F488365
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 412 | 2040 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100454150|Ga0068855_1004541502 |
| Length | 342 |
| Sequence | LISPVETWARKLRVFGIGAIFPIVTLASSTGFCDLGQMPATLQDKLRSKRFVITAEVTPPVSADRGELLAKALPLKGLADAVNITDAAGARPHLGAVTSAAILVEQGIESILQLTCRDRNRIALQSDLLSAAASGVRNLLMLRGDDPSAGDQPDAKPVFDLDPRSLLDTARRLRDTGELPTGRKVGGNFDFFLGSADNPIDPPPGWKPTGLQAKIDAGAQFVQTQFCMDAGVVHRYMARLAEQGLTARLSFLIGVVPLRSAKSARWIKEKLFGSIIPDALIDRMEQANDPVAEGARICADIIRELSGVAGVAGVHIMAPGNDAAVPGLIKAARAGIGRLAPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 272 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 273 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 274 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 275 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 276 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 277 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 278 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.65 |
| Nodule | 0 |
| Rhizoplane | 6.37 |
| Rhizosphere | 90.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100454150 | 3300005563 | Bacteria | 1398 |
| 2 | 2214884084 | 2209111006 | Bacteria | 7706 |
| 3 | ARcpr5oldR_c000026 | 3300000041 | Bacteria | 30226 |
| 4 | ARSoilYngRDRAFT_c00029 | 3300000042 | Bacteria | 22121 |
| 5 | ARcpr5yngRDRAFT_c000044 | 3300000043 | Bacteria | 19945 |
| 6 | ARSoilOldRDRAFT_c000037 | 3300000044 | Bacteria | 30277 |
| 7 | ARCol0oldRDRAFT_c00240 | 3300000045 | Bacteria | 5125 |
| 8 | ARCol0yngRDRAFT_1000020 | 3300000652 | Bacteria | 30273 |
| 9 | JGI24746J21847_1001748 | 3300001977 | Bacteria | 3487 |
| 10 | JGI24739J22299_10003786 | 3300001989 | Bacteria | 5773 |
| 11 | JGI24737J22298_10005485 | 3300001990 | Bacteria | 4379 |
| 12 | JGI24750J21931_1000198 | 3300002070 | Bacteria | 10173 |
| 13 | JGI24738J21930_10000052 | 3300002075 | Bacteria | 23911 |
| 14 | JGI24749J21850_1000597 | 3300002076 | Bacteria | 5248 |
| 15 | JGI24742J22300_10002032 | 3300002244 | Bacteria | 3231 |
| 16 | JGI24751J29686_10008188 | 3300002459 | Unclassified | 2137 |
| 17 | JGI25406J46586_10005868 | 3300003203 | Bacteria | 5683 |
| 18 | Ga0065704_10120387 | 3300005289 | Bacteria | 1783 |
| 19 | Ga0065712_10001891 | 3300005290 | Bacteria | 8703 |
| 20 | Ga0065712_10003129 | 3300005290 | Bacteria | 4886 |
| 21 | Ga0065715_10001815 | 3300005293 | Bacteria | 5541 |
| 22 | Ga0065707_10007556 | 3300005295 | Bacteria | 4303 |
| 23 | Ga0070658_10025338 | 3300005327 | Bacteria | 4756 |
| 24 | Ga0070658_10031715 | 3300005327 | Bacteria | 4246 |
| 25 | Ga0070676_10008754 | 3300005328 | Bacteria | 5462 |
| 26 | Ga0070676_10037233 | 3300005328 | Bacteria | 2805 |
| 27 | Ga0070676_10055717 | 3300005328 | Bacteria | 2334 |
| 28 | Ga0070676_10082248 | 3300005328 | Bacteria | 1956 |
| 29 | Ga0070683_100052294 | 3300005329 | Bacteria | 3783 |
| 30 | Ga0070683_100090687 | 3300005329 | Bacteria | 2869 |
| 31 | Ga0070683_100392539 | 3300005329 | Bacteria | 1323 |
| 32 | Ga0070683_100395300 | 3300005329 | Bacteria | 1318 |
| 33 | Ga0070690_100122512 | 3300005330 | Bacteria | 1747 |
| 34 | Ga0070690_100128763 | 3300005330 | Bacteria | 1707 |
| 35 | Ga0070670_100016798 | 3300005331 | Bacteria | 6281 |
| 36 | Ga0070670_100259375 | 3300005331 | Bacteria | 1515 |
| 37 | Ga0070677_10000009 | 3300005333 | Bacteria | 65648 |
| 38 | Ga0070677_10095923 | 3300005333 | Bacteria | 1298 |
| 39 | Ga0068869_100006664 | 3300005334 | Bacteria | 7336 |
| 40 | Ga0070666_10129048 | 3300005335 | Bacteria | 1756 |
| 41 | Ga0070666_10156480 | 3300005335 | Bacteria | 1592 |
| 42 | Ga0070680_100027056 | 3300005336 | Bacteria | 4592 |
| 43 | Ga0070680_100035562 | 3300005336 | Bacteria | 4022 |
| 44 | Ga0070680_100036212 | 3300005336 | Bacteria | 3986 |
| 45 | Ga0070680_100059601 | 3300005336 | Bacteria | 3123 |
| 46 | Ga0070680_100189409 | 3300005336 | Bacteria | 1733 |
| 47 | Ga0070682_100031935 | 3300005337 | Unclassified | 3189 |
| 48 | Ga0070682_100048621 | 3300005337 | Bacteria | 2641 |
| 49 | Ga0068868_100006618 | 3300005338 | Bacteria | 8216 |
| 50 | Ga0068868_100170642 | 3300005338 | Bacteria | 1801 |
| 51 | Ga0070660_100001398 | 3300005339 | Bacteria | 16443 |
| 52 | Ga0070660_100081553 | 3300005339 | Bacteria | 2539 |
| 53 | Ga0070660_100233018 | 3300005339 | Bacteria | 1498 |
| 54 | Ga0070689_100011661 | 3300005340 | Bacteria | 6303 |
| 55 | Ga0070689_100027243 | 3300005340 | Bacteria | 4308 |
| 56 | Ga0070691_10000769 | 3300005341 | Bacteria | 12720 |
| 57 | Ga0070691_10134665 | 3300005341 | Bacteria | 1255 |
| 58 | Ga0070687_100000649 | 3300005343 | Bacteria | 11529 |
| 59 | Ga0070687_100012429 | 3300005343 | Bacteria | 3760 |
| 60 | Ga0070687_100176227 | 3300005343 | Unclassified | 1277 |
| 61 | Ga0070661_100001106 | 3300005344 | Bacteria | 18965 |
| 62 | Ga0070661_100161260 | 3300005344 | Bacteria | 1698 |
| 63 | Ga0070692_10000072 | 3300005345 | Bacteria | 20566 |
| 64 | Ga0070668_100005480 | 3300005347 | Bacteria | 9416 |
| 65 | Ga0070669_100009459 | 3300005353 | Bacteria | 6941 |
| 66 | Ga0070669_100350212 | 3300005353 | Bacteria | 1199 |
| 67 | Ga0070675_100002349 | 3300005354 | Bacteria | 14066 |
| 68 | Ga0070675_100029169 | 3300005354 | Bacteria | 4447 |
| 69 | Ga0070675_100130532 | 3300005354 | Bacteria | 2141 |
| 70 | Ga0070675_100324943 | 3300005354 | Bacteria | 1359 |
| 71 | Ga0070671_100000438 | 3300005355 | Bacteria | 28920 |
| 72 | Ga0070671_100045645 | 3300005355 | Unclassified | 3643 |
| 73 | Ga0070671_100050521 | 3300005355 | Bacteria | 3458 |
| 74 | Ga0070671_100089563 | 3300005355 | Bacteria | 2576 |
| 75 | Ga0070671_100223436 | 3300005355 | Bacteria | 1598 |
| 76 | Ga0070674_100001976 | 3300005356 | Bacteria | 11215 |
| 77 | Ga0070674_100071552 | 3300005356 | Bacteria | 2453 |
| 78 | Ga0070674_100191438 | 3300005356 | Bacteria | 1574 |
| 79 | Ga0070673_100001186 | 3300005364 | Bacteria | 14992 |
| 80 | Ga0070673_100080451 | 3300005364 | Bacteria | 2640 |
| 81 | Ga0070688_100035736 | 3300005365 | Bacteria | 3019 |
| 82 | Ga0070688_100153477 | 3300005365 | Unclassified | 1576 |
| 83 | Ga0070659_100013978 | 3300005366 | Bacteria | 5991 |
| 84 | Ga0070659_100288144 | 3300005366 | Bacteria | 1367 |
| 85 | Ga0070667_100005963 | 3300005367 | Bacteria | 10128 |
| 86 | Ga0070667_100101873 | 3300005367 | Bacteria | 2481 |
| 87 | Ga0070667_100159717 | 3300005367 | Bacteria | 1984 |
| 88 | Ga0070703_10005335 | 3300005406 | Bacteria | 3591 |
| 89 | Ga0070709_10008201 | 3300005434 | Bacteria | 5735 |
| 90 | Ga0070709_10144177 | 3300005434 | Unclassified | 1639 |
| 91 | Ga0070714_100052973 | 3300005435 | Bacteria | 3462 |
| 92 | Ga0070714_100084308 | 3300005435 | Bacteria | 2773 |
| 93 | Ga0070714_100171127 | 3300005435 | Bacteria | 1971 |
| 94 | Ga0070710_10010269 | 3300005437 | Bacteria | 4597 |
| 95 | Ga0070710_10015527 | 3300005437 | Bacteria | 3857 |
| 96 | Ga0070701_10000339 | 3300005438 | Bacteria | 15527 |
| 97 | Ga0070711_100067290 | 3300005439 | Bacteria | 2512 |
| 98 | Ga0070711_100110019 | 3300005439 | Bacteria | 2021 |
| 99 | Ga0070705_100003054 | 3300005440 | Bacteria | 8249 |
| 100 | Ga0070705_100050327 | 3300005440 | Bacteria | 2423 |
| 101 | Ga0070705_100070392 | 3300005440 | Unclassified | 2113 |
| 102 | Ga0070700_100000783 | 3300005441 | Bacteria | 15666 |
| 103 | Ga0070694_100014187 | 3300005444 | Bacteria | 4985 |
| 104 | Ga0070694_100061664 | 3300005444 | Unclassified | 2560 |
| 105 | Ga0070708_100096571 | 3300005445 | Bacteria | 2699 |
| 106 | Ga0070663_100027744 | 3300005455 | Bacteria | 3848 |
| 107 | Ga0070663_100040500 | 3300005455 | Bacteria | 3262 |
| 108 | Ga0070663_100042928 | 3300005455 | Bacteria | 3180 |
| 109 | Ga0070663_100056778 | 3300005455 | Bacteria | 2806 |
| 110 | Ga0070678_100019814 | 3300005456 | Bacteria | 4397 |
| 111 | Ga0070678_100021372 | 3300005456 | Bacteria | 4266 |
| 112 | Ga0070678_100247523 | 3300005456 | Bacteria | 1493 |
| 113 | Ga0070662_100036455 | 3300005457 | Bacteria | 3479 |
| 114 | Ga0070662_100044877 | 3300005457 | Bacteria | 3169 |
| 115 | Ga0070681_10013056 | 3300005458 | Bacteria | 8249 |
| 116 | Ga0070681_10027156 | 3300005458 | Bacteria | 5755 |
| 117 | Ga0070681_10030773 | 3300005458 | Bacteria | 5387 |
| 118 | Ga0070681_10054338 | 3300005458 | Bacteria | 3991 |
| 119 | Ga0070681_10311605 | 3300005458 | Bacteria | 1483 |
| 120 | Ga0070681_10424403 | 3300005458 | Bacteria | 1242 |
| 121 | Ga0068867_100008659 | 3300005459 | Bacteria | 7184 |
| 122 | Ga0068867_100053124 | 3300005459 | Bacteria | 2992 |
| 123 | Ga0070685_10033306 | 3300005466 | Bacteria | 2893 |
| 124 | Ga0070679_100009564 | 3300005530 | Bacteria | 9168 |
| 125 | Ga0070679_100036942 | 3300005530 | Bacteria | 4849 |
| 126 | Ga0070679_100077914 | 3300005530 | Bacteria | 3304 |
| 127 | Ga0070679_100079137 | 3300005530 | Unclassified | 3276 |
| 128 | Ga0070679_100146078 | 3300005530 | Bacteria | 2343 |
| 129 | Ga0070684_100004598 | 3300005535 | Bacteria | 10523 |
| 130 | Ga0070684_100038335 | 3300005535 | Bacteria | 4116 |
| 131 | Ga0068853_100011358 | 3300005539 | Bacteria | 7233 |
| 132 | Ga0070672_100012109 | 3300005543 | Bacteria | 6039 |
| 133 | Ga0070672_100070968 | 3300005543 | Bacteria | 2769 |
| 134 | Ga0070686_100009064 | 3300005544 | Bacteria | 5581 |
| 135 | Ga0070686_100154504 | 3300005544 | Bacteria | 1610 |
| 136 | Ga0070695_100005496 | 3300005545 | Bacteria | 7465 |
| 137 | Ga0070695_100053264 | 3300005545 | Bacteria | 2601 |
| 138 | Ga0070695_100097589 | 3300005545 | Unclassified | 1973 |
| 139 | Ga0070696_100006579 | 3300005546 | Bacteria | 7758 |
| 140 | Ga0070696_100045218 | 3300005546 | Bacteria | 3050 |
| 141 | Ga0070696_100243912 | 3300005546 | Bacteria | 1356 |
| 142 | Ga0070693_100000577 | 3300005547 | Bacteria | 16215 |
| 143 | Ga0070693_100061065 | 3300005547 | Bacteria | 2190 |
| 144 | Ga0070693_100069591 | 3300005547 | Bacteria | 2069 |
| 145 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 146 | Ga0070665_100028823 | 3300005548 | Bacteria | 5589 |
| 147 | Ga0070665_100457838 | 3300005548 | Bacteria | 1286 |
| 148 | Ga0070665_100527826 | 3300005548 | Bacteria | 1192 |
| 149 | Ga0070704_100074354 | 3300005549 | Bacteria | 2478 |
| 150 | Ga0068855_100020938 | 3300005563 | Bacteria | 7842 |
| 151 | Ga0068855_100021980 | 3300005563 | Bacteria | 7648 |
| 152 | Ga0068855_100031300 | 3300005563 | Bacteria | 6354 |
| 153 | Ga0068855_100054081 | 3300005563 | Bacteria | 4720 |
| 154 | Ga0068855_100267153 | 3300005563 | Bacteria | 1903 |
| 155 | Ga0070664_100024388 | 3300005564 | Bacteria | 5002 |
| 156 | Ga0070664_100028348 | 3300005564 | Bacteria | 4657 |
| 157 | Ga0070664_100039420 | 3300005564 | Bacteria | 3981 |
| 158 | Ga0070664_100587985 | 3300005564 | Bacteria | 1032 |
| 159 | Ga0068857_100000295 | 3300005577 | Bacteria | 34486 |
| 160 | Ga0068857_100278654 | 3300005577 | Bacteria | 1538 |
| 161 | Ga0068857_100278936 | 3300005577 | Bacteria | 1537 |
| 162 | Ga0068854_100012062 | 3300005578 | Bacteria | 5650 |
| 163 | Ga0068854_100361370 | 3300005578 | Bacteria | 1191 |
| 164 | Ga0068856_100013620 | 3300005614 | Bacteria | 7868 |
| 165 | Ga0068856_100301719 | 3300005614 | Bacteria | 1619 |
| 166 | Ga0070702_100000267 | 3300005615 | Bacteria | 17761 |
| 167 | Ga0070702_100140653 | 3300005615 | Bacteria | 1537 |
| 168 | Ga0070702_100258691 | 3300005615 | Bacteria | 1184 |
| 169 | Ga0068852_100001086 | 3300005616 | Bacteria | 17979 |
| 170 | Ga0068852_100007303 | 3300005616 | Bacteria | 8057 |
| 171 | Ga0068852_100313908 | 3300005616 | Bacteria | 1520 |
| 172 | Ga0068859_100021829 | 3300005617 | Bacteria | 6420 |
| 173 | Ga0068859_100148033 | 3300005617 | Bacteria | 2423 |
| 174 | Ga0068859_100171998 | 3300005617 | Bacteria | 2247 |
| 175 | Ga0068864_100001366 | 3300005618 | Bacteria | 20286 |
| 176 | Ga0068864_100079048 | 3300005618 | Bacteria | 2879 |
| 177 | Ga0068866_10002521 | 3300005718 | Bacteria | 7541 |
| 178 | Ga0068866_10046718 | 3300005718 | Bacteria | 2179 |
| 179 | Ga0068861_100001047 | 3300005719 | Bacteria | 16998 |
| 180 | Ga0068863_100003728 | 3300005841 | Bacteria | 15069 |
| 181 | Ga0068863_100079799 | 3300005841 | Bacteria | 3099 |
| 182 | Ga0068858_100063453 | 3300005842 | Unclassified | 3419 |
| 183 | Ga0068858_100153698 | 3300005842 | Bacteria | 2164 |
| 184 | Ga0068858_100257556 | 3300005842 | Bacteria | 1658 |
| 185 | Ga0068860_100024719 | 3300005843 | Bacteria | 5802 |
| 186 | Ga0068860_100232017 | 3300005843 | Bacteria | 1794 |
| 187 | Ga0068862_100036350 | 3300005844 | Bacteria | 4175 |
| 188 | Ga0068862_100521493 | 3300005844 | Bacteria | 1131 |
| 189 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 190 | Ga0081455_10007757 | 3300005937 | Bacteria | 11254 |
| 191 | Ga0081455_10013123 | 3300005937 | Bacteria | 8212 |
| 192 | Ga0081538_10015675 | 3300005981 | Bacteria | 5854 |
| 193 | Ga0081540_1010900 | 3300005983 | Bacteria | 6104 |
| 194 | Ga0081539_10002061 | 3300005985 | Bacteria | 30119 |
| 195 | Ga0070717_10032001 | 3300006028 | Bacteria | 4235 |
| 196 | Ga0075365_10010162 | 3300006038 | Bacteria | 5465 |
| 197 | Ga0075365_10132634 | 3300006038 | Bacteria | 1725 |
| 198 | Ga0075363_100000067 | 3300006048 | Bacteria | 21390 |
| 199 | Ga0070715_10010844 | 3300006163 | Bacteria | 3260 |
| 200 | Ga0070712_100021077 | 3300006175 | Bacteria | 4274 |
| 201 | Ga0070712_100038876 | 3300006175 | Bacteria | 3254 |
| 202 | Ga0075362_10004658 | 3300006177 | Bacteria | 4947 |
| 203 | Ga0075362_10027285 | 3300006177 | Bacteria | 2444 |
| 204 | Ga0075367_10134281 | 3300006178 | Bacteria | 1530 |
| 205 | Ga0075367_10163363 | 3300006178 | Bacteria | 1385 |
| 206 | Ga0075369_10087922 | 3300006186 | Bacteria | 1384 |
| 207 | Ga0075366_10000504 | 3300006195 | Bacteria | 18137 |
| 208 | Ga0097621_100000421 | 3300006237 | Bacteria | 29460 |
| 209 | Ga0097621_100097277 | 3300006237 | Bacteria | 2471 |
| 210 | Ga0097621_100330119 | 3300006237 | Bacteria | 1353 |
| 211 | Ga0068871_100000515 | 3300006358 | Bacteria | 26586 |
| 212 | Ga0068871_100024613 | 3300006358 | Bacteria | 4670 |
| 213 | Ga0075428_100660113 | 3300006844 | Bacteria | 1115 |
| 214 | Ga0075430_100005350 | 3300006846 | Bacteria | 10840 |
| 215 | Ga0075433_10094190 | 3300006852 | Bacteria | 2650 |
| 216 | Ga0075433_10116669 | 3300006852 | Bacteria | 2368 |
| 217 | Ga0075434_100000693 | 3300006871 | Bacteria | 26314 |
| 218 | Ga0075434_100061772 | 3300006871 | Bacteria | 3728 |
| 219 | Ga0075434_100083839 | 3300006871 | Bacteria | 3185 |
| 220 | Ga0075434_100097810 | 3300006871 | Bacteria | 2939 |
| 221 | Ga0068865_100029576 | 3300006881 | Bacteria | 3637 |
| 222 | Ga0068865_100064789 | 3300006881 | Unclassified | 2573 |
| 223 | Ga0075436_100112663 | 3300006914 | Bacteria | 1900 |
| 224 | Ga0097620_100021830 | 3300006931 | Bacteria | 6420 |
| 225 | Ga0097620_100148036 | 3300006931 | Bacteria | 2423 |
| 226 | Ga0097620_100172007 | 3300006931 | Bacteria | 2247 |
| 227 | Ga0105251_10102907 | 3300009011 | Bacteria | 1304 |
| 228 | Ga0105240_10034247 | 3300009093 | Bacteria | 6553 |
| 229 | Ga0105240_10156710 | 3300009093 | Bacteria | 2707 |
| 230 | Ga0111539_10000373 | 3300009094 | Bacteria | 55466 |
| 231 | Ga0111539_10005607 | 3300009094 | Bacteria | 16233 |
| 232 | Ga0111539_10027506 | 3300009094 | Bacteria | 6947 |
| 233 | Ga0111539_10441025 | 3300009094 | Unclassified | 1516 |
| 234 | Ga0111539_10490067 | 3300009094 | Bacteria | 1432 |
| 235 | Ga0111539_10724475 | 3300009094 | Bacteria | 1158 |
| 236 | Ga0105245_10016444 | 3300009098 | Bacteria | 6453 |
| 237 | Ga0105245_10125708 | 3300009098 | Bacteria | 2400 |
| 238 | Ga0105245_10146407 | 3300009098 | Bacteria | 2229 |
| 239 | Ga0105247_10005559 | 3300009101 | Bacteria | 7924 |
| 240 | Ga0105247_10046246 | 3300009101 | Bacteria | 2671 |
| 241 | Ga0105247_10067554 | 3300009101 | Bacteria | 2228 |
| 242 | Ga0114129_10191179 | 3300009147 | Bacteria | 2779 |
| 243 | Ga0114129_10795135 | 3300009147 | Unclassified | 1207 |
| 244 | Ga0105243_10002574 | 3300009148 | Bacteria | 15152 |
| 245 | Ga0105243_10030471 | 3300009148 | Bacteria | 4153 |
| 246 | Ga0105243_10066661 | 3300009148 | Bacteria | 2896 |
| 247 | Ga0105243_10074638 | 3300009148 | Bacteria | 2751 |
| 248 | Ga0105243_10252971 | 3300009148 | Bacteria | 1574 |
| 249 | Ga0105243_10391254 | 3300009148 | Bacteria | 1289 |
| 250 | Ga0105241_10005339 | 3300009174 | Bacteria | 9492 |
| 251 | Ga0105241_10061919 | 3300009174 | Unclassified | 2883 |
| 252 | Ga0105241_10086181 | 3300009174 | Bacteria | 2470 |
| 253 | Ga0105241_10226551 | 3300009174 | Bacteria | 1574 |
| 254 | Ga0105241_10235080 | 3300009174 | Bacteria | 1546 |
| 255 | Ga0105242_10004599 | 3300009176 | Bacteria | 10698 |
| 256 | Ga0105242_10098654 | 3300009176 | Bacteria | 2471 |
| 257 | Ga0105242_10321376 | 3300009176 | Bacteria | 1419 |
| 258 | Ga0105248_10000821 | 3300009177 | Bacteria | 34849 |
| 259 | Ga0105248_10019527 | 3300009177 | Bacteria | 7500 |
| 260 | Ga0105248_10038612 | 3300009177 | Bacteria | 5345 |
| 261 | Ga0105248_10283434 | 3300009177 | Bacteria | 1865 |
| 262 | Ga0105248_10421338 | 3300009177 | Bacteria | 1503 |
| 263 | Ga0105237_10032224 | 3300009545 | Bacteria | 5307 |
| 264 | Ga0105237_10060496 | 3300009545 | Bacteria | 3789 |
| 265 | Ga0105237_10077895 | 3300009545 | Bacteria | 3305 |
| 266 | Ga0105237_10197116 | 3300009545 | Unclassified | 2013 |
| 267 | Ga0105237_10216677 | 3300009545 | Bacteria | 1914 |
| 268 | Ga0105238_10047955 | 3300009551 | Bacteria | 4305 |
| 269 | Ga0105238_10093005 | 3300009551 | Bacteria | 3003 |
| 270 | Ga0105238_10267237 | 3300009551 | Bacteria | 1691 |
| 271 | Ga0105238_10274650 | 3300009551 | Bacteria | 1666 |
| 272 | Ga0105249_10014562 | 3300009553 | Bacteria | 6952 |
| 273 | Ga0105249_10043584 | 3300009553 | Bacteria | 4080 |
| 274 | Ga0105249_10184446 | 3300009553 | Bacteria | 2032 |
| 275 | Ga0105239_10004537 | 3300010375 | Bacteria | 16545 |
| 276 | Ga0105239_10077459 | 3300010375 | Bacteria | 3659 |
| 277 | Ga0105239_10190933 | 3300010375 | Unclassified | 2293 |
| 278 | Ga0105239_10297270 | 3300010375 | Bacteria | 1818 |
| 279 | Ga0105246_10001092 | 3300011119 | Bacteria | 15711 |
| 280 | Ga0105246_10025894 | 3300011119 | Bacteria | 3826 |
| 281 | Ga0157335_1000301 | 3300012492 | Bacteria | 2161 |
| 282 | Ga0157373_10077569 | 3300013100 | Unclassified | 2344 |
| 283 | Ga0157371_10007315 | 3300013102 | Bacteria | 8965 |
| 284 | Ga0157370_10191988 | 3300013104 | Unclassified | 1896 |
| 285 | Ga0157370_10274147 | 3300013104 | Bacteria | 1559 |
| 286 | Ga0157369_10247517 | 3300013105 | Bacteria | 1861 |
| 287 | Ga0157374_10037579 | 3300013296 | Bacteria | 4446 |
| 288 | Ga0157374_10086663 | 3300013296 | Bacteria | 2980 |
| 289 | Ga0157378_10002005 | 3300013297 | Bacteria | 18210 |
| 290 | Ga0157378_10047633 | 3300013297 | Bacteria | 3811 |
| 291 | Ga0157378_10067689 | 3300013297 | Bacteria | 3201 |
| 292 | Ga0157378_10068432 | 3300013297 | Bacteria | 3184 |
| 293 | Ga0157378_10505196 | 3300013297 | Bacteria | 1208 |
| 294 | Ga0163162_10005029 | 3300013306 | Bacteria | 12738 |
| 295 | Ga0163162_10024612 | 3300013306 | Bacteria | 5945 |
| 296 | Ga0163162_10100054 | 3300013306 | Bacteria | 2990 |
| 297 | Ga0163162_10115707 | 3300013306 | Bacteria | 2782 |
| 298 | Ga0157372_10075453 | 3300013307 | Bacteria | 3804 |
| 299 | Ga0157372_10136160 | 3300013307 | Bacteria | 2828 |
| 300 | Ga0157372_10217855 | 3300013307 | Bacteria | 2213 |
| 301 | Ga0157375_10005227 | 3300013308 | Bacteria | 11266 |
| 302 | Ga0157375_10075628 | 3300013308 | Bacteria | 3392 |
| 303 | Ga0157375_10125652 | 3300013308 | Unclassified | 2679 |
| 304 | Ga0157375_10169755 | 3300013308 | Bacteria | 2329 |
| 305 | Ga0157375_10339972 | 3300013308 | Unclassified | 1666 |
| 306 | Ga0163163_10005574 | 3300014325 | Bacteria | 10905 |
| 307 | Ga0163163_10012667 | 3300014325 | Bacteria | 7691 |
| 308 | Ga0163163_10037725 | 3300014325 | Bacteria | 4702 |
| 309 | Ga0163163_10175984 | 3300014325 | Bacteria | 2186 |
| 310 | Ga0157380_10001279 | 3300014326 | Bacteria | 16357 |
| 311 | Ga0157380_10142215 | 3300014326 | Bacteria | 2063 |
| 312 | Ga0157377_10000312 | 3300014745 | Bacteria | 22340 |
| 313 | Ga0157379_10001989 | 3300014968 | Bacteria | 16918 |
| 314 | Ga0157379_10024779 | 3300014968 | Bacteria | 5326 |
| 315 | Ga0157379_10077270 | 3300014968 | Bacteria | 2981 |
| 316 | Ga0157379_10378975 | 3300014968 | Bacteria | 1298 |
| 317 | Ga0157376_10008937 | 3300014969 | Bacteria | 7255 |
| 318 | Ga0157376_10130042 | 3300014969 | Bacteria | 2245 |
| 319 | Ga0163161_10003480 | 3300017792 | Bacteria | 11037 |
| 320 | Ga0163161_10059527 | 3300017792 | Unclassified | 2777 |
| 321 | Ga0206353_10296623 | 3300020082 | Bacteria | 2290 |
| 322 | Ga0213876_10002175 | 3300021384 | Bacteria | 11579 |
| 323 | Ga0213875_10000182 | 3300021388 | Bacteria | 64147 |
| 324 | Ga0207666_1000038 | 3300025271 | Bacteria | 26508 |
| 325 | Ga0207666_1000832 | 3300025271 | Bacteria | 3698 |
| 326 | Ga0207697_10000373 | 3300025315 | Bacteria | 25127 |
| 327 | Ga0207697_10022605 | 3300025315 | Bacteria | 2576 |
| 328 | Ga0207713_1042190 | 3300025735 | Bacteria | 1897 |
| 329 | Ga0207653_10001598 | 3300025885 | Bacteria | 7320 |
| 330 | Ga0207653_10004919 | 3300025885 | Bacteria | 4175 |
| 331 | Ga0207682_10000071 | 3300025893 | Bacteria | 44843 |
| 332 | Ga0207682_10002800 | 3300025893 | Bacteria | 7711 |
| 333 | Ga0207692_10043913 | 3300025898 | Bacteria | 2227 |
| 334 | Ga0207692_10059524 | 3300025898 | Unclassified | 1973 |
| 335 | Ga0207642_10001427 | 3300025899 | Bacteria | 7414 |
| 336 | Ga0207642_10086838 | 3300025899 | Bacteria | 1534 |
| 337 | Ga0207710_10010642 | 3300025900 | Bacteria | 3873 |
| 338 | Ga0207710_10074943 | 3300025900 | Bacteria | 1559 |
| 339 | Ga0207688_10000237 | 3300025901 | Bacteria | 25119 |
| 340 | Ga0207688_10069383 | 3300025901 | Bacteria | 1997 |
| 341 | Ga0207688_10118139 | 3300025901 | Bacteria | 1545 |
| 342 | Ga0207647_10027371 | 3300025904 | Bacteria | 3716 |
| 343 | Ga0207647_10062229 | 3300025904 | Bacteria | 2274 |
| 344 | Ga0207685_10118945 | 3300025905 | Bacteria | 1157 |
| 345 | Ga0207699_10020664 | 3300025906 | Bacteria | 3533 |
| 346 | Ga0207699_10068631 | 3300025906 | Bacteria | 2159 |
| 347 | Ga0207645_10000779 | 3300025907 | Bacteria | 26604 |
| 348 | Ga0207645_10040218 | 3300025907 | Bacteria | 2994 |
| 349 | Ga0207645_10044402 | 3300025907 | Bacteria | 2844 |
| 350 | Ga0207645_10154019 | 3300025907 | Bacteria | 1501 |
| 351 | Ga0207643_10000276 | 3300025908 | Bacteria | 35671 |
| 352 | Ga0207643_10029334 | 3300025908 | Bacteria | 3059 |
| 353 | Ga0207705_10029831 | 3300025909 | Bacteria | 3889 |
| 354 | Ga0207705_10060824 | 3300025909 | Bacteria | 2729 |
| 355 | Ga0207654_10000498 | 3300025911 | Bacteria | 22492 |
| 356 | Ga0207654_10034577 | 3300025911 | Bacteria | 2809 |
| 357 | Ga0207654_10171711 | 3300025911 | Bacteria | 1408 |
| 358 | Ga0207707_10000454 | 3300025912 | Bacteria | 42654 |
| 359 | Ga0207707_10068214 | 3300025912 | Unclassified | 3099 |
| 360 | Ga0207707_10367116 | 3300025912 | Bacteria | 1239 |
| 361 | Ga0207671_10018444 | 3300025914 | Bacteria | 5353 |
| 362 | Ga0207693_10007602 | 3300025915 | Bacteria | 8902 |
| 363 | Ga0207693_10014845 | 3300025915 | Bacteria | 6257 |
| 364 | Ga0207663_10009339 | 3300025916 | Bacteria | 5176 |
| 365 | Ga0207663_10222489 | 3300025916 | Bacteria | 1374 |
| 366 | Ga0207660_10000087 | 3300025917 | Bacteria | 49552 |
| 367 | Ga0207660_10166951 | 3300025917 | Bacteria | 1702 |
| 368 | Ga0207660_10214329 | 3300025917 | Bacteria | 1509 |
| 369 | Ga0207662_10000659 | 3300025918 | Bacteria | 15653 |
| 370 | Ga0207662_10032387 | 3300025918 | Bacteria | 3043 |
| 371 | Ga0207657_10003101 | 3300025919 | Bacteria | 17768 |
| 372 | Ga0207657_10005173 | 3300025919 | Bacteria | 13682 |
| 373 | Ga0207657_10014279 | 3300025919 | Bacteria | 7763 |
| 374 | Ga0207657_10029186 | 3300025919 | Bacteria | 5024 |
| 375 | Ga0207657_10224137 | 3300025919 | Bacteria | 1505 |
| 376 | Ga0207649_10000662 | 3300025920 | Bacteria | 22982 |
| 377 | Ga0207652_10001908 | 3300025921 | Bacteria | 18069 |
| 378 | Ga0207652_10041189 | 3300025921 | Bacteria | 3925 |
| 379 | Ga0207652_10069666 | 3300025921 | Unclassified | 3054 |
| 380 | Ga0207652_10150851 | 3300025921 | Bacteria | 2081 |
| 381 | Ga0207652_10157309 | 3300025921 | Bacteria | 2036 |
| 382 | Ga0207681_10001262 | 3300025923 | Bacteria | 16334 |
| 383 | Ga0207681_10074523 | 3300025923 | Bacteria | 2378 |
| 384 | Ga0207694_10034810 | 3300025924 | Bacteria | 3862 |
| 385 | Ga0207694_10053463 | 3300025924 | Bacteria | 3131 |
| 386 | Ga0207650_10000908 | 3300025925 | Bacteria | 22316 |
| 387 | Ga0207650_10029948 | 3300025925 | Bacteria | 3917 |
| 388 | Ga0207659_10000143 | 3300025926 | Bacteria | 42200 |
| 389 | Ga0207659_10099330 | 3300025926 | Bacteria | 2191 |
| 390 | Ga0207687_10044186 | 3300025927 | Unclassified | 3073 |
| 391 | Ga0207700_10000323 | 3300025928 | Bacteria | 28133 |
| 392 | Ga0207664_10046302 | 3300025929 | Bacteria | 3413 |
| 393 | Ga0207664_10143527 | 3300025929 | Bacteria | 2022 |
| 394 | Ga0207664_10501104 | 3300025929 | Bacteria | 1087 |
| 395 | Ga0207644_10000532 | 3300025931 | Bacteria | 24677 |
| 396 | Ga0207644_10042639 | 3300025931 | Bacteria | 3216 |
| 397 | Ga0207644_10129855 | 3300025931 | Bacteria | 1928 |
| 398 | Ga0207644_10198086 | 3300025931 | Bacteria | 1583 |
| 399 | Ga0207690_10000409 | 3300025932 | Bacteria | 28156 |
| 400 | Ga0207706_10001338 | 3300025933 | Bacteria | 24639 |
| 401 | Ga0207706_10006493 | 3300025933 | Bacteria | 10857 |
| 402 | Ga0207706_10039341 | 3300025933 | Bacteria | 4192 |
| 403 | Ga0207706_10055553 | 3300025933 | Bacteria | 3491 |
| 404 | Ga0207706_10074710 | 3300025933 | Unclassified | 2980 |
| 405 | Ga0207686_10000500 | 3300025934 | Bacteria | 25713 |
| 406 | Ga0207686_10032022 | 3300025934 | Unclassified | 3126 |
| 407 | Ga0207709_10001266 | 3300025935 | Bacteria | 18089 |
| 408 | Ga0207709_10045185 | 3300025935 | Bacteria | 2666 |
| 409 | Ga0207709_10157246 | 3300025935 | Bacteria | 1581 |
| 410 | Ga0207670_10023942 | 3300025936 | Bacteria | 3809 |
| 411 | Ga0207669_10001043 | 3300025937 | Bacteria | 11828 |
| 412 | Ga0207669_10031236 | 3300025937 | Bacteria | 2973 |
| 413 | Ga0207669_10225986 | 3300025937 | Bacteria | 1377 |
| 414 | Ga0207704_10023287 | 3300025938 | Bacteria | 3335 |
| 415 | Ga0207704_10221139 | 3300025938 | Bacteria | 1401 |
| 416 | Ga0207704_10443199 | 3300025938 | Bacteria | 1035 |
| 417 | Ga0207665_10001537 | 3300025939 | Bacteria | 15519 |
| 418 | Ga0207665_10056821 | 3300025939 | Bacteria | 2642 |
| 419 | Ga0207665_10076302 | 3300025939 | Bacteria | 2298 |
| 420 | Ga0207665_10128950 | 3300025939 | Bacteria | 1793 |
| 421 | Ga0207691_10003339 | 3300025940 | Bacteria | 15624 |
| 422 | Ga0207711_10004435 | 3300025941 | Bacteria | 11962 |
| 423 | Ga0207711_10047133 | 3300025941 | Bacteria | 3684 |
| 424 | Ga0207711_10091308 | 3300025941 | Unclassified | 2678 |
| 425 | Ga0207711_10143291 | 3300025941 | Bacteria | 2151 |
| 426 | Ga0207711_10499035 | 3300025941 | Bacteria | 1134 |
| 427 | Ga0207689_10000440 | 3300025942 | Bacteria | 38932 |
| 428 | Ga0207689_10051013 | 3300025942 | Bacteria | 3410 |
| 429 | Ga0207661_10006110 | 3300025944 | Bacteria | 8507 |
| 430 | Ga0207661_10091223 | 3300025944 | Bacteria | 2538 |
| 431 | Ga0207679_10000131 | 3300025945 | Bacteria | 61363 |
| 432 | Ga0207679_10039093 | 3300025945 | Bacteria | 3386 |
| 433 | Ga0207679_10057881 | 3300025945 | Bacteria | 2869 |
| 434 | Ga0207667_10014577 | 3300025949 | Bacteria | 8954 |
| 435 | Ga0207667_10018606 | 3300025949 | Bacteria | 7784 |
| 436 | Ga0207667_10040968 | 3300025949 | Bacteria | 4929 |
| 437 | Ga0207651_10000335 | 3300025960 | Bacteria | 19911 |
| 438 | Ga0207651_10083390 | 3300025960 | Bacteria | 2311 |
| 439 | Ga0207712_10024327 | 3300025961 | Bacteria | 4008 |
| 440 | Ga0207712_10298100 | 3300025961 | Bacteria | 1322 |
| 441 | Ga0207668_10000065 | 3300025972 | Bacteria | 86273 |
| 442 | Ga0207668_10307481 | 3300025972 | Bacteria | 1311 |
| 443 | Ga0207640_10000339 | 3300025981 | Bacteria | 31004 |
| 444 | Ga0207640_10088894 | 3300025981 | Bacteria | 2134 |
| 445 | Ga0207658_10050040 | 3300025986 | Bacteria | 3073 |
| 446 | Ga0207658_10178177 | 3300025986 | Bacteria | 1757 |
| 447 | Ga0207658_10204296 | 3300025986 | Bacteria | 1651 |
| 448 | Ga0207677_10008507 | 3300026023 | Bacteria | 5738 |
| 449 | Ga0207703_10000217 | 3300026035 | Bacteria | 66826 |
| 450 | Ga0207703_10034607 | 3300026035 | Bacteria | 4009 |
| 451 | Ga0207703_10161630 | 3300026035 | Bacteria | 1962 |
| 452 | Ga0207703_10180470 | 3300026035 | Unclassified | 1863 |
| 453 | Ga0207639_10004757 | 3300026041 | Bacteria | 9146 |
| 454 | Ga0207639_10028833 | 3300026041 | Bacteria | 4057 |
| 455 | Ga0207678_10000944 | 3300026067 | Bacteria | 26538 |
| 456 | Ga0207678_10024036 | 3300026067 | Bacteria | 5325 |
| 457 | Ga0207678_10037793 | 3300026067 | Bacteria | 4198 |
| 458 | Ga0207678_10073774 | 3300026067 | Bacteria | 2924 |
| 459 | Ga0207678_10108052 | 3300026067 | Bacteria | 2373 |
| 460 | Ga0207678_10224196 | 3300026067 | Bacteria | 1609 |
| 461 | Ga0207708_10002019 | 3300026075 | Bacteria | 14954 |
| 462 | Ga0207708_10045518 | 3300026075 | Bacteria | 3344 |
| 463 | Ga0207702_10021867 | 3300026078 | Bacteria | 5297 |
| 464 | Ga0207702_10179647 | 3300026078 | Bacteria | 1948 |
| 465 | Ga0207702_10180726 | 3300026078 | Bacteria | 1942 |
| 466 | Ga0207702_10217437 | 3300026078 | Bacteria | 1779 |
| 467 | Ga0207641_10004083 | 3300026088 | Bacteria | 12731 |
| 468 | Ga0207641_10008795 | 3300026088 | Bacteria | 8341 |
| 469 | Ga0207641_10055511 | 3300026088 | Bacteria | 3364 |
| 470 | Ga0207641_10062668 | 3300026088 | Bacteria | 3174 |
| 471 | Ga0207648_10004730 | 3300026089 | Bacteria | 13904 |
| 472 | Ga0207648_10023044 | 3300026089 | Bacteria | 5584 |
| 473 | Ga0207648_10120841 | 3300026089 | Bacteria | 2303 |
| 474 | Ga0207676_10016120 | 3300026095 | Bacteria | 5405 |
| 475 | Ga0207676_10073144 | 3300026095 | Bacteria | 2757 |
| 476 | Ga0207676_10231965 | 3300026095 | Bacteria | 1650 |
| 477 | Ga0207674_10005364 | 3300026116 | Bacteria | 15249 |
| 478 | Ga0207674_10394557 | 3300026116 | Bacteria | 1337 |
| 479 | Ga0207675_100000815 | 3300026118 | Bacteria | 31016 |
| 480 | Ga0207675_100011636 | 3300026118 | Bacteria | 8227 |
| 481 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 482 | Ga0207683_10008849 | 3300026121 | Bacteria | 8589 |
| 483 | Ga0207698_10029932 | 3300026142 | Bacteria | 3907 |
| 484 | Ga0207698_10118425 | 3300026142 | Bacteria | 2236 |
| 485 | Ga0209966_1006261 | 3300027695 | Bacteria | 2063 |
| 486 | Ga0209998_10001227 | 3300027717 | Bacteria | 6309 |
| 487 | Ga0207428_10000172 | 3300027907 | Bacteria | 90200 |
| 488 | Ga0207428_10000255 | 3300027907 | Bacteria | 72962 |
| 489 | Ga0207428_10003313 | 3300027907 | Bacteria | 15665 |
| 490 | Ga0268266_10000058 | 3300028379 | Bacteria | 277346 |
| 491 | Ga0268266_10075314 | 3300028379 | Bacteria | 2932 |
| 492 | Ga0268266_10147240 | 3300028379 | Bacteria | 2118 |
| 493 | Ga0268265_10008830 | 3300028380 | Bacteria | 6810 |
| 494 | Ga0268264_10001153 | 3300028381 | Bacteria | 25764 |
| 495 | Ga0268264_10110097 | 3300028381 | Bacteria | 2411 |
| 496 | Ga0268264_10281314 | 3300028381 | Bacteria | 1558 |
| 497 | Ga0268264_10418141 | 3300028381 | Bacteria | 1292 |
| 498 | Ga0265337_1001632 | 3300028556 | Bacteria | 10908 |
| 499 | Ga0265338_10017850 | 3300028800 | Bacteria | 7627 |
| 500 | Ga0265338_10028383 | 3300028800 | Bacteria | 5581 |
| 501 | Ga0265330_10053973 | 3300031235 | Bacteria | 1757 |
| 502 | Ga0265320_10006878 | 3300031240 | Bacteria | 7115 |
| 503 | Ga0265325_10000320 | 3300031241 | Bacteria | 33866 |
| 504 | Ga0265325_10000901 | 3300031241 | Bacteria | 21471 |
| 505 | Ga0265325_10001624 | 3300031241 | Bacteria | 15665 |
| 506 | Ga0265325_10101179 | 3300031241 | Bacteria | 1410 |
| 507 | Ga0265329_10020324 | 3300031242 | Bacteria | 2244 |
| 508 | Ga0265340_10016322 | 3300031247 | Bacteria | 3846 |
| 509 | Ga0265340_10032433 | 3300031247 | Bacteria | 2608 |
| 510 | Ga0265340_10065244 | 3300031247 | Unclassified | 1734 |
| 511 | Ga0265339_10000387 | 3300031249 | Bacteria | 34871 |
| 512 | Ga0265339_10079762 | 3300031249 | Bacteria | 1731 |
| 513 | Ga0265339_10100257 | 3300031249 | Bacteria | 1508 |
| 514 | Ga0265331_10043978 | 3300031250 | Bacteria | 2161 |
| 515 | Ga0265316_10020862 | 3300031344 | Bacteria | 5565 |
| 516 | Ga0265316_10064204 | 3300031344 | Bacteria | 2845 |
| 517 | Ga0265316_10133386 | 3300031344 | Bacteria | 1869 |
| 518 | Ga0265313_10000216 | 3300031595 | Bacteria | 62003 |
| 519 | Ga0265313_10000850 | 3300031595 | Bacteria | 30762 |
| 520 | Ga0265313_10005527 | 3300031595 | Bacteria | 9267 |
| 521 | Ga0265313_10020239 | 3300031595 | Bacteria | 3676 |
| 522 | Ga0265313_10032153 | 3300031595 | Bacteria | 2683 |
| 523 | Ga0265313_10058569 | 3300031595 | Bacteria | 1815 |
| 524 | Ga0316579_10022646 | 3300031691 | Bacteria | 2812 |
| 525 | Ga0265342_10000196 | 3300031712 | Bacteria | 67364 |
| 526 | Ga0265342_10011087 | 3300031712 | Bacteria | 6187 |
| 527 | Ga0265342_10013456 | 3300031712 | Bacteria | 5487 |
| 528 | Ga0265342_10043273 | 3300031712 | Bacteria | 2718 |
| 529 | Ga0373930_0000014 | 3300034816 | Bacteria | 17170 |
| 530 | Ga0373948_0000311 | 3300034817 | Bacteria | 5850 |
| 531 | Ga0373950_0014396 | 3300034818 | Bacteria | 1330 |
| 532 | Ga0373958_0000064 | 3300034819 | Bacteria | 10619 |
| 533 | Ga0373958_0005156 | 3300034819 | Unclassified | 1971 |
| 534 | Ga0373959_0000998 | 3300034820 | Bacteria | 4687 |
| 535 | Ga0373928_0009438 | 3300035084 | Bacteria | 1905 |
| 536 | Ga0373929_0000101 | 3300035085 | Bacteria | 14304 |
| 537 | Ga0373934_0080537 | 3300035086 | Bacteria | 1308 |
| 538 | Ga0373934_0089587 | 3300035086 | Unclassified | 1239 |
| 539 | Ga0373940_0000387 | 3300035088 | Bacteria | 6665 |
| 540 | Ga0373944_0019935 | 3300035089 | Bacteria | 1928 |
| 541 | Ga0373949_0000293 | 3300035090 | Bacteria | 18099 |
| 542 | Ga0373951_0000622 | 3300035091 | Bacteria | 9752 |
| 543 | Ga0373952_0000030 | 3300035092 | Bacteria | 16323 |
| 544 | Ga0373952_0004196 | 3300035092 | Bacteria | 2604 |
| 545 | Ga0373923_0026423 | 3300035111 | Bacteria | 2309 |
| 546 | Ga0373923_0053730 | 3300035111 | Unclassified | 1694 |
| 547 | Ga0373932_0000489 | 3300035112 | Bacteria | 12212 |
| 548 | Ga0373932_0002527 | 3300035112 | Bacteria | 4593 |
| 549 | Ga0373932_0003729 | 3300035112 | Bacteria | 3637 |
| 550 | Ga0373936_0018281 | 3300035113 | Bacteria | 2706 |
| 551 | Ga0373939_0000851 | 3300035114 | Bacteria | 7558 |
| 552 | Ga0373939_0002295 | 3300035114 | Bacteria | 4520 |
| 553 | Ga0373939_0003114 | 3300035114 | Bacteria | 3897 |
| 554 | Ga0373941_0000823 | 3300035115 | Bacteria | 6378 |
| 555 | Ga0373941_0002224 | 3300035115 | Bacteria | 4236 |
| 556 | Ga0373945_0004713 | 3300035116 | Bacteria | 4343 |
| 557 | Ga0373945_0015386 | 3300035116 | Bacteria | 2573 |
| 558 | Ga0373945_0019764 | 3300035116 | Bacteria | 2300 |
| 559 | Ga0373953_0007900 | 3300035117 | Bacteria | 3587 |
| 560 | Ga0373953_0024755 | 3300035117 | Bacteria | 2285 |
| 561 | Ga0373954_0001907 | 3300035118 | Bacteria | 8628 |
| 562 | Ga0373954_0011991 | 3300035118 | Bacteria | 3849 |
| 563 | Ga0373954_0013565 | 3300035118 | Unclassified | 3633 |
| 564 | Ga0373954_0015835 | 3300035118 | Bacteria | 3372 |
| 565 | Ga0373956_0014440 | 3300035119 | Bacteria | 3300 |
| 566 | Ga0373957_0002197 | 3300035120 | Bacteria | 5516 |
| 567 | Ga0373957_0035201 | 3300035120 | Bacteria | 1859 |
| 568 | Ga0373957_0054785 | 3300035120 | Bacteria | 1532 |
| 569 | Ga0373960_0002164 | 3300035121 | Bacteria | 4421 |
| 570 | Ga0373943_0005719 | 3300035170 | Bacteria | 5579 |
| 571 | Ga0373943_0008406 | 3300035170 | Bacteria | 4630 |
| 572 | Ga0373943_0008838 | 3300035170 | Bacteria | 4511 |
| 573 | Ga0373943_0027468 | 3300035170 | Bacteria | 2674 |
| 574 | Ga0373943_0050946 | 3300035170 | Bacteria | 2037 |
| 575 | Ga0373946_0000496 | 3300035171 | Bacteria | 13068 |
| 576 | Ga0373946_0031061 | 3300035171 | Bacteria | 2136 |
| 577 | Ga0373946_0036827 | 3300035171 | Bacteria | 1986 |
| 578 | Ga0373955_0000780 | 3300035172 | Bacteria | 13641 |
| 579 | Ga0373955_0002744 | 3300035172 | Bacteria | 7721 |
| 580 | Ga0373955_0002991 | 3300035172 | Bacteria | 7404 |
| 581 | Ga0373955_0026980 | 3300035172 | Bacteria | 2965 |
| 582 | Ga0373955_0027586 | 3300035172 | Bacteria | 2937 |
| 583 | Ga0373955_0164410 | 3300035172 | Bacteria | 1311 |
| 584 | Ga0373942_0000073 | 3300035207 | Bacteria | 21344 |
| 585 | Ga0373942_0001348 | 3300035207 | Bacteria | 6364 |
| 586 | Ga0373961_0000480 | 3300035241 | Bacteria | 15603 |
| 587 | Ga0373961_0058041 | 3300035241 | Bacteria | 1166 |
| 588 | Ga0373924_0000612 | 3300035410 | Bacteria | 11004 |
| 589 | Ga0373931_0000537 | 3300035691 | Bacteria | 15543 |
| 590 | Ga0373931_0005818 | 3300035691 | Bacteria | 5736 |
| 591 | Ga0373931_0007041 | 3300035691 | Bacteria | 5290 |
| 592 | Ga0373935_0000018 | 3300035692 | Bacteria | 68811 |
| 593 | Ga0373935_0012572 | 3300035692 | Bacteria | 5094 |
| 594 | Ga0373935_0020195 | 3300035692 | Bacteria | 4067 |
| 595 | Ga0373927_0004548 | 3300035695 | Bacteria | 9693 |
| 596 | Ga0373933_0001624 | 3300035724 | Bacteria | 13116 |
| 597 | Ga0373933_0007467 | 3300035724 | Bacteria | 5967 |
| 598 | Ga0373933_0017014 | 3300035724 | Bacteria | 4076 |
| 599 | Ga0373933_0055010 | 3300035724 | Bacteria | 2386 |
| 600 | Ga0373933_0087093 | 3300035724 | Bacteria | 1923 |
| 601 | Ga0373947_0026450 | 3300035725 | Bacteria | 3391 |
| 602 | Ga0373947_0050393 | 3300035725 | Bacteria | 2503 |
| 603 | Ga0373947_0194251 | 3300035725 | Bacteria | 1325 |
| 604 | Ga0373937_0000054 | 3300036401 | Bacteria | 102542 |
| 605 | Ga0373937_0000907 | 3300036401 | Bacteria | 25212 |
| 606 | Ga0373937_0195170 | 3300036401 | Bacteria | 1903 |
| 607 | Ga0373937_0286739 | 3300036401 | Bacteria | 1555 |
| 608 | Ga0316582_0228345 | 3300036647 | Bacteria | 1274 |
| 609 | Ga0373925_0000018 | 3300037068 | Bacteria | 174213 |
| 610 | Ga0373925_0002911 | 3300037068 | Bacteria | 13500 |
| 611 | Ga0373925_0011253 | 3300037068 | Bacteria | 6490 |
| 612 | Ga0373925_0013922 | 3300037068 | Bacteria | 5822 |
| 613 | Ga0373925_0086347 | 3300037068 | Bacteria | 2393 |
| 614 | Ga0373925_0279863 | 3300037068 | Bacteria | 1343 |
| 615 | Ga0373925_0581347 | 3300037068 | Bacteria | 922 |
| 616 | Ga0395900_0034835 | 3300037418 | Bacteria | 5186 |
| 617 | Ga0395898_0001841 | 3300037466 | Bacteria | 27267 |
| 618 | Ga0395898_0003941 | 3300037466 | Bacteria | 16375 |
| 619 | Ga0395901_0024754 | 3300038443 | Bacteria | 6163 |
| 620 | Ga0395901_0032894 | 3300038443 | Bacteria | 5350 |
| 621 | Ga0395901_0279301 | 3300038443 | Bacteria | 1735 |
| 622 | Ga0395901_0463828 | 3300038443 | Bacteria | 1294 |
| 623 | Ga0242420_005653 | 3300038996 | Bacteria | 1947 |
| 624 | Ga0436365_0320065 | 3300039437 | Bacteria | 3859 |
| 625 | Ga0436365_0883242 | 3300039437 | Bacteria | 6053 |
| 626 | Ga0436365_1263688 | 3300039437 | Bacteria | 2876 |
| 627 | Ga0436365_1519653 | 3300039437 | Bacteria | 4266 |
| 628 | Ga0436365_1707590 | 3300039437 | Bacteria | 3035 |
| 629 | Ga0436365_1882402 | 3300039437 | Bacteria | 15518 |
| 630 | Ga0439443_003449 | 3300042003 | Bacteria | 1993 |
| 631 | Ga0439450_020261 | 3300042008 | Bacteria | 1418 |
| 632 | Ga0439455_0033751 | 3300042012 | Bacteria | 1285 |
| 633 | Ga0439435_0004656 | 3300042436 | Bacteria | 2968 |
| 634 | Ga0439459_0022417 | 3300042438 | Bacteria | 1222 |
| 635 | Ga0439464_0065545 | 3300042439 | Bacteria | 1068 |
| 636 | Ga0466963_0003932 | 3300044694 | Bacteria | 8589 |
| 637 | Ga0466963_0026169 | 3300044694 | Bacteria | 3730 |
| 638 | Ga0466963_0097040 | 3300044694 | Bacteria | 2014 |
| 639 | Ga0466971_0034852 | 3300044719 | Bacteria | 2256 |
| 640 | Ga0466957_0115977 | 3300044842 | Bacteria | 1703 |
| 641 | Ga0466959_0073406 | 3300045049 | Bacteria | 2475 |
| 642 | Ga0466958_0066033 | 3300045836 | Bacteria | 2208 |
| 643 | Ga0466958_0107784 | 3300045836 | Bacteria | 1738 |
| 644 | Ga0466967_0000135 | 3300045976 | Bacteria | 28276 |
| 645 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 646 | Ga0495592_0001841 | 3300046454 | Bacteria | 14911 |
| 647 | Ga0495592_0049907 | 3300046454 | Unclassified | 3109 |
| 648 | Ga0495603_0001804 | 3300046455 | Bacteria | 12638 |
| 649 | Ga0495603_0006399 | 3300046455 | Bacteria | 7046 |
| 650 | Ga0495629_0001140 | 3300046459 | Bacteria | 20980 |
| 651 | Ga0495629_0001999 | 3300046459 | Bacteria | 15839 |
| 652 | Ga0495629_0012504 | 3300046459 | Bacteria | 6147 |
| 653 | Ga0495629_0014702 | 3300046459 | Bacteria | 5630 |
| 654 | Ga0495629_0122295 | 3300046459 | Bacteria | 1813 |
| 655 | Ga0495638_0012011 | 3300046460 | Bacteria | 5951 |
| 656 | Ga0495638_0118625 | 3300046460 | Unclassified | 1565 |
| 657 | Ga0495641_0004661 | 3300046461 | Bacteria | 9579 |
| 658 | Ga0495641_0037748 | 3300046461 | Bacteria | 2261 |
| 659 | Ga0495641_0051670 | 3300046461 | Bacteria | 1875 |
| 660 | Ga0495651_0003314 | 3300046462 | Bacteria | 12363 |
| 661 | Ga0495651_0026886 | 3300046462 | Bacteria | 4481 |
| 662 | Ga0495651_0262615 | 3300046462 | Bacteria | 1174 |
| 663 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 664 | Ga0495653_0002480 | 3300046463 | Bacteria | 14680 |
| 665 | Ga0495653_0007463 | 3300046463 | Bacteria | 8942 |
| 666 | Ga0495653_0097728 | 3300046463 | Bacteria | 2133 |
| 667 | Ga0495653_0098713 | 3300046463 | Bacteria | 2120 |
| 668 | Ga0495580_0019092 | 3300046472 | Bacteria | 5097 |
| 669 | Ga0495580_0055410 | 3300046472 | Bacteria | 2794 |
| 670 | Ga0495582_0000379 | 3300046473 | Bacteria | 24152 |
| 671 | Ga0495582_0002467 | 3300046473 | Bacteria | 10310 |
| 672 | Ga0495582_0023779 | 3300046473 | Bacteria | 3350 |
| 673 | Ga0495582_0064200 | 3300046473 | Unclassified | 2027 |
| 674 | Ga0495639_0003077 | 3300046475 | Bacteria | 7255 |
| 675 | Ga0495639_0046612 | 3300046475 | Unclassified | 1962 |
| 676 | Ga0495662_0001826 | 3300046476 | Bacteria | 10666 |
| 677 | Ga0495662_0003041 | 3300046476 | Bacteria | 8462 |
| 678 | Ga0495662_0154796 | 3300046476 | Bacteria | 1129 |
| 679 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 680 | Ga0495664_0012476 | 3300046477 | Bacteria | 4813 |
| 681 | Ga0495664_0012757 | 3300046477 | Bacteria | 4760 |
| 682 | Ga0495664_0021119 | 3300046477 | Bacteria | 3761 |
| 683 | Ga0495594_0000628 | 3300046499 | Bacteria | 18193 |
| 684 | Ga0495594_0035602 | 3300046499 | Bacteria | 2712 |
| 685 | Ga0495607_0006681 | 3300046501 | Bacteria | 8081 |
| 686 | Ga0495608_0001556 | 3300046511 | Bacteria | 16383 |
| 687 | Ga0495608_0008407 | 3300046511 | Bacteria | 7231 |
| 688 | Ga0495618_0000045 | 3300046514 | Bacteria | 94654 |
| 689 | Ga0495618_0007081 | 3300046514 | Bacteria | 6782 |
| 690 | Ga0495618_0084063 | 3300046514 | Bacteria | 2033 |
| 691 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 692 | Ga0495628_0003222 | 3300046516 | Bacteria | 14635 |
| 693 | Ga0495628_0024916 | 3300046516 | Bacteria | 4893 |
| 694 | Ga0495628_0052307 | 3300046516 | Bacteria | 3226 |
| 695 | Ga0495630_0011378 | 3300046517 | Bacteria | 6443 |
| 696 | Ga0495630_0012501 | 3300046517 | Bacteria | 6165 |
| 697 | Ga0495630_0124505 | 3300046517 | Bacteria | 1956 |
| 698 | Ga0495631_0021068 | 3300046518 | Bacteria | 3038 |
| 699 | Ga0495644_0001849 | 3300046523 | Bacteria | 8536 |
| 700 | Ga0495666_0001574 | 3300046526 | Bacteria | 11221 |
| 701 | Ga0495666_0012617 | 3300046526 | Bacteria | 4212 |
| 702 | Ga0495666_0012636 | 3300046526 | Bacteria | 4208 |
| 703 | Ga0495642_0005501 | 3300046528 | Bacteria | 4865 |
| 704 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 705 | Ga0495652_0003251 | 3300046529 | Bacteria | 16195 |
| 706 | Ga0495652_0033232 | 3300046529 | Bacteria | 4505 |
| 707 | Ga0495652_0057717 | 3300046529 | Bacteria | 3290 |
| 708 | Ga0495652_0097619 | 3300046529 | Unclassified | 2389 |
| 709 | Ga0495665_0157533 | 3300046531 | Bacteria | 1184 |
| 710 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 711 | Ga0495640_0013464 | 3300046533 | Bacteria | 6214 |
| 712 | Ga0495640_0045546 | 3300046533 | Unclassified | 3043 |
| 713 | Ga0495640_0172772 | 3300046533 | Bacteria | 1380 |
| 714 | Ga0495586_0003618 | 3300046535 | Bacteria | 8282 |
| 715 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 716 | Ga0495587_0004338 | 3300046536 | Bacteria | 9361 |
| 717 | Ga0495587_0007680 | 3300046536 | Bacteria | 6975 |
| 718 | Ga0495587_0011614 | 3300046536 | Bacteria | 5575 |
| 719 | Ga0495587_0154112 | 3300046536 | Bacteria | 1309 |
| 720 | Ga0495621_0045512 | 3300046539 | Bacteria | 1554 |
| 721 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 722 | Ga0495645_0001743 | 3300046543 | Bacteria | 14779 |
| 723 | Ga0495622_0079789 | 3300046557 | Unclassified | 1506 |
| 724 | Ga0495633_0004389 | 3300046558 | Bacteria | 8992 |
| 725 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 726 | Ga0495667_0000365 | 3300046559 | Bacteria | 28797 |
| 727 | Ga0495667_0013452 | 3300046559 | Bacteria | 5540 |
| 728 | Ga0495667_0018239 | 3300046559 | Bacteria | 4740 |
| 729 | Ga0495667_0084282 | 3300046559 | Bacteria | 2064 |
| 730 | Ga0495656_0000167 | 3300046615 | Bacteria | 23487 |
| 731 | Ga0495634_0003795 | 3300046642 | Bacteria | 12004 |
| 732 | Ga0495634_0011520 | 3300046642 | Bacteria | 6433 |
| 733 | Ga0495634_0050513 | 3300046642 | Bacteria | 2792 |
| 734 | Ga0495634_0075441 | 3300046642 | Unclassified | 2214 |
| 735 | Ga0495634_0123291 | 3300046642 | Unclassified | 1658 |
| 736 | Ga0495634_0152584 | 3300046642 | Bacteria | 1460 |
| 737 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 738 | Ga0495635_0000981 | 3300046663 | Bacteria | 18808 |
| 739 | Ga0495635_0037835 | 3300046663 | Bacteria | 3340 |
| 740 | Ga0495588_0072980 | 3300046674 | Unclassified | 1786 |
| 741 | Ga0495657_0000250 | 3300046675 | Bacteria | 48717 |
| 742 | Ga0495657_0014027 | 3300046675 | Bacteria | 5886 |
| 743 | Ga0495657_0057996 | 3300046675 | Unclassified | 2572 |
| 744 | Ga0495657_0086346 | 3300046675 | Bacteria | 2021 |
| 745 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 746 | Ga0495599_0004379 | 3300046678 | Bacteria | 8360 |
| 747 | Ga0495599_0005186 | 3300046678 | Bacteria | 7768 |
| 748 | Ga0495623_0001448 | 3300046679 | Bacteria | 16089 |
| 749 | Ga0495623_0005930 | 3300046679 | Bacteria | 7962 |
| 750 | Ga0495623_0046861 | 3300046679 | Bacteria | 2743 |
| 751 | Ga0495646_0000049 | 3300046680 | Bacteria | 60856 |
| 752 | Ga0495646_0000794 | 3300046680 | Bacteria | 17647 |
| 753 | Ga0495646_0002316 | 3300046680 | Bacteria | 11659 |
| 754 | Ga0495646_0182212 | 3300046680 | Bacteria | 1152 |
| 755 | Ga0495647_0082373 | 3300046681 | Bacteria | 1306 |
| 756 | Ga0495658_0000210 | 3300046683 | Bacteria | 33648 |
| 757 | Ga0495658_0001195 | 3300046683 | Bacteria | 13670 |
| 758 | Ga0495658_0002366 | 3300046683 | Bacteria | 9522 |
| 759 | Ga0495658_0079220 | 3300046683 | Unclassified | 1924 |
| 760 | Ga0495669_0077023 | 3300046684 | Unclassified | 1527 |
| 761 | Ga0495613_0013585 | 3300046689 | Bacteria | 6045 |
| 762 | Ga0495613_0082415 | 3300046689 | Bacteria | 2336 |
| 763 | Ga0495624_0000222 | 3300046690 | Bacteria | 44293 |
| 764 | Ga0495671_0028675 | 3300046692 | Bacteria | 2865 |
| 765 | Ga0495600_0000388 | 3300046809 | Bacteria | 22724 |
| 766 | Ga0495600_0004336 | 3300046809 | Bacteria | 8486 |
| 767 | Ga0495581_0001772 | 3300047315 | Bacteria | 12062 |
| 768 | Ga0495581_0065940 | 3300047315 | Unclassified | 2094 |
| 769 | Ga0495581_0076044 | 3300047315 | Bacteria | 1942 |
| 770 | Ga0495581_0094200 | 3300047315 | Bacteria | 1738 |
| 771 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 772 | Ga0495604_0002563 | 3300047317 | Bacteria | 14535 |
| 773 | Ga0495604_0004482 | 3300047317 | Bacteria | 11061 |
| 774 | Ga0495604_0006585 | 3300047317 | Bacteria | 9206 |
| 775 | Ga0495604_0030840 | 3300047317 | Bacteria | 4254 |
| 776 | Ga0495604_0201826 | 3300047317 | Bacteria | 1379 |
| 777 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 778 | Ga0495674_0001490 | 3300047319 | Bacteria | 22945 |
| 779 | Ga0495674_0012662 | 3300047319 | Bacteria | 7949 |
| 780 | Ga0495674_0020664 | 3300047319 | Bacteria | 6096 |
| 781 | Ga0495674_0027967 | 3300047319 | Bacteria | 5148 |
| 782 | Ga0495674_0084058 | 3300047319 | Bacteria | 2728 |
| 783 | Ga0495674_0217737 | 3300047319 | Bacteria | 1579 |
| 784 | Ga0495676_0000289 | 3300047321 | Bacteria | 40718 |
| 785 | Ga0495676_0009583 | 3300047321 | Bacteria | 8815 |
| 786 | Ga0495680_0001414 | 3300047322 | Bacteria | 25878 |
| 787 | Ga0495680_0001759 | 3300047322 | Bacteria | 22952 |
| 788 | Ga0495680_0013679 | 3300047322 | Bacteria | 7067 |
| 789 | Ga0495680_0014248 | 3300047322 | Bacteria | 6895 |
| 790 | Ga0495680_0017136 | 3300047322 | Bacteria | 6199 |
| 791 | Ga0495680_0217010 | 3300047322 | Bacteria | 1367 |
| 792 | Ga0495680_0335041 | 3300047322 | Bacteria | 1056 |
| 793 | Ga0495675_0001296 | 3300047444 | Bacteria | 15160 |
| 794 | Ga0495675_0003130 | 3300047444 | Bacteria | 9934 |
| 795 | Ga0495675_0016877 | 3300047444 | Bacteria | 4619 |
| 796 | Ga0495675_0101987 | 3300047444 | Bacteria | 1795 |
| 797 | Ga0495677_0012556 | 3300047445 | Bacteria | 3089 |
| 798 | Ga0495684_0000046 | 3300047471 | Bacteria | 92658 |
| 799 | Ga0495684_0158192 | 3300047471 | Bacteria | 1692 |
| 800 | Ga0495684_0178043 | 3300047471 | Bacteria | 1578 |
| 801 | Ga0495593_0000935 | 3300047673 | Bacteria | 17005 |
| 802 | Ga0495593_0002092 | 3300047673 | Bacteria | 11942 |
| 803 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 804 | Ga0495602_0006171 | 3300048088 | Bacteria | 12571 |
| 805 | Ga0495602_0033711 | 3300048088 | Bacteria | 4800 |
| 806 | Ga0495602_0126428 | 3300048088 | Bacteria | 2047 |
| 807 | Ga0496100_0000759 | 3300048903 | Bacteria | 15303 |
| 808 | Ga0496100_0069856 | 3300048903 | Bacteria | 2340 |
| 809 | Ga0496100_0153165 | 3300048903 | Unclassified | 1646 |
| 810 | Ga0496100_0281142 | 3300048903 | Bacteria | 1240 |
| 811 | Ga0496101_0000423 | 3300048904 | Bacteria | 27228 |
| 812 | Ga0496101_0012182 | 3300048904 | Bacteria | 5732 |
| 813 | Ga0496101_0030759 | 3300048904 | Bacteria | 3768 |
| 814 | Ga0496101_0033728 | 3300048904 | Unclassified | 3612 |
| 815 | Ga0496101_0062062 | 3300048904 | Bacteria | 2716 |
| 816 | Ga0496102_0003323 | 3300048905 | Bacteria | 13636 |
| 817 | Ga0496102_0013302 | 3300048905 | Bacteria | 7127 |
| 818 | Ga0496102_0027348 | 3300048905 | Bacteria | 5093 |
| 819 | Ga0496102_0041199 | 3300048905 | Unclassified | 4180 |
| 820 | Ga0496102_0051835 | 3300048905 | Bacteria | 3738 |
| 821 | Ga0496103_0000998 | 3300048906 | Bacteria | 19896 |
| 822 | Ga0496103_0006412 | 3300048906 | Bacteria | 7028 |
| 823 | Ga0496103_0088306 | 3300048906 | Bacteria | 1955 |
| 824 | Ga0496104_0001036 | 3300048907 | Bacteria | 23773 |
| 825 | Ga0496104_0077394 | 3300048907 | Unclassified | 3169 |
| 826 | Ga0496104_0285637 | 3300048907 | Bacteria | 1563 |
| 827 | Ga0496105_0007270 | 3300048908 | Bacteria | 8554 |
| 828 | Ga0496105_0030076 | 3300048908 | Bacteria | 4449 |
| 829 | Ga0496105_0081793 | 3300048908 | Bacteria | 2667 |
| 830 | Ga0496105_0118707 | 3300048908 | Bacteria | 2182 |
| 831 | Ga0496105_0432166 | 3300048908 | Bacteria | 1041 |
| 832 | Ga0496106_0002446 | 3300048909 | Bacteria | 13839 |
| 833 | Ga0496106_0018622 | 3300048909 | Bacteria | 5139 |
| 834 | Ga0496106_0041978 | 3300048909 | Bacteria | 3429 |
| 835 | Ga0496106_0064133 | 3300048909 | Unclassified | 2794 |
| 836 | Ga0496107_0000500 | 3300048910 | Bacteria | 21655 |
| 837 | Ga0496107_0012166 | 3300048910 | Bacteria | 6002 |
| 838 | Ga0496107_0035173 | 3300048910 | Bacteria | 3591 |
| 839 | Ga0496107_0129242 | 3300048910 | Unclassified | 1864 |
| 840 | Ga0496107_0222833 | 3300048910 | Bacteria | 1403 |
| 841 | Ga0496108_0012575 | 3300048911 | Bacteria | 6895 |
| 842 | Ga0496108_0090557 | 3300048911 | Unclassified | 2600 |
| 843 | Ga0496108_0157647 | 3300048911 | Bacteria | 1960 |
| 844 | Ga0496108_0394661 | 3300048911 | Bacteria | 1208 |
| 845 | Ga0496109_0000359 | 3300048912 | Bacteria | 42297 |
| 846 | Ga0496109_0000976 | 3300048912 | Bacteria | 23658 |
| 847 | Ga0496109_0004488 | 3300048912 | Bacteria | 11664 |
| 848 | Ga0496109_0076539 | 3300048912 | Bacteria | 3077 |
| 849 | Ga0496109_0185890 | 3300048912 | Unclassified | 1952 |
| 850 | Ga0496110_0017548 | 3300048913 | Bacteria | 5986 |
| 851 | Ga0496110_0081293 | 3300048913 | Bacteria | 2888 |
| 852 | Ga0496110_0319824 | 3300048913 | Bacteria | 1413 |
| 853 | Ga0496111_0040873 | 3300048914 | Bacteria | 3327 |
| 854 | Ga0496111_0041581 | 3300048914 | Bacteria | 3299 |
| 855 | Ga0496111_0102889 | 3300048914 | Bacteria | 2100 |
| 856 | Ga0496111_0162710 | 3300048914 | Bacteria | 1657 |
| 857 | Ga0496111_0206555 | 3300048914 | Bacteria | 1459 |
| 858 | Ga0496111_0219835 | 3300048914 | Bacteria | 1411 |
| 859 | Ga0496112_0020210 | 3300048915 | Bacteria | 6307 |
| 860 | Ga0496112_0069057 | 3300048915 | Bacteria | 3490 |
| 861 | Ga0496112_0079934 | 3300048915 | Bacteria | 3233 |
| 862 | Ga0496112_0091984 | 3300048915 | Bacteria | 3002 |
| 863 | Ga0496113_0001950 | 3300048916 | Bacteria | 11812 |
| 864 | Ga0496113_0103186 | 3300048916 | Unclassified | 2212 |
| 865 | Ga0496113_0138805 | 3300048916 | Bacteria | 1911 |
| 866 | Ga0496114_0033845 | 3300048917 | Bacteria | 4213 |
| 867 | Ga0496114_0048260 | 3300048917 | Bacteria | 3541 |
| 868 | Ga0496115_0034721 | 3300048918 | Bacteria | 3985 |
| 869 | Ga0496115_0036722 | 3300048918 | Bacteria | 3880 |
| 870 | Ga0496115_0071341 | 3300048918 | Bacteria | 2817 |
| 871 | Ga0496115_0163819 | 3300048918 | Unclassified | 1838 |
| 872 | Ga0501031_0077063 | 3300049568 | Bacteria | 2171 |
| 873 | Ga0501031_0179112 | 3300049568 | Bacteria | 1385 |
| 874 | Ga0501032_0019973 | 3300049569 | Bacteria | 4675 |
| 875 | Ga0501032_0058186 | 3300049569 | Bacteria | 2595 |
| 876 | Ga0501033_0030833 | 3300049570 | Bacteria | 4030 |
| 877 | Ga0501033_0204732 | 3300049570 | Bacteria | 1409 |
| 878 | Ga0501034_0000994 | 3300049571 | Bacteria | 40719 |
| 879 | Ga0501034_0003982 | 3300049571 | Bacteria | 16597 |
| 880 | Ga0501034_0077373 | 3300049571 | Bacteria | 3333 |
| 881 | Ga0501034_0084819 | 3300049571 | Bacteria | 3169 |
| 882 | Ga0501034_0161846 | 3300049571 | Bacteria | 2208 |
| 883 | Ga0501034_0524341 | 3300049571 | Bacteria | 1096 |
| 884 | Ga0501036_0002363 | 3300049572 | Bacteria | 14753 |
| 885 | Ga0501037_0023068 | 3300049573 | Bacteria | 4602 |
| 886 | Ga0501037_0042050 | 3300049573 | Bacteria | 3359 |
| 887 | Ga0501038_0018943 | 3300049574 | Bacteria | 6212 |
| 888 | Ga0501038_0102870 | 3300049574 | Bacteria | 2376 |
| 889 | Ga0501038_0127564 | 3300049574 | Bacteria | 2092 |
| 890 | Ga0501038_0310272 | 3300049574 | Bacteria | 1236 |
| 891 | Ga0501039_0034460 | 3300049575 | Bacteria | 3906 |
| 892 | Ga0501043_0002909 | 3300049579 | Bacteria | 14293 |
| 893 | Ga0501043_0036232 | 3300049579 | Bacteria | 3880 |
| 894 | Ga0501043_0040931 | 3300049579 | Bacteria | 3641 |
| 895 | Ga0501043_0131594 | 3300049579 | Bacteria | 1960 |
| 896 | Ga0501043_0471546 | 3300049579 | Bacteria | 941 |
| 897 | Ga0501046_0173793 | 3300049580 | Bacteria | 1615 |
| 898 | Ga0501047_0000204 | 3300049581 | Bacteria | 71976 |
| 899 | Ga0501047_0009067 | 3300049581 | Bacteria | 9395 |
| 900 | Ga0501047_0018683 | 3300049581 | Bacteria | 6647 |
| 901 | Ga0501047_0039533 | 3300049581 | Bacteria | 4562 |
| 902 | Ga0501047_0069786 | 3300049581 | Bacteria | 3383 |
| 903 | Ga0501047_0079355 | 3300049581 | Bacteria | 3156 |
| 904 | Ga0501047_0358881 | 3300049581 | Bacteria | 1293 |
| 905 | Ga0501048_0000151 | 3300049582 | Bacteria | 42561 |
| 906 | Ga0501067_0008102 | 3300049583 | Bacteria | 5837 |
| 907 | Ga0501068_0007910 | 3300049584 | Bacteria | 5892 |
| 908 | Ga0501068_0205762 | 3300049584 | Bacteria | 1249 |
| 909 | Ga0501069_0003921 | 3300049585 | Bacteria | 7668 |
| 910 | Ga0501069_0013989 | 3300049585 | Bacteria | 4286 |
| 911 | Ga0501069_0035838 | 3300049585 | Bacteria | 2734 |
| 912 | Ga0501069_0215077 | 3300049585 | Bacteria | 1116 |
| 913 | Ga0501069_0229728 | 3300049585 | Bacteria | 1080 |
| 914 | Ga0501069_0242241 | 3300049585 | Bacteria | 1051 |
| 915 | Ga0501070_0004953 | 3300049586 | Bacteria | 11365 |
| 916 | Ga0501070_0009762 | 3300049586 | Bacteria | 8119 |
| 917 | Ga0501070_0019697 | 3300049586 | Bacteria | 5658 |
| 918 | Ga0501070_0021777 | 3300049586 | Bacteria | 5371 |
| 919 | Ga0501070_0105915 | 3300049586 | Bacteria | 2324 |
| 920 | Ga0501070_0336973 | 3300049586 | Bacteria | 1225 |
| 921 | Ga0501071_0169191 | 3300049587 | Bacteria | 1636 |
| 922 | Ga0501072_0026272 | 3300049588 | Bacteria | 4539 |
| 923 | Ga0501072_0056233 | 3300049588 | Bacteria | 3101 |
| 924 | Ga0501073_0024827 | 3300049589 | Bacteria | 4302 |
| 925 | Ga0501073_0059201 | 3300049589 | Bacteria | 2676 |
| 926 | Ga0501073_0092979 | 3300049589 | Bacteria | 2096 |
| 927 | Ga0501073_0178969 | 3300049589 | Bacteria | 1467 |
| 928 | Ga0501074_0009538 | 3300049590 | Bacteria | 7050 |
| 929 | Ga0501074_0011619 | 3300049590 | Bacteria | 6400 |
| 930 | Ga0501076_0026850 | 3300049592 | Bacteria | 4463 |
| 931 | Ga0501077_0009531 | 3300049593 | Bacteria | 6038 |
| 932 | Ga0501079_0100433 | 3300049741 | Bacteria | 2243 |
| 933 | Ga0501079_0160563 | 3300049741 | Unclassified | 1753 |
| 934 | Ga0501080_0006219 | 3300049742 | Bacteria | 10716 |
| 935 | Ga0501080_0019256 | 3300049742 | Bacteria | 6321 |
| 936 | Ga0501080_0050480 | 3300049742 | Bacteria | 3871 |
| 937 | Ga0501080_0099377 | 3300049742 | Bacteria | 2700 |
| 938 | Ga0501080_0109268 | 3300049742 | Bacteria | 2563 |
| 939 | Ga0501081_0036949 | 3300049743 | Bacteria | 3332 |
| 940 | Ga0501081_0059623 | 3300049743 | Bacteria | 2643 |
| 941 | Ga0501083_0032154 | 3300049744 | Bacteria | 3599 |
| 942 | Ga0501083_0055045 | 3300049744 | Bacteria | 2669 |
| 943 | Ga0501083_0070069 | 3300049744 | Bacteria | 2333 |
| 944 | Ga0501035_0000127 | 3300049822 | Bacteria | 92397 |
| 945 | Ga0501035_0049338 | 3300049822 | Bacteria | 3772 |
| 946 | Ga0501035_0132366 | 3300049822 | Bacteria | 2173 |
| 947 | Ga0501035_0152706 | 3300049822 | Bacteria | 2003 |
| 948 | Ga0501044_0000636 | 3300049823 | Bacteria | 42394 |
| 949 | Ga0501044_0035924 | 3300049823 | Bacteria | 5186 |
| 950 | Ga0501044_0045518 | 3300049823 | Bacteria | 4545 |
| 951 | Ga0501044_0097612 | 3300049823 | Bacteria | 2959 |
| 952 | Ga0501044_0144739 | 3300049823 | Bacteria | 2363 |
| 953 | Ga0501044_0269055 | 3300049823 | Bacteria | 1640 |
| 954 | Ga0501044_0289299 | 3300049823 | Bacteria | 1570 |
| 955 | Ga0501045_0308995 | 3300049824 | Bacteria | 1177 |
| 956 | nmdc:mga03n38_27807_c1 | 3300050490 | Bacteria | 2350 |
| 957 | nmdc:mga03n38_650_c1 | 3300050490 | Bacteria | 8920 |
| 958 | nmdc:mga00v17_23318_c1 | 3300050491 | Bacteria | 3578 |
| 959 | nmdc:mga00v17_47739_c1 | 3300050491 | Bacteria | 2594 |
| 960 | nmdc:mga0yw44_10192_c1 | 3300050492 | Bacteria | 4790 |
| 961 | nmdc:mga0k408_21025_c1 | 3300050493 | Bacteria | 3663 |
| 962 | nmdc:mga06z11_17054_c1 | 3300050494 | Bacteria | 3287 |
| 963 | nmdc:mga07m45_146538_c1 | 3300050496 | Bacteria | 1368 |
| 964 | nmdc:mga05p37_102_c1 | 3300050507 | Bacteria | 69207 |
| 965 | nmdc:mga05p37_702892_c1 | 3300050507 | Unclassified | 1123 |
| 966 | nmdc:mga09592_752_c1 | 3300050508 | Bacteria | 24935 |
| 967 | nmdc:mga0qj67_49003_c1 | 3300050509 | Bacteria | 3339 |
| 968 | nmdc:mga08y16_129558_c1 | 3300050511 | Bacteria | 2624 |
| 969 | nmdc:mga08y16_3146_c1 | 3300050511 | Bacteria | 17090 |
| 970 | nmdc:mga08y16_3939_c1 | 3300050511 | Bacteria | 15466 |
| 971 | nmdc:mga08y16_421689_c1 | 3300050511 | Bacteria | 1364 |
| 972 | nmdc:mga0n895_109560_c1 | 3300050512 | Bacteria | 2777 |
| 973 | nmdc:mga0n895_143242_c1 | 3300050512 | Bacteria | 2419 |
| 974 | nmdc:mga0n895_213610_c1 | 3300050512 | Bacteria | 1959 |
| 975 | nmdc:mga0n895_253364_c1 | 3300050512 | Unclassified | 1786 |
| 976 | nmdc:mga0n895_5770_c1 | 3300050512 | Bacteria | 10394 |
| 977 | nmdc:mga0n895_71912_c1 | 3300050512 | Bacteria | 3430 |
| 978 | nmdc:mga0n895_85445_c1 | 3300050512 | Bacteria | 3150 |
| 979 | nmdc:mga0rr50_73847_c1 | 3300050513 | Bacteria | 2609 |
| 980 | nmdc:mga0rr50_94079_c1 | 3300050513 | Unclassified | 2339 |
| 981 | nmdc:mga08x19_115687_c1 | 3300050514 | Bacteria | 1793 |
| 982 | nmdc:mga0a205_100156_c1 | 3300050515 | Bacteria | 2796 |
| 983 | nmdc:mga0a205_1990_c1 | 3300050515 | Bacteria | 17809 |
| 984 | nmdc:mga0a205_63990_c1 | 3300050515 | Bacteria | 3553 |
| 985 | nmdc:mga0sz30_107142_c1 | 3300050516 | Bacteria | 1223 |
| 986 | nmdc:mga0sz30_76087_c1 | 3300050516 | Bacteria | 1449 |
| 987 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 988 | Ga0495601_0000549 | 3300053077 | Bacteria | 19855 |
| 989 | Ga0495601_0002952 | 3300053077 | Bacteria | 9664 |
| 990 | Ga0495601_0003164 | 3300053077 | Bacteria | 9431 |
| 991 | Ga0495601_0003593 | 3300053077 | Bacteria | 8919 |
| 992 | Ga0495601_0003797 | 3300053077 | Bacteria | 8699 |
| 993 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 994 | Ga0495612_0000786 | 3300053078 | Bacteria | 12913 |
| 995 | Ga0495612_0010350 | 3300053078 | Bacteria | 3773 |
| 996 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 997 | Ga0495595_0000223 | 3300053084 | Bacteria | 22663 |
| 998 | Ga0495595_0001566 | 3300053084 | Bacteria | 8928 |
| 999 | Ga0495595_0007201 | 3300053084 | Bacteria | 4547 |
| 1000 | Ga0495619_0000229 | 3300053085 | Bacteria | 40785 |
| 1001 | Ga0495619_0000240 | 3300053085 | Bacteria | 39732 |
| 1002 | Ga0495619_0001121 | 3300053085 | Bacteria | 17592 |
| 1003 | Ga0495619_0001653 | 3300053085 | Bacteria | 14709 |
| 1004 | Ga0495619_0002881 | 3300053085 | Bacteria | 11182 |
| 1005 | Ga0495619_0014367 | 3300053085 | Bacteria | 4999 |
| 1006 | Ga0495619_0086681 | 3300053085 | Unclassified | 2116 |
| 1007 | Ga0500643_001600 | 3300053087 | Bacteria | 12762 |
| 1008 | Ga0500644_0000641 | 3300053088 | Bacteria | 13016 |
| 1009 | Ga0500562_048330 | 3300053108 | Unclassified | 1136 |
| 1010 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1011 | Ga0500568_0016709 | 3300053139 | Bacteria | 3254 |
| 1012 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1013 | Ga0500616_0129409 | 3300053153 | Bacteria | 1194 |
| 1014 | Ga0500645_000015 | 3300053730 | Bacteria | 150140 |
| 1015 | Ga0501082_0000046 | 3300060353 | Bacteria | 86307 |
| 1016 | Ga0501082_0022339 | 3300060353 | Bacteria | 5450 |
| 1017 | Ga0501082_0059313 | 3300060353 | Unclassified | 3298 |
| 1018 | Ga0501082_0172470 | 3300060353 | Bacteria | 1880 |
| 1019 | Ga0501082_0243431 | 3300060353 | Bacteria | 1565 |
| 1020 | 2643755367 | 2643221547 | Bacteria | 4740017 |
| 1021 | Ga0068855_100454150 | |||
| 1022 | 2214884084 | |||
| 1023 | ARcpr5oldR_c000026 | |||
| 1024 | ARSoilYngRDRAFT_c00029 | |||
| 1025 | ARcpr5yngRDRAFT_c000044 | |||
| 1026 | ARSoilOldRDRAFT_c000037 | |||
| 1027 | ARCol0oldRDRAFT_c00240 | |||
| 1028 | ARCol0yngRDRAFT_1000020 | |||
| 1029 | JGI24746J21847_1001748 | |||
| 1030 | JGI24739J22299_10003786 | |||
| 1031 | JGI24737J22298_10005485 | |||
| 1032 | JGI24750J21931_1000198 | |||
| 1033 | JGI24738J21930_10000052 | |||
| 1034 | JGI24749J21850_1000597 | |||
| 1035 | JGI24742J22300_10002032 | |||
| 1036 | JGI24751J29686_10008188 | |||
| 1037 | JGI25406J46586_10005868 | |||
| 1038 | Ga0065704_10120387 | |||
| 1039 | Ga0065712_10001891 | |||
| 1040 | Ga0065712_10003129 | |||
| 1041 | Ga0065715_10001815 | |||
| 1042 | Ga0065707_10007556 | |||
| 1043 | Ga0070658_10025338 | |||
| 1044 | Ga0070658_10031715 | |||
| 1045 | Ga0070676_10008754 | |||
| 1046 | Ga0070676_10037233 | |||
| 1047 | Ga0070676_10055717 | |||
| 1048 | Ga0070676_10082248 | |||
| 1049 | Ga0070683_100052294 | |||
| 1050 | Ga0070683_100090687 | |||
| 1051 | Ga0070683_100392539 | |||
| 1052 | Ga0070683_100395300 | |||
| 1053 | Ga0070690_100122512 | |||
| 1054 | Ga0070690_100128763 | |||
| 1055 | Ga0070670_100016798 | |||
| 1056 | Ga0070670_100259375 | |||
| 1057 | Ga0070677_10000009 | |||
| 1058 | Ga0070677_10095923 | |||
| 1059 | Ga0068869_100006664 | |||
| 1060 | Ga0070666_10129048 | |||
| 1061 | Ga0070666_10156480 | |||
| 1062 | Ga0070680_100027056 | |||
| 1063 | Ga0070680_100035562 | |||
| 1064 | Ga0070680_100036212 | |||
| 1065 | Ga0070680_100059601 | |||
| 1066 | Ga0070680_100189409 | |||
| 1067 | Ga0070682_100031935 | |||
| 1068 | Ga0070682_100048621 | |||
| 1069 | Ga0068868_100006618 | |||
| 1070 | Ga0068868_100170642 | |||
| 1071 | Ga0070660_100001398 | |||
| 1072 | Ga0070660_100081553 | |||
| 1073 | Ga0070660_100233018 | |||
| 1074 | Ga0070689_100011661 | |||
| 1075 | Ga0070689_100027243 | |||
| 1076 | Ga0070691_10000769 | |||
| 1077 | Ga0070691_10134665 | |||
| 1078 | Ga0070687_100000649 | |||
| 1079 | Ga0070687_100012429 | |||
| 1080 | Ga0070687_100176227 | |||
| 1081 | Ga0070661_100001106 | |||
| 1082 | Ga0070661_100161260 | |||
| 1083 | Ga0070692_10000072 | |||
| 1084 | Ga0070668_100005480 | |||
| 1085 | Ga0070669_100009459 | |||
| 1086 | Ga0070669_100350212 | |||
| 1087 | Ga0070675_100002349 | |||
| 1088 | Ga0070675_100029169 | |||
| 1089 | Ga0070675_100130532 | |||
| 1090 | Ga0070675_100324943 | |||
| 1091 | Ga0070671_100000438 | |||
| 1092 | Ga0070671_100045645 | |||
| 1093 | Ga0070671_100050521 | |||
| 1094 | Ga0070671_100089563 | |||
| 1095 | Ga0070671_100223436 | |||
| 1096 | Ga0070674_100001976 | |||
| 1097 | Ga0070674_100071552 | |||
| 1098 | Ga0070674_100191438 | |||
| 1099 | Ga0070673_100001186 | |||
| 1100 | Ga0070673_100080451 | |||
| 1101 | Ga0070688_100035736 | |||
| 1102 | Ga0070688_100153477 | |||
| 1103 | Ga0070659_100013978 | |||
| 1104 | Ga0070659_100288144 | |||
| 1105 | Ga0070667_100005963 | |||
| 1106 | Ga0070667_100101873 | |||
| 1107 | Ga0070667_100159717 | |||
| 1108 | Ga0070703_10005335 | |||
| 1109 | Ga0070709_10008201 | |||
| 1110 | Ga0070709_10144177 | |||
| 1111 | Ga0070714_100052973 | |||
| 1112 | Ga0070714_100084308 | |||
| 1113 | Ga0070714_100171127 | |||
| 1114 | Ga0070710_10010269 | |||
| 1115 | Ga0070710_10015527 | |||
| 1116 | Ga0070701_10000339 | |||
| 1117 | Ga0070711_100067290 | |||
| 1118 | Ga0070711_100110019 | |||
| 1119 | Ga0070705_100003054 | |||
| 1120 | Ga0070705_100050327 | |||
| 1121 | Ga0070705_100070392 | |||
| 1122 | Ga0070700_100000783 | |||
| 1123 | Ga0070694_100014187 | |||
| 1124 | Ga0070694_100061664 | |||
| 1125 | Ga0070708_100096571 | |||
| 1126 | Ga0070663_100027744 | |||
| 1127 | Ga0070663_100040500 | |||
| 1128 | Ga0070663_100042928 | |||
| 1129 | Ga0070663_100056778 | |||
| 1130 | Ga0070678_100019814 | |||
| 1131 | Ga0070678_100021372 | |||
| 1132 | Ga0070678_100247523 | |||
| 1133 | Ga0070662_100036455 | |||
| 1134 | Ga0070662_100044877 | |||
| 1135 | Ga0070681_10013056 | |||
| 1136 | Ga0070681_10027156 | |||
| 1137 | Ga0070681_10030773 | |||
| 1138 | Ga0070681_10054338 | |||
| 1139 | Ga0070681_10311605 | |||
| 1140 | Ga0070681_10424403 | |||
| 1141 | Ga0068867_100008659 | |||
| 1142 | Ga0068867_100053124 | |||
| 1143 | Ga0070685_10033306 | |||
| 1144 | Ga0070679_100009564 | |||
| 1145 | Ga0070679_100036942 | |||
| 1146 | Ga0070679_100077914 | |||
| 1147 | Ga0070679_100079137 | |||
| 1148 | Ga0070679_100146078 | |||
| 1149 | Ga0070684_100004598 | |||
| 1150 | Ga0070684_100038335 | |||
| 1151 | Ga0068853_100011358 | |||
| 1152 | Ga0070672_100012109 | |||
| 1153 | Ga0070672_100070968 | |||
| 1154 | Ga0070686_100009064 | |||
| 1155 | Ga0070686_100154504 | |||
| 1156 | Ga0070695_100005496 | |||
| 1157 | Ga0070695_100053264 | |||
| 1158 | Ga0070695_100097589 | |||
| 1159 | Ga0070696_100006579 | |||
| 1160 | Ga0070696_100045218 | |||
| 1161 | Ga0070696_100243912 | |||
| 1162 | Ga0070693_100000577 | |||
| 1163 | Ga0070693_100061065 | |||
| 1164 | Ga0070693_100069591 | |||
| 1165 | Ga0070665_100000011 | |||
| 1166 | Ga0070665_100028823 | |||
| 1167 | Ga0070665_100457838 | |||
| 1168 | Ga0070665_100527826 | |||
| 1169 | Ga0070704_100074354 | |||
| 1170 | Ga0068855_100020938 | |||
| 1171 | Ga0068855_100021980 | |||
| 1172 | Ga0068855_100031300 | |||
| 1173 | Ga0068855_100054081 | |||
| 1174 | Ga0068855_100267153 | |||
| 1175 | Ga0070664_100024388 | |||
| 1176 | Ga0070664_100028348 | |||
| 1177 | Ga0070664_100039420 | |||
| 1178 | Ga0070664_100587985 | |||
| 1179 | Ga0068857_100000295 | |||
| 1180 | Ga0068857_100278654 | |||
| 1181 | Ga0068857_100278936 | |||
| 1182 | Ga0068854_100012062 | |||
| 1183 | Ga0068854_100361370 | |||
| 1184 | Ga0068856_100013620 | |||
| 1185 | Ga0068856_100301719 | |||
| 1186 | Ga0070702_100000267 | |||
| 1187 | Ga0070702_100140653 | |||
| 1188 | Ga0070702_100258691 | |||
| 1189 | Ga0068852_100001086 | |||
| 1190 | Ga0068852_100007303 | |||
| 1191 | Ga0068852_100313908 | |||
| 1192 | Ga0068859_100021829 | |||
| 1193 | Ga0068859_100148033 | |||
| 1194 | Ga0068859_100171998 | |||
| 1195 | Ga0068864_100001366 | |||
| 1196 | Ga0068864_100079048 | |||
| 1197 | Ga0068866_10002521 | |||
| 1198 | Ga0068866_10046718 | |||
| 1199 | Ga0068861_100001047 | |||
| 1200 | Ga0068863_100003728 | |||
| 1201 | Ga0068863_100079799 | |||
| 1202 | Ga0068858_100063453 | |||
| 1203 | Ga0068858_100153698 | |||
| 1204 | Ga0068858_100257556 | |||
| 1205 | Ga0068860_100024719 | |||
| 1206 | Ga0068860_100232017 | |||
| 1207 | Ga0068862_100036350 | |||
| 1208 | Ga0068862_100521493 | |||
| 1209 | Ga0081455_10000012 | |||
| 1210 | Ga0081455_10007757 | |||
| 1211 | Ga0081455_10013123 | |||
| 1212 | Ga0081538_10015675 | |||
| 1213 | Ga0081540_1010900 | |||
| 1214 | Ga0081539_10002061 | |||
| 1215 | Ga0070717_10032001 | |||
| 1216 | Ga0075365_10010162 | |||
| 1217 | Ga0075365_10132634 | |||
| 1218 | Ga0075363_100000067 | |||
| 1219 | Ga0070715_10010844 | |||
| 1220 | Ga0070712_100021077 | |||
| 1221 | Ga0070712_100038876 | |||
| 1222 | Ga0075362_10004658 | |||
| 1223 | Ga0075362_10027285 | |||
| 1224 | Ga0075367_10134281 | |||
| 1225 | Ga0075367_10163363 | |||
| 1226 | Ga0075369_10087922 | |||
| 1227 | Ga0075366_10000504 | |||
| 1228 | Ga0097621_100000421 | |||
| 1229 | Ga0097621_100097277 | |||
| 1230 | Ga0097621_100330119 | |||
| 1231 | Ga0068871_100000515 | |||
| 1232 | Ga0068871_100024613 | |||
| 1233 | Ga0075428_100660113 | |||
| 1234 | Ga0075430_100005350 | |||
| 1235 | Ga0075433_10094190 | |||
| 1236 | Ga0075433_10116669 | |||
| 1237 | Ga0075434_100000693 | |||
| 1238 | Ga0075434_100061772 | |||
| 1239 | Ga0075434_100083839 | |||
| 1240 | Ga0075434_100097810 | |||
| 1241 | Ga0068865_100029576 | |||
| 1242 | Ga0068865_100064789 | |||
| 1243 | Ga0075436_100112663 | |||
| 1244 | Ga0097620_100021830 | |||
| 1245 | Ga0097620_100148036 | |||
| 1246 | Ga0097620_100172007 | |||
| 1247 | Ga0105251_10102907 | |||
| 1248 | Ga0105240_10034247 | |||
| 1249 | Ga0105240_10156710 | |||
| 1250 | Ga0111539_10000373 | |||
| 1251 | Ga0111539_10005607 | |||
| 1252 | Ga0111539_10027506 | |||
| 1253 | Ga0111539_10441025 | |||
| 1254 | Ga0111539_10490067 | |||
| 1255 | Ga0111539_10724475 | |||
| 1256 | Ga0105245_10016444 | |||
| 1257 | Ga0105245_10125708 | |||
| 1258 | Ga0105245_10146407 | |||
| 1259 | Ga0105247_10005559 | |||
| 1260 | Ga0105247_10046246 | |||
| 1261 | Ga0105247_10067554 | |||
| 1262 | Ga0114129_10191179 | |||
| 1263 | Ga0114129_10795135 | |||
| 1264 | Ga0105243_10002574 | |||
| 1265 | Ga0105243_10030471 | |||
| 1266 | Ga0105243_10066661 | |||
| 1267 | Ga0105243_10074638 | |||
| 1268 | Ga0105243_10252971 | |||
| 1269 | Ga0105243_10391254 | |||
| 1270 | Ga0105241_10005339 | |||
| 1271 | Ga0105241_10061919 | |||
| 1272 | Ga0105241_10086181 | |||
| 1273 | Ga0105241_10226551 | |||
| 1274 | Ga0105241_10235080 | |||
| 1275 | Ga0105242_10004599 | |||
| 1276 | Ga0105242_10098654 | |||
| 1277 | Ga0105242_10321376 | |||
| 1278 | Ga0105248_10000821 | |||
| 1279 | Ga0105248_10019527 | |||
| 1280 | Ga0105248_10038612 | |||
| 1281 | Ga0105248_10283434 | |||
| 1282 | Ga0105248_10421338 | |||
| 1283 | Ga0105237_10032224 | |||
| 1284 | Ga0105237_10060496 | |||
| 1285 | Ga0105237_10077895 | |||
| 1286 | Ga0105237_10197116 | |||
| 1287 | Ga0105237_10216677 | |||
| 1288 | Ga0105238_10047955 | |||
| 1289 | Ga0105238_10093005 | |||
| 1290 | Ga0105238_10267237 | |||
| 1291 | Ga0105238_10274650 | |||
| 1292 | Ga0105249_10014562 | |||
| 1293 | Ga0105249_10043584 | |||
| 1294 | Ga0105249_10184446 | |||
| 1295 | Ga0105239_10004537 | |||
| 1296 | Ga0105239_10077459 | |||
| 1297 | Ga0105239_10190933 | |||
| 1298 | Ga0105239_10297270 | |||
| 1299 | Ga0105246_10001092 | |||
| 1300 | Ga0105246_10025894 | |||
| 1301 | Ga0157335_1000301 | |||
| 1302 | Ga0157373_10077569 | |||
| 1303 | Ga0157371_10007315 | |||
| 1304 | Ga0157370_10191988 | |||
| 1305 | Ga0157370_10274147 | |||
| 1306 | Ga0157369_10247517 | |||
| 1307 | Ga0157374_10037579 | |||
| 1308 | Ga0157374_10086663 | |||
| 1309 | Ga0157378_10002005 | |||
| 1310 | Ga0157378_10047633 | |||
| 1311 | Ga0157378_10067689 | |||
| 1312 | Ga0157378_10068432 | |||
| 1313 | Ga0157378_10505196 | |||
| 1314 | Ga0163162_10005029 | |||
| 1315 | Ga0163162_10024612 | |||
| 1316 | Ga0163162_10100054 | |||
| 1317 | Ga0163162_10115707 | |||
| 1318 | Ga0157372_10075453 | |||
| 1319 | Ga0157372_10136160 | |||
| 1320 | Ga0157372_10217855 | |||
| 1321 | Ga0157375_10005227 | |||
| 1322 | Ga0157375_10075628 | |||
| 1323 | Ga0157375_10125652 | |||
| 1324 | Ga0157375_10169755 | |||
| 1325 | Ga0157375_10339972 | |||
| 1326 | Ga0163163_10005574 | |||
| 1327 | Ga0163163_10012667 | |||
| 1328 | Ga0163163_10037725 | |||
| 1329 | Ga0163163_10175984 | |||
| 1330 | Ga0157380_10001279 | |||
| 1331 | Ga0157380_10142215 | |||
| 1332 | Ga0157377_10000312 | |||
| 1333 | Ga0157379_10001989 | |||
| 1334 | Ga0157379_10024779 | |||
| 1335 | Ga0157379_10077270 | |||
| 1336 | Ga0157379_10378975 | |||
| 1337 | Ga0157376_10008937 | |||
| 1338 | Ga0157376_10130042 | |||
| 1339 | Ga0163161_10003480 | |||
| 1340 | Ga0163161_10059527 | |||
| 1341 | Ga0206353_10296623 | |||
| 1342 | Ga0213876_10002175 | |||
| 1343 | Ga0213875_10000182 | |||
| 1344 | Ga0207666_1000038 | |||
| 1345 | Ga0207666_1000832 | |||
| 1346 | Ga0207697_10000373 | |||
| 1347 | Ga0207697_10022605 | |||
| 1348 | Ga0207713_1042190 | |||
| 1349 | Ga0207653_10001598 | |||
| 1350 | Ga0207653_10004919 | |||
| 1351 | Ga0207682_10000071 | |||
| 1352 | Ga0207682_10002800 | |||
| 1353 | Ga0207692_10043913 | |||
| 1354 | Ga0207692_10059524 | |||
| 1355 | Ga0207642_10001427 | |||
| 1356 | Ga0207642_10086838 | |||
| 1357 | Ga0207710_10010642 | |||
| 1358 | Ga0207710_10074943 | |||
| 1359 | Ga0207688_10000237 | |||
| 1360 | Ga0207688_10069383 | |||
| 1361 | Ga0207688_10118139 | |||
| 1362 | Ga0207647_10027371 | |||
| 1363 | Ga0207647_10062229 | |||
| 1364 | Ga0207685_10118945 | |||
| 1365 | Ga0207699_10020664 | |||
| 1366 | Ga0207699_10068631 | |||
| 1367 | Ga0207645_10000779 | |||
| 1368 | Ga0207645_10040218 | |||
| 1369 | Ga0207645_10044402 | |||
| 1370 | Ga0207645_10154019 | |||
| 1371 | Ga0207643_10000276 | |||
| 1372 | Ga0207643_10029334 | |||
| 1373 | Ga0207705_10029831 | |||
| 1374 | Ga0207705_10060824 | |||
| 1375 | Ga0207654_10000498 | |||
| 1376 | Ga0207654_10034577 | |||
| 1377 | Ga0207654_10171711 | |||
| 1378 | Ga0207707_10000454 | |||
| 1379 | Ga0207707_10068214 | |||
| 1380 | Ga0207707_10367116 | |||
| 1381 | Ga0207671_10018444 | |||
| 1382 | Ga0207693_10007602 | |||
| 1383 | Ga0207693_10014845 | |||
| 1384 | Ga0207663_10009339 | |||
| 1385 | Ga0207663_10222489 | |||
| 1386 | Ga0207660_10000087 | |||
| 1387 | Ga0207660_10166951 | |||
| 1388 | Ga0207660_10214329 | |||
| 1389 | Ga0207662_10000659 | |||
| 1390 | Ga0207662_10032387 | |||
| 1391 | Ga0207657_10003101 | |||
| 1392 | Ga0207657_10005173 | |||
| 1393 | Ga0207657_10014279 | |||
| 1394 | Ga0207657_10029186 | |||
| 1395 | Ga0207657_10224137 | |||
| 1396 | Ga0207649_10000662 | |||
| 1397 | Ga0207652_10001908 | |||
| 1398 | Ga0207652_10041189 | |||
| 1399 | Ga0207652_10069666 | |||
| 1400 | Ga0207652_10150851 | |||
| 1401 | Ga0207652_10157309 | |||
| 1402 | Ga0207681_10001262 | |||
| 1403 | Ga0207681_10074523 | |||
| 1404 | Ga0207694_10034810 | |||
| 1405 | Ga0207694_10053463 | |||
| 1406 | Ga0207650_10000908 | |||
| 1407 | Ga0207650_10029948 | |||
| 1408 | Ga0207659_10000143 | |||
| 1409 | Ga0207659_10099330 | |||
| 1410 | Ga0207687_10044186 | |||
| 1411 | Ga0207700_10000323 | |||
| 1412 | Ga0207664_10046302 | |||
| 1413 | Ga0207664_10143527 | |||
| 1414 | Ga0207664_10501104 | |||
| 1415 | Ga0207644_10000532 | |||
| 1416 | Ga0207644_10042639 | |||
| 1417 | Ga0207644_10129855 | |||
| 1418 | Ga0207644_10198086 | |||
| 1419 | Ga0207690_10000409 | |||
| 1420 | Ga0207706_10001338 | |||
| 1421 | Ga0207706_10006493 | |||
| 1422 | Ga0207706_10039341 | |||
| 1423 | Ga0207706_10055553 | |||
| 1424 | Ga0207706_10074710 | |||
| 1425 | Ga0207686_10000500 | |||
| 1426 | Ga0207686_10032022 | |||
| 1427 | Ga0207709_10001266 | |||
| 1428 | Ga0207709_10045185 | |||
| 1429 | Ga0207709_10157246 | |||
| 1430 | Ga0207670_10023942 | |||
| 1431 | Ga0207669_10001043 | |||
| 1432 | Ga0207669_10031236 | |||
| 1433 | Ga0207669_10225986 | |||
| 1434 | Ga0207704_10023287 | |||
| 1435 | Ga0207704_10221139 | |||
| 1436 | Ga0207704_10443199 | |||
| 1437 | Ga0207665_10001537 | |||
| 1438 | Ga0207665_10056821 | |||
| 1439 | Ga0207665_10076302 | |||
| 1440 | Ga0207665_10128950 | |||
| 1441 | Ga0207691_10003339 | |||
| 1442 | Ga0207711_10004435 | |||
| 1443 | Ga0207711_10047133 | |||
| 1444 | Ga0207711_10091308 | |||
| 1445 | Ga0207711_10143291 | |||
| 1446 | Ga0207711_10499035 | |||
| 1447 | Ga0207689_10000440 | |||
| 1448 | Ga0207689_10051013 | |||
| 1449 | Ga0207661_10006110 | |||
| 1450 | Ga0207661_10091223 | |||
| 1451 | Ga0207679_10000131 | |||
| 1452 | Ga0207679_10039093 | |||
| 1453 | Ga0207679_10057881 | |||
| 1454 | Ga0207667_10014577 | |||
| 1455 | Ga0207667_10018606 | |||
| 1456 | Ga0207667_10040968 | |||
| 1457 | Ga0207651_10000335 | |||
| 1458 | Ga0207651_10083390 | |||
| 1459 | Ga0207712_10024327 | |||
| 1460 | Ga0207712_10298100 | |||
| 1461 | Ga0207668_10000065 | |||
| 1462 | Ga0207668_10307481 | |||
| 1463 | Ga0207640_10000339 | |||
| 1464 | Ga0207640_10088894 | |||
| 1465 | Ga0207658_10050040 | |||
| 1466 | Ga0207658_10178177 | |||
| 1467 | Ga0207658_10204296 | |||
| 1468 | Ga0207677_10008507 | |||
| 1469 | Ga0207703_10000217 | |||
| 1470 | Ga0207703_10034607 | |||
| 1471 | Ga0207703_10161630 | |||
| 1472 | Ga0207703_10180470 | |||
| 1473 | Ga0207639_10004757 | |||
| 1474 | Ga0207639_10028833 | |||
| 1475 | Ga0207678_10000944 | |||
| 1476 | Ga0207678_10024036 | |||
| 1477 | Ga0207678_10037793 | |||
| 1478 | Ga0207678_10073774 | |||
| 1479 | Ga0207678_10108052 | |||
| 1480 | Ga0207678_10224196 | |||
| 1481 | Ga0207708_10002019 | |||
| 1482 | Ga0207708_10045518 | |||
| 1483 | Ga0207702_10021867 | |||
| 1484 | Ga0207702_10179647 | |||
| 1485 | Ga0207702_10180726 | |||
| 1486 | Ga0207702_10217437 | |||
| 1487 | Ga0207641_10004083 | |||
| 1488 | Ga0207641_10008795 | |||
| 1489 | Ga0207641_10055511 | |||
| 1490 | Ga0207641_10062668 | |||
| 1491 | Ga0207648_10004730 | |||
| 1492 | Ga0207648_10023044 | |||
| 1493 | Ga0207648_10120841 | |||
| 1494 | Ga0207676_10016120 | |||
| 1495 | Ga0207676_10073144 | |||
| 1496 | Ga0207676_10231965 | |||
| 1497 | Ga0207674_10005364 | |||
| 1498 | Ga0207674_10394557 | |||
| 1499 | Ga0207675_100000815 | |||
| 1500 | Ga0207675_100011636 | |||
| 1501 | Ga0207683_10000001 | |||
| 1502 | Ga0207683_10008849 | |||
| 1503 | Ga0207698_10029932 | |||
| 1504 | Ga0207698_10118425 | |||
| 1505 | Ga0209966_1006261 | |||
| 1506 | Ga0209998_10001227 | |||
| 1507 | Ga0207428_10000172 | |||
| 1508 | Ga0207428_10000255 | |||
| 1509 | Ga0207428_10003313 | |||
| 1510 | Ga0268266_10000058 | |||
| 1511 | Ga0268266_10075314 | |||
| 1512 | Ga0268266_10147240 | |||
| 1513 | Ga0268265_10008830 | |||
| 1514 | Ga0268264_10001153 | |||
| 1515 | Ga0268264_10110097 | |||
| 1516 | Ga0268264_10281314 | |||
| 1517 | Ga0268264_10418141 | |||
| 1518 | Ga0265337_1001632 | |||
| 1519 | Ga0265338_10017850 | |||
| 1520 | Ga0265338_10028383 | |||
| 1521 | Ga0265330_10053973 | |||
| 1522 | Ga0265320_10006878 | |||
| 1523 | Ga0265325_10000320 | |||
| 1524 | Ga0265325_10000901 | |||
| 1525 | Ga0265325_10001624 | |||
| 1526 | Ga0265325_10101179 | |||
| 1527 | Ga0265329_10020324 | |||
| 1528 | Ga0265340_10016322 | |||
| 1529 | Ga0265340_10032433 | |||
| 1530 | Ga0265340_10065244 | |||
| 1531 | Ga0265339_10000387 | |||
| 1532 | Ga0265339_10079762 | |||
| 1533 | Ga0265339_10100257 | |||
| 1534 | Ga0265331_10043978 | |||
| 1535 | Ga0265316_10020862 | |||
| 1536 | Ga0265316_10064204 | |||
| 1537 | Ga0265316_10133386 | |||
| 1538 | Ga0265313_10000216 | |||
| 1539 | Ga0265313_10000850 | |||
| 1540 | Ga0265313_10005527 | |||
| 1541 | Ga0265313_10020239 | |||
| 1542 | Ga0265313_10032153 | |||
| 1543 | Ga0265313_10058569 | |||
| 1544 | Ga0316579_10022646 | |||
| 1545 | Ga0265342_10000196 | |||
| 1546 | Ga0265342_10011087 | |||
| 1547 | Ga0265342_10013456 | |||
| 1548 | Ga0265342_10043273 | |||
| 1549 | Ga0373930_0000014 | |||
| 1550 | Ga0373948_0000311 | |||
| 1551 | Ga0373950_0014396 | |||
| 1552 | Ga0373958_0000064 | |||
| 1553 | Ga0373958_0005156 | |||
| 1554 | Ga0373959_0000998 | |||
| 1555 | Ga0373928_0009438 | |||
| 1556 | Ga0373929_0000101 | |||
| 1557 | Ga0373934_0080537 | |||
| 1558 | Ga0373934_0089587 | |||
| 1559 | Ga0373940_0000387 | |||
| 1560 | Ga0373944_0019935 | |||
| 1561 | Ga0373949_0000293 | |||
| 1562 | Ga0373951_0000622 | |||
| 1563 | Ga0373952_0000030 | |||
| 1564 | Ga0373952_0004196 | |||
| 1565 | Ga0373923_0026423 | |||
| 1566 | Ga0373923_0053730 | |||
| 1567 | Ga0373932_0000489 | |||
| 1568 | Ga0373932_0002527 | |||
| 1569 | Ga0373932_0003729 | |||
| 1570 | Ga0373936_0018281 | |||
| 1571 | Ga0373939_0000851 | |||
| 1572 | Ga0373939_0002295 | |||
| 1573 | Ga0373939_0003114 | |||
| 1574 | Ga0373941_0000823 | |||
| 1575 | Ga0373941_0002224 | |||
| 1576 | Ga0373945_0004713 | |||
| 1577 | Ga0373945_0015386 | |||
| 1578 | Ga0373945_0019764 | |||
| 1579 | Ga0373953_0007900 | |||
| 1580 | Ga0373953_0024755 | |||
| 1581 | Ga0373954_0001907 | |||
| 1582 | Ga0373954_0011991 | |||
| 1583 | Ga0373954_0013565 | |||
| 1584 | Ga0373954_0015835 | |||
| 1585 | Ga0373956_0014440 | |||
| 1586 | Ga0373957_0002197 | |||
| 1587 | Ga0373957_0035201 | |||
| 1588 | Ga0373957_0054785 | |||
| 1589 | Ga0373960_0002164 | |||
| 1590 | Ga0373943_0005719 | |||
| 1591 | Ga0373943_0008406 | |||
| 1592 | Ga0373943_0008838 | |||
| 1593 | Ga0373943_0027468 | |||
| 1594 | Ga0373943_0050946 | |||
| 1595 | Ga0373946_0000496 | |||
| 1596 | Ga0373946_0031061 | |||
| 1597 | Ga0373946_0036827 | |||
| 1598 | Ga0373955_0000780 | |||
| 1599 | Ga0373955_0002744 | |||
| 1600 | Ga0373955_0002991 | |||
| 1601 | Ga0373955_0026980 | |||
| 1602 | Ga0373955_0027586 | |||
| 1603 | Ga0373955_0164410 | |||
| 1604 | Ga0373942_0000073 | |||
| 1605 | Ga0373942_0001348 | |||
| 1606 | Ga0373961_0000480 | |||
| 1607 | Ga0373961_0058041 | |||
| 1608 | Ga0373924_0000612 | |||
| 1609 | Ga0373931_0000537 | |||
| 1610 | Ga0373931_0005818 | |||
| 1611 | Ga0373931_0007041 | |||
| 1612 | Ga0373935_0000018 | |||
| 1613 | Ga0373935_0012572 | |||
| 1614 | Ga0373935_0020195 | |||
| 1615 | Ga0373927_0004548 | |||
| 1616 | Ga0373933_0001624 | |||
| 1617 | Ga0373933_0007467 | |||
| 1618 | Ga0373933_0017014 | |||
| 1619 | Ga0373933_0055010 | |||
| 1620 | Ga0373933_0087093 | |||
| 1621 | Ga0373947_0026450 | |||
| 1622 | Ga0373947_0050393 | |||
| 1623 | Ga0373947_0194251 | |||
| 1624 | Ga0373937_0000054 | |||
| 1625 | Ga0373937_0000907 | |||
| 1626 | Ga0373937_0195170 | |||
| 1627 | Ga0373937_0286739 | |||
| 1628 | Ga0316582_0228345 | |||
| 1629 | Ga0373925_0000018 | |||
| 1630 | Ga0373925_0002911 | |||
| 1631 | Ga0373925_0011253 | |||
| 1632 | Ga0373925_0013922 | |||
| 1633 | Ga0373925_0086347 | |||
| 1634 | Ga0373925_0279863 | |||
| 1635 | Ga0373925_0581347 | |||
| 1636 | Ga0395900_0034835 | |||
| 1637 | Ga0395898_0001841 | |||
| 1638 | Ga0395898_0003941 | |||
| 1639 | Ga0395901_0024754 | |||
| 1640 | Ga0395901_0032894 | |||
| 1641 | Ga0395901_0279301 | |||
| 1642 | Ga0395901_0463828 | |||
| 1643 | Ga0242420_005653 | |||
| 1644 | Ga0436365_0320065 | |||
| 1645 | Ga0436365_0883242 | |||
| 1646 | Ga0436365_1263688 | |||
| 1647 | Ga0436365_1519653 | |||
| 1648 | Ga0436365_1707590 | |||
| 1649 | Ga0436365_1882402 | |||
| 1650 | Ga0439443_003449 | |||
| 1651 | Ga0439450_020261 | |||
| 1652 | Ga0439455_0033751 | |||
| 1653 | Ga0439435_0004656 | |||
| 1654 | Ga0439459_0022417 | |||
| 1655 | Ga0439464_0065545 | |||
| 1656 | Ga0466963_0003932 | |||
| 1657 | Ga0466963_0026169 | |||
| 1658 | Ga0466963_0097040 | |||
| 1659 | Ga0466971_0034852 | |||
| 1660 | Ga0466957_0115977 | |||
| 1661 | Ga0466959_0073406 | |||
| 1662 | Ga0466958_0066033 | |||
| 1663 | Ga0466958_0107784 | |||
| 1664 | Ga0466967_0000135 | |||
| 1665 | Ga0495592_0000001 | |||
| 1666 | Ga0495592_0001841 | |||
| 1667 | Ga0495592_0049907 | |||
| 1668 | Ga0495603_0001804 | |||
| 1669 | Ga0495603_0006399 | |||
| 1670 | Ga0495629_0001140 | |||
| 1671 | Ga0495629_0001999 | |||
| 1672 | Ga0495629_0012504 | |||
| 1673 | Ga0495629_0014702 | |||
| 1674 | Ga0495629_0122295 | |||
| 1675 | Ga0495638_0012011 | |||
| 1676 | Ga0495638_0118625 | |||
| 1677 | Ga0495641_0004661 | |||
| 1678 | Ga0495641_0037748 | |||
| 1679 | Ga0495641_0051670 | |||
| 1680 | Ga0495651_0003314 | |||
| 1681 | Ga0495651_0026886 | |||
| 1682 | Ga0495651_0262615 | |||
| 1683 | Ga0495653_0000015 | |||
| 1684 | Ga0495653_0002480 | |||
| 1685 | Ga0495653_0007463 | |||
| 1686 | Ga0495653_0097728 | |||
| 1687 | Ga0495653_0098713 | |||
| 1688 | Ga0495580_0019092 | |||
| 1689 | Ga0495580_0055410 | |||
| 1690 | Ga0495582_0000379 | |||
| 1691 | Ga0495582_0002467 | |||
| 1692 | Ga0495582_0023779 | |||
| 1693 | Ga0495582_0064200 | |||
| 1694 | Ga0495639_0003077 | |||
| 1695 | Ga0495639_0046612 | |||
| 1696 | Ga0495662_0001826 | |||
| 1697 | Ga0495662_0003041 | |||
| 1698 | Ga0495662_0154796 | |||
| 1699 | Ga0495664_0000001 | |||
| 1700 | Ga0495664_0012476 | |||
| 1701 | Ga0495664_0012757 | |||
| 1702 | Ga0495664_0021119 | |||
| 1703 | Ga0495594_0000628 | |||
| 1704 | Ga0495594_0035602 | |||
| 1705 | Ga0495607_0006681 | |||
| 1706 | Ga0495608_0001556 | |||
| 1707 | Ga0495608_0008407 | |||
| 1708 | Ga0495618_0000045 | |||
| 1709 | Ga0495618_0007081 | |||
| 1710 | Ga0495618_0084063 | |||
| 1711 | Ga0495628_0000005 | |||
| 1712 | Ga0495628_0003222 | |||
| 1713 | Ga0495628_0024916 | |||
| 1714 | Ga0495628_0052307 | |||
| 1715 | Ga0495630_0011378 | |||
| 1716 | Ga0495630_0012501 | |||
| 1717 | Ga0495630_0124505 | |||
| 1718 | Ga0495631_0021068 | |||
| 1719 | Ga0495644_0001849 | |||
| 1720 | Ga0495666_0001574 | |||
| 1721 | Ga0495666_0012617 | |||
| 1722 | Ga0495666_0012636 | |||
| 1723 | Ga0495642_0005501 | |||
| 1724 | Ga0495652_0000001 | |||
| 1725 | Ga0495652_0003251 | |||
| 1726 | Ga0495652_0033232 | |||
| 1727 | Ga0495652_0057717 | |||
| 1728 | Ga0495652_0097619 | |||
| 1729 | Ga0495665_0157533 | |||
| 1730 | Ga0495640_0000006 | |||
| 1731 | Ga0495640_0013464 | |||
| 1732 | Ga0495640_0045546 | |||
| 1733 | Ga0495640_0172772 | |||
| 1734 | Ga0495586_0003618 | |||
| 1735 | Ga0495587_0000012 | |||
| 1736 | Ga0495587_0004338 | |||
| 1737 | Ga0495587_0007680 | |||
| 1738 | Ga0495587_0011614 | |||
| 1739 | Ga0495587_0154112 | |||
| 1740 | Ga0495621_0045512 | |||
| 1741 | Ga0495645_0000004 | |||
| 1742 | Ga0495645_0001743 | |||
| 1743 | Ga0495622_0079789 | |||
| 1744 | Ga0495633_0004389 | |||
| 1745 | Ga0495667_0000001 | |||
| 1746 | Ga0495667_0000365 | |||
| 1747 | Ga0495667_0013452 | |||
| 1748 | Ga0495667_0018239 | |||
| 1749 | Ga0495667_0084282 | |||
| 1750 | Ga0495656_0000167 | |||
| 1751 | Ga0495634_0003795 | |||
| 1752 | Ga0495634_0011520 | |||
| 1753 | Ga0495634_0050513 | |||
| 1754 | Ga0495634_0075441 | |||
| 1755 | Ga0495634_0123291 | |||
| 1756 | Ga0495634_0152584 | |||
| 1757 | Ga0495635_0000007 | |||
| 1758 | Ga0495635_0000981 | |||
| 1759 | Ga0495635_0037835 | |||
| 1760 | Ga0495588_0072980 | |||
| 1761 | Ga0495657_0000250 | |||
| 1762 | Ga0495657_0014027 | |||
| 1763 | Ga0495657_0057996 | |||
| 1764 | Ga0495657_0086346 | |||
| 1765 | Ga0495599_0000002 | |||
| 1766 | Ga0495599_0004379 | |||
| 1767 | Ga0495599_0005186 | |||
| 1768 | Ga0495623_0001448 | |||
| 1769 | Ga0495623_0005930 | |||
| 1770 | Ga0495623_0046861 | |||
| 1771 | Ga0495646_0000049 | |||
| 1772 | Ga0495646_0000794 | |||
| 1773 | Ga0495646_0002316 | |||
| 1774 | Ga0495646_0182212 | |||
| 1775 | Ga0495647_0082373 | |||
| 1776 | Ga0495658_0000210 | |||
| 1777 | Ga0495658_0001195 | |||
| 1778 | Ga0495658_0002366 | |||
| 1779 | Ga0495658_0079220 | |||
| 1780 | Ga0495669_0077023 | |||
| 1781 | Ga0495613_0013585 | |||
| 1782 | Ga0495613_0082415 | |||
| 1783 | Ga0495624_0000222 | |||
| 1784 | Ga0495671_0028675 | |||
| 1785 | Ga0495600_0000388 | |||
| 1786 | Ga0495600_0004336 | |||
| 1787 | Ga0495581_0001772 | |||
| 1788 | Ga0495581_0065940 | |||
| 1789 | Ga0495581_0076044 | |||
| 1790 | Ga0495581_0094200 | |||
| 1791 | Ga0495604_0000007 | |||
| 1792 | Ga0495604_0002563 | |||
| 1793 | Ga0495604_0004482 | |||
| 1794 | Ga0495604_0006585 | |||
| 1795 | Ga0495604_0030840 | |||
| 1796 | Ga0495604_0201826 | |||
| 1797 | Ga0495674_0000001 | |||
| 1798 | Ga0495674_0001490 | |||
| 1799 | Ga0495674_0012662 | |||
| 1800 | Ga0495674_0020664 | |||
| 1801 | Ga0495674_0027967 | |||
| 1802 | Ga0495674_0084058 | |||
| 1803 | Ga0495674_0217737 | |||
| 1804 | Ga0495676_0000289 | |||
| 1805 | Ga0495676_0009583 | |||
| 1806 | Ga0495680_0001414 | |||
| 1807 | Ga0495680_0001759 | |||
| 1808 | Ga0495680_0013679 | |||
| 1809 | Ga0495680_0014248 | |||
| 1810 | Ga0495680_0017136 | |||
| 1811 | Ga0495680_0217010 | |||
| 1812 | Ga0495680_0335041 | |||
| 1813 | Ga0495675_0001296 | |||
| 1814 | Ga0495675_0003130 | |||
| 1815 | Ga0495675_0016877 | |||
| 1816 | Ga0495675_0101987 | |||
| 1817 | Ga0495677_0012556 | |||
| 1818 | Ga0495684_0000046 | |||
| 1819 | Ga0495684_0158192 | |||
| 1820 | Ga0495684_0178043 | |||
| 1821 | Ga0495593_0000935 | |||
| 1822 | Ga0495593_0002092 | |||
| 1823 | Ga0495602_0000004 | |||
| 1824 | Ga0495602_0006171 | |||
| 1825 | Ga0495602_0033711 | |||
| 1826 | Ga0495602_0126428 | |||
| 1827 | Ga0496100_0000759 | |||
| 1828 | Ga0496100_0069856 | |||
| 1829 | Ga0496100_0153165 | |||
| 1830 | Ga0496100_0281142 | |||
| 1831 | Ga0496101_0000423 | |||
| 1832 | Ga0496101_0012182 | |||
| 1833 | Ga0496101_0030759 | |||
| 1834 | Ga0496101_0033728 | |||
| 1835 | Ga0496101_0062062 | |||
| 1836 | Ga0496102_0003323 | |||
| 1837 | Ga0496102_0013302 | |||
| 1838 | Ga0496102_0027348 | |||
| 1839 | Ga0496102_0041199 | |||
| 1840 | Ga0496102_0051835 | |||
| 1841 | Ga0496103_0000998 | |||
| 1842 | Ga0496103_0006412 | |||
| 1843 | Ga0496103_0088306 | |||
| 1844 | Ga0496104_0001036 | |||
| 1845 | Ga0496104_0077394 | |||
| 1846 | Ga0496104_0285637 | |||
| 1847 | Ga0496105_0007270 | |||
| 1848 | Ga0496105_0030076 | |||
| 1849 | Ga0496105_0081793 | |||
| 1850 | Ga0496105_0118707 | |||
| 1851 | Ga0496105_0432166 | |||
| 1852 | Ga0496106_0002446 | |||
| 1853 | Ga0496106_0018622 | |||
| 1854 | Ga0496106_0041978 | |||
| 1855 | Ga0496106_0064133 | |||
| 1856 | Ga0496107_0000500 | |||
| 1857 | Ga0496107_0012166 | |||
| 1858 | Ga0496107_0035173 | |||
| 1859 | Ga0496107_0129242 | |||
| 1860 | Ga0496107_0222833 | |||
| 1861 | Ga0496108_0012575 | |||
| 1862 | Ga0496108_0090557 | |||
| 1863 | Ga0496108_0157647 | |||
| 1864 | Ga0496108_0394661 | |||
| 1865 | Ga0496109_0000359 | |||
| 1866 | Ga0496109_0000976 | |||
| 1867 | Ga0496109_0004488 | |||
| 1868 | Ga0496109_0076539 | |||
| 1869 | Ga0496109_0185890 | |||
| 1870 | Ga0496110_0017548 | |||
| 1871 | Ga0496110_0081293 | |||
| 1872 | Ga0496110_0319824 | |||
| 1873 | Ga0496111_0040873 | |||
| 1874 | Ga0496111_0041581 | |||
| 1875 | Ga0496111_0102889 | |||
| 1876 | Ga0496111_0162710 | |||
| 1877 | Ga0496111_0206555 | |||
| 1878 | Ga0496111_0219835 | |||
| 1879 | Ga0496112_0020210 | |||
| 1880 | Ga0496112_0069057 | |||
| 1881 | Ga0496112_0079934 | |||
| 1882 | Ga0496112_0091984 | |||
| 1883 | Ga0496113_0001950 | |||
| 1884 | Ga0496113_0103186 | |||
| 1885 | Ga0496113_0138805 | |||
| 1886 | Ga0496114_0033845 | |||
| 1887 | Ga0496114_0048260 | |||
| 1888 | Ga0496115_0034721 | |||
| 1889 | Ga0496115_0036722 | |||
| 1890 | Ga0496115_0071341 | |||
| 1891 | Ga0496115_0163819 | |||
| 1892 | Ga0501031_0077063 | |||
| 1893 | Ga0501031_0179112 | |||
| 1894 | Ga0501032_0019973 | |||
| 1895 | Ga0501032_0058186 | |||
| 1896 | Ga0501033_0030833 | |||
| 1897 | Ga0501033_0204732 | |||
| 1898 | Ga0501034_0000994 | |||
| 1899 | Ga0501034_0003982 | |||
| 1900 | Ga0501034_0077373 | |||
| 1901 | Ga0501034_0084819 | |||
| 1902 | Ga0501034_0161846 | |||
| 1903 | Ga0501034_0524341 | |||
| 1904 | Ga0501036_0002363 | |||
| 1905 | Ga0501037_0023068 | |||
| 1906 | Ga0501037_0042050 | |||
| 1907 | Ga0501038_0018943 | |||
| 1908 | Ga0501038_0102870 | |||
| 1909 | Ga0501038_0127564 | |||
| 1910 | Ga0501038_0310272 | |||
| 1911 | Ga0501039_0034460 | |||
| 1912 | Ga0501043_0002909 | |||
| 1913 | Ga0501043_0036232 | |||
| 1914 | Ga0501043_0040931 | |||
| 1915 | Ga0501043_0131594 | |||
| 1916 | Ga0501043_0471546 | |||
| 1917 | Ga0501046_0173793 | |||
| 1918 | Ga0501047_0000204 | |||
| 1919 | Ga0501047_0009067 | |||
| 1920 | Ga0501047_0018683 | |||
| 1921 | Ga0501047_0039533 | |||
| 1922 | Ga0501047_0069786 | |||
| 1923 | Ga0501047_0079355 | |||
| 1924 | Ga0501047_0358881 | |||
| 1925 | Ga0501048_0000151 | |||
| 1926 | Ga0501067_0008102 | |||
| 1927 | Ga0501068_0007910 | |||
| 1928 | Ga0501068_0205762 | |||
| 1929 | Ga0501069_0003921 | |||
| 1930 | Ga0501069_0013989 | |||
| 1931 | Ga0501069_0035838 | |||
| 1932 | Ga0501069_0215077 | |||
| 1933 | Ga0501069_0229728 | |||
| 1934 | Ga0501069_0242241 | |||
| 1935 | Ga0501070_0004953 | |||
| 1936 | Ga0501070_0009762 | |||
| 1937 | Ga0501070_0019697 | |||
| 1938 | Ga0501070_0021777 | |||
| 1939 | Ga0501070_0105915 | |||
| 1940 | Ga0501070_0336973 | |||
| 1941 | Ga0501071_0169191 | |||
| 1942 | Ga0501072_0026272 | |||
| 1943 | Ga0501072_0056233 | |||
| 1944 | Ga0501073_0024827 | |||
| 1945 | Ga0501073_0059201 | |||
| 1946 | Ga0501073_0092979 | |||
| 1947 | Ga0501073_0178969 | |||
| 1948 | Ga0501074_0009538 | |||
| 1949 | Ga0501074_0011619 | |||
| 1950 | Ga0501076_0026850 | |||
| 1951 | Ga0501077_0009531 | |||
| 1952 | Ga0501079_0100433 | |||
| 1953 | Ga0501079_0160563 | |||
| 1954 | Ga0501080_0006219 | |||
| 1955 | Ga0501080_0019256 | |||
| 1956 | Ga0501080_0050480 | |||
| 1957 | Ga0501080_0099377 | |||
| 1958 | Ga0501080_0109268 | |||
| 1959 | Ga0501081_0036949 | |||
| 1960 | Ga0501081_0059623 | |||
| 1961 | Ga0501083_0032154 | |||
| 1962 | Ga0501083_0055045 | |||
| 1963 | Ga0501083_0070069 | |||
| 1964 | Ga0501035_0000127 | |||
| 1965 | Ga0501035_0049338 | |||
| 1966 | Ga0501035_0132366 | |||
| 1967 | Ga0501035_0152706 | |||
| 1968 | Ga0501044_0000636 | |||
| 1969 | Ga0501044_0035924 | |||
| 1970 | Ga0501044_0045518 | |||
| 1971 | Ga0501044_0097612 | |||
| 1972 | Ga0501044_0144739 | |||
| 1973 | Ga0501044_0269055 | |||
| 1974 | Ga0501044_0289299 | |||
| 1975 | Ga0501045_0308995 | |||
| 1976 | nmdc:mga03n38_27807_c1 | |||
| 1977 | nmdc:mga03n38_650_c1 | |||
| 1978 | nmdc:mga00v17_23318_c1 | |||
| 1979 | nmdc:mga00v17_47739_c1 | |||
| 1980 | nmdc:mga0yw44_10192_c1 | |||
| 1981 | nmdc:mga0k408_21025_c1 | |||
| 1982 | nmdc:mga06z11_17054_c1 | |||
| 1983 | nmdc:mga07m45_146538_c1 | |||
| 1984 | nmdc:mga05p37_102_c1 | |||
| 1985 | nmdc:mga05p37_702892_c1 | |||
| 1986 | nmdc:mga09592_752_c1 | |||
| 1987 | nmdc:mga0qj67_49003_c1 | |||
| 1988 | nmdc:mga08y16_129558_c1 | |||
| 1989 | nmdc:mga08y16_3146_c1 | |||
| 1990 | nmdc:mga08y16_3939_c1 | |||
| 1991 | nmdc:mga08y16_421689_c1 | |||
| 1992 | nmdc:mga0n895_109560_c1 | |||
| 1993 | nmdc:mga0n895_143242_c1 | |||
| 1994 | nmdc:mga0n895_213610_c1 | |||
| 1995 | nmdc:mga0n895_253364_c1 | |||
| 1996 | nmdc:mga0n895_5770_c1 | |||
| 1997 | nmdc:mga0n895_71912_c1 | |||
| 1998 | nmdc:mga0n895_85445_c1 | |||
| 1999 | nmdc:mga0rr50_73847_c1 | |||
| 2000 | nmdc:mga0rr50_94079_c1 | |||
| 2001 | nmdc:mga08x19_115687_c1 | |||
| 2002 | nmdc:mga0a205_100156_c1 | |||
| 2003 | nmdc:mga0a205_1990_c1 | |||
| 2004 | nmdc:mga0a205_63990_c1 | |||
| 2005 | nmdc:mga0sz30_107142_c1 | |||
| 2006 | nmdc:mga0sz30_76087_c1 | |||
| 2007 | Ga0495601_0000006 | |||
| 2008 | Ga0495601_0000549 | |||
| 2009 | Ga0495601_0002952 | |||
| 2010 | Ga0495601_0003164 | |||
| 2011 | Ga0495601_0003593 | |||
| 2012 | Ga0495601_0003797 | |||
| 2013 | Ga0495612_0000004 | |||
| 2014 | Ga0495612_0000786 | |||
| 2015 | Ga0495612_0010350 | |||
| 2016 | Ga0495595_0000006 | |||
| 2017 | Ga0495595_0000223 | |||
| 2018 | Ga0495595_0001566 | |||
| 2019 | Ga0495595_0007201 | |||
| 2020 | Ga0495619_0000229 | |||
| 2021 | Ga0495619_0000240 | |||
| 2022 | Ga0495619_0001121 | |||
| 2023 | Ga0495619_0001653 | |||
| 2024 | Ga0495619_0002881 | |||
| 2025 | Ga0495619_0014367 | |||
| 2026 | Ga0495619_0086681 | |||
| 2027 | Ga0500643_001600 | |||
| 2028 | Ga0500644_0000641 | |||
| 2029 | Ga0500562_048330 | |||
| 2030 | Ga0500595_000010 | |||
| 2031 | Ga0500568_0016709 | |||
| 2032 | Ga0500616_0000001 | |||
| 2033 | Ga0500616_0129409 | |||
| 2034 | Ga0500645_000015 | |||
| 2035 | Ga0501082_0000046 | |||
| 2036 | Ga0501082_0022339 | |||
| 2037 | Ga0501082_0059313 | |||
| 2038 | Ga0501082_0172470 | |||
| 2039 | Ga0501082_0243431 | |||
| 2040 | 2643755367 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fmo-assembly1.cif.gz_A | ala177val mutant of e. coli methylenetetrahydrofolate reductase | 0.8059 | 13 | 301 |
| 1b5t-assembly1.cif.gz_C | escherichia coli methylenetetrahydrofolate reductase | 0.8018 | 13 | 301 |
| 3fsu-assembly1.cif.gz_C | crystal structure of escherichia coli methylenetetrahydrofolate reductase double mutant phe223leuglu28gln complexed with methyltetrahydrofolate | 0.7984 | 13 | 301 |
| 2fmo-assembly1.cif.gz_A | ala177val mutant of e. coli methylenetetrahydrofolate reductase | 0.7974 | 13 | 301 |
| 1zp4-assembly1.cif.gz_C | glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate | 0.7959 | 13 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G121_302_599_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8673 | 2 | 291 | 3.20.20.220 |
| af_Q2G121_302_599_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8347 | 2 | 291 | 3.20.20.220 |
| 1v93A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.7841 | 4 | 295 | 3.20.20.220 |
| af_Q17693_57_348_3.20.20.220 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.779 | 5 | 293 | 3.20.20.220 |
| 1v93A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.7671 | 4 | 295 | 3.20.20.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q4DBF0-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9867 | 4 | 303 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A1W6ZL58-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9865 | 3 | 298 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A537KZ71-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9829 | 170 | 297 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A2D9QIZ0-F1-model_v4 | Methylenetetrahydrofolate reductase | 0.9758 | 177 | 295 |
GO:0005829
GO:0009086 GO:0035999 GO:0071949 GO:0106312 |
| AF-A0A381YZ97-F1-model_v4 | Uncharacterized protein | 0.9739 | 33 | 295 |
GO:0004489
GO:0005829 GO:0009086 GO:0035999 GO:0071949 |