 743 | Ga0451795_1224247 | 3300041456 | Bacteria | 643 |
| 744 | Ga0451798_0388718 | 3300041458 | Bacteria | 614 |
| 745 | Ga0451843_0349938 | 3300041509 | Bacteria | 724 |
| 746 | Ga0450898_085726 | 3300042134 | Bacteria | 645 |
| 747 | Ga0439464_0002912 | 3300042439 | Bacteria | 4262 |
| 748 | Ga0466969_0058948 | 3300044656 | Bacteria | 1867 |
| 749 | Ga0466965_0052459 | 3300044683 | Bacteria | 2025 |
| 750 | Ga0466965_0064290 | 3300044683 | Bacteria | 1836 |
| 751 | Ga0466966_0011578 | 3300044684 | Bacteria | 5848 |
| 752 | Ga0466966_0027088 | 3300044684 | Bacteria | 3738 |
| 753 | Ga0466961_0010761 | 3300044693 | Bacteria | 5843 |
| 754 | Ga0466961_0157290 | 3300044693 | Bacteria | 1417 |
| 755 | Ga0466963_0513052 | 3300044694 | Bacteria | 846 |
| 756 | Ga0466964_0007682 | 3300044706 | Bacteria | 4036 |
| 757 | Ga0466964_0279146 | 3300044706 | Bacteria | 834 |
| 758 | Ga0466971_0008613 | 3300044719 | Bacteria | 4449 |
| 759 | Ga0466971_0028527 | 3300044719 | Bacteria | 2496 |
| 760 | Ga0466968_0039786 | 3300044735 | Bacteria | 1980 |
| 761 | Ga0466970_0058122 | 3300044765 | Bacteria | 2069 |
| 762 | Ga0466957_0020706 | 3300044842 | Bacteria | 3872 |
| 763 | Ga0466957_0067419 | 3300044842 | Bacteria | 2208 |
| 764 | Ga0466957_0127429 | 3300044842 | Bacteria | 1627 |
| 765 | Ga0466967_0066022 | 3300045976 | Bacteria | 3223 |
| 766 | Ga0466967_0776087 | 3300045976 | Bacteria | 951 |
| 767 | Ga0495592_0039033 | 3300046454 | Bacteria | 3569 |
| 768 | Ga0495590_0053145 | 3300046457 | Bacteria | 1415 |
| 769 | Ga0495629_0030791 | 3300046459 | Bacteria | 3801 |
| 770 | Ga0495629_0042353 | 3300046459 | Bacteria | 3200 |
| 771 | Ga0495629_0153929 | 3300046459 | Bacteria | 1598 |
| 772 | Ga0495651_0009538 | 3300046462 | Bacteria | 7456 |
| 773 | Ga0495651_0256178 | 3300046462 | Bacteria | 1192 |
| 774 | Ga0495653_0021947 | 3300046463 | Bacteria | 5167 |
| 775 | Ga0495653_0088251 | 3300046463 | Bacteria | 2275 |
| 776 | Ga0495653_0437458 | 3300046463 | Bacteria | 825 |
| 777 | Ga0495650_0211714 | 3300046471 | Bacteria | 670 |
| 778 | Ga0495582_0762436 | 3300046473 | Bacteria | 560 |
| 779 | Ga0495639_0021367 | 3300046475 | Bacteria | 2833 |
| 780 | Ga0495664_0020652 | 3300046477 | Bacteria | 3800 |
| 781 | Ga0495585_0091519 | 3300046492 | Bacteria | 1637 |
| 782 | Ga0495596_0064933 | 3300046500 | Bacteria | 1420 |
| 783 | Ga0495583_0000717 | 3300046506 | Bacteria | 42460 |
| 784 | Ga0495606_0001165 | 3300046507 | Bacteria | 37175 |
| 785 | Ga0495606_0001828 | 3300046507 | Bacteria | 26968 |
| 786 | Ga0495606_0108705 | 3300046507 | Bacteria | 1676 |
| 787 | Ga0495606_0598471 | 3300046507 | Bacteria | 541 |
| 788 | Ga0495608_0041349 | 3300046511 | Bacteria | 3085 |
| 789 | Ga0495608_0246984 | 3300046511 | Bacteria | 1113 |
| 790 | Ga0495618_0021531 | 3300046514 | Bacteria | 3976 |
| 791 | Ga0495620_0111324 | 3300046515 | Bacteria | 1085 |
| 792 | Ga0495628_0252247 | 3300046516 | Bacteria | 1317 |
| 793 | Ga0495628_0420283 | 3300046516 | Bacteria | 974 |
| 794 | Ga0495630_0140350 | 3300046517 | Bacteria | 1837 |
| 795 | Ga0495630_0871841 | 3300046517 | Bacteria | 686 |
| 796 | Ga0495631_0100935 | 3300046518 | Bacteria | 1242 |
| 797 | Ga0495632_0002264 | 3300046519 | Bacteria | 14832 |
| 798 | Ga0495648_0241600 | 3300046524 | Bacteria | 877 |
| 799 | Ga0495652_0022074 | 3300046529 | Bacteria | 5652 |
| 800 | Ga0495640_0095188 | 3300046533 | Bacteria | 1960 |
| 801 | Ga0495640_0225433 | 3300046533 | Bacteria | 1180 |
| 802 | Ga0495586_0010203 | 3300046535 | Bacteria | 4997 |
| 803 | Ga0495587_0023347 | 3300046536 | Bacteria | 3800 |
| 804 | Ga0495598_0019860 | 3300046537 | Bacteria | 1767 |
| 805 | Ga0495598_0055549 | 3300046537 | Bacteria | 1206 |
| 806 | Ga0495621_0057524 | 3300046539 | Bacteria | 1404 |
| 807 | Ga0495597_0010500 | 3300046542 | Bacteria | 4523 |
| 808 | Ga0495645_0008575 | 3300046543 | Bacteria | 7139 |
| 809 | Ga0495645_0106584 | 3300046543 | Bacteria | 1987 |
| 810 | Ga0495667_0038481 | 3300046559 | Bacteria | 3184 |
| 811 | Ga0495667_0116418 | 3300046559 | Bacteria | 1726 |
| 812 | Ga0495656_0224299 | 3300046615 | Bacteria | 941 |
| 813 | Ga0495668_0057333 | 3300046616 | Bacteria | 2150 |
| 814 | Ga0495668_0170657 | 3300046616 | Bacteria | 1192 |
| 815 | Ga0495634_0026497 | 3300046642 | Bacteria | 4044 |
| 816 | Ga0495634_0048984 | 3300046642 | Bacteria | 2842 |
| 817 | Ga0495611_0176079 | 3300046648 | Bacteria | 1000 |
| 818 | Ga0495625_0004769 | 3300046660 | Bacteria | 12683 |
| 819 | Ga0495625_0032244 | 3300046660 | Bacteria | 3888 |
| 820 | Ga0495635_0054202 | 3300046663 | Bacteria | 2762 |
| 821 | Ga0495657_0082376 | 3300046675 | Bacteria | 2079 |
| 822 | Ga0495657_0266238 | 3300046675 | Bacteria | 1028 |
| 823 | Ga0495599_0026974 | 3300046678 | Bacteria | 3599 |
| 824 | Ga0495599_0091927 | 3300046678 | Bacteria | 1893 |
| 825 | Ga0495623_0000341 | 3300046679 | Bacteria | 30684 |
| 826 | Ga0495623_0056506 | 3300046679 | Bacteria | 2470 |
| 827 | Ga0495623_0503271 | 3300046679 | Bacteria | 639 |
| 828 | Ga0495646_0051164 | 3300046680 | Bacteria | 2501 |
| 829 | Ga0495647_0113192 | 3300046681 | Bacteria | 1134 |
| 830 | Ga0495647_0454440 | 3300046681 | Bacteria | 593 |
| 831 | Ga0495613_0079173 | 3300046689 | Bacteria | 2390 |
| 832 | Ga0495613_0449294 | 3300046689 | Bacteria | 873 |
| 833 | Ga0495649_0000314 | 3300046694 | Bacteria | 42490 |
| 834 | Ga0495649_0003800 | 3300046694 | Bacteria | 10003 |
| 835 | Ga0495589_0017299 | 3300046794 | Bacteria | 3700 |
| 836 | Ga0495600_0004899 | 3300046809 | Bacteria | 8041 |
| 837 | Ga0495600_0021231 | 3300046809 | Bacteria | 4156 |
| 838 | Ga0495660_0237968 | 3300046810 | Bacteria | 850 |
| 839 | Ga0495604_0073588 | 3300047317 | Bacteria | 2578 |
| 840 | Ga0495604_0817886 | 3300047317 | Bacteria | 586 |
| 841 | Ga0495636_0448666 | 3300047318 | Bacteria | 619 |
| 842 | Ga0495672_0163529 | 3300047320 | Bacteria | 1142 |
| 843 | Ga0495680_0011531 | 3300047322 | Bacteria | 7817 |
| 844 | Ga0495680_0070998 | 3300047322 | Bacteria | 2652 |
| 845 | Ga0495680_0134503 | 3300047322 | Bacteria | 1813 |
| 846 | Ga0495687_000500 | 3300047443 | Bacteria | 47248 |
| 847 | Ga0495687_081066 | 3300047443 | Bacteria | 1270 |
| 848 | Ga0495687_081148 | 3300047443 | Bacteria | 1269 |
| 849 | Ga0495675_0025108 | 3300047444 | Bacteria | 3800 |
| 850 | Ga0495675_0451011 | 3300047444 | Bacteria | 744 |
| 851 | Ga0495684_0006898 | 3300047471 | Bacteria | 8816 |
| 852 | Ga0495684_0141527 | 3300047471 | Bacteria | 1803 |
| 853 | Ga0495686_0009986 | 3300047472 | Bacteria | 6786 |
| 854 | Ga0495593_0049844 | 3300047673 | Bacteria | 2220 |
| 855 | Ga0495593_0388925 | 3300047673 | Bacteria | 697 |
| 856 | Ga0495602_0077100 | 3300048088 | Bacteria | 2821 |
| 857 | Ga0495602_0093108 | 3300048088 | Bacteria | 2494 |
| 858 | Ga0495626_0060994 | 3300048091 | Bacteria | 1717 |
| 859 | Ga0496100_0001742 | 3300048903 | Bacteria | 10853 |
| 860 | Ga0496100_0310792 | 3300048903 | Bacteria | 1182 |
| 861 | Ga0496100_0550174 | 3300048903 | Bacteria | 893 |
| 862 | Ga0496100_0762313 | 3300048903 | Bacteria | 757 |
| 863 | Ga0496100_1034811 | 3300048903 | Bacteria | 646 |
| 864 | Ga0496101_0017477 | 3300048904 | Bacteria | 4866 |
| 865 | Ga0496101_0079654 | 3300048904 | Bacteria | 2418 |
| 866 | Ga0496101_0166311 | 3300048904 | Bacteria | 1693 |
| 867 | Ga0496101_0854767 | 3300048904 | Bacteria | 717 |
| 868 | Ga0496102_0007582 | 3300048905 | Bacteria | 9270 |
| 869 | Ga0496102_0015979 | 3300048905 | Bacteria | 6551 |
| 870 | Ga0496102_0175593 | 3300048905 | Bacteria | 2017 |
| 871 | Ga0496102_0856937 | 3300048905 | Bacteria | 831 |
| 872 | Ga0496102_1074809 | 3300048905 | Bacteria | 725 |
| 873 | Ga0496103_0012760 | 3300048906 | Bacteria | 4983 |
| 874 | Ga0496103_0026277 | 3300048906 | Bacteria | 3525 |
| 875 | Ga0496103_0099130 | 3300048906 | Bacteria | 1843 |
| 876 | Ga0496104_0040323 | 3300048907 | Bacteria | 4376 |
| 877 | Ga0496104_0041031 | 3300048907 | Bacteria | 4338 |
| 878 | Ga0496104_0190843 | 3300048907 | Bacteria | 1960 |
| 879 | Ga0496104_0742583 | 3300048907 | Bacteria | 889 |
| 880 | Ga0496104_1259910 | 3300048907 | Bacteria | 643 |
| 881 | Ga0496105_0052096 | 3300048908 | Bacteria | 3379 |
| 882 | Ga0496105_0068158 | 3300048908 | Bacteria | 2938 |
| 883 | Ga0496105_0076564 | 3300048908 | Bacteria | 2763 |
| 884 | Ga0496105_0101187 | 3300048908 | Bacteria | 2380 |
| 885 | Ga0496106_0000560 | 3300048909 | Bacteria | 26498 |
| 886 | Ga0496106_0005275 | 3300048909 | Bacteria | 9573 |
| 887 | Ga0496106_0008322 | 3300048909 | Bacteria | 7676 |
| 888 | Ga0496106_0037455 | 3300048909 | Bacteria | 3629 |
| 889 | Ga0496106_0479362 | 3300048909 | Bacteria | 999 |
| 890 | Ga0496107_0014344 | 3300048910 | Bacteria | 5548 |
| 891 | Ga0496107_0785578 | 3300048910 | Bacteria | 697 |
| 892 | Ga0496108_0071481 | 3300048911 | Bacteria | 2928 |
| 893 | Ga0496108_0213026 | 3300048911 | Bacteria | 1677 |
| 894 | Ga0496108_0734787 | 3300048911 | Bacteria | 854 |
| 895 | Ga0496108_0749983 | 3300048911 | Bacteria | 844 |
| 896 | Ga0496109_0059173 | 3300048912 | Bacteria | 3500 |
| 897 | Ga0496109_0628642 | 3300048912 | Bacteria | 1010 |
| 898 | Ga0496109_1235856 | 3300048912 | Bacteria | 683 |
| 899 | Ga0496109_1276508 | 3300048912 | Bacteria | 670 |
| 900 | Ga0496110_0002997 | 3300048913 | Bacteria | 12811 |
| 901 | Ga0496110_0041098 | 3300048913 | Bacteria | 4033 |
| 902 | Ga0496110_0042554 | 3300048913 | Bacteria | 3964 |
| 903 | Ga0496111_0028911 | 3300048914 | Bacteria | 3931 |
| 904 | Ga0496111_0206895 | 3300048914 | Bacteria | 1458 |
| 905 | Ga0496112_0035167 | 3300048915 | Bacteria | 4877 |
| 906 | Ga0496112_0086130 | 3300048915 | Bacteria | 3108 |
| 907 | Ga0496112_0157544 | 3300048915 | Bacteria | 2237 |
| 908 | Ga0496112_0489775 | 3300048915 | Bacteria | 1165 |
| 909 | Ga0496112_0651940 | 3300048915 | Bacteria | 982 |
| 910 | Ga0496112_0731559 | 3300048915 | Bacteria | 916 |
| 911 | Ga0496113_0004759 | 3300048916 | Bacteria | 8382 |
| 912 | Ga0496113_0043328 | 3300048916 | Bacteria | 3330 |
| 913 | Ga0496113_0110260 | 3300048916 | Bacteria | 2141 |
| 914 | Ga0496113_0151546 | 3300048916 | Bacteria | 1829 |
| 915 | Ga0496113_0236481 | 3300048916 | Bacteria | 1457 |
| 916 | Ga0496114_0008471 | 3300048917 | Bacteria | 8147 |
| 917 | Ga0496114_0055488 | 3300048917 | Bacteria | 3304 |
| 918 | Ga0496114_0314103 | 3300048917 | Bacteria | 1384 |
| 919 | Ga0496115_0002892 | 3300048918 | Bacteria | 12380 |
| 920 | Ga0496115_0085405 | 3300048918 | Bacteria | 2574 |
| 921 | Ga0496115_0239650 | 3300048918 | Bacteria | 1495 |
| 922 | Ga0496117_0017580 | 3300048920 | Bacteria | 5967 |
| 923 | Ga0496118_0035996 | 3300048921 | Bacteria | 4010 |
| 924 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 925 | Ga0496121_0255839 | 3300048924 | Bacteria | 1212 |
| 926 | Ga0496124_0000788 | 3300048927 | Bacteria | 51794 |
| 927 | Ga0496125_0053711 | 3300048928 | Bacteria | 3300 |
| 928 | Ga0496126_0029319 | 3300048929 | Bacteria | 5229 |
| 929 | Ga0501039_0293243 | 3300049575 | Bacteria | 1279 |
| 930 | Ga0501040_0126934 | 3300049576 | Bacteria | 1792 |
| 931 | Ga0501041_0045854 | 3300049577 | Bacteria | 2659 |
| 932 | Ga0501042_0188245 | 3300049578 | Bacteria | 1489 |
| 933 | Ga0501042_0489903 | 3300049578 | Bacteria | 892 |
| 934 | Ga0501043_0000072 | 3300049579 | Bacteria | 89021 |
| 935 | Ga0501046_0000112 | 3300049580 | Bacteria | 86313 |
| 936 | Ga0501047_0000138 | 3300049581 | Bacteria | 89028 |
| 937 | Ga0501048_0001221 | 3300049582 | Bacteria | 19469 |
| 938 | Ga0501071_0578945 | 3300049587 | Bacteria | 863 |
| 939 | Ga0501072_0724123 | 3300049588 | Bacteria | 781 |
| 940 | Ga0501075_0215615 | 3300049591 | Bacteria | 1464 |
| 941 | Ga0501075_0777819 | 3300049591 | Bacteria | 728 |
| 942 | Ga0501076_0108269 | 3300049592 | Bacteria | 2245 |
| 943 | Ga0501077_0439517 | 3300049593 | Bacteria | 835 |
| 944 | Ga0501081_0018831 | 3300049743 | Bacteria | 4586 |
| 945 | Ga0501045_0001874 | 3300049824 | Bacteria | 14253 |
| 946 | nmdc:mga03683_126189_c1 | 3300050489 | Bacteria | 1142 |
| 947 | nmdc:mga03683_351134_c1 | 3300050489 | Bacteria | 698 |
| 948 | nmdc:mga03683_59909_c1 | 3300050489 | Bacteria | 1607 |
| 949 | nmdc:mga03n38_69771_c1 | 3300050490 | Bacteria | 1624 |
| 950 | nmdc:mga00v17_117322_c1 | 3300050491 | Bacteria | 1693 |
| 951 | nmdc:mga0yw44_191524_c1 | 3300050492 | Bacteria | 1349 |
| 952 | nmdc:mga0yw44_289056_c1 | 3300050492 | Bacteria | 1097 |
| 953 | nmdc:mga0yw44_33386_c1 | 3300050492 | Bacteria | 3006 |
| 954 | nmdc:mga0k408_110896_c1 | 3300050493 | Bacteria | 1622 |
| 955 | nmdc:mga0k408_14148_c1 | 3300050493 | Bacteria | 4391 |
| 956 | nmdc:mga0k408_156211_c1 | 3300050493 | Bacteria | 1359 |
| 957 | nmdc:mga0k408_18465_c1 | 3300050493 | Bacteria | 3894 |
| 958 | nmdc:mga0k408_27324_c1 | 3300050493 | Bacteria | 3241 |
| 959 | nmdc:mga0k408_373534_c1 | 3300050493 | Bacteria | 850 |
| 960 | nmdc:mga0k408_52971_c1 | 3300050493 | Bacteria | 2352 |
| 961 | nmdc:mga0k408_593108_c1 | 3300050493 | Bacteria | 654 |
| 962 | nmdc:mga06z11_111437_c1 | 3300050494 | Bacteria | 1516 |
| 963 | nmdc:mga06z11_111603_c1 | 3300050494 | Bacteria | 1515 |
| 964 | nmdc:mga06z11_51205_c1 | 3300050494 | Bacteria | 2114 |
| 965 | nmdc:mga06z11_575132_c1 | 3300050494 | Bacteria | 685 |
| 966 | nmdc:mga04h51_114287_c1 | 3300050495 | Bacteria | 999 |
| 967 | nmdc:mga04h51_47957_c1 | 3300050495 | Bacteria | 1421 |
| 968 | nmdc:mga07m45_13868_c1 | 3300050496 | Bacteria | 4283 |
| 969 | nmdc:mga07m45_2631_c1 | 3300050496 | Bacteria | 8451 |
| 970 | nmdc:mga07m45_53421_c1 | 3300050496 | Bacteria | 2283 |
| 971 | nmdc:mga07m45_5517_c1 | 3300050496 | Bacteria | 6304 |
| 972 | nmdc:mga07m45_6941_c1 | 3300050496 | Bacteria | 5758 |
| 973 | nmdc:mga07m45_7349_c1 | 3300050496 | Bacteria | 5624 |
| 974 | nmdc:mga05p37_69451_c1 | 3300050507 | Bacteria | 4333 |
| 975 | nmdc:mga09592_381116_c1 | 3300050508 | Bacteria | 1219 |
| 976 | nmdc:mga0qj67_133129_c1 | 3300050509 | Bacteria | 2014 |
| 977 | nmdc:mga06r32_9686_c1 | 3300050510 | Bacteria | 8705 |
| 978 | nmdc:mga08y16_71_c1 | 3300050511 | Bacteria | 84502 |
| 979 | Ga0495601_0101590 | 3300053077 | Bacteria | 1857 |
| 980 | Ga0495601_0124329 | 3300053077 | Bacteria | 1677 |
| 981 | Ga0495612_0010858 | 3300053078 | Bacteria | 3680 |
| 982 | Ga0500635_0011934 | 3300053080 | Bacteria | 2482 |
| 983 | Ga0495595_0001806 | 3300053084 | Bacteria | 8340 |
| 984 | Ga0495595_0075033 | 3300053084 | Bacteria | 1604 |
| 985 | Ga0495595_0139953 | 3300053084 | Bacteria | 1187 |
| 986 | Ga0495619_0059753 | 3300053085 | Bacteria | 2533 |
| 987 | Ga0495619_0108585 | 3300053085 | Bacteria | 1894 |
| 988 | Ga0495619_0124241 | 3300053085 | Bacteria | 1770 |
| 989 | Ga0495619_0154852 | 3300053085 | Bacteria | 1581 |
| 990 | Ga0500578_0094750 | 3300053086 | Bacteria | 1894 |
| 991 | Ga0500583_0546241 | 3300053092 | Bacteria | 539 |
| 992 | Ga0500566_0000072 | 3300053094 | Bacteria | 48857 |
| 993 | Ga0500566_0003307 | 3300053094 | Bacteria | 9641 |
| 994 | Ga0500554_004194 | 3300053102 | Bacteria | 3032 |
| 995 | Ga0500595_000589 | 3300053119 | Bacteria | 21663 |
| 996 | Ga0500595_002741 | 3300053119 | Bacteria | 8519 |
| 997 | Ga0500595_096104 | 3300053119 | Bacteria | 853 |
| 998 | Ga0500608_022018 | 3300053122 | Bacteria | 2952 |
| 999 | Ga0500614_019971 | 3300053123 | Bacteria | 1541 |
| 1000 | Ga0500559_0094526 | 3300053136 | Bacteria | 1372 |
| 1001 | Ga0500568_0018322 | 3300053139 | Bacteria | 3067 |
| 1002 | Ga0500568_0059007 | 3300053139 | Bacteria | 1489 |
| 1003 | Ga0500590_017800 | 3300053148 | Bacteria | 3674 |
| 1004 | Ga0500603_000091 | 3300053150 | Bacteria | 21606 |
| 1005 | Ga0500630_002125 | 3300053159 | Bacteria | 9567 |
| 1006 | Ga0500638_004644 | 3300053162 | Bacteria | 5335 |
| 1007 | Ga0500638_107978 | 3300053162 | Bacteria | 1289 |
| 1008 | Ga0500639_000478 | 3300053163 | Bacteria | 19952 |
| 1009 | Ga0500636_0136038 | 3300053177 | Bacteria | 1364 |
| 1010 | Ga0500637_0000302 | 3300053178 | Bacteria | 18681 |
| 1011 | Ga0500637_0342028 | 3300053178 | Bacteria | 799 |
| 1012 | Ga0500645_021713 | 3300053730 | Bacteria | 1979 |
| 1013 | Ga0501084_0258132 | 3300054114 | Bacteria | 1471 |
| 1014 | Ga0500661_003847 | 3300055283 | Bacteria | 2820 |
| 1015 | Ga0466962_0025069 | 3300061719 | Bacteria | 2862 |
| 1016 | Ga0530510_0380218 | 3300061734 | Bacteria | 1063 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049577 | Ga0501041_0045854 | Ga0501041_0045854_1546_2112 | 147 |
| 2 | 3300049576 | Ga0501040_0126934 | Ga0501040_0126934_437_997 | 152 |
| 3 | 3300049578 | Ga0501042_0489903 | Ga0501042_0489903_209_769 | 152 |
| 4 | 3300049591 | Ga0501075_0215615 | Ga0501075_0215615_469_1029 | 152 |
| 5 | 3300049743 | Ga0501081_0018831 | Ga0501081_0018831_2022_2582 | 152 |
| 6 | 3300054114 | Ga0501084_0258132 | Ga0501084_0258132_143_703 | 152 |
| 7 | 3300061734 | Ga0530510_0380218 | Ga0530510_0380218_356_916 | 152 |
| 8 | 3300005544 | Ga0070686_100237719 | Ga0070686_1002377193 | 153 |
| 9 | 3300005983 | Ga0081540_1035958 | Ga0081540_10359581 | 153 |
| 10 | 3300014326 | Ga0157380_11103385 | Ga0157380_111033852 | 154 |
| 11 | 3300047320 | Ga0495672_0163529 | Ga0495672_0163529_290_769 | 154 |
| 12 | 3300005329 | Ga0070683_100404610 | Ga0070683_1004046101 | 155 |
| 13 | 3300005616 | Ga0068852_100094445 | Ga0068852_1000944453 | 155 |
| 14 | 3300005842 | Ga0068858_100159495 | Ga0068858_1001594953 | 155 |
| 15 | 3300006163 | Ga0070715_10013898 | Ga0070715_100138982 | 155 |
| 16 | 3300006237 | Ga0097621_100229999 | Ga0097621_1002299993 | 155 |
| 17 | 3300009177 | Ga0105248_10081205 | Ga0105248_100812053 | 155 |
| 18 | 3300009551 | Ga0105238_10269970 | Ga0105238_102699702 | 155 |
| 19 | 3300010375 | Ga0105239_10002730 | Ga0105239_1000273010 | 155 |
| 20 | 3300025321 | Ga0207656_10123197 | Ga0207656_101231972 | 155 |
| 21 | 3300025924 | Ga0207694_10449771 | Ga0207694_104497712 | 155 |
| 22 | 3300025931 | Ga0207644_10372927 | Ga0207644_103729271 | 155 |
| 23 | 3300026035 | Ga0207703_10833961 | Ga0207703_108339611 | 155 |
| 24 | 3300035085 | Ga0373929_0036554 | Ga0373929_0036554_149_697 | 155 |
| 25 | 3300035113 | Ga0373936_0121615 | Ga0373936_0121615_439_981 | 155 |
| 26 | 3300035114 | Ga0373939_0068988 | Ga0373939_0068988_117_665 | 155 |
| 27 | 3300035691 | Ga0373931_0004059 | Ga0373931_0004059_2819_3367 | 155 |
| 28 | 3300035692 | Ga0373935_0258046 | Ga0373935_0258046_598_1146 | 155 |
| 29 | 3300048903 | Ga0496100_1034811 | Ga0496100_1034811_40_588 | 155 |
| 30 | 3300048904 | Ga0496101_0166311 | Ga0496101_0166311_262_810 | 155 |
| 31 | 3300048906 | Ga0496103_0026277 | Ga0496103_0026277_17_565 | 155 |
| 32 | 3300048907 | Ga0496104_0041031 | Ga0496104_0041031_2746_3294 | 155 |
| 33 | 3300048907 | Ga0496104_0190843 | Ga0496104_0190843_1350_1931 | 155 |
| 34 | 3300048908 | Ga0496105_0052096 | Ga0496105_0052096_1806_2354 | 155 |
| 35 | 3300048909 | Ga0496106_0008322 | Ga0496106_0008322_2199_2747 | 155 |
| 36 | 3300048910 | Ga0496107_0014344 | Ga0496107_0014344_265_813 | 155 |
| 37 | 3300048911 | Ga0496108_0071481 | Ga0496108_0071481_149_730 | 155 |
| 38 | 3300048912 | Ga0496109_0059173 | Ga0496109_0059173_172_720 | 155 |
| 39 | 3300048912 | Ga0496109_1235856 | Ga0496109_1235856_91_672 | 155 |
| 40 | 3300048913 | Ga0496110_0042554 | Ga0496110_0042554_2465_3013 | 155 |
| 41 | 3300048914 | Ga0496111_0206895 | Ga0496111_0206895_752_1300 | 155 |
| 42 | 3300048915 | Ga0496112_0086130 | Ga0496112_0086130_1448_1996 | 155 |
| 43 | 3300048915 | Ga0496112_0157544 | Ga0496112_0157544_1163_1744 | 155 |
| 44 | 3300048916 | Ga0496113_0004759 | Ga0496113_0004759_4585_5133 | 155 |
| 45 | 3300048916 | Ga0496113_0110260 | Ga0496113_0110260_167_748 | 155 |
| 46 | 3300053080 | Ga0500635_0011934 | Ga0500635_0011934_449_991 | 155 |
| 47 | 3300053094 | Ga0500566_0000072 | Ga0500566_0000072_33791_34333 | 155 |
| 48 | 3300053123 | Ga0500614_019971 | Ga0500614_019971_141_683 | 155 |
| 49 | 3300053150 | Ga0500603_000091 | Ga0500603_000091_475_1017 | 155 |
| 50 | 3300053159 | Ga0500630_002125 | Ga0500630_002125_8646_9188 | 155 |
| 51 | 3300053162 | Ga0500638_107978 | Ga0500638_107978_442_984 | 155 |
| 52 | 3300053163 | Ga0500639_000478 | Ga0500639_000478_18080_18622 | 155 |
| 53 | 3300053178 | Ga0500637_0342028 | Ga0500637_0342028_14_556 | 155 |
| 54 | iso_pu_bacteria | 2876808645 | 2876810313 | 155 |
| 55 | iso_pu_bacteria | 2879110137 | 2879114313 | 155 |
| 56 | 3300003791 | Ga0055530_10000090 | Ga0055530_1000009014 | 156 |
| 57 | 3300003794 | Ga0055531_10011587 | Ga0055531_100115873 | 156 |
| 58 | 3300005338 | Ga0068868_100065715 | Ga0068868_1000657155 | 156 |
| 59 | 3300005339 | Ga0070660_100034252 | Ga0070660_1000342524 | 156 |
| 60 | 3300005339 | Ga0070660_100208653 | Ga0070660_1002086532 | 156 |
| 61 | 3300005355 | Ga0070671_100233877 | Ga0070671_1002338773 | 156 |
| 62 | 3300005355 | Ga0070671_100622389 | Ga0070671_1006223891 | 156 |
| 63 | 3300005364 | Ga0070673_100500610 | Ga0070673_1005006102 | 156 |
| 64 | 3300005366 | Ga0070659_100092787 | Ga0070659_1000927875 | 156 |
| 65 | 3300005456 | Ga0070678_100637208 | Ga0070678_1006372081 | 156 |
| 66 | 3300005457 | Ga0070662_100042086 | Ga0070662_1000420865 | 156 |
| 67 | 3300005458 | Ga0070681_10162733 | Ga0070681_101627332 | 156 |
| 68 | 3300005530 | Ga0070679_100085996 | Ga0070679_1000859963 | 156 |
| 69 | 3300005539 | Ga0068853_100000534 | Ga0068853_1000005347 | 156 |
| 70 | 3300005539 | Ga0068853_100089424 | Ga0068853_1000894242 | 156 |
| 71 | 3300005539 | Ga0068853_100782521 | Ga0068853_1007825212 | 156 |
| 72 | 3300005548 | Ga0070665_100000015 | Ga0070665_100000015426 | 156 |
| 73 | 3300005563 | Ga0068855_100209328 | Ga0068855_1002093283 | 156 |
| 74 | 3300005614 | Ga0068856_100329386 | Ga0068856_1003293862 | 156 |
| 75 | 3300005616 | Ga0068852_100541139 | Ga0068852_1005411392 | 156 |
| 76 | 3300005616 | Ga0068852_101449339 | Ga0068852_1014493391 | 156 |
| 77 | 3300005618 | Ga0068864_100005578 | Ga0068864_10000557810 | 156 |
| 78 | 3300005841 | Ga0068863_100089212 | Ga0068863_1000892125 | 156 |
| 79 | 3300005842 | Ga0068858_101140953 | Ga0068858_1011409532 | 156 |
| 80 | 3300006051 | Ga0075364_11125140 | Ga0075364_111251401 | 156 |
| 81 | 3300006058 | Ga0075432_10086362 | Ga0075432_100863621 | 156 |
| 82 | 3300006195 | Ga0075366_10012080 | Ga0075366_100120806 | 156 |
| 83 | 3300006237 | Ga0097621_100603024 | Ga0097621_1006030242 | 156 |
| 84 | 3300006353 | Ga0075370_10084819 | Ga0075370_100848193 | 156 |
| 85 | 3300006881 | Ga0068865_100010326 | Ga0068865_10001032611 | 156 |
| 86 | 3300009093 | Ga0105240_10013171 | Ga0105240_1001317111 | 156 |
| 87 | 3300009093 | Ga0105240_10085474 | Ga0105240_100854744 | 156 |
| 88 | 3300009093 | Ga0105240_10098021 | Ga0105240_100980216 | 156 |
| 89 | 3300009174 | Ga0105241_10259293 | Ga0105241_102592932 | 156 |
| 90 | 3300009551 | Ga0105238_10034659 | Ga0105238_100346592 | 156 |
| 91 | 3300009551 | Ga0105238_10053983 | Ga0105238_100539836 | 156 |
| 92 | 3300009551 | Ga0105238_10091391 | Ga0105238_100913912 | 156 |
| 93 | 3300009551 | Ga0105238_10687003 | Ga0105238_106870031 | 156 |
| 94 | 3300009553 | Ga0105249_10303720 | Ga0105249_103037204 | 156 |
| 95 | 3300013306 | Ga0163162_10082936 | Ga0163162_100829367 | 156 |
| 96 | 3300013308 | Ga0157375_10097366 | Ga0157375_100973663 | 156 |
| 97 | 3300014325 | Ga0163163_10052942 | Ga0163163_100529425 | 156 |
| 98 | 3300014325 | Ga0163163_10095599 | Ga0163163_100955994 | 156 |
| 99 | 3300014325 | Ga0163163_11186221 | Ga0163163_111862212 | 156 |
| 100 | 3300025909 | Ga0207705_10455173 | Ga0207705_104551732 | 156 |
| 101 | 3300025919 | Ga0207657_10029996 | Ga0207657_100299962 | 156 |
| 102 | 3300027907 | Ga0207428_10000098 | Ga0207428_10000098105 | 156 |
| 103 | 3300039447 | Ga0436361_0256361 | Ga0436361_0256361_1202_1687 | 156 |
| 104 | 3300050493 | nmdc:mga0k408_18465_c1 | nmdc:mga0k408_18465_c1_2143_2622 | 156 |
| 105 | 3300050511 | nmdc:mga08y16_71_c1 | nmdc:mga08y16_71_c1_59660_60139 | 156 |
| 106 | iso_pu_bacteria | 2508501128 | 2509147075 | 156 |
| 107 | 3300005328 | Ga0070676_10295820 | Ga0070676_102958202 | 157 |
| 108 | 3300005336 | Ga0070680_100006948 | Ga0070680_1000069487 | 157 |
| 109 | 3300005341 | Ga0070691_10006435 | Ga0070691_100064353 | 157 |
| 110 | 3300005343 | Ga0070687_100105042 | Ga0070687_1001050421 | 157 |
| 111 | 3300005353 | Ga0070669_100750962 | Ga0070669_1007509621 | 157 |
| 112 | 3300005355 | Ga0070671_100694395 | Ga0070671_1006943952 | 157 |
| 113 | 3300005406 | Ga0070703_10004941 | Ga0070703_100049413 | 157 |
| 114 | 3300005435 | Ga0070714_101387840 | Ga0070714_1013878401 | 157 |
| 115 | 3300005438 | Ga0070701_10016708 | Ga0070701_100167083 | 157 |
| 116 | 3300005440 | Ga0070705_100000274 | Ga0070705_10000027428 | 157 |
| 117 | 3300005441 | Ga0070700_100008253 | Ga0070700_1000082535 | 157 |
| 118 | 3300005444 | Ga0070694_100017655 | Ga0070694_1000176554 | 157 |
| 119 | 3300005445 | Ga0070708_100207858 | Ga0070708_1002078582 | 157 |
| 120 | 3300005457 | Ga0070662_100132740 | Ga0070662_1001327402 | 157 |
| 121 | 3300005471 | Ga0070698_100095479 | Ga0070698_1000954791 | 157 |
| 122 | 3300005518 | Ga0070699_100001895 | Ga0070699_1000018957 | 157 |
| 123 | 3300005536 | Ga0070697_100083215 | Ga0070697_1000832152 | 157 |
| 124 | 3300005543 | Ga0070672_100282598 | Ga0070672_1002825981 | 157 |
| 125 | 3300005545 | Ga0070695_100009399 | Ga0070695_1000093993 | 157 |
| 126 | 3300005546 | Ga0070696_100000144 | Ga0070696_10000014436 | 157 |
| 127 | 3300005549 | Ga0070704_100001504 | Ga0070704_1000015048 | 157 |
| 128 | 3300005564 | Ga0070664_101015478 | Ga0070664_1010154782 | 157 |
| 129 | 3300005577 | Ga0068857_100514128 | Ga0068857_1005141282 | 157 |
| 130 | 3300005617 | Ga0068859_100010211 | Ga0068859_1000102118 | 157 |
| 131 | 3300005618 | Ga0068864_100062295 | Ga0068864_1000622952 | 157 |
| 132 | 3300005719 | Ga0068861_100124412 | Ga0068861_1001244122 | 157 |
| 133 | 3300005719 | Ga0068861_100554935 | Ga0068861_1005549352 | 157 |
| 134 | 3300005843 | Ga0068860_100002707 | Ga0068860_10000270719 | 157 |
| 135 | 3300005844 | Ga0068862_100006297 | Ga0068862_1000062979 | 157 |
| 136 | 3300005981 | Ga0081538_10021290 | Ga0081538_100212906 | 157 |
| 137 | 3300006237 | Ga0097621_101356393 | Ga0097621_1013563932 | 157 |
| 138 | 3300006844 | Ga0075428_100037961 | Ga0075428_1000379617 | 157 |
| 139 | 3300006846 | Ga0075430_100141446 | Ga0075430_1001414463 | 157 |
| 140 | 3300006847 | Ga0075431_100056480 | Ga0075431_1000564805 | 157 |
| 141 | 3300006931 | Ga0097620_100010212 | Ga0097620_1000102128 | 157 |
| 142 | 3300009098 | Ga0105245_10491786 | Ga0105245_104917861 | 157 |
| 143 | 3300009553 | Ga0105249_10134118 | Ga0105249_101341181 | 157 |
| 144 | 3300009553 | Ga0105249_10172734 | Ga0105249_101727343 | 157 |
| 145 | 3300011119 | Ga0105246_10321268 | Ga0105246_103212682 | 157 |
| 146 | 3300013105 | Ga0157369_11168944 | Ga0157369_111689442 | 157 |
| 147 | 3300013296 | Ga0157374_10268968 | Ga0157374_102689682 | 157 |
| 148 | 3300013297 | Ga0157378_10804753 | Ga0157378_108047531 | 157 |
| 149 | 3300014968 | Ga0157379_10348252 | Ga0157379_103482522 | 157 |
| 150 | 3300021361 | Ga0213872_10020494 | Ga0213872_100204942 | 157 |
| 151 | 3300021377 | Ga0213874_10013909 | Ga0213874_100139093 | 157 |
| 152 | 3300021384 | Ga0213876_10000320 | Ga0213876_1000032021 | 157 |
| 153 | 3300021384 | Ga0213876_10078214 | Ga0213876_100782142 | 157 |
| 154 | 3300021388 | Ga0213875_10145273 | Ga0213875_101452732 | 157 |
| 155 | 3300025917 | Ga0207660_10014201 | Ga0207660_100142013 | 157 |
| 156 | 3300025927 | Ga0207687_10684489 | Ga0207687_106844892 | 157 |
| 157 | 3300025933 | Ga0207706_10114233 | Ga0207706_101142331 | 157 |
| 158 | 3300025935 | Ga0207709_10374788 | Ga0207709_103747882 | 157 |
| 159 | 3300025942 | Ga0207689_10300263 | Ga0207689_103002631 | 157 |
| 160 | 3300025961 | Ga0207712_10119023 | Ga0207712_101190233 | 157 |
| 161 | 3300025961 | Ga0207712_10986626 | Ga0207712_109866262 | 157 |
| 162 | 3300025972 | Ga0207668_10050945 | Ga0207668_100509455 | 157 |
| 163 | 3300026075 | Ga0207708_10012007 | Ga0207708_100120076 | 157 |
| 164 | 3300026088 | Ga0207641_10068611 | Ga0207641_100686113 | 157 |
| 165 | 3300026095 | Ga0207676_10101927 | Ga0207676_101019272 | 157 |
| 166 | 3300026116 | Ga0207674_10024173 | Ga0207674_100241737 | 157 |
| 167 | 3300026118 | Ga0207675_100160619 | Ga0207675_1001606192 | 157 |
| 168 | 3300026118 | Ga0207675_100332382 | Ga0207675_1003323822 | 157 |
| 169 | 3300028380 | Ga0268265_10025046 | Ga0268265_100250465 | 157 |
| 170 | 3300028381 | Ga0268264_10004187 | Ga0268264_1000418711 | 157 |
| 171 | 3300031250 | Ga0265331_10111470 | Ga0265331_101114702 | 157 |
| 172 | 3300031251 | Ga0265327_10001569 | Ga0265327_1000156922 | 157 |
| 173 | 3300031507 | Ga0307509_10005866 | Ga0307509_100058664 | 157 |
| 174 | 3300034819 | Ga0373958_0118009 | Ga0373958_0118009_95_604 | 157 |
| 175 | 3300035089 | Ga0373944_0019778 | Ga0373944_0019778_475_1014 | 157 |
| 176 | 3300037312 | Ga0395899_0331913 | Ga0395899_0331913_307_789 | 157 |
| 177 | 3300037418 | Ga0395900_0251576 | Ga0395900_0251576_1004_1486 | 157 |
| 178 | 3300037466 | Ga0395898_0012212 | Ga0395898_0012212_2505_2987 | 157 |
| 179 | 3300037853 | Ga0436364_0482689 | Ga0436364_0482689_420_908 | 157 |
| 180 | 3300039437 | Ga0436365_0274646 | Ga0436365_0274646_3588_4076 | 157 |
| 181 | 3300039437 | Ga0436365_1345740 | Ga0436365_1345740_4117_4596 | 157 |
| 182 | 3300039447 | Ga0436361_1015175 | Ga0436361_1015175_2038_2523 | 157 |
| 183 | 3300039450 | Ga0436363_1257368 | Ga0436363_1257368_628_1107 | 157 |
| 184 | 3300041456 | Ga0451795_1224247 | Ga0451795_1224247_77_574 | 157 |
| 185 | 3300042134 | Ga0450898_085726 | Ga0450898_085726_54_608 | 157 |
| 186 | 3300046473 | Ga0495582_0762436 | Ga0495582_0762436_27_506 | 157 |
| 187 | 3300046515 | Ga0495620_0111324 | Ga0495620_0111324_145_627 | 157 |
| 188 | 3300047444 | Ga0495675_0451011 | Ga0495675_0451011_170_700 | 157 |
| 189 | 3300048905 | Ga0496102_0007582 | Ga0496102_0007582_6479_6988 | 157 |
| 190 | 3300048905 | Ga0496102_1074809 | Ga0496102_1074809_132_626 | 157 |
| 191 | 3300048906 | Ga0496103_0012760 | Ga0496103_0012760_2656_3165 | 157 |
| 192 | 3300048908 | Ga0496105_0076564 | Ga0496105_0076564_1572_2081 | 157 |
| 193 | 3300048909 | Ga0496106_0005275 | Ga0496106_0005275_5511_6020 | 157 |
| 194 | 3300048915 | Ga0496112_0035167 | Ga0496112_0035167_2797_3330 | 157 |
| 195 | 3300048916 | Ga0496113_0151546 | Ga0496113_0151546_917_1450 | 157 |
| 196 | 3300050492 | nmdc:mga0yw44_191524_c1 | nmdc:mga0yw44_191524_c1_201_764 | 157 |
| 197 | 3300050507 | nmdc:mga05p37_69451_c1 | nmdc:mga05p37_69451_c1_2427_2981 | 157 |
| 198 | 3300050508 | nmdc:mga09592_381116_c1 | nmdc:mga09592_381116_c1_219_773 | 157 |
| 199 | 3300050509 | nmdc:mga0qj67_133129_c1 | nmdc:mga0qj67_133129_c1_393_947 | 157 |
| 200 | 3300050510 | nmdc:mga06r32_9686_c1 | nmdc:mga06r32_9686_c1_1745_2299 | 157 |
| 201 | 3300053085 | Ga0495619_0108585 | Ga0495619_0108585_1273_1803 | 157 |
| 202 | 3300053119 | Ga0500595_096104 | Ga0500595_096104_227_706 | 157 |
| 203 | 3300003203 | JGI25406J46586_10003368 | JGI25406J46586_100033683 | 158 |
| 204 | 3300003752 | Ga0055539_1000310 | Ga0055539_100031016 | 158 |
| 205 | 3300003756 | Ga0055533_1000010 | Ga0055533_1000010385 | 158 |
| 206 | 3300005327 | Ga0070658_10029468 | Ga0070658_100294684 | 158 |
| 207 | 3300005329 | Ga0070683_100012316 | Ga0070683_1000123161 | 158 |
| 208 | 3300005329 | Ga0070683_100352552 | Ga0070683_1003525522 | 158 |
| 209 | 3300005334 | Ga0068869_100002609 | Ga0068869_10000260911 | 158 |
| 210 | 3300005335 | Ga0070666_10067577 | Ga0070666_100675774 | 158 |
| 211 | 3300005336 | Ga0070680_100006496 | Ga0070680_1000064964 | 158 |
| 212 | 3300005339 | Ga0070660_100066556 | Ga0070660_1000665563 | 158 |
| 213 | 3300005339 | Ga0070660_100383487 | Ga0070660_1003834872 | 158 |
| 214 | 3300005344 | Ga0070661_100141353 | Ga0070661_1001413531 | 158 |
| 215 | 3300005344 | Ga0070661_100844233 | Ga0070661_1008442332 | 158 |
| 216 | 3300005347 | Ga0070668_100018414 | Ga0070668_1000184146 | 158 |
| 217 | 3300005347 | Ga0070668_100130277 | Ga0070668_1001302773 | 158 |
| 218 | 3300005353 | Ga0070669_100005334 | Ga0070669_1000053343 | 158 |
| 219 | 3300005354 | Ga0070675_100034949 | Ga0070675_1000349494 | 158 |
| 220 | 3300005355 | Ga0070671_100092111 | Ga0070671_1000921112 | 158 |
| 221 | 3300005366 | Ga0070659_100115723 | Ga0070659_1001157231 | 158 |
| 222 | 3300005366 | Ga0070659_100164583 | Ga0070659_1001645831 | 158 |
| 223 | 3300005367 | Ga0070667_100197297 | Ga0070667_1001972972 | 158 |
| 224 | 3300005438 | Ga0070701_10873952 | Ga0070701_108739521 | 158 |
| 225 | 3300005455 | Ga0070663_100008842 | Ga0070663_1000088422 | 158 |
| 226 | 3300005456 | Ga0070678_100629240 | Ga0070678_1006292401 | 158 |
| 227 | 3300005457 | Ga0070662_100650011 | Ga0070662_1006500112 | 158 |
| 228 | 3300005458 | Ga0070681_10074065 | Ga0070681_100740653 | 158 |
| 229 | 3300005530 | Ga0070679_100005291 | Ga0070679_1000052913 | 158 |
| 230 | 3300005535 | Ga0070684_100307910 | Ga0070684_1003079101 | 158 |
| 231 | 3300005535 | Ga0070684_100684755 | Ga0070684_1006847552 | 158 |
| 232 | 3300005539 | Ga0068853_100373643 | Ga0068853_1003736431 | 158 |
| 233 | 3300005547 | Ga0070693_100529227 | Ga0070693_1005292272 | 158 |
| 234 | 3300005563 | Ga0068855_100179051 | Ga0068855_1001790513 | 158 |
| 235 | 3300005564 | Ga0070664_100020489 | Ga0070664_1000204897 | 158 |
| 236 | 3300005577 | Ga0068857_100075687 | Ga0068857_1000756873 | 158 |
| 237 | 3300005577 | Ga0068857_100991210 | Ga0068857_1009912101 | 158 |
| 238 | 3300005578 | Ga0068854_100060190 | Ga0068854_1000601903 | 158 |
| 239 | 3300005578 | Ga0068854_100146967 | Ga0068854_1001469671 | 158 |
| 240 | 3300005614 | Ga0068856_100021624 | Ga0068856_1000216241 | 158 |
| 241 | 3300005614 | Ga0068856_101089069 | Ga0068856_1010890692 | 158 |
| 242 | 3300005616 | Ga0068852_100178858 | Ga0068852_1001788581 | 158 |
| 243 | 3300005616 | Ga0068852_100201137 | Ga0068852_1002011371 | 158 |
| 244 | 3300005618 | Ga0068864_100663254 | Ga0068864_1006632541 | 158 |
| 245 | 3300005719 | Ga0068861_100003183 | Ga0068861_10000318311 | 158 |
| 246 | 3300005834 | Ga0068851_10152401 | Ga0068851_101524011 | 158 |
| 247 | 3300005841 | Ga0068863_100389617 | Ga0068863_1003896172 | 158 |
| 248 | 3300005844 | Ga0068862_100033250 | Ga0068862_1000332503 | 158 |
| 249 | 3300005985 | Ga0081539_10000617 | Ga0081539_1000061711 | 158 |
| 250 | 3300006237 | Ga0097621_100326286 | Ga0097621_1003262861 | 158 |
| 251 | 3300006358 | Ga0068871_100049854 | Ga0068871_1000498543 | 158 |
| 252 | 3300009093 | Ga0105240_10503646 | Ga0105240_105036462 | 158 |
| 253 | 3300009094 | Ga0111539_10239408 | Ga0111539_102394083 | 158 |
| 254 | 3300009098 | Ga0105245_10033929 | Ga0105245_100339294 | 158 |
| 255 | 3300009174 | Ga0105241_10284041 | Ga0105241_102840411 | 158 |
| 256 | 3300009177 | Ga0105248_10008033 | Ga0105248_1000803311 | 158 |
| 257 | 3300009545 | Ga0105237_10136637 | Ga0105237_101366372 | 158 |
| 258 | 3300009551 | Ga0105238_10013227 | Ga0105238_100132271 | 158 |
| 259 | 3300009551 | Ga0105238_10835669 | Ga0105238_108356691 | 158 |
| 260 | 3300009551 | Ga0105238_11361673 | Ga0105238_113616732 | 158 |
| 261 | 3300010375 | Ga0105239_10241157 | Ga0105239_102411572 | 158 |
| 262 | 3300013100 | Ga0157373_10012235 | Ga0157373_100122354 | 158 |
| 263 | 3300013105 | Ga0157369_10004416 | Ga0157369_1000441611 | 158 |
| 264 | 3300013296 | Ga0157374_10007118 | Ga0157374_1000711811 | 158 |
| 265 | 3300013306 | Ga0163162_10011386 | Ga0163162_100113865 | 158 |
| 266 | 3300013307 | Ga0157372_10010659 | Ga0157372_1001065911 | 158 |
| 267 | 3300013307 | Ga0157372_10252013 | Ga0157372_102520131 | 158 |
| 268 | 3300013308 | Ga0157375_11167751 | Ga0157375_111677512 | 158 |
| 269 | 3300014745 | Ga0157377_10352414 | Ga0157377_103524142 | 158 |
| 270 | 3300014968 | Ga0157379_10010452 | Ga0157379_100104527 | 158 |
| 271 | 3300014969 | Ga0157376_10081366 | Ga0157376_100813663 | 158 |
| 272 | 3300017792 | Ga0163161_10029214 | Ga0163161_100292143 | 158 |
| 273 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031719 | 158 |
| 274 | 3300025230 | Ga0209563_100049 | Ga0209563_100049181 | 158 |
| 275 | 3300025253 | Ga0209677_100050 | Ga0209677_100050138 | 158 |
| 276 | 3300025315 | Ga0207697_10051694 | Ga0207697_100516942 | 158 |
| 277 | 3300025321 | Ga0207656_10106025 | Ga0207656_101060252 | 158 |
| 278 | 3300025900 | Ga0207710_10023200 | Ga0207710_100232002 | 158 |
| 279 | 3300025901 | Ga0207688_10035566 | Ga0207688_100355662 | 158 |
| 280 | 3300025909 | Ga0207705_10063288 | Ga0207705_100632882 | 158 |
| 281 | 3300025911 | Ga0207654_10140240 | Ga0207654_101402403 | 158 |
| 282 | 3300025912 | Ga0207707_10168156 | Ga0207707_101681561 | 158 |
| 283 | 3300025917 | Ga0207660_10025665 | Ga0207660_100256652 | 158 |
| 284 | 3300025919 | Ga0207657_10363682 | Ga0207657_103636821 | 158 |
| 285 | 3300025919 | Ga0207657_10689728 | Ga0207657_106897282 | 158 |
| 286 | 3300025920 | Ga0207649_10087335 | Ga0207649_100873352 | 158 |
| 287 | 3300025921 | Ga0207652_10096240 | Ga0207652_100962403 | 158 |
| 288 | 3300025923 | Ga0207681_10112035 | Ga0207681_101120352 | 158 |
| 289 | 3300025924 | Ga0207694_10031813 | Ga0207694_100318134 | 158 |
| 290 | 3300025924 | Ga0207694_10767015 | Ga0207694_107670152 | 158 |
| 291 | 3300025926 | Ga0207659_10455249 | Ga0207659_104552491 | 158 |
| 292 | 3300025927 | Ga0207687_10028883 | Ga0207687_100288833 | 158 |
| 293 | 3300025931 | Ga0207644_10475583 | Ga0207644_104755832 | 158 |
| 294 | 3300025932 | Ga0207690_10228431 | Ga0207690_102284311 | 158 |
| 295 | 3300025932 | Ga0207690_10531001 | Ga0207690_105310011 | 158 |
| 296 | 3300025933 | Ga0207706_10005446 | Ga0207706_100054462 | 158 |
| 297 | 3300025941 | Ga0207711_10179546 | Ga0207711_101795463 | 158 |
| 298 | 3300025942 | Ga0207689_10000550 | Ga0207689_1000055024 | 158 |
| 299 | 3300025944 | Ga0207661_10009060 | Ga0207661_100090603 | 158 |
| 300 | 3300025944 | Ga0207661_10246521 | Ga0207661_102465212 | 158 |
| 301 | 3300025945 | Ga0207679_10003726 | Ga0207679_1000372612 | 158 |
| 302 | 3300025945 | Ga0207679_10361897 | Ga0207679_103618971 | 158 |
| 303 | 3300025949 | Ga0207667_10180435 | Ga0207667_101804352 | 158 |
| 304 | 3300025972 | Ga0207668_10428276 | Ga0207668_104282761 | 158 |
| 305 | 3300025981 | Ga0207640_10138846 | Ga0207640_101388463 | 158 |
| 306 | 3300025981 | Ga0207640_10167522 | Ga0207640_101675221 | 158 |
| 307 | 3300026023 | Ga0207677_10005039 | Ga0207677_100050395 | 158 |
| 308 | 3300026035 | Ga0207703_10140792 | Ga0207703_101407923 | 158 |
| 309 | 3300026041 | Ga0207639_10048460 | Ga0207639_100484603 | 158 |
| 310 | 3300026078 | Ga0207702_10004454 | Ga0207702_1000445412 | 158 |
| 311 | 3300026078 | Ga0207702_10609855 | Ga0207702_106098552 | 158 |
| 312 | 3300026078 | Ga0207702_10683692 | Ga0207702_106836922 | 158 |
| 313 | 3300026088 | Ga0207641_10040743 | Ga0207641_100407432 | 158 |
| 314 | 3300026095 | Ga0207676_10105250 | Ga0207676_101052502 | 158 |
| 315 | 3300026116 | Ga0207674_10732725 | Ga0207674_107327251 | 158 |
| 316 | 3300026116 | Ga0207674_11115352 | Ga0207674_111153522 | 158 |
| 317 | 3300026118 | Ga0207675_100000576 | Ga0207675_10000057624 | 158 |
| 318 | 3300026121 | Ga0207683_10088749 | Ga0207683_100887493 | 158 |
| 319 | 3300026142 | Ga0207698_10007575 | Ga0207698_100075752 | 158 |
| 320 | 3300026142 | Ga0207698_10009788 | Ga0207698_100097884 | 158 |
| 321 | 3300028380 | Ga0268265_10067092 | Ga0268265_100670923 | 158 |
| 322 | 3300028381 | Ga0268264_10032705 | Ga0268264_100327052 | 158 |
| 323 | 3300031901 | Ga0307406_10390720 | Ga0307406_103907202 | 158 |
| 324 | 3300032002 | Ga0307416_100092178 | Ga0307416_1000921784 | 158 |
| 325 | 3300035112 | Ga0373932_0112300 | Ga0373932_0112300_325_804 | 158 |
| 326 | 3300035114 | Ga0373939_0025744 | Ga0373939_0025744_836_1315 | 158 |
| 327 | 3300035114 | Ga0373939_0201822 | Ga0373939_0201822_236_727 | 158 |
| 328 | 3300035115 | Ga0373941_0016087 | Ga0373941_0016087_607_1086 | 158 |
| 329 | 3300035117 | Ga0373953_0001844 | Ga0373953_0001844_3700_4212 | 158 |
| 330 | 3300035118 | Ga0373954_0036066 | Ga0373954_0036066_938_1450 | 158 |
| 331 | 3300035120 | Ga0373957_0201631 | Ga0373957_0201631_245_766 | 158 |
| 332 | 3300035172 | Ga0373955_0011070 | Ga0373955_0011070_1783_2295 | 158 |
| 333 | 3300035242 | Ga0373962_0004177 | Ga0373962_0004177_1100_1579 | 158 |
| 334 | 3300035692 | Ga0373935_0278951 | Ga0373935_0278951_333_845 | 158 |
| 335 | 3300039453 | Ga0436362_0531272 | Ga0436362_0531272_42_527 | 158 |
| 336 | 3300041453 | Ga0451797_0909590 | Ga0451797_0909590_423_971 | 158 |
| 337 | 3300046459 | Ga0495629_0153929 | Ga0495629_0153929_453_965 | 158 |
| 338 | 3300046462 | Ga0495651_0009538 | Ga0495651_0009538_2333_2845 | 158 |
| 339 | 3300046463 | Ga0495653_0021947 | Ga0495653_0021947_2724_3236 | 158 |
| 340 | 3300046477 | Ga0495664_0020652 | Ga0495664_0020652_1223_1735 | 158 |
| 341 | 3300046507 | Ga0495606_0001165 | Ga0495606_0001165_13838_14320 | 158 |
| 342 | 3300046511 | Ga0495608_0041349 | Ga0495608_0041349_22_534 | 158 |
| 343 | 3300046514 | Ga0495618_0021531 | Ga0495618_0021531_2263_2775 | 158 |
| 344 | 3300046517 | Ga0495630_0140350 | Ga0495630_0140350_1239_1751 | 158 |
| 345 | 3300046533 | Ga0495640_0095188 | Ga0495640_0095188_1250_1762 | 158 |
| 346 | 3300046535 | Ga0495586_0010203 | Ga0495586_0010203_1659_2171 | 158 |
| 347 | 3300046536 | Ga0495587_0023347 | Ga0495587_0023347_1506_2018 | 158 |
| 348 | 3300046543 | Ga0495645_0008575 | Ga0495645_0008575_2657_3169 | 158 |
| 349 | 3300046559 | Ga0495667_0038481 | Ga0495667_0038481_1089_1601 | 158 |
| 350 | 3300046642 | Ga0495634_0026497 | Ga0495634_0026497_2722_3234 | 158 |
| 351 | 3300046663 | Ga0495635_0054202 | Ga0495635_0054202_992_1504 | 158 |
| 352 | 3300046675 | Ga0495657_0082376 | Ga0495657_0082376_566_1078 | 158 |
| 353 | 3300046678 | Ga0495599_0091927 | Ga0495599_0091927_519_1031 | 158 |
| 354 | 3300046679 | Ga0495623_0056506 | Ga0495623_0056506_1783_2295 | 158 |
| 355 | 3300046679 | Ga0495623_0503271 | Ga0495623_0503271_21_554 | 158 |
| 356 | 3300046680 | Ga0495646_0051164 | Ga0495646_0051164_1427_1939 | 158 |
| 357 | 3300046689 | Ga0495613_0079173 | Ga0495613_0079173_1012_1524 | 158 |
| 358 | 3300046809 | Ga0495600_0021231 | Ga0495600_0021231_1102_1614 | 158 |
| 359 | 3300047317 | Ga0495604_0073588 | Ga0495604_0073588_1081_1593 | 158 |
| 360 | 3300047322 | Ga0495680_0011531 | Ga0495680_0011531_2688_3200 | 158 |
| 361 | 3300047444 | Ga0495675_0025108 | Ga0495675_0025108_1084_1596 | 158 |
| 362 | 3300047471 | Ga0495684_0141527 | Ga0495684_0141527_84_596 | 158 |
| 363 | 3300048088 | Ga0495602_0077100 | Ga0495602_0077100_1452_1964 | 158 |
| 364 | 3300048904 | Ga0496101_0079654 | Ga0496101_0079654_1182_1661 | 158 |
| 365 | 3300048905 | Ga0496102_0175593 | Ga0496102_0175593_1222_1701 | 158 |
| 366 | 3300048909 | Ga0496106_0479362 | Ga0496106_0479362_209_688 | 158 |
| 367 | 3300048910 | Ga0496107_0785578 | Ga0496107_0785578_161_640 | 158 |
| 368 | 3300048911 | Ga0496108_0213026 | Ga0496108_0213026_25_504 | 158 |
| 369 | 3300048912 | Ga0496109_0628642 | Ga0496109_0628642_173_652 | 158 |
| 370 | 3300048913 | Ga0496110_0002997 | Ga0496110_0002997_4122_4601 | 158 |
| 371 | 3300048915 | Ga0496112_0731559 | Ga0496112_0731559_156_635 | 158 |
| 372 | 3300048916 | Ga0496113_0043328 | Ga0496113_0043328_1448_1927 | 158 |
| 373 | 3300048917 | Ga0496114_0314103 | Ga0496114_0314103_843_1322 | 158 |
| 374 | 3300048918 | Ga0496115_0085405 | Ga0496115_0085405_670_1149 | 158 |
| 375 | 3300049575 | Ga0501039_0293243 | Ga0501039_0293243_452_985 | 158 |
| 376 | 3300049587 | Ga0501071_0578945 | Ga0501071_0578945_51_542 | 158 |
| 377 | 3300049588 | Ga0501072_0724123 | Ga0501072_0724123_36_569 | 158 |
| 378 | 3300049591 | Ga0501075_0777819 | Ga0501075_0777819_177_710 | 158 |
| 379 | 3300049592 | Ga0501076_0108269 | Ga0501076_0108269_298_789 | 158 |
| 380 | 3300049593 | Ga0501077_0439517 | Ga0501077_0439517_269_802 | 158 |
| 381 | 3300050493 | nmdc:mga0k408_27324_c1 | nmdc:mga0k408_27324_c1_16_495 | 158 |
| 382 | 3300053077 | Ga0495601_0101590 | Ga0495601_0101590_1220_1732 | 158 |
| 383 | 3300053078 | Ga0495612_0010858 | Ga0495612_0010858_2011_2523 | 158 |
| 384 | 3300053085 | Ga0495619_0124241 | Ga0495619_0124241_39_551 | 158 |
| 385 | 3300053094 | Ga0500566_0003307 | Ga0500566_0003307_2048_2623 | 158 |
| 386 | 3300053102 | Ga0500554_004194 | Ga0500554_004194_338_913 | 158 |
| 387 | 3300053119 | Ga0500595_000589 | Ga0500595_000589_10120_10662 | 158 |
| 388 | 3300053119 | Ga0500595_002741 | Ga0500595_002741_5912_6487 | 158 |
| 389 | 3300053136 | Ga0500559_0094526 | Ga0500559_0094526_15_620 | 158 |
| 390 | 3300053162 | Ga0500638_004644 | Ga0500638_004644_4095_4670 | 158 |
| 391 | 3300053178 | Ga0500637_0000302 | Ga0500637_0000302_13126_13701 | 158 |
| 392 | 3300055283 | Ga0500661_003847 | Ga0500661_003847_771_1346 | 158 |
| 393 | 3300002705 | JGI25156J39149_1000441 | JGI25156J39149_100044119 | 159 |
| 394 | 3300002738 | JGI25154J39366_1001707 | JGI25154J39366_10017073 | 159 |
| 395 | 3300002741 | JGI25157J39369_1000029 | JGI25157J39369_1000029116 | 159 |
| 396 | 3300005327 | Ga0070658_10723216 | Ga0070658_107232161 | 159 |
| 397 | 3300005328 | Ga0070676_10254885 | Ga0070676_102548852 | 159 |
| 398 | 3300005328 | Ga0070676_10655148 | Ga0070676_106551481 | 159 |
| 399 | 3300005330 | Ga0070690_100043087 | Ga0070690_1000430871 | 159 |
| 400 | 3300005331 | Ga0070670_100001996 | Ga0070670_1000019965 | 159 |
| 401 | 3300005331 | Ga0070670_100317037 | Ga0070670_1003170372 | 159 |
| 402 | 3300005331 | Ga0070670_100371798 | Ga0070670_1003717981 | 159 |
| 403 | 3300005331 | Ga0070670_100499518 | Ga0070670_1004995181 | 159 |
| 404 | 3300005331 | Ga0070670_101364923 | Ga0070670_1013649231 | 159 |
| 405 | 3300005333 | Ga0070677_10035705 | Ga0070677_100357052 | 159 |
| 406 | 3300005334 | Ga0068869_100104367 | Ga0068869_1001043671 | 159 |
| 407 | 3300005334 | Ga0068869_101024787 | Ga0068869_1010247871 | 159 |
| 408 | 3300005335 | Ga0070666_10001744 | Ga0070666_100017442 | 159 |
| 409 | 3300005337 | Ga0070682_100286063 | Ga0070682_1002860632 | 159 |
| 410 | 3300005338 | Ga0068868_100050964 | Ga0068868_1000509641 | 159 |
| 411 | 3300005338 | Ga0068868_100563350 | Ga0068868_1005633502 | 159 |
| 412 | 3300005339 | Ga0070660_100142089 | Ga0070660_1001420892 | 159 |
| 413 | 3300005340 | Ga0070689_100298032 | Ga0070689_1002980322 | 159 |
| 414 | 3300005344 | Ga0070661_100076457 | Ga0070661_1000764573 | 159 |
| 415 | 3300005344 | Ga0070661_100497429 | Ga0070661_1004974292 | 159 |
| 416 | 3300005344 | Ga0070661_100743402 | Ga0070661_1007434021 | 159 |
| 417 | 3300005344 | Ga0070661_100832769 | Ga0070661_1008327691 | 159 |
| 418 | 3300005347 | Ga0070668_100001912 | Ga0070668_1000019121 | 159 |
| 419 | 3300005353 | Ga0070669_100017767 | Ga0070669_1000177671 | 159 |
| 420 | 3300005353 | Ga0070669_100664583 | Ga0070669_1006645832 | 159 |
| 421 | 3300005353 | Ga0070669_100956205 | Ga0070669_1009562051 | 159 |
| 422 | 3300005354 | Ga0070675_100018417 | Ga0070675_1000184174 | 159 |
| 423 | 3300005354 | Ga0070675_100129939 | Ga0070675_1001299393 | 159 |
| 424 | 3300005354 | Ga0070675_100271144 | Ga0070675_1002711442 | 159 |
| 425 | 3300005355 | Ga0070671_100045432 | Ga0070671_1000454325 | 159 |
| 426 | 3300005355 | Ga0070671_100332322 | Ga0070671_1003323222 | 159 |
| 427 | 3300005355 | Ga0070671_100599977 | Ga0070671_1005999771 | 159 |
| 428 | 3300005355 | Ga0070671_100617343 | Ga0070671_1006173432 | 159 |
| 429 | 3300005355 | Ga0070671_100618580 | Ga0070671_1006185801 | 159 |
| 430 | 3300005356 | Ga0070674_100065144 | Ga0070674_1000651441 | 159 |
| 431 | 3300005356 | Ga0070674_100748185 | Ga0070674_1007481852 | 159 |
| 432 | 3300005364 | Ga0070673_100247511 | Ga0070673_1002475112 | 159 |
| 433 | 3300005364 | Ga0070673_100376247 | Ga0070673_1003762471 | 159 |
| 434 | 3300005364 | Ga0070673_100404315 | Ga0070673_1004043152 | 159 |
| 435 | 3300005364 | Ga0070673_100826492 | Ga0070673_1008264922 | 159 |
| 436 | 3300005365 | Ga0070688_100943877 | Ga0070688_1009438771 | 159 |
| 437 | 3300005366 | Ga0070659_101041513 | Ga0070659_1010415131 | 159 |
| 438 | 3300005367 | Ga0070667_100013141 | Ga0070667_1000131418 | 159 |
| 439 | 3300005367 | Ga0070667_100364933 | Ga0070667_1003649331 | 159 |
| 440 | 3300005435 | Ga0070714_100080128 | Ga0070714_1000801282 | 159 |
| 441 | 3300005455 | Ga0070663_100076689 | Ga0070663_1000766894 | 159 |
| 442 | 3300005455 | Ga0070663_100425029 | Ga0070663_1004250292 | 159 |
| 443 | 3300005456 | Ga0070678_100114485 | Ga0070678_1001144852 | 159 |
| 444 | 3300005456 | Ga0070678_100137173 | Ga0070678_1001371733 | 159 |
| 445 | 3300005456 | Ga0070678_100301671 | Ga0070678_1003016712 | 159 |
| 446 | 3300005456 | Ga0070678_100470944 | Ga0070678_1004709442 | 159 |
| 447 | 3300005456 | Ga0070678_100702022 | Ga0070678_1007020222 | 159 |
| 448 | 3300005459 | Ga0068867_100017625 | Ga0068867_1000176256 | 159 |
| 449 | 3300005459 | Ga0068867_100812925 | Ga0068867_1008129252 | 159 |
| 450 | 3300005467 | Ga0070706_100115678 | Ga0070706_1001156782 | 159 |
| 451 | 3300005468 | Ga0070707_100115367 | Ga0070707_1001153672 | 159 |
| 452 | 3300005471 | Ga0070698_100016443 | Ga0070698_1000164431 | 159 |
| 453 | 3300005535 | Ga0070684_100020787 | Ga0070684_1000207877 | 159 |
| 454 | 3300005536 | Ga0070697_100167989 | Ga0070697_1001679891 | 159 |
| 455 | 3300005543 | Ga0070672_100033366 | Ga0070672_1000333662 | 159 |
| 456 | 3300005543 | Ga0070672_100781184 | Ga0070672_1007811841 | 159 |
| 457 | 3300005544 | Ga0070686_100189641 | Ga0070686_1001896413 | 159 |
| 458 | 3300005547 | Ga0070693_100335695 | Ga0070693_1003356952 | 159 |
| 459 | 3300005548 | Ga0070665_100095104 | Ga0070665_1000951043 | 159 |
| 460 | 3300005548 | Ga0070665_100554362 | Ga0070665_1005543622 | 159 |
| 461 | 3300005563 | Ga0068855_100030535 | Ga0068855_1000305352 | 159 |
| 462 | 3300005564 | Ga0070664_100146650 | Ga0070664_1001466502 | 159 |
| 463 | 3300005564 | Ga0070664_100392951 | Ga0070664_1003929511 | 159 |
| 464 | 3300005564 | Ga0070664_101389635 | Ga0070664_1013896351 | 159 |
| 465 | 3300005577 | Ga0068857_100002542 | Ga0068857_1000025425 | 159 |
| 466 | 3300005578 | Ga0068854_100012169 | Ga0068854_1000121697 | 159 |
| 467 | 3300005578 | Ga0068854_100088278 | Ga0068854_1000882781 | 159 |
| 468 | 3300005578 | Ga0068854_100182664 | Ga0068854_1001826642 | 159 |
| 469 | 3300005578 | Ga0068854_100768018 | Ga0068854_1007680182 | 159 |
| 470 | 3300005614 | Ga0068856_100003174 | Ga0068856_1000031745 | 159 |
| 471 | 3300005615 | Ga0070702_100385695 | Ga0070702_1003856951 | 159 |
| 472 | 3300005616 | Ga0068852_100238240 | Ga0068852_1002382401 | 159 |
| 473 | 3300005616 | Ga0068852_100989743 | Ga0068852_1009897432 | 159 |
| 474 | 3300005617 | Ga0068859_100567876 | Ga0068859_1005678762 | 159 |
| 475 | 3300005618 | Ga0068864_100001915 | Ga0068864_10000191512 | 159 |
| 476 | 3300005618 | Ga0068864_100047489 | Ga0068864_1000474895 | 159 |
| 477 | 3300005718 | Ga0068866_10005777 | Ga0068866_100057772 | 159 |
| 478 | 3300005718 | Ga0068866_10857448 | Ga0068866_108574481 | 159 |
| 479 | 3300005719 | Ga0068861_100200015 | Ga0068861_1002000152 | 159 |
| 480 | 3300005834 | Ga0068851_10102836 | Ga0068851_101028362 | 159 |
| 481 | 3300005834 | Ga0068851_10327412 | Ga0068851_103274122 | 159 |
| 482 | 3300005841 | Ga0068863_100011347 | Ga0068863_1000113479 | 159 |
| 483 | 3300005841 | Ga0068863_100616797 | Ga0068863_1006167971 | 159 |
| 484 | 3300005843 | Ga0068860_100267957 | Ga0068860_1002679572 | 159 |
| 485 | 3300005844 | Ga0068862_100041742 | Ga0068862_1000417424 | 159 |
| 486 | 3300006028 | Ga0070717_10358474 | Ga0070717_103584742 | 159 |
| 487 | 3300006195 | Ga0075366_10192843 | Ga0075366_101928433 | 159 |
| 488 | 3300006195 | Ga0075366_10220835 | Ga0075366_102208352 | 159 |
| 489 | 3300006237 | Ga0097621_100072627 | Ga0097621_1000726273 | 159 |
| 490 | 3300006237 | Ga0097621_100105115 | Ga0097621_1001051153 | 159 |
| 491 | 3300006237 | Ga0097621_100126855 | Ga0097621_1001268553 | 159 |
| 492 | 3300006237 | Ga0097621_101519783 | Ga0097621_1015197831 | 159 |
| 493 | 3300006358 | Ga0068871_100006827 | Ga0068871_1000068275 | 159 |
| 494 | 3300006358 | Ga0068871_100046827 | Ga0068871_1000468274 | 159 |
| 495 | 3300006881 | Ga0068865_100013714 | Ga0068865_1000137146 | 159 |
| 496 | 3300006931 | Ga0097620_100567860 | Ga0097620_1005678602 | 159 |
| 497 | 3300009093 | Ga0105240_10051215 | Ga0105240_100512155 | 159 |
| 498 | 3300009093 | Ga0105240_10118401 | Ga0105240_101184011 | 159 |
| 499 | 3300009098 | Ga0105245_10081246 | Ga0105245_100812463 | 159 |
| 500 | 3300009098 | Ga0105245_10100259 | Ga0105245_101002592 | 159 |
| 501 | 3300009101 | Ga0105247_10722166 | Ga0105247_107221661 | 159 |
| 502 | 3300009148 | Ga0105243_10004595 | Ga0105243_100045955 | 159 |
| 503 | 3300009177 | Ga0105248_10834043 | Ga0105248_108340431 | 159 |
| 504 | 3300009545 | Ga0105237_10037720 | Ga0105237_100377204 | 159 |
| 505 | 3300009545 | Ga0105237_10085690 | Ga0105237_100856902 | 159 |
| 506 | 3300009551 | Ga0105238_10167006 | Ga0105238_101670062 | 159 |
| 507 | 3300009553 | Ga0105249_10536865 | Ga0105249_105368651 | 159 |
| 508 | 3300009553 | Ga0105249_11162630 | Ga0105249_111626301 | 159 |
| 509 | 3300010375 | Ga0105239_10029727 | Ga0105239_100297275 | 159 |
| 510 | 3300010375 | Ga0105239_10033427 | Ga0105239_100334275 | 159 |
| 511 | 3300011119 | Ga0105246_10142595 | Ga0105246_101425953 | 159 |
| 512 | 3300013105 | Ga0157369_10233802 | Ga0157369_102338023 | 159 |
| 513 | 3300013296 | Ga0157374_10095353 | Ga0157374_100953535 | 159 |
| 514 | 3300013296 | Ga0157374_10653393 | Ga0157374_106533932 | 159 |
| 515 | 3300013297 | Ga0157378_10247821 | Ga0157378_102478212 | 159 |
| 516 | 3300013297 | Ga0157378_10282318 | Ga0157378_102823181 | 159 |
| 517 | 3300013297 | Ga0157378_10286921 | Ga0157378_102869212 | 159 |
| 518 | 3300013306 | Ga0163162_10013440 | Ga0163162_1001344012 | 159 |
| 519 | 3300013307 | Ga0157372_11067182 | Ga0157372_110671822 | 159 |
| 520 | 3300013308 | Ga0157375_10004510 | Ga0157375_1000451012 | 159 |
| 521 | 3300013308 | Ga0157375_10092181 | Ga0157375_100921812 | 159 |
| 522 | 3300013308 | Ga0157375_10126249 | Ga0157375_101262492 | 159 |
| 523 | 3300013308 | Ga0157375_11069189 | Ga0157375_110691892 | 159 |
| 524 | 3300013308 | Ga0157375_12201351 | Ga0157375_122013511 | 159 |
| 525 | 3300014325 | Ga0163163_10084865 | Ga0163163_100848654 | 159 |
| 526 | 3300014325 | Ga0163163_10330491 | Ga0163163_103304912 | 159 |
| 527 | 3300014497 | Ga0182008_10807465 | Ga0182008_108074651 | 159 |
| 528 | 3300014745 | Ga0157377_10575874 | Ga0157377_105758742 | 159 |
| 529 | 3300014968 | Ga0157379_10330220 | Ga0157379_103302202 | 159 |
| 530 | 3300014968 | Ga0157379_10480377 | Ga0157379_104803772 | 159 |
| 531 | 3300014968 | Ga0157379_10600370 | Ga0157379_106003701 | 159 |
| 532 | 3300014968 | Ga0157379_11119126 | Ga0157379_111191261 | 159 |
| 533 | 3300014969 | Ga0157376_10004195 | Ga0157376_100041958 | 159 |
| 534 | 3300014969 | Ga0157376_10933886 | Ga0157376_109338861 | 159 |
| 535 | 3300017792 | Ga0163161_10148429 | Ga0163161_101484293 | 159 |
| 536 | 3300021384 | Ga0213876_10013845 | Ga0213876_100138454 | 159 |
| 537 | 3300025246 | Ga0209646_1000257 | Ga0209646_100025737 | 159 |
| 538 | 3300025250 | Ga0209026_1000054 | Ga0209026_100005471 | 159 |
| 539 | 3300025253 | Ga0209677_100316 | Ga0209677_1003169 | 159 |
| 540 | 3300025256 | Ga0209759_1000043 | Ga0209759_1000043156 | 159 |
| 541 | 3300025256 | Ga0209759_1007372 | Ga0209759_10073723 | 159 |
| 542 | 3300025271 | Ga0207666_1034245 | Ga0207666_10342451 | 159 |
| 543 | 3300025315 | Ga0207697_10072947 | Ga0207697_100729472 | 159 |
| 544 | 3300025321 | Ga0207656_10079392 | Ga0207656_100793922 | 159 |
| 545 | 3300025901 | Ga0207688_10021261 | Ga0207688_100212614 | 159 |
| 546 | 3300025903 | Ga0207680_10574620 | Ga0207680_105746202 | 159 |
| 547 | 3300025907 | Ga0207645_10013318 | Ga0207645_100133182 | 159 |
| 548 | 3300025907 | Ga0207645_10033535 | Ga0207645_100335354 | 159 |
| 549 | 3300025907 | Ga0207645_10389387 | Ga0207645_103893871 | 159 |
| 550 | 3300025908 | Ga0207643_10140986 | Ga0207643_101409863 | 159 |
| 551 | 3300025908 | Ga0207643_10284330 | Ga0207643_102843301 | 159 |
| 552 | 3300025909 | Ga0207705_10377252 | Ga0207705_103772522 | 159 |
| 553 | 3300025909 | Ga0207705_10761505 | Ga0207705_107615051 | 159 |
| 554 | 3300025910 | Ga0207684_10092637 | Ga0207684_100926371 | 159 |
| 555 | 3300025914 | Ga0207671_10111436 | Ga0207671_101114362 | 159 |
| 556 | 3300025914 | Ga0207671_10598003 | Ga0207671_105980031 | 159 |
| 557 | 3300025917 | Ga0207660_10013863 | Ga0207660_100138633 | 159 |
| 558 | 3300025919 | Ga0207657_10017177 | Ga0207657_100171778 | 159 |
| 559 | 3300025920 | Ga0207649_10701527 | Ga0207649_107015272 | 159 |
| 560 | 3300025922 | Ga0207646_10174411 | Ga0207646_101744111 | 159 |
| 561 | 3300025922 | Ga0207646_11569991 | Ga0207646_115699911 | 159 |
| 562 | 3300025923 | Ga0207681_10006059 | Ga0207681_100060595 | 159 |
| 563 | 3300025924 | Ga0207694_10013700 | Ga0207694_100137008 | 159 |
| 564 | 3300025925 | Ga0207650_10008713 | Ga0207650_100087134 | 159 |
| 565 | 3300025925 | Ga0207650_10021070 | Ga0207650_100210701 | 159 |
| 566 | 3300025925 | Ga0207650_10524697 | Ga0207650_105246971 | 159 |
| 567 | 3300025926 | Ga0207659_10027360 | Ga0207659_100273604 | 159 |
| 568 | 3300025927 | Ga0207687_10140822 | Ga0207687_101408222 | 159 |
| 569 | 3300025927 | Ga0207687_10145092 | Ga0207687_101450921 | 159 |
| 570 | 3300025928 | Ga0207700_10251354 | Ga0207700_102513543 | 159 |
| 571 | 3300025929 | Ga0207664_10093577 | Ga0207664_100935772 | 159 |
| 572 | 3300025931 | Ga0207644_10111536 | Ga0207644_101115361 | 159 |
| 573 | 3300025931 | Ga0207644_10424186 | Ga0207644_104241862 | 159 |
| 574 | 3300025931 | Ga0207644_10548773 | Ga0207644_105487731 | 159 |
| 575 | 3300025931 | Ga0207644_10774640 | Ga0207644_107746401 | 159 |
| 576 | 3300025931 | Ga0207644_11000790 | Ga0207644_110007901 | 159 |
| 577 | 3300025931 | Ga0207644_11012014 | Ga0207644_110120142 | 159 |
| 578 | 3300025932 | Ga0207690_10586255 | Ga0207690_105862552 | 159 |
| 579 | 3300025933 | Ga0207706_10256036 | Ga0207706_102560363 | 159 |
| 580 | 3300025935 | Ga0207709_10164485 | Ga0207709_101644852 | 159 |
| 581 | 3300025936 | Ga0207670_10527379 | Ga0207670_105273792 | 159 |
| 582 | 3300025937 | Ga0207669_10005530 | Ga0207669_100055305 | 159 |
| 583 | 3300025938 | Ga0207704_10009803 | Ga0207704_100098033 | 159 |
| 584 | 3300025940 | Ga0207691_10055485 | Ga0207691_100554854 | 159 |
| 585 | 3300025940 | Ga0207691_10191803 | Ga0207691_101918033 | 159 |
| 586 | 3300025940 | Ga0207691_10208810 | Ga0207691_102088102 | 159 |
| 587 | 3300025940 | Ga0207691_10374450 | Ga0207691_103744501 | 159 |
| 588 | 3300025940 | Ga0207691_10382534 | Ga0207691_103825342 | 159 |
| 589 | 3300025941 | Ga0207711_10060901 | Ga0207711_100609011 | 159 |
| 590 | 3300025941 | Ga0207711_11017865 | Ga0207711_110178651 | 159 |
| 591 | 3300025942 | Ga0207689_10005418 | Ga0207689_100054183 | 159 |
| 592 | 3300025942 | Ga0207689_10232972 | Ga0207689_102329722 | 159 |
| 593 | 3300025944 | Ga0207661_10134005 | Ga0207661_101340052 | 159 |
| 594 | 3300025944 | Ga0207661_10170343 | Ga0207661_101703431 | 159 |
| 595 | 3300025944 | Ga0207661_10679394 | Ga0207661_106793942 | 159 |
| 596 | 3300025945 | Ga0207679_11592574 | Ga0207679_115925741 | 159 |
| 597 | 3300025949 | Ga0207667_10047907 | Ga0207667_100479073 | 159 |
| 598 | 3300025960 | Ga0207651_10083499 | Ga0207651_100834992 | 159 |
| 599 | 3300025960 | Ga0207651_10104845 | Ga0207651_101048453 | 159 |
| 600 | 3300025960 | Ga0207651_10245587 | Ga0207651_102455871 | 159 |
| 601 | 3300025960 | Ga0207651_10347699 | Ga0207651_103476992 | 159 |
| 602 | 3300025960 | Ga0207651_11168467 | Ga0207651_111684671 | 159 |
| 603 | 3300025961 | Ga0207712_10018795 | Ga0207712_100187953 | 159 |
| 604 | 3300025972 | Ga0207668_10121772 | Ga0207668_101217723 | 159 |
| 605 | 3300025981 | Ga0207640_10061934 | Ga0207640_100619343 | 159 |
| 606 | 3300025981 | Ga0207640_10126093 | Ga0207640_101260932 | 159 |
| 607 | 3300025981 | Ga0207640_10313059 | Ga0207640_103130592 | 159 |
| 608 | 3300025986 | Ga0207658_10218590 | Ga0207658_102185902 | 159 |
| 609 | 3300026023 | Ga0207677_10040495 | Ga0207677_100404953 | 159 |
| 610 | 3300026023 | Ga0207677_10766819 | Ga0207677_107668192 | 159 |
| 611 | 3300026035 | Ga0207703_10021520 | Ga0207703_100215204 | 159 |
| 612 | 3300026035 | Ga0207703_10406747 | Ga0207703_104067472 | 159 |
| 613 | 3300026041 | Ga0207639_10028942 | Ga0207639_100289423 | 159 |
| 614 | 3300026041 | Ga0207639_10897623 | Ga0207639_108976232 | 159 |
| 615 | 3300026067 | Ga0207678_10040307 | Ga0207678_100403072 | 159 |
| 616 | 3300026067 | Ga0207678_10057806 | Ga0207678_100578064 | 159 |
| 617 | 3300026075 | Ga0207708_10025472 | Ga0207708_100254722 | 159 |
| 618 | 3300026075 | Ga0207708_10176849 | Ga0207708_101768491 | 159 |
| 619 | 3300026078 | Ga0207702_10011854 | Ga0207702_100118543 | 159 |
| 620 | 3300026088 | Ga0207641_10002779 | Ga0207641_100027793 | 159 |
| 621 | 3300026089 | Ga0207648_10018173 | Ga0207648_100181738 | 159 |
| 622 | 3300026089 | Ga0207648_10772546 | Ga0207648_107725461 | 159 |
| 623 | 3300026089 | Ga0207648_11191882 | Ga0207648_111918822 | 159 |
| 624 | 3300026095 | Ga0207676_10011759 | Ga0207676_100117595 | 159 |
| 625 | 3300026095 | Ga0207676_10342893 | Ga0207676_103428932 | 159 |
| 626 | 3300026116 | Ga0207674_10021066 | Ga0207674_100210665 | 159 |
| 627 | 3300026118 | Ga0207675_100002372 | Ga0207675_1000023724 | 159 |
| 628 | 3300026118 | Ga0207675_101208499 | Ga0207675_1012084992 | 159 |
| 629 | 3300026121 | Ga0207683_10046461 | Ga0207683_100464614 | 159 |
| 630 | 3300026121 | Ga0207683_10066278 | Ga0207683_100662782 | 159 |
| 631 | 3300026121 | Ga0207683_10814249 | Ga0207683_108142492 | 159 |
| 632 | 3300026142 | Ga0207698_10675002 | Ga0207698_106750022 | 159 |
| 633 | 3300026142 | Ga0207698_10941339 | Ga0207698_109413391 | 159 |
| 634 | 3300026142 | Ga0207698_11025973 | Ga0207698_110259731 | 159 |
| 635 | 3300026142 | Ga0207698_11875927 | Ga0207698_118759271 | 159 |
| 636 | 3300028379 | Ga0268266_10177715 | Ga0268266_101777153 | 159 |
| 637 | 3300028379 | Ga0268266_10441477 | Ga0268266_104414772 | 159 |
| 638 | 3300028380 | Ga0268265_10063188 | Ga0268265_100631883 | 159 |
| 639 | 3300028381 | Ga0268264_10002728 | Ga0268264_1000272814 | 159 |
| 640 | 3300028573 | Ga0265334_10144263 | Ga0265334_101442632 | 159 |
| 641 | 3300028666 | Ga0265336_10000006 | Ga0265336_10000006180 | 159 |
| 642 | 3300029957 | Ga0265324_10005524 | Ga0265324_100055245 | 159 |
| 643 | 3300031235 | Ga0265330_10014154 | Ga0265330_100141544 | 159 |
| 644 | 3300031235 | Ga0265330_10036812 | Ga0265330_100368124 | 159 |
| 645 | 3300031238 | Ga0265332_10020329 | Ga0265332_100203292 | 159 |
| 646 | 3300031239 | Ga0265328_10057981 | Ga0265328_100579812 | 159 |
| 647 | 3300031239 | Ga0265328_10093175 | Ga0265328_100931752 | 159 |
| 648 | 3300031241 | Ga0265325_10014378 | Ga0265325_100143782 | 159 |
| 649 | 3300031249 | Ga0265339_10090733 | Ga0265339_100907332 | 159 |
| 650 | 3300031344 | Ga0265316_10343810 | Ga0265316_103438102 | 159 |
| 651 | 3300031456 | Ga0307513_10104370 | Ga0307513_101043703 | 159 |
| 652 | 3300031712 | Ga0265342_10160601 | Ga0265342_101606012 | 159 |
| 653 | 3300031712 | Ga0265342_10243393 | Ga0265342_102433932 | 159 |
| 654 | 3300035086 | Ga0373934_0015252 | Ga0373934_0015252_780_1316 | 159 |
| 655 | 3300035089 | Ga0373944_0046640 | Ga0373944_0046640_22_504 | 159 |
| 656 | 3300035113 | Ga0373936_0302194 | Ga0373936_0302194_59_595 | 159 |
| 657 | 3300035117 | Ga0373953_0021843 | Ga0373953_0021843_1199_1735 | 159 |
| 658 | 3300035118 | Ga0373954_0064007 | Ga0373954_0064007_198_734 | 159 |
| 659 | 3300035118 | Ga0373954_0354612 | Ga0373954_0354612_164_694 | 159 |
| 660 | 3300035119 | Ga0373956_0139555 | Ga0373956_0139555_524_1060 | 159 |
| 661 | 3300035120 | Ga0373957_0027091 | Ga0373957_0027091_723_1259 | 159 |
| 662 | 3300035170 | Ga0373943_0286310 | Ga0373943_0286310_124_612 | 159 |
| 663 | 3300035172 | Ga0373955_0128365 | Ga0373955_0128365_379_915 | 159 |
| 664 | 3300035172 | Ga0373955_0234314 | Ga0373955_0234314_522_1031 | 159 |
| 665 | 3300035207 | Ga0373942_0044805 | Ga0373942_0044805_170_652 | 159 |
| 666 | 3300035410 | Ga0373924_0093407 | Ga0373924_0093407_19_555 | 159 |
| 667 | 3300035691 | Ga0373931_0006509 | Ga0373931_0006509_4257_4742 | 159 |
| 668 | 3300035692 | Ga0373935_0489627 | Ga0373935_0489627_59_595 | 159 |
| 669 | 3300035695 | Ga0373927_0072709 | Ga0373927_0072709_408_935 | 159 |
| 670 | 3300035724 | Ga0373933_0060893 | Ga0373933_0060893_289_825 | 159 |
| 671 | 3300035724 | Ga0373933_0080796 | Ga0373933_0080796_520_1002 | 159 |
| 672 | 3300036401 | Ga0373937_0014381 | Ga0373937_0014381_4596_5132 | 159 |
| 673 | 3300036401 | Ga0373937_0036056 | Ga0373937_0036056_3054_3536 | 159 |
| 674 | 3300037068 | Ga0373925_0637208 | Ga0373925_0637208_102_584 | 159 |
| 675 | 3300037068 | Ga0373925_1402071 | Ga0373925_1402071_50_559 | 159 |
| 676 | 3300037471 | Ga0395905_0004450 | Ga0395905_0004450_13924_14406 | 159 |
| 677 | 3300037471 | Ga0395905_1121043 | Ga0395905_1121043_100_591 | 159 |
| 678 | 3300039437 | Ga0436365_1773448 | Ga0436365_1773448_3651_4166 | 159 |
| 679 | 3300041509 | Ga0451843_0349938 | Ga0451843_0349938_54_533 | 159 |
| 680 | 3300045976 | Ga0466967_0066022 | Ga0466967_0066022_1729_2247 | 159 |
| 681 | 3300046454 | Ga0495592_0039033 | Ga0495592_0039033_2022_2558 | 159 |
| 682 | 3300046459 | Ga0495629_0030791 | Ga0495629_0030791_2009_2491 | 159 |
| 683 | 3300046459 | Ga0495629_0042353 | Ga0495629_0042353_950_1486 | 159 |
| 684 | 3300046462 | Ga0495651_0256178 | Ga0495651_0256178_577_1113 | 159 |
| 685 | 3300046463 | Ga0495653_0088251 | Ga0495653_0088251_25_561 | 159 |
| 686 | 3300046463 | Ga0495653_0437458 | Ga0495653_0437458_28_510 | 159 |
| 687 | 3300046492 | Ga0495585_0091519 | Ga0495585_0091519_143_628 | 159 |
| 688 | 3300046500 | Ga0495596_0064933 | Ga0495596_0064933_553_1035 | 159 |
| 689 | 3300046507 | Ga0495606_0108705 | Ga0495606_0108705_387_866 | 159 |
| 690 | 3300046511 | Ga0495608_0246984 | Ga0495608_0246984_382_918 | 159 |
| 691 | 3300046516 | Ga0495628_0252247 | Ga0495628_0252247_570_1052 | 159 |
| 692 | 3300046516 | Ga0495628_0420283 | Ga0495628_0420283_172_708 | 159 |
| 693 | 3300046517 | Ga0495630_0871841 | Ga0495630_0871841_63_599 | 159 |
| 694 | 3300046529 | Ga0495652_0022074 | Ga0495652_0022074_3389_3925 | 159 |
| 695 | 3300046533 | Ga0495640_0225433 | Ga0495640_0225433_157_693 | 159 |
| 696 | 3300046537 | Ga0495598_0019860 | Ga0495598_0019860_357_839 | 159 |
| 697 | 3300046539 | Ga0495621_0057524 | Ga0495621_0057524_40_522 | 159 |
| 698 | 3300046543 | Ga0495645_0106584 | Ga0495645_0106584_79_615 | 159 |
| 699 | 3300046559 | Ga0495667_0116418 | Ga0495667_0116418_1167_1703 | 159 |
| 700 | 3300046615 | Ga0495656_0224299 | Ga0495656_0224299_43_540 | 159 |
| 701 | 3300046616 | Ga0495668_0057333 | Ga0495668_0057333_449_934 | 159 |
| 702 | 3300046642 | Ga0495634_0048984 | Ga0495634_0048984_296_832 | 159 |
| 703 | 3300046675 | Ga0495657_0266238 | Ga0495657_0266238_324_860 | 159 |
| 704 | 3300046678 | Ga0495599_0026974 | Ga0495599_0026974_308_844 | 159 |
| 705 | 3300046679 | Ga0495623_0000341 | Ga0495623_0000341_24633_25169 | 159 |
| 706 | 3300046681 | Ga0495647_0113192 | Ga0495647_0113192_45_527 | 159 |
| 707 | 3300046681 | Ga0495647_0454440 | Ga0495647_0454440_68_577 | 159 |
| 708 | 3300046689 | Ga0495613_0449294 | Ga0495613_0449294_31_567 | 159 |
| 709 | 3300046809 | Ga0495600_0004899 | Ga0495600_0004899_6054_6590 | 159 |
| 710 | 3300047317 | Ga0495604_0817886 | Ga0495604_0817886_81_563 | 159 |
| 711 | 3300047322 | Ga0495680_0070998 | Ga0495680_0070998_1167_1703 | 159 |
| 712 | 3300047322 | Ga0495680_0134503 | Ga0495680_0134503_1231_1713 | 159 |
| 713 | 3300047471 | Ga0495684_0006898 | Ga0495684_0006898_6804_7340 | 159 |
| 714 | 3300047673 | Ga0495593_0049844 | Ga0495593_0049844_1512_2048 | 159 |
| 715 | 3300047673 | Ga0495593_0388925 | Ga0495593_0388925_40_576 | 159 |
| 716 | 3300048088 | Ga0495602_0093108 | Ga0495602_0093108_1580_2116 | 159 |
| 717 | 3300048903 | Ga0496100_0001742 | Ga0496100_0001742_9398_9934 | 159 |
| 718 | 3300048903 | Ga0496100_0310792 | Ga0496100_0310792_121_600 | 159 |
| 719 | 3300048903 | Ga0496100_0550174 | Ga0496100_0550174_230_751 | 159 |
| 720 | 3300048904 | Ga0496101_0017477 | Ga0496101_0017477_3739_4275 | 159 |
| 721 | 3300048905 | Ga0496102_0015979 | Ga0496102_0015979_5626_6162 | 159 |
| 722 | 3300048906 | Ga0496103_0099130 | Ga0496103_0099130_666_1202 | 159 |
| 723 | 3300048907 | Ga0496104_0040323 | Ga0496104_0040323_810_1346 | 159 |
| 724 | 3300048908 | Ga0496105_0068158 | Ga0496105_0068158_899_1435 | 159 |
| 725 | 3300048908 | Ga0496105_0101187 | Ga0496105_0101187_170_652 | 159 |
| 726 | 3300048909 | Ga0496106_0000560 | Ga0496106_0000560_11474_11995 | 159 |
| 727 | 3300048909 | Ga0496106_0037455 | Ga0496106_0037455_513_992 | 159 |
| 728 | 3300048911 | Ga0496108_0734787 | Ga0496108_0734787_306_842 | 159 |
| 729 | 3300048911 | Ga0496108_0749983 | Ga0496108_0749983_315_797 | 159 |
| 730 | 3300048912 | Ga0496109_1276508 | Ga0496109_1276508_42_524 | 159 |
| 731 | 3300048913 | Ga0496110_0041098 | Ga0496110_0041098_2943_3479 | 159 |
| 732 | 3300048914 | Ga0496111_0028911 | Ga0496111_0028911_122_658 | 159 |
| 733 | 3300048915 | Ga0496112_0489775 | Ga0496112_0489775_246_782 | 159 |
| 734 | 3300048916 | Ga0496113_0236481 | Ga0496113_0236481_189_725 | 159 |
| 735 | 3300048917 | Ga0496114_0008471 | Ga0496114_0008471_293_829 | 159 |
| 736 | 3300048917 | Ga0496114_0055488 | Ga0496114_0055488_162_644 | 159 |
| 737 | 3300048918 | Ga0496115_0002892 | Ga0496115_0002892_9893_10429 | 159 |
| 738 | 3300048920 | Ga0496117_0017580 | Ga0496117_0017580_1407_1928 | 159 |
| 739 | 3300048921 | Ga0496118_0035996 | Ga0496118_0035996_3403_3924 | 159 |
| 740 | 3300048924 | Ga0496121_0000099 | Ga0496121_0000099_161339_161860 | 159 |
| 741 | 3300048924 | Ga0496121_0255839 | Ga0496121_0255839_386_865 | 159 |
| 742 | 3300048928 | Ga0496125_0053711 | Ga0496125_0053711_681_1202 | 159 |
| 743 | 3300048929 | Ga0496126_0029319 | Ga0496126_0029319_4396_4917 | 159 |
| 744 | 3300049578 | Ga0501042_0188245 | Ga0501042_0188245_754_1242 | 159 |
| 745 | 3300049579 | Ga0501043_0000072 | Ga0501043_0000072_79385_79873 | 159 |
| 746 | 3300049580 | Ga0501046_0000112 | Ga0501046_0000112_76736_77224 | 159 |
| 747 | 3300049581 | Ga0501047_0000138 | Ga0501047_0000138_9149_9637 | 159 |
| 748 | 3300049582 | Ga0501048_0001221 | Ga0501048_0001221_16837_17325 | 159 |
| 749 | 3300049824 | Ga0501045_0001874 | Ga0501045_0001874_4862_5350 | 159 |
| 750 | 3300050496 | nmdc:mga07m45_6941_c1 | nmdc:mga07m45_6941_c1_533_1012 | 159 |
| 751 | 3300053077 | Ga0495601_0124329 | Ga0495601_0124329_118_636 | 159 |
| 752 | 3300053084 | Ga0495595_0001806 | Ga0495595_0001806_577_1113 | 159 |
| 753 | 3300053084 | Ga0495595_0075033 | Ga0495595_0075033_710_1240 | 159 |
| 754 | 3300053084 | Ga0495595_0139953 | Ga0495595_0139953_582_1064 | 159 |
| 755 | 3300053085 | Ga0495619_0059753 | Ga0495619_0059753_1953_2483 | 159 |
| 756 | 3300053085 | Ga0495619_0154852 | Ga0495619_0154852_212_694 | 159 |
| 757 | 3300053086 | Ga0500578_0094750 | Ga0500578_0094750_809_1288 | 159 |
| 758 | 3300053148 | Ga0500590_017800 | Ga0500590_017800_304_786 | 159 |
| 759 | 3300053730 | Ga0500645_021713 | Ga0500645_021713_1032_1511 | 159 |
| 760 | iso_pu_bacteria | 2791355199 | 2793080150 | 159 |
| 761 | 3300002705 | JGI25156J39149_1009487 | JGI25156J39149_10094872 | 160 |
| 762 | 3300003761 | Ga0055535_1010849 | Ga0055535_10108492 | 160 |
| 763 | 3300005327 | Ga0070658_10098608 | Ga0070658_100986082 | 160 |
| 764 | 3300005334 | Ga0068869_100240696 | Ga0068869_1002406962 | 160 |
| 765 | 3300005338 | Ga0068868_100889774 | Ga0068868_1008897742 | 160 |
| 766 | 3300005339 | Ga0070660_100257459 | Ga0070660_1002574592 | 160 |
| 767 | 3300005339 | Ga0070660_100611554 | Ga0070660_1006115542 | 160 |
| 768 | 3300005353 | Ga0070669_100877340 | Ga0070669_1008773402 | 160 |
| 769 | 3300005356 | Ga0070674_100836145 | Ga0070674_1008361451 | 160 |
| 770 | 3300005366 | Ga0070659_100104449 | Ga0070659_1001044492 | 160 |
| 771 | 3300005366 | Ga0070659_100190091 | Ga0070659_1001900911 | 160 |
| 772 | 3300005366 | Ga0070659_100645141 | Ga0070659_1006451412 | 160 |
| 773 | 3300005435 | Ga0070714_100208211 | Ga0070714_1002082111 | 160 |
| 774 | 3300005459 | Ga0068867_100133182 | Ga0068867_1001331821 | 160 |
| 775 | 3300005539 | Ga0068853_100051167 | Ga0068853_1000511675 | 160 |
| 776 | 3300005543 | Ga0070672_100044460 | Ga0070672_1000444603 | 160 |
| 777 | 3300005563 | Ga0068855_100160366 | Ga0068855_1001603662 | 160 |
| 778 | 3300005563 | Ga0068855_100580577 | Ga0068855_1005805772 | 160 |
| 779 | 3300005719 | Ga0068861_100072447 | Ga0068861_1000724473 | 160 |
| 780 | 3300005844 | Ga0068862_100154048 | Ga0068862_1001540481 | 160 |
| 781 | 3300006028 | Ga0070717_10028434 | Ga0070717_100284343 | 160 |
| 782 | 3300006195 | Ga0075366_10008494 | Ga0075366_100084941 | 160 |
| 783 | 3300006353 | Ga0075370_10006736 | Ga0075370_100067361 | 160 |
| 784 | 3300009148 | Ga0105243_10230023 | Ga0105243_102300233 | 160 |
| 785 | 3300009148 | Ga0105243_10248324 | Ga0105243_102483242 | 160 |
| 786 | 3300009176 | Ga0105242_11380649 | Ga0105242_113806492 | 160 |
| 787 | 3300009545 | Ga0105237_10633881 | Ga0105237_106338811 | 160 |
| 788 | 3300009553 | Ga0105249_10088620 | Ga0105249_100886204 | 160 |
| 789 | 3300014326 | Ga0157380_10439715 | Ga0157380_104397151 | 160 |
| 790 | 3300015262 | Ga0182007_10028336 | Ga0182007_100283363 | 160 |
| 791 | 3300017792 | Ga0163161_10312557 | Ga0163161_103125572 | 160 |
| 792 | 3300024227 | Ga0228598_1079813 | Ga0228598_10798132 | 160 |
| 793 | 3300025242 | Ga0209258_100700 | Ga0209258_10070016 | 160 |
| 794 | 3300025250 | Ga0209026_1029234 | Ga0209026_10292342 | 160 |
| 795 | 3300025256 | Ga0209759_1001086 | Ga0209759_100108612 | 160 |
| 796 | 3300025256 | Ga0209759_1007199 | Ga0209759_10071993 | 160 |
| 797 | 3300025256 | Ga0209759_1020122 | Ga0209759_10201222 | 160 |
| 798 | 3300025914 | Ga0207671_10173436 | Ga0207671_101734362 | 160 |
| 799 | 3300025915 | Ga0207693_10210518 | Ga0207693_102105182 | 160 |
| 800 | 3300025919 | Ga0207657_10077341 | Ga0207657_100773412 | 160 |
| 801 | 3300025919 | Ga0207657_10175173 | Ga0207657_101751732 | 160 |
| 802 | 3300025923 | Ga0207681_10124516 | Ga0207681_101245163 | 160 |
| 803 | 3300025929 | Ga0207664_10719386 | Ga0207664_107193861 | 160 |
| 804 | 3300025932 | Ga0207690_10154689 | Ga0207690_101546892 | 160 |
| 805 | 3300025932 | Ga0207690_10212660 | Ga0207690_102126602 | 160 |
| 806 | 3300025935 | Ga0207709_10063345 | Ga0207709_100633452 | 160 |
| 807 | 3300025937 | Ga0207669_10083324 | Ga0207669_100833243 | 160 |
| 808 | 3300025940 | Ga0207691_10028023 | Ga0207691_100280234 | 160 |
| 809 | 3300025942 | Ga0207689_10045901 | Ga0207689_100459012 | 160 |
| 810 | 3300025949 | Ga0207667_10012561 | Ga0207667_100125615 | 160 |
| 811 | 3300025960 | Ga0207651_11690149 | Ga0207651_116901491 | 160 |
| 812 | 3300025972 | Ga0207668_10036498 | Ga0207668_100364982 | 160 |
| 813 | 3300026075 | Ga0207708_10021407 | Ga0207708_100214074 | 160 |
| 814 | 3300026118 | Ga0207675_100027403 | Ga0207675_1000274036 | 160 |
| 815 | 3300030521 | Ga0307511_10207407 | Ga0307511_102074072 | 160 |
| 816 | 3300031250 | Ga0265331_10167807 | Ga0265331_101678071 | 160 |
| 817 | 3300031344 | Ga0265316_10633125 | Ga0265316_106331251 | 160 |
| 818 | 3300031548 | Ga0307408_100437667 | Ga0307408_1004376672 | 160 |
| 819 | 3300031730 | Ga0307516_10000360 | Ga0307516_100003603 | 160 |
| 820 | 3300031730 | Ga0307516_10001515 | Ga0307516_1000151511 | 160 |
| 821 | 3300031730 | Ga0307516_10242632 | Ga0307516_102426322 | 160 |
| 822 | 3300031852 | Ga0307410_10416064 | Ga0307410_104160642 | 160 |
| 823 | 3300031852 | Ga0307410_10630510 | Ga0307410_106305101 | 160 |
| 824 | 3300031995 | Ga0307409_100727726 | Ga0307409_1007277262 | 160 |
| 825 | 3300035086 | Ga0373934_0017850 | Ga0373934_0017850_691_1197 | 160 |
| 826 | 3300035724 | Ga0373933_0000272 | Ga0373933_0000272_32917_33426 | 160 |
| 827 | 3300037312 | Ga0395899_0237362 | Ga0395899_0237362_508_990 | 160 |
| 828 | 3300037471 | Ga0395905_0481794 | Ga0395905_0481794_178_663 | 160 |
| 829 | 3300038443 | Ga0395901_0002847 | Ga0395901_0002847_6208_6690 | 160 |
| 830 | 3300041456 | Ga0451795_0486996 | Ga0451795_0486996_100_627 | 160 |
| 831 | 3300042439 | Ga0439464_0002912 | Ga0439464_0002912_203_691 | 160 |
| 832 | 3300044656 | Ga0466969_0058948 | Ga0466969_0058948_137_619 | 160 |
| 833 | 3300044683 | Ga0466965_0064290 | Ga0466965_0064290_1143_1649 | 160 |
| 834 | 3300044684 | Ga0466966_0011578 | Ga0466966_0011578_5252_5758 | 160 |
| 835 | 3300044684 | Ga0466966_0027088 | Ga0466966_0027088_1963_2445 | 160 |
| 836 | 3300044693 | Ga0466961_0010761 | Ga0466961_0010761_5026_5532 | 160 |
| 837 | 3300044693 | Ga0466961_0157290 | Ga0466961_0157290_873_1355 | 160 |
| 838 | 3300044694 | Ga0466963_0513052 | Ga0466963_0513052_125_631 | 160 |
| 839 | 3300044706 | Ga0466964_0007682 | Ga0466964_0007682_2392_2898 | 160 |
| 840 | 3300044706 | Ga0466964_0279146 | Ga0466964_0279146_160_642 | 160 |
| 841 | 3300044719 | Ga0466971_0008613 | Ga0466971_0008613_197_679 | 160 |
| 842 | 3300044719 | Ga0466971_0028527 | Ga0466971_0028527_1123_1629 | 160 |
| 843 | 3300044735 | Ga0466968_0039786 | Ga0466968_0039786_176_682 | 160 |
| 844 | 3300044765 | Ga0466970_0058122 | Ga0466970_0058122_1294_1800 | 160 |
| 845 | 3300044842 | Ga0466957_0020706 | Ga0466957_0020706_1178_1660 | 160 |
| 846 | 3300044842 | Ga0466957_0067419 | Ga0466957_0067419_486_968 | 160 |
| 847 | 3300044842 | Ga0466957_0127429 | Ga0466957_0127429_1023_1529 | 160 |
| 848 | 3300045976 | Ga0466967_0776087 | Ga0466967_0776087_305_811 | 160 |
| 849 | 3300046475 | Ga0495639_0021367 | Ga0495639_0021367_1680_2174 | 160 |
| 850 | 3300046506 | Ga0495583_0000717 | Ga0495583_0000717_25168_25662 | 160 |
| 851 | 3300046507 | Ga0495606_0001828 | Ga0495606_0001828_14562_15056 | 160 |
| 852 | 3300046524 | Ga0495648_0241600 | Ga0495648_0241600_129_623 | 160 |
| 853 | 3300046537 | Ga0495598_0055549 | Ga0495598_0055549_123_611 | 160 |
| 854 | 3300046660 | Ga0495625_0004769 | Ga0495625_0004769_1128_1622 | 160 |
| 855 | 3300046694 | Ga0495649_0000314 | Ga0495649_0000314_16819_17313 | 160 |
| 856 | 3300046794 | Ga0495589_0017299 | Ga0495589_0017299_2062_2556 | 160 |
| 857 | 3300047318 | Ga0495636_0448666 | Ga0495636_0448666_110_598 | 160 |
| 858 | 3300047472 | Ga0495686_0009986 | Ga0495686_0009986_5503_5997 | 160 |
| 859 | 3300048903 | Ga0496100_0762313 | Ga0496100_0762313_98_595 | 160 |
| 860 | 3300048905 | Ga0496102_0856937 | Ga0496102_0856937_164_661 | 160 |
| 861 | 3300048907 | Ga0496104_1259910 | Ga0496104_1259910_13_498 | 160 |
| 862 | 3300048918 | Ga0496115_0239650 | Ga0496115_0239650_464_955 | 160 |
| 863 | 3300048927 | Ga0496124_0000788 | Ga0496124_0000788_37399_37920 | 160 |
| 864 | 3300050492 | nmdc:mga0yw44_33386_c1 | nmdc:mga0yw44_33386_c1_2012_2647 | 160 |
| 865 | 3300050494 | nmdc:mga06z11_575132_c1 | nmdc:mga06z11_575132_c1_20_502 | 160 |
| 866 | 3300050496 | nmdc:mga07m45_5517_c1 | nmdc:mga07m45_5517_c1_5476_5958 | 160 |
| 867 | 3300053122 | Ga0500608_022018 | Ga0500608_022018_1230_1724 | 160 |
| 868 | 3300053139 | Ga0500568_0059007 | Ga0500568_0059007_277_777 | 160 |
| 869 | 3300053177 | Ga0500636_0136038 | Ga0500636_0136038_164_658 | 160 |
| 870 | 3300061719 | Ga0466962_0025069 | Ga0466962_0025069_1396_1902 | 160 |
| 871 | 3300002126 | JGI24035J26624_1010479 | JGI24035J26624_10104791 | 161 |
| 872 | 3300005290 | Ga0065712_10200379 | Ga0065712_102003791 | 161 |
| 873 | 3300005293 | Ga0065715_10111173 | Ga0065715_101111732 | 161 |
| 874 | 3300005328 | Ga0070676_10037404 | Ga0070676_100374042 | 161 |
| 875 | 3300005331 | Ga0070670_100019051 | Ga0070670_1000190511 | 161 |
| 876 | 3300005333 | Ga0070677_10007631 | Ga0070677_100076312 | 161 |
| 877 | 3300005334 | Ga0068869_100050299 | Ga0068869_1000502993 | 161 |
| 878 | 3300005353 | Ga0070669_100017046 | Ga0070669_1000170464 | 161 |
| 879 | 3300005354 | Ga0070675_100005042 | Ga0070675_1000050421 | 161 |
| 880 | 3300005354 | Ga0070675_100194931 | Ga0070675_1001949312 | 161 |
| 881 | 3300005355 | Ga0070671_100011841 | Ga0070671_1000118411 | 161 |
| 882 | 3300005356 | Ga0070674_100023639 | Ga0070674_1000236391 | 161 |
| 883 | 3300005356 | Ga0070674_100092494 | Ga0070674_1000924941 | 161 |
| 884 | 3300005364 | Ga0070673_100029265 | Ga0070673_1000292652 | 161 |
| 885 | 3300005367 | Ga0070667_100046171 | Ga0070667_1000461713 | 161 |
| 886 | 3300005441 | Ga0070700_100230905 | Ga0070700_1002309052 | 161 |
| 887 | 3300005445 | Ga0070708_100542613 | Ga0070708_1005426131 | 161 |
| 888 | 3300005455 | Ga0070663_100094830 | Ga0070663_1000948302 | 161 |
| 889 | 3300005456 | Ga0070678_100024510 | Ga0070678_1000245101 | 161 |
| 890 | 3300005456 | Ga0070678_100058487 | Ga0070678_1000584871 | 161 |
| 891 | 3300005456 | Ga0070678_100626886 | Ga0070678_1006268862 | 161 |
| 892 | 3300005459 | Ga0068867_100102645 | Ga0068867_1001026451 | 161 |
| 893 | 3300005467 | Ga0070706_100001589 | Ga0070706_10000158911 | 161 |
| 894 | 3300005468 | Ga0070707_100032827 | Ga0070707_1000328275 | 161 |
| 895 | 3300005539 | Ga0068853_100171601 | Ga0068853_1001716013 | 161 |
| 896 | 3300005539 | Ga0068853_100353396 | Ga0068853_1003533962 | 161 |
| 897 | 3300005543 | Ga0070672_100000138 | Ga0070672_10000013833 | 161 |
| 898 | 3300005577 | Ga0068857_100117657 | Ga0068857_1001176572 | 161 |
| 899 | 3300005578 | Ga0068854_100301987 | Ga0068854_1003019872 | 161 |
| 900 | 3300005617 | Ga0068859_101335082 | Ga0068859_1013350821 | 161 |
| 901 | 3300005834 | Ga0068851_10391892 | Ga0068851_103918922 | 161 |
| 902 | 3300006042 | Ga0075368_10077518 | Ga0075368_100775182 | 161 |
| 903 | 3300006042 | Ga0075368_10212506 | Ga0075368_102125062 | 161 |
| 904 | 3300006048 | Ga0075363_100010223 | Ga0075363_1000102231 | 161 |
| 905 | 3300006051 | Ga0075364_10048232 | Ga0075364_100482324 | 161 |
| 906 | 3300006051 | Ga0075364_10398089 | Ga0075364_103980891 | 161 |
| 907 | 3300006177 | Ga0075362_10021552 | Ga0075362_100215524 | 161 |
| 908 | 3300006177 | Ga0075362_10069344 | Ga0075362_100693443 | 161 |
| 909 | 3300006177 | Ga0075362_10212690 | Ga0075362_102126901 | 161 |
| 910 | 3300006178 | Ga0075367_10042370 | Ga0075367_100423701 | 161 |
| 911 | 3300006178 | Ga0075367_10139526 | Ga0075367_101395263 | 161 |
| 912 | 3300006186 | Ga0075369_10031758 | Ga0075369_100317581 | 161 |
| 913 | 3300006195 | Ga0075366_10040468 | Ga0075366_100404685 | 161 |
| 914 | 3300006195 | Ga0075366_10085820 | Ga0075366_100858201 | 161 |
| 915 | 3300006195 | Ga0075366_10161106 | Ga0075366_101611062 | 161 |
| 916 | 3300006353 | Ga0075370_10006621 | Ga0075370_100066212 | 161 |
| 917 | 3300006353 | Ga0075370_10018502 | Ga0075370_100185023 | 161 |
| 918 | 3300006931 | Ga0097620_101335072 | Ga0097620_1013350721 | 161 |
| 919 | 3300009148 | Ga0105243_10322215 | Ga0105243_103222151 | 161 |
| 920 | 3300009176 | Ga0105242_10127617 | Ga0105242_101276171 | 161 |
| 921 | 3300009545 | Ga0105237_10062076 | Ga0105237_100620765 | 161 |
| 922 | 3300009551 | Ga0105238_10300930 | Ga0105238_103009303 | 161 |
| 923 | 3300010375 | Ga0105239_10138849 | Ga0105239_101388493 | 161 |
| 924 | 3300012494 | Ga0157341_1013590 | Ga0157341_10135901 | 161 |
| 925 | 3300013306 | Ga0163162_10173972 | Ga0163162_101739723 | 161 |
| 926 | 3300014969 | Ga0157376_10071755 | Ga0157376_100717555 | 161 |
| 927 | 3300014969 | Ga0157376_10309586 | Ga0157376_103095861 | 161 |
| 928 | 3300025304 | Ga0209257_1020862 | Ga0209257_10208624 | 161 |
| 929 | 3300025315 | Ga0207697_10011255 | Ga0207697_100112552 | 161 |
| 930 | 3300025321 | Ga0207656_10056547 | Ga0207656_100565473 | 161 |
| 931 | 3300025893 | Ga0207682_10002713 | Ga0207682_100027131 | 161 |
| 932 | 3300025908 | Ga0207643_10073334 | Ga0207643_100733342 | 161 |
| 933 | 3300025910 | Ga0207684_10006317 | Ga0207684_100063179 | 161 |
| 934 | 3300025914 | Ga0207671_10278855 | Ga0207671_102788553 | 161 |
| 935 | 3300025922 | Ga0207646_10052114 | Ga0207646_100521142 | 161 |
| 936 | 3300025923 | Ga0207681_10291164 | Ga0207681_102911642 | 161 |
| 937 | 3300025924 | Ga0207694_10674823 | Ga0207694_106748232 | 161 |
| 938 | 3300025925 | Ga0207650_10000408 | Ga0207650_1000040830 | 161 |
| 939 | 3300025926 | Ga0207659_10000775 | Ga0207659_1000077512 | 161 |
| 940 | 3300025931 | Ga0207644_10011177 | Ga0207644_100111777 | 161 |
| 941 | 3300025934 | Ga0207686_11531673 | Ga0207686_115316731 | 161 |
| 942 | 3300025937 | Ga0207669_10060349 | Ga0207669_100603491 | 161 |
| 943 | 3300025937 | Ga0207669_10454684 | Ga0207669_104546842 | 161 |
| 944 | 3300025940 | Ga0207691_10000360 | Ga0207691_100003607 | 161 |
| 945 | 3300025942 | Ga0207689_10414685 | Ga0207689_104146852 | 161 |
| 946 | 3300025960 | Ga0207651_10007721 | Ga0207651_100077216 | 161 |
| 947 | 3300025981 | Ga0207640_10355629 | Ga0207640_103556292 | 161 |
| 948 | 3300025986 | Ga0207658_10013819 | Ga0207658_100138194 | 161 |
| 949 | 3300026023 | Ga0207677_10040938 | Ga0207677_100409384 | 161 |
| 950 | 3300026023 | Ga0207677_10125339 | Ga0207677_101253392 | 161 |
| 951 | 3300026041 | Ga0207639_10648705 | Ga0207639_106487051 | 161 |
| 952 | 3300026067 | Ga0207678_10067677 | Ga0207678_100676772 | 161 |
| 953 | 3300026089 | Ga0207648_10077377 | Ga0207648_100773771 | 161 |
| 954 | 3300026095 | Ga0207676_10795142 | Ga0207676_107951421 | 161 |
| 955 | 3300026121 | Ga0207683_10006928 | Ga0207683_100069281 | 161 |
| 956 | 3300026121 | Ga0207683_10201427 | Ga0207683_102014271 | 161 |
| 957 | 3300027866 | Ga0209813_10071989 | Ga0209813_100719892 | 161 |
| 958 | 3300028786 | Ga0307517_10090491 | Ga0307517_100904913 | 161 |
| 959 | 3300029957 | Ga0265324_10024172 | Ga0265324_100241722 | 161 |
| 960 | 3300031456 | Ga0307513_10346743 | Ga0307513_103467432 | 161 |
| 961 | 3300031548 | Ga0307408_100073952 | Ga0307408_1000739521 | 161 |
| 962 | 3300031548 | Ga0307408_100484356 | Ga0307408_1004843561 | 161 |
| 963 | 3300031616 | Ga0307508_10236935 | Ga0307508_102369352 | 161 |
| 964 | 3300031731 | Ga0307405_10244883 | Ga0307405_102448832 | 161 |
| 965 | 3300031824 | Ga0307413_10116625 | Ga0307413_101166252 | 161 |
| 966 | 3300031852 | Ga0307410_10010373 | Ga0307410_100103734 | 161 |
| 967 | 3300031901 | Ga0307406_10007409 | Ga0307406_100074097 | 161 |
| 968 | 3300031903 | Ga0307407_10021342 | Ga0307407_100213425 | 161 |
| 969 | 3300031911 | Ga0307412_10017797 | Ga0307412_100177972 | 161 |
| 970 | 3300031911 | Ga0307412_10724317 | Ga0307412_107243171 | 161 |
| 971 | 3300031995 | Ga0307409_100096445 | Ga0307409_1000964454 | 161 |
| 972 | 3300031995 | Ga0307409_100422996 | Ga0307409_1004229962 | 161 |
| 973 | 3300032002 | Ga0307416_100289203 | Ga0307416_1002892032 | 161 |
| 974 | 3300032004 | Ga0307414_10187493 | Ga0307414_101874933 | 161 |
| 975 | 3300032005 | Ga0307411_10046117 | Ga0307411_100461174 | 161 |
| 976 | 3300032126 | Ga0307415_100420861 | Ga0307415_1004208612 | 161 |
| 977 | 3300032126 | Ga0307415_100939739 | Ga0307415_1009397391 | 161 |
| 978 | 3300041458 | Ga0451798_0388718 | Ga0451798_0388718_107_595 | 161 |
| 979 | 3300044683 | Ga0466965_0052459 | Ga0466965_0052459_1495_1986 | 161 |
| 980 | 3300046457 | Ga0495590_0053145 | Ga0495590_0053145_516_1001 | 161 |
| 981 | 3300046471 | Ga0495650_0211714 | Ga0495650_0211714_20_616 | 161 |
| 982 | 3300046507 | Ga0495606_0598471 | Ga0495606_0598471_46_531 | 161 |
| 983 | 3300046518 | Ga0495631_0100935 | Ga0495631_0100935_605_1090 | 161 |
| 984 | 3300046519 | Ga0495632_0002264 | Ga0495632_0002264_6413_6898 | 161 |
| 985 | 3300046542 | Ga0495597_0010500 | Ga0495597_0010500_2534_3019 | 161 |
| 986 | 3300046616 | Ga0495668_0170657 | Ga0495668_0170657_296_781 | 161 |
| 987 | 3300046648 | Ga0495611_0176079 | Ga0495611_0176079_248_733 | 161 |
| 988 | 3300046660 | Ga0495625_0032244 | Ga0495625_0032244_1038_1523 | 161 |
| 989 | 3300046694 | Ga0495649_0003800 | Ga0495649_0003800_6390_6875 | 161 |
| 990 | 3300046810 | Ga0495660_0237968 | Ga0495660_0237968_300_785 | 161 |
| 991 | 3300047443 | Ga0495687_000500 | Ga0495687_000500_4708_5193 | 161 |
| 992 | 3300047443 | Ga0495687_081066 | Ga0495687_081066_136_621 | 161 |
| 993 | 3300047443 | Ga0495687_081148 | Ga0495687_081148_136_621 | 161 |
| 994 | 3300048091 | Ga0495626_0060994 | Ga0495626_0060994_707_1198 | 161 |
| 995 | 3300048904 | Ga0496101_0854767 | Ga0496101_0854767_44_544 | 161 |
| 996 | 3300048907 | Ga0496104_0742583 | Ga0496104_0742583_40_540 | 161 |
| 997 | 3300048915 | Ga0496112_0651940 | Ga0496112_0651940_438_938 | 161 |
| 998 | 3300050489 | nmdc:mga03683_126189_c1 | nmdc:mga03683_126189_c1_473_958 | 161 |
| 999 | 3300050489 | nmdc:mga03683_351134_c1 | nmdc:mga03683_351134_c1_63_548 | 161 |
| 1000 | 3300050489 | nmdc:mga03683_59909_c1 | nmdc:mga03683_59909_c1_251_736 | 161 |
| 1001 | 3300050490 | nmdc:mga03n38_69771_c1 | nmdc:mga03n38_69771_c1_885_1370 | 161 |
| 1002 | 3300050491 | nmdc:mga00v17_117322_c1 | nmdc:mga00v17_117322_c1_251_736 | 161 |
| 1003 | 3300050492 | nmdc:mga0yw44_289056_c1 | nmdc:mga0yw44_289056_c1_352_837 | 161 |
| 1004 | 3300050493 | nmdc:mga0k408_110896_c1 | nmdc:mga0k408_110896_c1_198_683 | 161 |
| 1005 | 3300050493 | nmdc:mga0k408_14148_c1 | nmdc:mga0k408_14148_c1_779_1264 | 161 |
| 1006 | 3300050493 | nmdc:mga0k408_156211_c1 | nmdc:mga0k408_156211_c1_199_684 | 161 |
| 1007 | 3300050493 | nmdc:mga0k408_373534_c1 | nmdc:mga0k408_373534_c1_323_817 | 161 |
| 1008 | 3300050493 | nmdc:mga0k408_52971_c1 | nmdc:mga0k408_52971_c1_1673_2158 | 161 |
| 1009 | 3300050493 | nmdc:mga0k408_593108_c1 | nmdc:mga0k408_593108_c1_81_566 | 161 |
| 1010 | 3300050494 | nmdc:mga06z11_111437_c1 | nmdc:mga06z11_111437_c1_872_1357 | 161 |
| 1011 | 3300050494 | nmdc:mga06z11_111603_c1 | nmdc:mga06z11_111603_c1_419_913 | 161 |
| 1012 | 3300050494 | nmdc:mga06z11_51205_c1 | nmdc:mga06z11_51205_c1_1375_1860 | 161 |
| 1013 | 3300050495 | nmdc:mga04h51_114287_c1 | nmdc:mga04h51_114287_c1_251_736 | 161 |
| 1014 | 3300050495 | nmdc:mga04h51_47957_c1 | nmdc:mga04h51_47957_c1_770_1255 | 161 |
| 1015 | 3300050496 | nmdc:mga07m45_13868_c1 | nmdc:mga07m45_13868_c1_173_658 | 161 |
| 1016 | 3300050496 | nmdc:mga07m45_2631_c1 | nmdc:mga07m45_2631_c1_7913_8398 | 161 |
| 1017 | 3300050496 | nmdc:mga07m45_53421_c1 | nmdc:mga07m45_53421_c1_195_680 | 161 |
| 1018 | 3300050496 | nmdc:mga07m45_7349_c1 | nmdc:mga07m45_7349_c1_1409_1903 | 161 |
| 1019 | 3300053092 | Ga0500583_0546241 | Ga0500583_0546241_26_511 | 161 |
| 1020 | 3300053139 | Ga0500568_0018322 | Ga0500568_0018322_1421_1906 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q29-assembly1.cif.gz_B | ensemble refinement of plu4264 protein from photorhabdus luminescens | 0.9054 | 50 | 132 |
| 6o2d-assembly1.cif.gz_A | schizosaccharomyces pombe cnp3 cupin domain | 0.8937 | 51 | 130 |
| 2phd-assembly1.cif.gz_C | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.8781 | 52 | 133 |
| 8hjz-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a/h58q mutant) in copper (cu) substituted form | 0.8778 | 50 | 130 |
| 8hjx-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a/h58e mutant) in copper (cu) substituted form | 0.876 | 50 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8921 | 51 | 130 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8902 | 51 | 130 | 2.60.120.10 |
| af_Q5A3Z5_62_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8798 | 52 | 130 | 2.60.120.10 |
| af_P76555_101_233_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8755 | 51 | 130 | 2.60.120.10 |
| 2gu9B01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8715 | 51 | 130 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9BXB3-F1-model_v4 | Cupin | 0.903 | 52 | 134 |
|
| AF-A0A388RQ61-F1-model_v4 | deleted | 0.8973 | 54 | 132 |
|
| AF-A0A841M4E9-F1-model_v4 | Quercetin dioxygenase-like cupin family protein | 0.8943 | 53 | 134 |
GO:0051213
|
| AF-A0A538NES1-F1-model_v4 | Cupin domain-containing protein | 0.8937 | 54 | 134 |
|
| AF-A0A523FIC8-F1-model_v4 | Cupin domain-containing protein | 0.8909 | 52 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar