F488313

General Info

Members Datasets Scaffolds Average Seq Length
1018 519 2036 132

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_11222599|Ga0157379_112225991
Length 149
Sequence MYSVNVRDHFMIAHSFRGEVFGPAQRLHGATYVVDLELRRAELDADGVVVDIALATEVLRGVLGELNLRNLDDDPSFKGKNTTTEFMARVIFDRIADRIAKGELGPHSSGLSALRVRLNESHVAWAAYEGALPARAGGTTAAAFSFRET

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
218 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
227 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
228 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
247 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
248 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
249 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
253 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
254 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
273 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
274 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
275 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
276 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
277 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
278 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
279 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
280 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
281 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
282 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
283 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
284 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
285 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
290 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
295 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
296 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
297 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
298 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
299 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
300 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
301 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
302 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
303 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
304 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
305 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
306 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
307 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
308 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
309 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
312 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
313 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
314 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
315 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
316 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
317 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
318 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
338 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
339 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
340 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
343 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
347 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
359 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
360 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
371 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
372 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
373 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
374 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
375 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
379 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
399 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
400 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
403 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
404 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
405 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
406 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
407 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
424 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
425 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
429 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
430 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
431 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
455 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
456 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
457 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
458 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
459 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
460 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
461 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
465 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
466 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
474 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
478 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
483 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
484 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
485 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
486 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
487 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
488 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
489 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
490 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
491 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
494 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
495 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
496 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
497 2501939600 Micromonospora sp. L5 Isolate Unclassified
498 2558860280 Kutzneria sp. 744 Isolate Unclassified
499 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
500 2643221711 Terrabacter sp. Root85 Isolate Unclassified
501 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
502 2738543013 Variovorax sp. BT01 Isolate Unclassified
503 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
504 2842733646 Variovorax sp. R-72446 Isolate Unclassified
505 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
506 2858868258 Micromonospora sp. MH33 Isolate Unclassified
507 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
508 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
509 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
510 2902582711 Micromonospora sp. AP08 Isolate Unclassified
511 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
512 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
513 649633069 Micromonospora sp. L5 Isolate Unclassified
514 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
515 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
516 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
517 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
518 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
519 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0.39
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 0
Rhizoplane 8.55
Rhizosphere 79.47
Stem 0
Stem Tuber 0.1
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_11222599 3300014968 Bacteria 723
2 JGI24735J21928_10172920 3300002067 Bacteria 625
3 JGI24748J21848_1008115 3300002074 Bacteria 1233
4 JGI24744J21845_10008927 3300002077 Bacteria 2060
5 JGI24742J22300_10001686 3300002244 Bacteria 3522
6 JGI25159J45721_1018451 3300002987 Bacteria 1406
7 rootH2_10034964 3300003320 Bacteria 2548
8 rootL2_10026840 3300003322 Bacteria 1234
9 Ga0055536_1021586 3300003781 Bacteria 1948
10 Ga0055534_1001074 3300003784 Bacteria 11753
11 Ga0065165_1023608 3300005262 Bacteria 2081
12 Ga0065714_10304250 3300005288 Bacteria 690
13 Ga0065715_10265259 3300005293 Bacteria 1109
14 Ga0070658_10090488 3300005327 Bacteria 2521
15 Ga0070676_10070662 3300005328 Bacteria 2095
16 Ga0070676_10112415 3300005328 Bacteria 1698
17 Ga0070690_100371934 3300005330 Bacteria 1043
18 Ga0070670_100449115 3300005331 Bacteria 1142
19 Ga0070670_101161066 3300005331 Bacteria 705
20 Ga0070670_101206962 3300005331 Bacteria 691
21 Ga0070666_10140479 3300005335 Bacteria 1682
22 Ga0070666_10186907 3300005335 Bacteria 1455
23 Ga0070680_100413145 3300005336 Bacteria 1151
24 Ga0070682_101082412 3300005337 Bacteria 670
25 Ga0070682_101673269 3300005337 Bacteria 552
26 Ga0068868_100016515 3300005338 Bacteria 5484
27 Ga0068868_101073879 3300005338 Bacteria 740
28 Ga0068868_101465723 3300005338 Bacteria 638
29 Ga0070660_100207859 3300005339 Bacteria 1589
30 Ga0070660_100805747 3300005339 Bacteria 790
31 Ga0070689_100025236 3300005340 Bacteria 4463
32 Ga0070691_10225640 3300005341 Bacteria 995
33 Ga0070692_10154673 3300005345 Bacteria 1309
34 Ga0070668_100018680 3300005347 Bacteria 5205
35 Ga0070668_100332893 3300005347 Bacteria 1281
36 Ga0070669_100064693 3300005353 Bacteria 2694
37 Ga0070669_100244349 3300005353 Bacteria 1427
38 Ga0070675_100173253 3300005354 Bacteria 1862
39 Ga0070675_100356422 3300005354 Bacteria 1298
40 Ga0070675_100793664 3300005354 Bacteria 865
41 Ga0070671_100766453 3300005355 Bacteria 839
42 Ga0070674_100008012 3300005356 Bacteria 6262
43 Ga0070674_100021660 3300005356 Bacteria 4132
44 Ga0070674_100341654 3300005356 Bacteria 1206
45 Ga0070674_101411477 3300005356 Bacteria 624
46 Ga0070673_100042639 3300005364 Bacteria 3500
47 Ga0070673_100575249 3300005364 Bacteria 1025
48 Ga0070673_101812787 3300005364 Bacteria 578
49 Ga0070659_100152307 3300005366 Bacteria 1887
50 Ga0070659_100407126 3300005366 Bacteria 1149
51 Ga0070659_100413861 3300005366 Bacteria 1139
52 Ga0070667_100027114 3300005367 Bacteria 4767
53 Ga0070667_100036634 3300005367 Bacteria 4113
54 Ga0070709_10199704 3300005434 Bacteria 1415
55 Ga0070714_100105406 3300005435 Bacteria 2489
56 Ga0070713_100079692 3300005436 Bacteria 2790
57 Ga0070710_10039279 3300005437 Bacteria 2604
58 Ga0070701_10017100 3300005438 Bacteria 3385
59 Ga0070711_100014147 3300005439 Bacteria 5022
60 Ga0070705_100048274 3300005440 Bacteria 2465
61 Ga0070705_100071395 3300005440 Bacteria 2100
62 Ga0070700_100053452 3300005441 Bacteria 2521
63 Ga0070700_100176358 3300005441 Bacteria 1484
64 Ga0070700_100807657 3300005441 Bacteria 756
65 Ga0070694_100173161 3300005444 Bacteria 1591
66 Ga0070708_102150063 3300005445 Bacteria 516
67 Ga0070663_100558960 3300005455 Bacteria 957
68 Ga0070678_100001294 3300005456 Bacteria 13272
69 Ga0070678_100078800 3300005456 Bacteria 2490
70 Ga0070678_100086545 3300005456 Bacteria 2391
71 Ga0070678_100784048 3300005456 Bacteria 864
72 Ga0070662_100257279 3300005457 Bacteria 1405
73 Ga0070662_101398133 3300005457 Bacteria 603
74 Ga0070681_10144431 3300005458 Bacteria 2309
75 Ga0070681_10442928 3300005458 Bacteria 1211
76 Ga0068867_100008440 3300005459 Bacteria 7265
77 Ga0068867_100293167 3300005459 Bacteria 1338
78 Ga0070685_10439347 3300005466 Bacteria 912
79 Ga0070706_100090329 3300005467 Unclassified 2840
80 Ga0070707_100062969 3300005468 Bacteria 3559
81 Ga0070707_100528875 3300005468 Bacteria 1141
82 Ga0070699_100180201 3300005518 Bacteria 1875
83 Ga0070699_101159005 3300005518 Bacteria 709
84 Ga0070679_100269820 3300005530 Bacteria 1656
85 Ga0070679_100955777 3300005530 Bacteria 800
86 Ga0070684_100369695 3300005535 Bacteria 1320
87 Ga0068853_100036947 3300005539 Bacteria 4155
88 Ga0068853_100107809 3300005539 Bacteria 2470
89 Ga0068853_100315093 3300005539 Bacteria 1449
90 Ga0070672_100151280 3300005543 Bacteria 1920
91 Ga0070672_100548114 3300005543 Bacteria 1004
92 Ga0070686_100093953 3300005544 Bacteria 2012
93 Ga0070695_100045120 3300005545 Bacteria 2808
94 Ga0070696_100066279 3300005546 Bacteria 2532
95 Ga0070696_100172963 3300005546 Bacteria 1598
96 Ga0070693_100031922 3300005547 Bacteria 2891
97 Ga0070693_101161568 3300005547 Bacteria 591
98 Ga0070693_101171658 3300005547 Bacteria 589
99 Ga0070665_100042922 3300005548 Bacteria 4546
100 Ga0070665_100051263 3300005548 Bacteria 4139
101 Ga0070665_100383285 3300005548 Bacteria 1413
102 Ga0070665_100534506 3300005548 Bacteria 1184
103 Ga0070665_100910509 3300005548 Bacteria 892
104 Ga0070665_101304798 3300005548 Bacteria 736
105 Ga0070665_101662619 3300005548 Bacteria 646
106 Ga0070704_100024045 3300005549 Bacteria 3991
107 Ga0068855_100114588 3300005563 Bacteria 3090
108 Ga0068855_100855039 3300005563 Bacteria 964
109 Ga0070664_101332470 3300005564 Bacteria 678
110 Ga0068854_100023417 3300005578 Bacteria 4218
111 Ga0068854_100045135 3300005578 Bacteria 3132
112 Ga0070702_100024373 3300005615 Bacteria 3227
113 Ga0070702_100199986 3300005615 Bacteria 1322
114 Ga0068852_100549006 3300005616 Bacteria 1156
115 Ga0068859_100037263 3300005617 Bacteria 4881
116 Ga0068859_100111455 3300005617 Bacteria 2799
117 Ga0068859_100293493 3300005617 Bacteria 1719
118 Ga0068859_101260357 3300005617 Bacteria 814
119 Ga0068864_101975244 3300005618 Bacteria 589
120 Ga0068866_10001530 3300005718 Bacteria 9830
121 Ga0068861_100038370 3300005719 Bacteria 3566
122 Ga0068861_101379145 3300005719 Bacteria 688
123 Ga0068851_10337315 3300005834 Bacteria 874
124 Ga0068863_100146957 3300005841 Bacteria 2255
125 Ga0068863_100373813 3300005841 Bacteria 1391
126 Ga0068863_101056975 3300005841 Bacteria 816
127 Ga0068858_100267655 3300005842 Bacteria 1625
128 Ga0068860_100011938 3300005843 Bacteria 8562
129 Ga0068862_100047952 3300005844 Bacteria 3646
130 Ga0068862_100610275 3300005844 Bacteria 1048
131 Ga0068862_101376999 3300005844 Bacteria 708
132 Ga0081538_10046032 3300005981 Bacteria 2697
133 Ga0081538_10091673 3300005981 Bacteria 1568
134 Ga0081540_1007386 3300005983 Bacteria 7838
135 Ga0081540_1016146 3300005983 Bacteria 4688
136 Ga0081540_1167435 3300005983 Bacteria 843
137 Ga0081539_10000299 3300005985 Bacteria 111908
138 Ga0081539_10006277 3300005985 Bacteria 11490
139 Ga0070717_10010702 3300006028 Bacteria 6939
140 Ga0070717_10066969 3300006028 Bacteria 2987
141 Ga0070717_10120662 3300006028 Bacteria 2246
142 Ga0075365_10071999 3300006038 Bacteria 2328
143 Ga0075365_10211734 3300006038 Bacteria 1359
144 Ga0075365_10220873 3300006038 Bacteria 1329
145 Ga0075365_10271109 3300006038 Bacteria 1194
146 Ga0075368_10143308 3300006042 Bacteria 996
147 Ga0075368_10150401 3300006042 Bacteria 972
148 Ga0075363_100023402 3300006048 Bacteria 3130
149 Ga0075363_100592895 3300006048 Bacteria 663
150 Ga0075363_100696964 3300006048 Bacteria 613
151 Ga0075364_10029290 3300006051 Bacteria 3530
152 Ga0075364_10458701 3300006051 Bacteria 871
153 Ga0070715_10052427 3300006163 Bacteria 1759
154 Ga0070716_100068576 3300006173 Bacteria 2075
155 Ga0070716_101393205 3300006173 Bacteria 570
156 Ga0070712_100008934 3300006175 Bacteria 6311
157 Ga0070712_100345257 3300006175 Bacteria 1217
158 Ga0075362_10060502 3300006177 Bacteria 1712
159 Ga0075362_10720379 3300006177 Bacteria 521
160 Ga0075367_10390720 3300006178 Bacteria 879
161 Ga0075366_10208717 3300006195 Bacteria 1188
162 Ga0075366_10268627 3300006195 Bacteria 1042
163 Ga0075370_10368658 3300006353 Bacteria 859
164 Ga0075370_10947642 3300006353 Bacteria 527
165 Ga0068871_100398100 3300006358 Bacteria 1226
166 Ga0075428_100018822 3300006844 Bacteria 7635
167 Ga0075428_100354231 3300006844 Bacteria 1575
168 Ga0075430_100072971 3300006846 Bacteria 2878
169 Ga0075431_100042432 3300006847 Bacteria 4692
170 Ga0075431_101084318 3300006847 Bacteria 766
171 Ga0075433_10182552 3300006852 Bacteria 1867
172 Ga0075433_11767433 3300006852 Bacteria 532
173 Ga0075434_100367206 3300006871 Bacteria 1460
174 Ga0068865_100125572 3300006881 Bacteria 1915
175 Ga0068865_100129560 3300006881 Bacteria 1888
176 Ga0097620_100037262 3300006931 Bacteria 4881
177 Ga0097620_100111448 3300006931 Bacteria 2799
178 Ga0097620_100293499 3300006931 Bacteria 1719
179 Ga0097620_101260336 3300006931 Bacteria 814
180 Ga0075435_100014526 3300007076 Bacteria 5889
181 Ga0105251_10017909 3300009011 Bacteria 3783
182 Ga0105244_10197529 3300009036 Bacteria 949
183 Ga0105250_10092247 3300009092 Bacteria 1233
184 Ga0105240_10074931 3300009093 Bacteria 4175
185 Ga0105240_11384836 3300009093 Bacteria 740
186 Ga0105240_12236665 3300009093 Bacteria 567
187 Ga0105240_12472115 3300009093 Bacteria 537
188 Ga0105245_10009348 3300009098 Bacteria 8551
189 Ga0105245_10368583 3300009098 Bacteria 1427
190 Ga0105245_11653112 3300009098 Bacteria 692
191 Ga0105247_10006155 3300009101 Bacteria 7453
192 Ga0105247_10010073 3300009101 Bacteria 5726
193 Ga0105247_11080438 3300009101 Bacteria 632
194 Ga0105247_11651280 3300009101 Bacteria 528
195 Ga0114129_10017668 3300009147 Bacteria 10155
196 Ga0114129_10678086 3300009147 Bacteria 1327
197 Ga0114129_10942226 3300009147 Bacteria 1091
198 Ga0105243_10051593 3300009148 Bacteria 3254
199 Ga0105243_10897620 3300009148 Bacteria 881
200 Ga0105241_11225501 3300009174 Bacteria 712
201 Ga0105242_10042876 3300009176 Bacteria 3657
202 Ga0105248_10038947 3300009177 Bacteria 5322
203 Ga0105248_10143185 3300009177 Bacteria 2697
204 Ga0105248_10859441 3300009177 Bacteria 1024
205 Ga0105248_11240489 3300009177 Bacteria 843
206 Ga0105237_10318849 3300009545 Bacteria 1558
207 Ga0105237_11013762 3300009545 Bacteria 837
208 Ga0105237_11314535 3300009545 Bacteria 729
209 Ga0105238_10024517 3300009551 Bacteria 6148
210 Ga0105238_10300619 3300009551 Bacteria 1588
211 Ga0105249_11822231 3300009553 Bacteria 681
212 Ga0105239_10142382 3300010375 Bacteria 2673
213 Ga0105239_10171478 3300010375 Bacteria 2426
214 Ga0105239_10420894 3300010375 Bacteria 1513
215 Ga0105239_12761492 3300010375 Bacteria 573
216 Ga0105246_10114745 3300011119 Bacteria 1985
217 Ga0105246_11917460 3300011119 Bacteria 569
218 Ga0157371_10190717 3300013102 Bacteria 1467
219 Ga0157370_11678116 3300013104 Bacteria 570
220 Ga0157369_10310155 3300013105 Bacteria 1641
221 Ga0157369_10331275 3300013105 Bacteria 1582
222 Ga0171462_1004 3300013250 Bacteria 678877
223 Ga0157374_10208145 3300013296 Bacteria 1917
224 Ga0157374_10493822 3300013296 Bacteria 1228
225 Ga0157378_10021612 3300013297 Bacteria 5659
226 Ga0163162_10084317 3300013306 Bacteria 3253
227 Ga0163162_10142108 3300013306 Bacteria 2514
228 Ga0163162_10332349 3300013306 Bacteria 1652
229 Ga0163162_10654578 3300013306 Bacteria 1174
230 Ga0157372_10102729 3300013307 Bacteria 3265
231 Ga0157372_11219675 3300013307 Bacteria 869
232 Ga0157375_10210678 3300013308 Bacteria 2101
233 Ga0157375_10224591 3300013308 Bacteria 2037
234 Ga0157375_10614737 3300013308 Bacteria 1245
235 Ga0157375_10731172 3300013308 Bacteria 1142
236 Ga0157375_11403674 3300013308 Bacteria 823
237 Ga0157380_10049476 3300014326 Bacteria 3316
238 Ga0182008_10001482 3300014497 Bacteria 15678
239 Ga0182008_10749493 3300014497 Bacteria 562
240 Ga0157377_10073172 3300014745 Bacteria 1985
241 Ga0157377_10333652 3300014745 Bacteria 1012
242 Ga0157379_10143086 3300014968 Bacteria 2156
243 Ga0157379_10207813 3300014968 Bacteria 1772
244 Ga0157379_10300546 3300014968 Bacteria 1463
245 Ga0157376_10894255 3300014969 Bacteria 906
246 Ga0157376_10984409 3300014969 Bacteria 865
247 Ga0157376_11044620 3300014969 Bacteria 841
248 Ga0157376_12384402 3300014969 Bacteria 569
249 Ga0182007_10000321 3300015262 Bacteria 30433
250 Ga0182005_1037556 3300015265 Bacteria 1317
251 Ga0183362_10003 3300015683 Bacteria 977584
252 Ga0163161_10073709 3300017792 Bacteria 2502
253 Ga0163161_10098765 3300017792 Bacteria 2170
254 Ga0163161_10743269 3300017792 Bacteria 820
255 Ga0163161_11172797 3300017792 Bacteria 663
256 Ga0163161_11448280 3300017792 Bacteria 601
257 Ga0213876_10028695 3300021384 Bacteria 2934
258 Ga0224712_10046356 3300022467 Bacteria 1668
259 Ga0209130_1006006 3300025284 Bacteria 4044
260 Ga0209675_1005102 3300025291 Bacteria 5600
261 Ga0209676_1006325 3300025292 Bacteria 5875
262 Ga0209564_1045945 3300025295 Bacteria 1118
263 Ga0209758_1008881 3300025297 Bacteria 6384
264 Ga0209050_1064932 3300025298 Bacteria 843
265 Ga0207426_1068224 3300025302 Bacteria 1000
266 Ga0209051_1021425 3300025303 Bacteria 2753
267 Ga0209257_1021959 3300025304 Bacteria 2295
268 Ga0207696_1185139 3300025711 Bacteria 550
269 Ga0207713_1032370 3300025735 Bacteria 2297
270 Ga0207682_10112758 3300025893 Bacteria 1198
271 Ga0207692_10000532 3300025898 Bacteria 13531
272 Ga0207692_10014167 3300025898 Bacteria 3479
273 Ga0207642_10005216 3300025899 Bacteria 4233
274 Ga0207642_10365176 3300025899 Bacteria 855
275 Ga0207710_10005704 3300025900 Bacteria 5346
276 Ga0207710_10013402 3300025900 Bacteria 3451
277 Ga0207710_10203756 3300025900 Bacteria 978
278 Ga0207688_10105007 3300025901 Bacteria 1635
279 Ga0207688_10479698 3300025901 Bacteria 777
280 Ga0207680_10273418 3300025903 Bacteria 1172
281 Ga0207645_10133496 3300025907 Bacteria 1616
282 Ga0207645_10591921 3300025907 Bacteria 753
283 Ga0207643_10051860 3300025908 Bacteria 2329
284 Ga0207684_11190203 3300025910 Bacteria 631
285 Ga0207654_10100282 3300025911 Bacteria 1783
286 Ga0207707_10091702 3300025912 Bacteria 2655
287 Ga0207707_10257787 3300025912 Bacteria 1514
288 Ga0207695_10369810 3300025913 Bacteria 1320
289 Ga0207671_10319052 3300025914 Bacteria 1229
290 Ga0207671_10724174 3300025914 Bacteria 791
291 Ga0207693_10022554 3300025915 Bacteria 5002
292 Ga0207693_10155484 3300025915 Bacteria 1798
293 Ga0207693_10240116 3300025915 Bacteria 1422
294 Ga0207663_10020680 3300025916 Bacteria 3731
295 Ga0207660_10098925 3300025917 Bacteria 2176
296 Ga0207660_10207307 3300025917 Bacteria 1534
297 Ga0207660_10416852 3300025917 Bacteria 1083
298 Ga0207662_10192237 3300025918 Bacteria 1317
299 Ga0207657_10241729 3300025919 Bacteria 1441
300 Ga0207657_10325893 3300025919 Bacteria 1214
301 Ga0207657_10376376 3300025919 Bacteria 1118
302 Ga0207657_10769224 3300025919 Bacteria 745
303 Ga0207652_10331988 3300025921 Bacteria 1373
304 Ga0207652_10571534 3300025921 Bacteria 1015
305 Ga0207652_10748062 3300025921 Bacteria 870
306 Ga0207652_11355563 3300025921 Bacteria 614
307 Ga0207646_10168149 3300025922 Unclassified 1980
308 Ga0207681_10060858 3300025923 Bacteria 2593
309 Ga0207681_10263604 3300025923 Bacteria 1350
310 Ga0207694_10065630 3300025924 Bacteria 2830
311 Ga0207650_10644367 3300025925 Bacteria 893
312 Ga0207650_11388262 3300025925 Bacteria 598
313 Ga0207659_10188988 3300025926 Bacteria 1638
314 Ga0207659_10203087 3300025926 Bacteria 1584
315 Ga0207659_10562722 3300025926 Bacteria 970
316 Ga0207659_10669363 3300025926 Bacteria 888
317 Ga0207687_10008069 3300025927 Bacteria 6890
318 Ga0207687_10030326 3300025927 Bacteria 3646
319 Ga0207700_10462442 3300025928 Bacteria 1119
320 Ga0207700_10766761 3300025928 Bacteria 862
321 Ga0207664_10068766 3300025929 Bacteria 2846
322 Ga0207644_10844881 3300025931 Bacteria 766
323 Ga0207644_11043055 3300025931 Bacteria 687
324 Ga0207690_10172027 3300025932 Bacteria 1624
325 Ga0207690_10367526 3300025932 Bacteria 1141
326 Ga0207690_10386997 3300025932 Bacteria 1113
327 Ga0207690_10419978 3300025932 Bacteria 1070
328 Ga0207690_11013745 3300025932 Bacteria 691
329 Ga0207706_10046195 3300025933 Bacteria 3856
330 Ga0207709_10012850 3300025935 Bacteria 4617
331 Ga0207709_11615274 3300025935 Bacteria 538
332 Ga0207670_10644665 3300025936 Bacteria 873
333 Ga0207669_10010595 3300025937 Bacteria 4442
334 Ga0207669_10086942 3300025937 Bacteria 2023
335 Ga0207669_10286496 3300025937 Bacteria 1245
336 Ga0207669_11089017 3300025937 Bacteria 674
337 Ga0207704_10001963 3300025938 Bacteria 9223
338 Ga0207704_10159079 3300025938 Bacteria 1605
339 Ga0207704_10688319 3300025938 Bacteria 845
340 Ga0207665_10013758 3300025939 Bacteria 5321
341 Ga0207691_10012135 3300025940 Bacteria 8261
342 Ga0207691_10683048 3300025940 Bacteria 866
343 Ga0207711_10089795 3300025941 Bacteria 2700
344 Ga0207711_10823973 3300025941 Bacteria 864
345 Ga0207711_10903854 3300025941 Bacteria 821
346 Ga0207711_11417763 3300025941 Bacteria 637
347 Ga0207689_10104805 3300025942 Bacteria 2324
348 Ga0207661_10237536 3300025944 Bacteria 1616
349 Ga0207661_10446308 3300025944 Bacteria 1178
350 Ga0207679_11720307 3300025945 Bacteria 574
351 Ga0207667_10353033 3300025949 Bacteria 1499
352 Ga0207667_11067545 3300025949 Bacteria 792
353 Ga0207667_11301264 3300025949 Bacteria 703
354 Ga0207651_10001558 3300025960 Bacteria 10485
355 Ga0207651_10778370 3300025960 Bacteria 847
356 Ga0207712_10413268 3300025961 Bacteria 1137
357 Ga0207712_10424765 3300025961 Bacteria 1122
358 Ga0207668_10012098 3300025972 Bacteria 5271
359 Ga0207640_10073446 3300025981 Bacteria 2311
360 Ga0207640_10210114 3300025981 Bacteria 1482
361 Ga0207658_10004918 3300025986 Bacteria 9215
362 Ga0207658_10029493 3300025986 Bacteria 3875
363 Ga0207677_10011807 3300026023 Bacteria 4996
364 Ga0207677_10065995 3300026023 Bacteria 2528
365 Ga0207677_10297832 3300026023 Bacteria 1331
366 Ga0207703_10096913 3300026035 Bacteria 2491
367 Ga0207703_10185395 3300026035 Bacteria 1839
368 Ga0207639_10015661 3300026041 Bacteria 5350
369 Ga0207639_10027103 3300026041 Bacteria 4170
370 Ga0207678_10114498 3300026067 Bacteria 2301
371 Ga0207678_10505399 3300026067 Bacteria 1054
372 Ga0207678_10799330 3300026067 Bacteria 833
373 Ga0207708_10051067 3300026075 Bacteria 3148
374 Ga0207708_10323234 3300026075 Bacteria 1260
375 Ga0207702_10691622 3300026078 Bacteria 1005
376 Ga0207641_10163572 3300026088 Bacteria 2025
377 Ga0207641_11333372 3300026088 Bacteria 718
378 Ga0207648_10066671 3300026089 Bacteria 3139
379 Ga0207648_10323752 3300026089 Bacteria 1386
380 Ga0207648_10371651 3300026089 Bacteria 1291
381 Ga0207648_11661497 3300026089 Bacteria 600
382 Ga0207676_10277669 3300026095 Bacteria 1520
383 Ga0207676_10335749 3300026095 Bacteria 1392
384 Ga0207676_10390358 3300026095 Bacteria 1298
385 Ga0207676_11210054 3300026095 Bacteria 749
386 Ga0207676_11249253 3300026095 Bacteria 737
387 Ga0207675_100058616 3300026118 Bacteria 3593
388 Ga0207675_100138746 3300026118 Bacteria 2309
389 Ga0207675_100740156 3300026118 Bacteria 994
390 Ga0207683_10062809 3300026121 Bacteria 3271
391 Ga0207683_10081042 3300026121 Bacteria 2880
392 Ga0207683_10115571 3300026121 Bacteria 2405
393 Ga0207683_10232151 3300026121 Bacteria 1683
394 Ga0207683_10323035 3300026121 Bacteria 1414
395 Ga0207683_10617951 3300026121 Bacteria 1003
396 Ga0207683_10665235 3300026121 Bacteria 965
397 Ga0207683_11113099 3300026121 Bacteria 733
398 Ga0207698_10209663 3300026142 Bacteria 1752
399 Ga0207698_10993240 3300026142 Bacteria 850
400 Ga0207698_11084800 3300026142 Bacteria 813
401 Ga0207698_11321224 3300026142 Bacteria 736
402 Ga0209813_10161325 3300027866 Bacteria 809
403 Ga0209974_10224326 3300027876 Bacteria 700
404 Ga0207428_10111254 3300027907 Bacteria 2107
405 Ga0268266_10016681 3300028379 Bacteria 6276
406 Ga0268266_10204779 3300028379 Bacteria 1807
407 Ga0268266_10208375 3300028379 Bacteria 1792
408 Ga0268266_10222587 3300028379 Bacteria 1735
409 Ga0268266_10435207 3300028379 Bacteria 1245
410 Ga0268266_10480135 3300028379 Bacteria 1185
411 Ga0268266_11108744 3300028379 Bacteria 766
412 Ga0268265_10316918 3300028380 Bacteria 1410
413 Ga0268264_10030902 3300028381 Bacteria 4391
414 Ga0265337_1031514 3300028556 Bacteria 1574
415 Ga0265318_10325930 3300028577 Bacteria 560
416 Ga0265336_10061960 3300028666 Bacteria 1122
417 Ga0307517_10130253 3300028786 Bacteria 1815
418 Ga0307515_10000487 3300028794 Bacteria 94783
419 Ga0307515_10056940 3300028794 Bacteria 5667
420 Ga0307511_10000159 3300030521 Bacteria 65231
421 Ga0307511_10001103 3300030521 Bacteria 28774
422 Ga0307512_10053040 3300030522 Bacteria 3228
423 Ga0316177_1113942 3300030731 Bacteria 718
424 Ga0265320_10000429 3300031240 Bacteria 33137
425 Ga0265331_10197765 3300031250 Bacteria 906
426 Ga0265327_10003277 3300031251 Bacteria 15681
427 Ga0265316_10037489 3300031344 Bacteria 3912
428 Ga0307513_10025548 3300031456 Bacteria 6837
429 Ga0307513_10032587 3300031456 Bacteria 5873
430 Ga0307513_10033683 3300031456 Bacteria 5756
431 Ga0307513_10098869 3300031456 Bacteria 2947
432 Ga0307513_10308731 3300031456 Bacteria 1345
433 Ga0307513_10441643 3300031456 Bacteria 1027
434 Ga0307513_10445830 3300031456 Bacteria 1020
435 Ga0307513_10448606 3300031456 Bacteria 1015
436 Ga0307509_10036922 3300031507 Bacteria 5344
437 Ga0307408_100214815 3300031548 Bacteria 1566
438 Ga0307408_100269808 3300031548 Bacteria 1412
439 Ga0307408_100556305 3300031548 Bacteria 1013
440 Ga0307408_101932668 3300031548 Bacteria 566
441 Ga0307514_10108568 3300031649 Bacteria 1972
442 Ga0316575_10002608 3300031665 Bacteria 6073
443 Ga0316579_10003332 3300031691 Bacteria 6242
444 Ga0316579_10422801 3300031691 Bacteria 644
445 Ga0265314_10022219 3300031711 Bacteria 4862
446 Ga0316576_10002073 3300031727 Bacteria 11256
447 Ga0316576_10204172 3300031727 Bacteria 1488
448 Ga0316578_10000393 3300031728 Bacteria 14094
449 Ga0316578_10158789 3300031728 Bacteria 1362
450 Ga0307516_10001460 3300031730 Bacteria 32683
451 Ga0307516_10041378 3300031730 Bacteria 4580
452 Ga0307405_10456388 3300031731 Bacteria 1014
453 Ga0316577_10029468 3300031733 Bacteria 3063
454 Ga0307413_10096982 3300031824 Bacteria 1937
455 Ga0307413_10481726 3300031824 Bacteria 992
456 Ga0307413_11207694 3300031824 Bacteria 658
457 Ga0307413_11921610 3300031824 Bacteria 532
458 Ga0307518_10009673 3300031838 Bacteria 6883
459 Ga0307410_10035590 3300031852 Bacteria 3235
460 Ga0307410_10282119 3300031852 Bacteria 1304
461 Ga0307406_10046095 3300031901 Bacteria 2741
462 Ga0307406_10145830 3300031901 Bacteria 1682
463 Ga0307406_11158689 3300031901 Bacteria 670
464 Ga0307407_10022944 3300031903 Bacteria 3248
465 Ga0307407_11451107 3300031903 Bacteria 542
466 Ga0307412_10551037 3300031911 Bacteria 968
467 Ga0307412_10822742 3300031911 Bacteria 808
468 Ga0307409_100069879 3300031995 Bacteria 2785
469 Ga0307409_100221069 3300031995 Bacteria 1710
470 Ga0307409_100277771 3300031995 Bacteria 1546
471 Ga0307409_101283505 3300031995 Bacteria 757
472 Ga0307416_100365830 3300032002 Bacteria 1466
473 Ga0307416_101094106 3300032002 Bacteria 901
474 Ga0307416_102273067 3300032002 Bacteria 643
475 Ga0307414_10224023 3300032004 Bacteria 1546
476 Ga0307411_10000850 3300032005 Bacteria 11472
477 Ga0307411_10289605 3300032005 Bacteria 1308
478 Ga0307411_11303703 3300032005 Bacteria 662
479 Ga0307415_100395947 3300032126 Bacteria 1177
480 Ga0316583_10010654 3300032133 Bacteria 3315
481 Ga0316583_10061685 3300032133 Bacteria 1313
482 Ga0316585_10154369 3300032137 Bacteria 758
483 Ga0316580_10010722 3300032139 Bacteria 2774
484 Ga0316580_10081089 3300032139 Bacteria 992
485 Ga0307507_10015626 3300033179 Bacteria 8907
486 Ga0307507_10047289 3300033179 Bacteria 4205
487 Ga0307510_10076915 3300033180 Bacteria 3277
488 Ga0316596_1020082 3300033541 Bacteria 1698
489 Ga0373948_0022376 3300034817 Bacteria 1218
490 Ga0373928_0031819 3300035084 Bacteria 1173
491 Ga0373929_0096214 3300035085 Bacteria 741
492 Ga0373940_0013567 3300035088 Bacteria 1975
493 Ga0373932_0025237 3300035112 Bacteria 1607
494 Ga0373932_0034054 3300035112 Bacteria 1433
495 Ga0373943_0801310 3300035170 Bacteria 561
496 Ga0373955_1000875 3300035172 Bacteria 515
497 Ga0316574_0007588 3300035398 Bacteria 5957
498 Ga0316574_0182618 3300035398 Bacteria 1349
499 Ga0316574_0325191 3300035398 Bacteria 976
500 Ga0316574_0639565 3300035398 Bacteria 655
501 Ga0373931_0047293 3300035691 Bacteria 2277
502 Ga0316582_0001290 3300036647 Bacteria 10842
503 Ga0316582_0119321 3300036647 Bacteria 1763
504 Ga0316584_0005768 3300036712 Bacteria 8344
505 Ga0316584_0006427 3300036712 Bacteria 7957
506 Ga0316584_0028260 3300036712 Bacteria 4133
507 Ga0316584_0056631 3300036712 Bacteria 2934
508 Ga0373925_0341859 3300037068 Bacteria 1214
509 Ga0373925_0916629 3300037068 Bacteria 722
510 Ga0395900_0685437 3300037418 Bacteria 959
511 Ga0395898_1280448 3300037466 Bacteria 663
512 Ga0395905_0001958 3300037471 Bacteria 23568
513 Ga0436364_0814508 3300037853 Bacteria 6441
514 Ga0395901_0038670 3300038443 Bacteria 4935
515 Ga0395901_0104465 3300038443 Bacteria 2973
516 Ga0395901_0155976 3300038443 Bacteria 2398
517 Ga0395901_0398040 3300038443 Bacteria 1415
518 Ga0436365_0301162 3300039437 Bacteria 3663
519 Ga0436363_1309788 3300039450 Bacteria 672
520 Ga0436363_1589930 3300039450 Bacteria 683
521 Ga0439436_0010782 3300041404 Bacteria 2784
522 Ga0439436_0018666 3300041404 Bacteria 2073
523 Ga0439436_0076691 3300041404 Bacteria 931
524 Ga0439438_073999 3300041405 Bacteria 841
525 Ga0439439_0003849 3300041406 Bacteria 3337
526 Ga0439439_0123106 3300041406 Bacteria 724
527 Ga0439447_012773 3300041407 Bacteria 2402
528 Ga0439447_032115 3300041407 Bacteria 1314
529 Ga0439461_0007746 3300041410 Bacteria 1912
530 Ga0439461_0020941 3300041410 Bacteria 1299
531 Ga0439466_0070440 3300041411 Bacteria 1114
532 Ga0439466_0101741 3300041411 Bacteria 895
533 Ga0439465_0012312 3300041413 Bacteria 2677
534 Ga0451800_0803309 3300041459 Unclassified 899
535 Ga0451802_1269109 3300041460 Bacteria 1025
536 Ga0451833_0080370 3300041491 Bacteria 845
537 Ga0451837_1419958 3300041494 Bacteria 1653
538 Ga0451845_0914589 3300041501 Bacteria 793
539 Ga0451847_0013531 3300041503 Bacteria 675
540 Ga0451849_0339851 3300041505 Bacteria 3606
541 Ga0451843_0253762 3300041509 Bacteria 760
542 Ga0451843_1206146 3300041509 Bacteria 584
543 Ga0451843_1772571 3300041509 Bacteria 599
544 Ga0451853_0371860 3300041512 Bacteria 25651
545 Ga0451853_2463512 3300041512 Bacteria 1325
546 Ga0439431_0002697 3300041997 Bacteria 3901
547 Ga0439431_0025503 3300041997 Bacteria 1444
548 Ga0439433_0006460 3300041999 Bacteria 2522
549 Ga0439433_0025770 3300041999 Bacteria 1329
550 Ga0439433_0056272 3300041999 Bacteria 933
551 Ga0439433_0075693 3300041999 Bacteria 814
552 Ga0439442_020830 3300042002 Bacteria 1359
553 Ga0439442_038499 3300042002 Bacteria 1002
554 Ga0439445_0003652 3300042004 Bacteria 3454
555 Ga0439432_001430 3300042006 Bacteria 8979
556 Ga0439432_047206 3300042006 Bacteria 1351
557 Ga0439449_0000791 3300042007 Bacteria 12215
558 Ga0439449_0002046 3300042007 Bacteria 7942
559 Ga0439449_0012758 3300042007 Bacteria 3160
560 Ga0439452_003109 3300042010 Bacteria 5886
561 Ga0439452_038430 3300042010 Bacteria 1136
562 Ga0439457_018913 3300042014 Bacteria 1530
563 Ga0439457_025777 3300042014 Bacteria 1300
564 Ga0439457_026139 3300042014 Bacteria 1292
565 Ga0439462_0007236 3300042015 Bacteria 2776
566 Ga0439462_0012747 3300042015 Bacteria 2150
567 Ga0439462_0119658 3300042015 Bacteria 732
568 Ga0450897_018121 3300042128 Bacteria 737
569 Ga0450894_001632 3300042131 Bacteria 3168
570 Ga0450894_009610 3300042131 Bacteria 1255
571 Ga0450898_023986 3300042134 Bacteria 1088
572 Ga0450889_020336 3300042144 Bacteria 735
573 Ga0450906_030582 3300042145 Bacteria 952
574 Ga0450907_043258 3300042146 Bacteria 771
575 Ga0439446_0011919 3300042156 Bacteria 2368
576 Ga0439446_0247102 3300042156 Bacteria 614
577 Ga0439446_0345635 3300042156 Bacteria 529
578 Ga0450908_022151 3300042184 Bacteria 1114
579 Ga0450909_001800 3300042185 Bacteria 3017
580 Ga0439434_0012172 3300042435 Bacteria 2545
581 Ga0439434_0012407 3300042435 Bacteria 2521
582 Ga0439434_0092605 3300042435 Bacteria 968
583 Ga0439459_0151166 3300042438 Bacteria 607
584 Ga0439460_0151314 3300042461 Bacteria 774
585 Ga0450893_0016581 3300042532 Bacteria 1248
586 Ga0466969_0020496 3300044656 Bacteria 3423
587 Ga0466969_0045057 3300044656 Bacteria 2190
588 Ga0466972_0007057 3300044658 Bacteria 5637
589 Ga0466972_0013289 3300044658 Bacteria 4133
590 Ga0466972_0139847 3300044658 Bacteria 1139
591 Ga0466972_0621125 3300044658 Bacteria 511
592 Ga0466965_0446689 3300044683 Bacteria 719
593 Ga0466966_0012619 3300044684 Bacteria 5600
594 Ga0466966_0290131 3300044684 Bacteria 983
595 Ga0466961_0019506 3300044693 Bacteria 4361
596 Ga0466961_0026723 3300044693 Bacteria 3711
597 Ga0466961_0171730 3300044693 Bacteria 1348
598 Ga0466963_0023612 3300044694 Bacteria 3908
599 Ga0466963_0046778 3300044694 Bacteria 2854
600 Ga0466964_0045742 3300044706 Bacteria 1782
601 Ga0466964_0046761 3300044706 Bacteria 1765
602 Ga0466971_0013985 3300044719 Bacteria 3527
603 Ga0466971_0235231 3300044719 Bacteria 870
604 Ga0466968_0003477 3300044735 Bacteria 5823
605 Ga0466968_0013252 3300044735 Bacteria 3240
606 Ga0466968_0054924 3300044735 Bacteria 1708
607 Ga0466968_0170000 3300044735 Bacteria 1010
608 Ga0466970_0045561 3300044765 Bacteria 2336
609 Ga0466970_0109183 3300044765 Bacteria 1510
610 Ga0466970_0115115 3300044765 Bacteria 1470
611 Ga0466970_0165459 3300044765 Bacteria 1224
612 Ga0466970_0776843 3300044765 Bacteria 560
613 Ga0466957_0204418 3300044842 Bacteria 1298
614 Ga0466957_1301351 3300044842 Bacteria 527
615 Ga0466960_0011715 3300044901 Bacteria 3680
616 Ga0466960_0015043 3300044901 Bacteria 3329
617 Ga0466960_0061209 3300044901 Bacteria 1847
618 Ga0466960_0127334 3300044901 Bacteria 1340
619 Ga0466960_0538870 3300044901 Bacteria 687
620 Ga0466960_0562661 3300044901 Bacteria 673
621 Ga0466960_0602736 3300044901 Bacteria 652
622 Ga0466959_0027067 3300045049 Bacteria 4253
623 Ga0466959_0146439 3300045049 Bacteria 1666
624 Ga0466959_0361069 3300045049 Bacteria 990
625 Ga0451576_0861574 3300045051 Bacteria 951
626 Ga0466958_0001930 3300045836 Bacteria 10160
627 Ga0466958_0258283 3300045836 Bacteria 1115
628 Ga0466967_0042891 3300045976 Bacteria 3913
629 Ga0466967_0195376 3300045976 Bacteria 1914
630 Ga0466967_0219775 3300045976 Bacteria 1805
631 Ga0466967_0234972 3300045976 Bacteria 1746
632 Ga0466967_0331305 3300045976 Bacteria 1470
633 Ga0466967_0492976 3300045976 Bacteria 1201
634 Ga0466967_0499147 3300045976 Bacteria 1194
635 Ga0466967_0877783 3300045976 Bacteria 892
636 Ga0466967_2036727 3300045976 Bacteria 571
637 Ga0495617_007078 3300046452 Bacteria 3912
638 Ga0495627_031049 3300046453 Bacteria 1690
639 Ga0495592_0046118 3300046454 Bacteria 3249
640 Ga0495592_0236177 3300046454 Bacteria 1215
641 Ga0495603_0011194 3300046455 Bacteria 5437
642 Ga0495603_0020447 3300046455 Bacteria 4011
643 Ga0495603_0064159 3300046455 Bacteria 2166
644 Ga0495590_0101900 3300046457 Bacteria 1020
645 Ga0495629_0000826 3300046459 Bacteria 25106
646 Ga0495629_0089285 3300046459 Bacteria 2150
647 Ga0495629_0129549 3300046459 Bacteria 1757
648 Ga0495629_0183071 3300046459 Bacteria 1452
649 Ga0495638_0134535 3300046460 Bacteria 1449
650 Ga0495651_0039768 3300046462 Bacteria 3659
651 Ga0495651_0067319 3300046462 Bacteria 2732
652 Ga0495651_0551112 3300046462 Bacteria 732
653 Ga0495653_0532159 3300046463 Bacteria 729
654 Ga0495653_0811526 3300046463 Bacteria 562
655 Ga0495650_0004071 3300046471 Bacteria 10225
656 Ga0495650_0122923 3300046471 Bacteria 954
657 Ga0495580_0274634 3300046472 Bacteria 1150
658 Ga0495582_0080172 3300046473 Bacteria 1812
659 Ga0495605_0003700 3300046474 Bacteria 9072
660 Ga0495639_0001006 3300046475 Bacteria 12734
661 Ga0495639_0003852 3300046475 Bacteria 6445
662 Ga0495662_0005228 3300046476 Bacteria 6506
663 Ga0495664_0556275 3300046477 Bacteria 683
664 Ga0495584_0133047 3300046491 Bacteria 1262
665 Ga0495594_0000177 3300046499 Bacteria 30788
666 Ga0495594_0139607 3300046499 Bacteria 1374
667 Ga0495583_0059830 3300046506 Bacteria 1705
668 Ga0495606_0016399 3300046507 Bacteria 5650
669 Ga0495608_0090288 3300046511 Bacteria 1982
670 Ga0495608_0222705 3300046511 Bacteria 1183
671 Ga0495610_0060642 3300046512 Bacteria 1800
672 Ga0495616_0018753 3300046513 Bacteria 3790
673 Ga0495618_0050137 3300046514 Bacteria 2636
674 Ga0495620_0050344 3300046515 Bacteria 1777
675 Ga0495628_0066026 3300046516 Bacteria 2828
676 Ga0495628_0321781 3300046516 Bacteria 1141
677 Ga0495628_0740758 3300046516 Bacteria 691
678 Ga0495630_0684128 3300046517 Bacteria 785
679 Ga0495631_0005737 3300046518 Bacteria 6475
680 Ga0495632_0170772 3300046519 Bacteria 999
681 Ga0495643_0005063 3300046522 Bacteria 9017
682 Ga0495643_0095385 3300046522 Bacteria 1530
683 Ga0495648_0013270 3300046524 Bacteria 6102
684 Ga0495663_0009814 3300046525 Bacteria 2658
685 Ga0495666_0010356 3300046526 Bacteria 4647
686 Ga0495642_0010168 3300046528 Bacteria 3604
687 Ga0495642_0532180 3300046528 Bacteria 521
688 Ga0495652_0012460 3300046529 Bacteria 7666
689 Ga0495654_0078989 3300046530 Bacteria 1546
690 Ga0495665_0593313 3300046531 Bacteria 554
691 Ga0495640_0009264 3300046533 Bacteria 7675
692 Ga0495640_0145921 3300046533 Bacteria 1522
693 Ga0495586_0089819 3300046535 Bacteria 1696
694 Ga0495586_0470595 3300046535 Bacteria 725
695 Ga0495587_0419179 3300046536 Bacteria 743
696 Ga0495621_0322780 3300046539 Bacteria 643
697 Ga0495645_0160416 3300046543 Bacteria 1555
698 Ga0495645_0287484 3300046543 Bacteria 1079
699 Ga0495645_0358971 3300046543 Bacteria 937
700 Ga0495622_0047154 3300046557 Bacteria 2002
701 Ga0495622_0065903 3300046557 Bacteria 1674
702 Ga0495622_0101223 3300046557 Bacteria 1320
703 Ga0495633_0042904 3300046558 Bacteria 2146
704 Ga0495633_0573919 3300046558 Bacteria 507
705 Ga0495656_0000073 3300046615 Bacteria 44754
706 Ga0495668_0012473 3300046616 Bacteria 5038
707 Ga0495634_0044708 3300046642 Bacteria 2996
708 Ga0495611_0046736 3300046648 Bacteria 1941
709 Ga0495625_0038753 3300046660 Bacteria 3486
710 Ga0495625_0183547 3300046660 Bacteria 1389
711 Ga0495635_0021267 3300046663 Bacteria 4522
712 Ga0495635_0335406 3300046663 Bacteria 1010
713 Ga0495659_0370794 3300046664 Bacteria 614
714 Ga0495661_0029347 3300046665 Bacteria 3511
715 Ga0495588_0002150 3300046674 Bacteria 8432
716 Ga0495588_0089506 3300046674 Bacteria 1612
717 Ga0495588_0096693 3300046674 Bacteria 1549
718 Ga0495588_0242631 3300046674 Bacteria 950
719 Ga0495588_0543978 3300046674 Bacteria 608
720 Ga0495657_0099059 3300046675 Bacteria 1859
721 Ga0495599_0271547 3300046678 Bacteria 1029
722 Ga0495599_0275980 3300046678 Bacteria 1019
723 Ga0495599_0554923 3300046678 Bacteria 672
724 Ga0495623_0047241 3300046679 Bacteria 2732
725 Ga0495658_0060684 3300046683 Bacteria 2169
726 Ga0495658_0438519 3300046683 Bacteria 834
727 Ga0495669_0383665 3300046684 Bacteria 680
728 Ga0495613_0021244 3300046689 Bacteria 4841
729 Ga0495613_0170537 3300046689 Bacteria 1544
730 Ga0495613_0570427 3300046689 Bacteria 755
731 Ga0495624_0021994 3300046690 Bacteria 4222
732 Ga0495624_0065203 3300046690 Bacteria 2275
733 Ga0495624_0699164 3300046690 Bacteria 602
734 Ga0495670_0129399 3300046691 Bacteria 1315
735 Ga0495649_0031727 3300046694 Bacteria 2912
736 Ga0495589_0212769 3300046794 Bacteria 910
737 Ga0495600_0125983 3300046809 Bacteria 1666
738 Ga0495600_0166548 3300046809 Bacteria 1423
739 Ga0495660_0208771 3300046810 Bacteria 927
740 Ga0495581_0094891 3300047315 Bacteria 1732
741 Ga0495581_0235632 3300047315 Bacteria 1070
742 Ga0495604_0151764 3300047317 Bacteria 1645
743 Ga0495604_0225515 3300047317 Bacteria 1288
744 Ga0495604_0625339 3300047317 Bacteria 688
745 Ga0495636_0009829 3300047318 Bacteria 3767
746 Ga0495636_0063959 3300047318 Bacteria 1560
747 Ga0495636_0367052 3300047318 Bacteria 681
748 Ga0495674_0066221 3300047319 Bacteria 3135
749 Ga0495674_0108554 3300047319 Bacteria 2354
750 Ga0495676_0008000 3300047321 Bacteria 9694
751 Ga0495676_0066306 3300047321 Bacteria 2798
752 Ga0495676_0105305 3300047321 Bacteria 2080
753 Ga0495680_0091481 3300047322 Bacteria 2280
754 Ga0495687_001616 3300047443 Bacteria 20319
755 Ga0495687_055125 3300047443 Bacteria 1663
756 Ga0495687_084167 3300047443 Bacteria 1236
757 Ga0495675_0006543 3300047444 Bacteria 7134
758 Ga0495675_0668309 3300047444 Bacteria 584
759 Ga0495677_0046213 3300047445 Bacteria 1598
760 Ga0495677_0351579 3300047445 Bacteria 582
761 Ga0495685_001871 3300047447 Bacteria 6504
762 Ga0495685_005147 3300047447 Bacteria 4258
763 Ga0495681_0064080 3300047470 Bacteria 1685
764 Ga0495681_0198968 3300047470 Bacteria 814
765 Ga0495684_0130016 3300047471 Bacteria 1892
766 Ga0495686_0111878 3300047472 Bacteria 1636
767 Ga0495686_0498386 3300047472 Bacteria 642
768 Ga0495686_0509102 3300047472 Bacteria 633
769 Ga0495686_0568431 3300047472 Bacteria 590
770 Ga0495593_0090469 3300047673 Bacteria 1576
771 Ga0495593_0096633 3300047673 Bacteria 1517
772 Ga0495602_0446839 3300048088 Bacteria 913
773 Ga0495614_0033238 3300048089 Bacteria 2219
774 Ga0495626_0111202 3300048091 Bacteria 1186
775 Ga0495626_0115705 3300048091 Bacteria 1157
776 Ga0496100_0003006 3300048903 Bacteria 8695
777 Ga0496100_0009927 3300048903 Bacteria 5369
778 Ga0496100_0262922 3300048903 Bacteria 1280
779 Ga0496101_0003437 3300048904 Bacteria 9883
780 Ga0496101_0003632 3300048904 Bacteria 9631
781 Ga0496101_0005647 3300048904 Bacteria 7980
782 Ga0496101_0296101 3300048904 Bacteria 1267
783 Ga0496101_0342137 3300048904 Bacteria 1175
784 Ga0496101_0378587 3300048904 Bacteria 1113
785 Ga0496101_0441698 3300048904 Bacteria 1026
786 Ga0496101_1078930 3300048904 Bacteria 631
787 Ga0496102_0000044 3300048905 Bacteria 187834
788 Ga0496102_0005443 3300048905 Bacteria 10797
789 Ga0496102_0014277 3300048905 Bacteria 6902
790 Ga0496102_0074466 3300048905 Bacteria 3121
791 Ga0496102_0347129 3300048905 Bacteria 1397
792 Ga0496102_1100422 3300048905 Bacteria 714
793 Ga0496103_0000123 3300048906 Bacteria 83794
794 Ga0496103_0002209 3300048906 Bacteria 12338
795 Ga0496103_0029536 3300048906 Bacteria 3332
796 Ga0496103_0085105 3300048906 Bacteria 1992
797 Ga0496103_0108051 3300048906 Bacteria 1765
798 Ga0496104_0001352 3300048907 Bacteria 21226
799 Ga0496104_0013914 3300048907 Bacteria 7259
800 Ga0496104_0037452 3300048907 Bacteria 4536
801 Ga0496104_0040299 3300048907 Bacteria 4378
802 Ga0496104_0069434 3300048907 Bacteria 3349
803 Ga0496104_0647129 3300048907 Bacteria 966
804 Ga0496104_1466524 3300048907 Bacteria 585
805 Ga0496105_0001642 3300048908 Bacteria 15921
806 Ga0496105_0062883 3300048908 Bacteria 3062
807 Ga0496105_0111863 3300048908 Bacteria 2253
808 Ga0496105_0148916 3300048908 Bacteria 1924
809 Ga0496105_0242187 3300048908 Bacteria 1463
810 Ga0496105_1003590 3300048908 Bacteria 624
811 Ga0496105_1196171 3300048908 Bacteria 560
812 Ga0496106_0003811 3300048909 Bacteria 11238
813 Ga0496106_0131730 3300048909 Bacteria 1961
814 Ga0496106_0167838 3300048909 Bacteria 1738
815 Ga0496106_0187073 3300048909 Bacteria 1645
816 Ga0496107_0005200 3300048910 Bacteria 8888
817 Ga0496107_0017687 3300048910 Bacteria 5016
818 Ga0496107_0300023 3300048910 Bacteria 1196
819 Ga0496107_0477407 3300048910 Bacteria 925
820 Ga0496108_0001073 3300048911 Bacteria 21338
821 Ga0496108_0010591 3300048911 Bacteria 7484
822 Ga0496108_0221656 3300048911 Bacteria 1643
823 Ga0496108_1160860 3300048911 Bacteria 654
824 Ga0496109_0001427 3300048912 Bacteria 19839
825 Ga0496109_0031889 3300048912 Bacteria 4734
826 Ga0496109_0032893 3300048912 Bacteria 4665
827 Ga0496109_0158597 3300048912 Bacteria 2119
828 Ga0496109_0291856 3300048912 Bacteria 1537
829 Ga0496109_0308043 3300048912 Bacteria 1494
830 Ga0496109_0945495 3300048912 Bacteria 800
831 Ga0496110_0019879 3300048913 Bacteria 5660
832 Ga0496110_0091020 3300048913 Bacteria 2728
833 Ga0496110_0114355 3300048913 Bacteria 2428
834 Ga0496110_0114747 3300048913 Bacteria 2424
835 Ga0496110_0118502 3300048913 Bacteria 2384
836 Ga0496110_0212754 3300048913 Bacteria 1758
837 Ga0496110_0632040 3300048913 Bacteria 970
838 Ga0496110_1347307 3300048913 Bacteria 623
839 Ga0496111_0002651 3300048914 Bacteria 10848
840 Ga0496111_0088090 3300048914 Bacteria 2273
841 Ga0496111_0102392 3300048914 Bacteria 2105
842 Ga0496112_0105661 3300048915 Bacteria 2785
843 Ga0496112_0144537 3300048915 Bacteria 2347
844 Ga0496112_0903852 3300048915 Bacteria 805
845 Ga0496113_0172971 3300048916 Bacteria 1711
846 Ga0496113_0271922 3300048916 Bacteria 1354
847 Ga0496113_1190826 3300048916 Bacteria 595
848 Ga0496114_0003033 3300048917 Bacteria 12879
849 Ga0496114_0014718 3300048917 Bacteria 6286
850 Ga0496114_0025803 3300048917 Bacteria 4806
851 Ga0496114_0028600 3300048917 Bacteria 4575
852 Ga0496114_0085365 3300048917 Bacteria 2674
853 Ga0496114_0093689 3300048917 Bacteria 2554
854 Ga0496114_0159218 3300048917 Bacteria 1962
855 Ga0496114_0160327 3300048917 Bacteria 1955
856 Ga0496114_1177035 3300048917 Bacteria 652
857 Ga0496114_1519473 3300048917 Bacteria 557
858 Ga0496115_0018895 3300048918 Bacteria 5300
859 Ga0496115_0217946 3300048918 Bacteria 1575
860 Ga0496117_0345407 3300048920 Bacteria 770
861 Ga0496118_0106977 3300048921 Bacteria 1869
862 Ga0496119_0015393 3300048922 Bacteria 5893
863 Ga0496121_0008995 3300048924 Bacteria 11580
864 Ga0496121_0711222 3300048924 Bacteria 603
865 Ga0496122_0260143 3300048925 Bacteria 964
866 Ga0496125_0519795 3300048928 Bacteria 666
867 Ga0496126_0000026 3300048929 Bacteria 422310
868 Ga0495678_040874 3300049459 Bacteria 1860
869 Ga0501320_019591 3300049536 Bacteria 773
870 Ga0501325_056979 3300049541 Bacteria 509
871 Ga0501031_0023018 3300049568 Bacteria 4063
872 Ga0501031_0073073 3300049568 Bacteria 2233
873 Ga0501031_0343690 3300049568 Bacteria 966
874 Ga0501032_0173014 3300049569 Bacteria 1415
875 Ga0501032_0320542 3300049569 Bacteria 1000
876 Ga0501033_0189168 3300049570 Bacteria 1474
877 Ga0501033_0192909 3300049570 Bacteria 1457
878 Ga0501034_0023509 3300049571 Bacteria 6280
879 Ga0501034_0481555 3300049571 Bacteria 1156
880 Ga0501034_0742682 3300049571 Bacteria 877
881 Ga0501034_1332925 3300049571 Bacteria 594
882 Ga0501036_0166222 3300049572 Bacteria 1860
883 Ga0501036_0632376 3300049572 Bacteria 887
884 Ga0501037_0014653 3300049573 Bacteria 5769
885 Ga0501037_0640389 3300049573 Bacteria 711
886 Ga0501038_0528442 3300049574 Bacteria 899
887 Ga0501039_0037309 3300049575 Bacteria 3750
888 Ga0501039_0068441 3300049575 Bacteria 2757
889 Ga0501039_0335445 3300049575 Bacteria 1188
890 Ga0501040_0063758 3300049576 Bacteria 2536
891 Ga0501040_0273327 3300049576 Bacteria 1207
892 Ga0501040_0725630 3300049576 Bacteria 719
893 Ga0501041_0027304 3300049577 Bacteria 3440
894 Ga0501041_0048489 3300049577 Bacteria 2587
895 Ga0501041_0249025 3300049577 Bacteria 1117
896 Ga0501042_0048239 3300049578 Bacteria 3037
897 Ga0501042_0064138 3300049578 Bacteria 2625
898 Ga0501042_0406136 3300049578 Bacteria 987
899 Ga0501042_0548212 3300049578 Bacteria 840
900 Ga0501043_0053889 3300049579 Bacteria 3158
901 Ga0501043_0291779 3300049579 Bacteria 1248
902 Ga0501043_0675573 3300049579 Bacteria 756
903 Ga0501046_0045749 3300049580 Bacteria 3475
904 Ga0501046_0459756 3300049580 Bacteria 915
905 Ga0501046_1274242 3300049580 Bacteria 503
906 Ga0501047_0039795 3300049581 Bacteria 4547
907 Ga0501048_0025305 3300049582 Bacteria 4325
908 Ga0501048_0132673 3300049582 Bacteria 1760
909 Ga0501067_0222949 3300049583 Bacteria 1050
910 Ga0501068_0218630 3300049584 Bacteria 1211
911 Ga0501069_0324543 3300049585 Bacteria 905
912 Ga0501070_0003499 3300049586 Bacteria 13603
913 Ga0501070_1334663 3300049586 Bacteria 547
914 Ga0501071_0080329 3300049587 Bacteria 2384
915 Ga0501071_0246643 3300049587 Bacteria 1347
916 Ga0501071_0440933 3300049587 Bacteria 996
917 Ga0501072_0016033 3300049588 Bacteria 5746
918 Ga0501072_0019727 3300049588 Bacteria 5215
919 Ga0501072_0617195 3300049588 Bacteria 854
920 Ga0501074_0137136 3300049590 Bacteria 1750
921 Ga0501074_0450420 3300049590 Bacteria 913
922 Ga0501074_1290099 3300049590 Bacteria 512
923 Ga0501075_0121026 3300049591 Bacteria 1992
924 Ga0501075_0156975 3300049591 Bacteria 1735
925 Ga0501076_0037194 3300049592 Bacteria 3816
926 Ga0501076_0121735 3300049592 Bacteria 2113
927 Ga0501076_0433121 3300049592 Bacteria 1082
928 Ga0501076_0553768 3300049592 Bacteria 948
929 Ga0501077_0039288 3300049593 Bacteria 3014
930 Ga0501077_0147522 3300049593 Bacteria 1492
931 Ga0501077_0694437 3300049593 Bacteria 654
932 Ga0501079_0068644 3300049741 Bacteria 2736
933 Ga0501080_0328331 3300049742 Bacteria 1384
934 Ga0501081_0038825 3300049743 Bacteria 3256
935 Ga0501081_0164928 3300049743 Bacteria 1598
936 Ga0501081_1278983 3300049743 Bacteria 556
937 Ga0501083_0201281 3300049744 Bacteria 1299
938 Ga0501083_0708608 3300049744 Bacteria 655
939 Ga0501035_0035383 3300049822 Bacteria 4532
940 Ga0501044_0000854 3300049823 Bacteria 36617
941 Ga0501044_0426551 3300049823 Bacteria 1235
942 Ga0501045_0077963 3300049824 Bacteria 2442
943 Ga0501045_0118141 3300049824 Bacteria 1968
944 Ga0501045_0298601 3300049824 Bacteria 1199
945 Ga0501045_0345218 3300049824 Bacteria 1108
946 nmdc:mga03683_304756_c1 3300050489 Bacteria 748
947 nmdc:mga03683_508175_c1 3300050489 Bacteria 584
948 nmdc:mga03n38_27148_c1 3300050490 Bacteria 2372
949 nmdc:mga03n38_6707_c1 3300050490 Bacteria 4023
950 nmdc:mga03n38_911639_c1 3300050490 Bacteria 517
951 nmdc:mga0yw44_43246_c1 3300050492 Bacteria 2689
952 nmdc:mga0yw44_521209_c1 3300050492 Bacteria 807
953 nmdc:mga0yw44_84242_c1 3300050492 Bacteria 1998
954 nmdc:mga0k408_250805_c1 3300050493 Bacteria 1057
955 nmdc:mga0k408_26286_c1 3300050493 Bacteria 3299
956 nmdc:mga0k408_743818_c1 3300050493 Bacteria 573
957 nmdc:mga06z11_308684_c1 3300050494 Bacteria 942
958 nmdc:mga06z11_338566_c1 3300050494 Bacteria 899
959 nmdc:mga04h51_114965_c1 3300050495 Bacteria 996
960 nmdc:mga07m45_542831_c1 3300050496 Bacteria 672
961 nmdc:mga07m45_64778_c1 3300050496 Bacteria 2074
962 nmdc:mga05p37_1106233_c1 3300050507 Bacteria 829
963 nmdc:mga05p37_391874_c1 3300050507 Bacteria 1624
964 nmdc:mga05p37_63568_c1 3300050507 Bacteria 4542
965 nmdc:mga0qj67_104126_c1 3300050509 Bacteria 2289
966 nmdc:mga06r32_116320_c1 3300050510 Bacteria 2634
967 nmdc:mga0n895_18784_c1 3300050512 Bacteria 5880
968 nmdc:mga0rr50_14251_c1 3300050513 Bacteria 5207
969 nmdc:mga0a205_98967_c2 3300050515 Bacteria 1883
970 nmdc:mga0sz30_353798_c1 3300050516 Bacteria 656
971 Ga0495619_0162262 3300053085 Bacteria 1544
972 Ga0500643_215482 3300053087 Bacteria 515
973 Ga0500644_0018445 3300053088 Bacteria 2044
974 Ga0500646_0053454 3300053090 Bacteria 1171
975 Ga0500650_0174622 3300053098 Bacteria 986
976 Ga0500554_030720 3300053102 Bacteria 1581
977 Ga0500562_001750 3300053108 Bacteria 5417
978 Ga0500568_0180783 3300053139 Bacteria 775
979 Ga0500573_0143528 3300053140 Bacteria 1313
980 Ga0500586_004324 3300053145 Bacteria 3464
981 Ga0500590_031916 3300053148 Bacteria 2731
982 Ga0500600_0069878 3300053149 Bacteria 1929
983 Ga0500619_000013 3300053154 Bacteria 56987
984 Ga0501084_0017861 3300054114 Bacteria 5905
985 Ga0501084_0119084 3300054114 Bacteria 2219
986 Ga0590071_002328 3300059421 Bacteria 4799
987 Ga0501082_0079810 3300060353 Bacteria 2824
988 Ga0501082_0575828 3300060353 Bacteria 985
989 Ga0466962_0026001 3300061719 Bacteria 2810
990 Ga0466962_0182206 3300061719 Bacteria 1024
991 Ga0466962_0204940 3300061719 Bacteria 964
992 Ga0530510_0035937 3300061734 Bacteria 3571
993 Ga0530510_0370493 3300061734 Bacteria 1077
994 Ga0530510_0474942 3300061734 Bacteria 947
995 Ga0530510_1295287 3300061734 Bacteria 559
996 2501941712 2501939600 Bacteria 6907073
997 2559426176 2558860280 Bacteria 11429938
998 2616693470 2616644814 Bacteria 11555299
999 2644607862 2643221711 Bacteria 4865335
1000 2729905317 2728369276 Bacteria 5610032
1001 2739247849 2738543013 Bacteria 5618633
1002 2793980085 2791355406 Bacteria 11364898
1003 2842734119 2842733646 Bacteria 5716726
1004 2856863314 2856858025 Bacteria 7255264
1005 2858874511 2858868258 Bacteria 7683772
1006 2866613216 2866612099 Bacteria 7543886
1007 2885195364 2885192300 Bacteria 5882526
1008 2899372111 2899370129 Bacteria 6781179
1009 2902582960 2902582711 Bacteria 6187705
1010 2919704965 2919704043 Bacteria 5560311
1011 2997601797 2997600082 Bacteria 9896405
1012 649814921 649633069 Bacteria 6962533
1013 8008575993 8008574985 Bacteria 7815457
1014 8047900101 8047893842 Bacteria 11723082
1015 8048358826 8048356638 Bacteria 11044339
1016 8048377048 8048369669 Bacteria 11666822
1017 8048386103 8048379754 Bacteria 11877923
1018 8056834290 8056829672 Bacteria 9045328
1019 Ga0157379_11222599
1020 JGI24735J21928_10172920
1021 JGI24748J21848_1008115
1022 JGI24744J21845_10008927
1023 JGI24742J22300_10001686
1024 JGI25159J45721_1018451
1025 rootH2_10034964
1026 rootL2_10026840
1027 Ga0055536_1021586
1028 Ga0055534_1001074
1029 Ga0065165_1023608
1030 Ga0065714_10304250
1031 Ga0065715_10265259
1032 Ga0070658_10090488
1033 Ga0070676_10070662
1034 Ga0070676_10112415
1035 Ga0070690_100371934
1036 Ga0070670_100449115
1037 Ga0070670_101161066
1038 Ga0070670_101206962
1039 Ga0070666_10140479
1040 Ga0070666_10186907
1041 Ga0070680_100413145
1042 Ga0070682_101082412
1043 Ga0070682_101673269
1044 Ga0068868_100016515
1045 Ga0068868_101073879
1046 Ga0068868_101465723
1047 Ga0070660_100207859
1048 Ga0070660_100805747
1049 Ga0070689_100025236
1050 Ga0070691_10225640
1051 Ga0070692_10154673
1052 Ga0070668_100018680
1053 Ga0070668_100332893
1054 Ga0070669_100064693
1055 Ga0070669_100244349
1056 Ga0070675_100173253
1057 Ga0070675_100356422
1058 Ga0070675_100793664
1059 Ga0070671_100766453
1060 Ga0070674_100008012
1061 Ga0070674_100021660
1062 Ga0070674_100341654
1063 Ga0070674_101411477
1064 Ga0070673_100042639
1065 Ga0070673_100575249
1066 Ga0070673_101812787
1067 Ga0070659_100152307
1068 Ga0070659_100407126
1069 Ga0070659_100413861
1070 Ga0070667_100027114
1071 Ga0070667_100036634
1072 Ga0070709_10199704
1073 Ga0070714_100105406
1074 Ga0070713_100079692
1075 Ga0070710_10039279
1076 Ga0070701_10017100
1077 Ga0070711_100014147
1078 Ga0070705_100048274
1079 Ga0070705_100071395
1080 Ga0070700_100053452
1081 Ga0070700_100176358
1082 Ga0070700_100807657
1083 Ga0070694_100173161
1084 Ga0070708_102150063
1085 Ga0070663_100558960
1086 Ga0070678_100001294
1087 Ga0070678_100078800
1088 Ga0070678_100086545
1089 Ga0070678_100784048
1090 Ga0070662_100257279
1091 Ga0070662_101398133
1092 Ga0070681_10144431
1093 Ga0070681_10442928
1094 Ga0068867_100008440
1095 Ga0068867_100293167
1096 Ga0070685_10439347
1097 Ga0070706_100090329
1098 Ga0070707_100062969
1099 Ga0070707_100528875
1100 Ga0070699_100180201
1101 Ga0070699_101159005
1102 Ga0070679_100269820
1103 Ga0070679_100955777
1104 Ga0070684_100369695
1105 Ga0068853_100036947
1106 Ga0068853_100107809
1107 Ga0068853_100315093
1108 Ga0070672_100151280
1109 Ga0070672_100548114
1110 Ga0070686_100093953
1111 Ga0070695_100045120
1112 Ga0070696_100066279
1113 Ga0070696_100172963
1114 Ga0070693_100031922
1115 Ga0070693_101161568
1116 Ga0070693_101171658
1117 Ga0070665_100042922
1118 Ga0070665_100051263
1119 Ga0070665_100383285
1120 Ga0070665_100534506
1121 Ga0070665_100910509
1122 Ga0070665_101304798
1123 Ga0070665_101662619
1124 Ga0070704_100024045
1125 Ga0068855_100114588
1126 Ga0068855_100855039
1127 Ga0070664_101332470
1128 Ga0068854_100023417
1129 Ga0068854_100045135
1130 Ga0070702_100024373
1131 Ga0070702_100199986
1132 Ga0068852_100549006
1133 Ga0068859_100037263
1134 Ga0068859_100111455
1135 Ga0068859_100293493
1136 Ga0068859_101260357
1137 Ga0068864_101975244
1138 Ga0068866_10001530
1139 Ga0068861_100038370
1140 Ga0068861_101379145
1141 Ga0068851_10337315
1142 Ga0068863_100146957
1143 Ga0068863_100373813
1144 Ga0068863_101056975
1145 Ga0068858_100267655
1146 Ga0068860_100011938
1147 Ga0068862_100047952
1148 Ga0068862_100610275
1149 Ga0068862_101376999
1150 Ga0081538_10046032
1151 Ga0081538_10091673
1152 Ga0081540_1007386
1153 Ga0081540_1016146
1154 Ga0081540_1167435
1155 Ga0081539_10000299
1156 Ga0081539_10006277
1157 Ga0070717_10010702
1158 Ga0070717_10066969
1159 Ga0070717_10120662
1160 Ga0075365_10071999
1161 Ga0075365_10211734
1162 Ga0075365_10220873
1163 Ga0075365_10271109
1164 Ga0075368_10143308
1165 Ga0075368_10150401
1166 Ga0075363_100023402
1167 Ga0075363_100592895
1168 Ga0075363_100696964
1169 Ga0075364_10029290
1170 Ga0075364_10458701
1171 Ga0070715_10052427
1172 Ga0070716_100068576
1173 Ga0070716_101393205
1174 Ga0070712_100008934
1175 Ga0070712_100345257
1176 Ga0075362_10060502
1177 Ga0075362_10720379
1178 Ga0075367_10390720
1179 Ga0075366_10208717
1180 Ga0075366_10268627
1181 Ga0075370_10368658
1182 Ga0075370_10947642
1183 Ga0068871_100398100
1184 Ga0075428_100018822
1185 Ga0075428_100354231
1186 Ga0075430_100072971
1187 Ga0075431_100042432
1188 Ga0075431_101084318
1189 Ga0075433_10182552
1190 Ga0075433_11767433
1191 Ga0075434_100367206
1192 Ga0068865_100125572
1193 Ga0068865_100129560
1194 Ga0097620_100037262
1195 Ga0097620_100111448
1196 Ga0097620_100293499
1197 Ga0097620_101260336
1198 Ga0075435_100014526
1199 Ga0105251_10017909
1200 Ga0105244_10197529
1201 Ga0105250_10092247
1202 Ga0105240_10074931
1203 Ga0105240_11384836
1204 Ga0105240_12236665
1205 Ga0105240_12472115
1206 Ga0105245_10009348
1207 Ga0105245_10368583
1208 Ga0105245_11653112
1209 Ga0105247_10006155
1210 Ga0105247_10010073
1211 Ga0105247_11080438
1212 Ga0105247_11651280
1213 Ga0114129_10017668
1214 Ga0114129_10678086
1215 Ga0114129_10942226
1216 Ga0105243_10051593
1217 Ga0105243_10897620
1218 Ga0105241_11225501
1219 Ga0105242_10042876
1220 Ga0105248_10038947
1221 Ga0105248_10143185
1222 Ga0105248_10859441
1223 Ga0105248_11240489
1224 Ga0105237_10318849
1225 Ga0105237_11013762
1226 Ga0105237_11314535
1227 Ga0105238_10024517
1228 Ga0105238_10300619
1229 Ga0105249_11822231
1230 Ga0105239_10142382
1231 Ga0105239_10171478
1232 Ga0105239_10420894
1233 Ga0105239_12761492
1234 Ga0105246_10114745
1235 Ga0105246_11917460
1236 Ga0157371_10190717
1237 Ga0157370_11678116
1238 Ga0157369_10310155
1239 Ga0157369_10331275
1240 Ga0171462_1004
1241 Ga0157374_10208145
1242 Ga0157374_10493822
1243 Ga0157378_10021612
1244 Ga0163162_10084317
1245 Ga0163162_10142108
1246 Ga0163162_10332349
1247 Ga0163162_10654578
1248 Ga0157372_10102729
1249 Ga0157372_11219675
1250 Ga0157375_10210678
1251 Ga0157375_10224591
1252 Ga0157375_10614737
1253 Ga0157375_10731172
1254 Ga0157375_11403674
1255 Ga0157380_10049476
1256 Ga0182008_10001482
1257 Ga0182008_10749493
1258 Ga0157377_10073172
1259 Ga0157377_10333652
1260 Ga0157379_10143086
1261 Ga0157379_10207813
1262 Ga0157379_10300546
1263 Ga0157376_10894255
1264 Ga0157376_10984409
1265 Ga0157376_11044620
1266 Ga0157376_12384402
1267 Ga0182007_10000321
1268 Ga0182005_1037556
1269 Ga0183362_10003
1270 Ga0163161_10073709
1271 Ga0163161_10098765
1272 Ga0163161_10743269
1273 Ga0163161_11172797
1274 Ga0163161_11448280
1275 Ga0213876_10028695
1276 Ga0224712_10046356
1277 Ga0209130_1006006
1278 Ga0209675_1005102
1279 Ga0209676_1006325
1280 Ga0209564_1045945
1281 Ga0209758_1008881
1282 Ga0209050_1064932
1283 Ga0207426_1068224
1284 Ga0209051_1021425
1285 Ga0209257_1021959
1286 Ga0207696_1185139
1287 Ga0207713_1032370
1288 Ga0207682_10112758
1289 Ga0207692_10000532
1290 Ga0207692_10014167
1291 Ga0207642_10005216
1292 Ga0207642_10365176
1293 Ga0207710_10005704
1294 Ga0207710_10013402
1295 Ga0207710_10203756
1296 Ga0207688_10105007
1297 Ga0207688_10479698
1298 Ga0207680_10273418
1299 Ga0207645_10133496
1300 Ga0207645_10591921
1301 Ga0207643_10051860
1302 Ga0207684_11190203
1303 Ga0207654_10100282
1304 Ga0207707_10091702
1305 Ga0207707_10257787
1306 Ga0207695_10369810
1307 Ga0207671_10319052
1308 Ga0207671_10724174
1309 Ga0207693_10022554
1310 Ga0207693_10155484
1311 Ga0207693_10240116
1312 Ga0207663_10020680
1313 Ga0207660_10098925
1314 Ga0207660_10207307
1315 Ga0207660_10416852
1316 Ga0207662_10192237
1317 Ga0207657_10241729
1318 Ga0207657_10325893
1319 Ga0207657_10376376
1320 Ga0207657_10769224
1321 Ga0207652_10331988
1322 Ga0207652_10571534
1323 Ga0207652_10748062
1324 Ga0207652_11355563
1325 Ga0207646_10168149
1326 Ga0207681_10060858
1327 Ga0207681_10263604
1328 Ga0207694_10065630
1329 Ga0207650_10644367
1330 Ga0207650_11388262
1331 Ga0207659_10188988
1332 Ga0207659_10203087
1333 Ga0207659_10562722
1334 Ga0207659_10669363
1335 Ga0207687_10008069
1336 Ga0207687_10030326
1337 Ga0207700_10462442
1338 Ga0207700_10766761
1339 Ga0207664_10068766
1340 Ga0207644_10844881
1341 Ga0207644_11043055
1342 Ga0207690_10172027
1343 Ga0207690_10367526
1344 Ga0207690_10386997
1345 Ga0207690_10419978
1346 Ga0207690_11013745
1347 Ga0207706_10046195
1348 Ga0207709_10012850
1349 Ga0207709_11615274
1350 Ga0207670_10644665
1351 Ga0207669_10010595
1352 Ga0207669_10086942
1353 Ga0207669_10286496
1354 Ga0207669_11089017
1355 Ga0207704_10001963
1356 Ga0207704_10159079
1357 Ga0207704_10688319
1358 Ga0207665_10013758
1359 Ga0207691_10012135
1360 Ga0207691_10683048
1361 Ga0207711_10089795
1362 Ga0207711_10823973
1363 Ga0207711_10903854
1364 Ga0207711_11417763
1365 Ga0207689_10104805
1366 Ga0207661_10237536
1367 Ga0207661_10446308
1368 Ga0207679_11720307
1369 Ga0207667_10353033
1370 Ga0207667_11067545
1371 Ga0207667_11301264
1372 Ga0207651_10001558
1373 Ga0207651_10778370
1374 Ga0207712_10413268
1375 Ga0207712_10424765
1376 Ga0207668_10012098
1377 Ga0207640_10073446
1378 Ga0207640_10210114
1379 Ga0207658_10004918
1380 Ga0207658_10029493
1381 Ga0207677_10011807
1382 Ga0207677_10065995
1383 Ga0207677_10297832
1384 Ga0207703_10096913
1385 Ga0207703_10185395
1386 Ga0207639_10015661
1387 Ga0207639_10027103
1388 Ga0207678_10114498
1389 Ga0207678_10505399
1390 Ga0207678_10799330
1391 Ga0207708_10051067
1392 Ga0207708_10323234
1393 Ga0207702_10691622
1394 Ga0207641_10163572
1395 Ga0207641_11333372
1396 Ga0207648_10066671
1397 Ga0207648_10323752
1398 Ga0207648_10371651
1399 Ga0207648_11661497
1400 Ga0207676_10277669
1401 Ga0207676_10335749
1402 Ga0207676_10390358
1403 Ga0207676_11210054
1404 Ga0207676_11249253
1405 Ga0207675_100058616
1406 Ga0207675_100138746
1407 Ga0207675_100740156
1408 Ga0207683_10062809
1409 Ga0207683_10081042
1410 Ga0207683_10115571
1411 Ga0207683_10232151
1412 Ga0207683_10323035
1413 Ga0207683_10617951
1414 Ga0207683_10665235
1415 Ga0207683_11113099
1416 Ga0207698_10209663
1417 Ga0207698_10993240
1418 Ga0207698_11084800
1419 Ga0207698_11321224
1420 Ga0209813_10161325
1421 Ga0209974_10224326
1422 Ga0207428_10111254
1423 Ga0268266_10016681
1424 Ga0268266_10204779
1425 Ga0268266_10208375
1426 Ga0268266_10222587
1427 Ga0268266_10435207
1428 Ga0268266_10480135
1429 Ga0268266_11108744
1430 Ga0268265_10316918
1431 Ga0268264_10030902
1432 Ga0265337_1031514
1433 Ga0265318_10325930
1434 Ga0265336_10061960
1435 Ga0307517_10130253
1436 Ga0307515_10000487
1437 Ga0307515_10056940
1438 Ga0307511_10000159
1439 Ga0307511_10001103
1440 Ga0307512_10053040
1441 Ga0316177_1113942
1442 Ga0265320_10000429
1443 Ga0265331_10197765
1444 Ga0265327_10003277
1445 Ga0265316_10037489
1446 Ga0307513_10025548
1447 Ga0307513_10032587
1448 Ga0307513_10033683
1449 Ga0307513_10098869
1450 Ga0307513_10308731
1451 Ga0307513_10441643
1452 Ga0307513_10445830
1453 Ga0307513_10448606
1454 Ga0307509_10036922
1455 Ga0307408_100214815
1456 Ga0307408_100269808
1457 Ga0307408_100556305
1458 Ga0307408_101932668
1459 Ga0307514_10108568
1460 Ga0316575_10002608
1461 Ga0316579_10003332
1462 Ga0316579_10422801
1463 Ga0265314_10022219
1464 Ga0316576_10002073
1465 Ga0316576_10204172
1466 Ga0316578_10000393
1467 Ga0316578_10158789
1468 Ga0307516_10001460
1469 Ga0307516_10041378
1470 Ga0307405_10456388
1471 Ga0316577_10029468
1472 Ga0307413_10096982
1473 Ga0307413_10481726
1474 Ga0307413_11207694
1475 Ga0307413_11921610
1476 Ga0307518_10009673
1477 Ga0307410_10035590
1478 Ga0307410_10282119
1479 Ga0307406_10046095
1480 Ga0307406_10145830
1481 Ga0307406_11158689
1482 Ga0307407_10022944
1483 Ga0307407_11451107
1484 Ga0307412_10551037
1485 Ga0307412_10822742
1486 Ga0307409_100069879
1487 Ga0307409_100221069
1488 Ga0307409_100277771
1489 Ga0307409_101283505
1490 Ga0307416_100365830
1491 Ga0307416_101094106
1492 Ga0307416_102273067
1493 Ga0307414_10224023
1494 Ga0307411_10000850
1495 Ga0307411_10289605
1496 Ga0307411_11303703
1497 Ga0307415_100395947
1498 Ga0316583_10010654
1499 Ga0316583_10061685
1500 Ga0316585_10154369
1501 Ga0316580_10010722
1502 Ga0316580_10081089
1503 Ga0307507_10015626
1504 Ga0307507_10047289
1505 Ga0307510_10076915
1506 Ga0316596_1020082
1507 Ga0373948_0022376
1508 Ga0373928_0031819
1509 Ga0373929_0096214
1510 Ga0373940_0013567
1511 Ga0373932_0025237
1512 Ga0373932_0034054
1513 Ga0373943_0801310
1514 Ga0373955_1000875
1515 Ga0316574_0007588
1516 Ga0316574_0182618
1517 Ga0316574_0325191
1518 Ga0316574_0639565
1519 Ga0373931_0047293
1520 Ga0316582_0001290
1521 Ga0316582_0119321
1522 Ga0316584_0005768
1523 Ga0316584_0006427
1524 Ga0316584_0028260
1525 Ga0316584_0056631
1526 Ga0373925_0341859
1527 Ga0373925_0916629
1528 Ga0395900_0685437
1529 Ga0395898_1280448
1530 Ga0395905_0001958
1531 Ga0436364_0814508
1532 Ga0395901_0038670
1533 Ga0395901_0104465
1534 Ga0395901_0155976
1535 Ga0395901_0398040
1536 Ga0436365_0301162
1537 Ga0436363_1309788
1538 Ga0436363_1589930
1539 Ga0439436_0010782
1540 Ga0439436_0018666
1541 Ga0439436_0076691
1542 Ga0439438_073999
1543 Ga0439439_0003849
1544 Ga0439439_0123106
1545 Ga0439447_012773
1546 Ga0439447_032115
1547 Ga0439461_0007746
1548 Ga0439461_0020941
1549 Ga0439466_0070440
1550 Ga0439466_0101741
1551 Ga0439465_0012312
1552 Ga0451800_0803309
1553 Ga0451802_1269109
1554 Ga0451833_0080370
1555 Ga0451837_1419958
1556 Ga0451845_0914589
1557 Ga0451847_0013531
1558 Ga0451849_0339851
1559 Ga0451843_0253762
1560 Ga0451843_1206146
1561 Ga0451843_1772571
1562 Ga0451853_0371860
1563 Ga0451853_2463512
1564 Ga0439431_0002697
1565 Ga0439431_0025503
1566 Ga0439433_0006460
1567 Ga0439433_0025770
1568 Ga0439433_0056272
1569 Ga0439433_0075693
1570 Ga0439442_020830
1571 Ga0439442_038499
1572 Ga0439445_0003652
1573 Ga0439432_001430
1574 Ga0439432_047206
1575 Ga0439449_0000791
1576 Ga0439449_0002046
1577 Ga0439449_0012758
1578 Ga0439452_003109
1579 Ga0439452_038430
1580 Ga0439457_018913
1581 Ga0439457_025777
1582 Ga0439457_026139
1583 Ga0439462_0007236
1584 Ga0439462_0012747
1585 Ga0439462_0119658
1586 Ga0450897_018121
1587 Ga0450894_001632
1588 Ga0450894_009610
1589 Ga0450898_023986
1590 Ga0450889_020336
1591 Ga0450906_030582
1592 Ga0450907_043258
1593 Ga0439446_0011919
1594 Ga0439446_0247102
1595 Ga0439446_0345635
1596 Ga0450908_022151
1597 Ga0450909_001800
1598 Ga0439434_0012172
1599 Ga0439434_0012407
1600 Ga0439434_0092605
1601 Ga0439459_0151166
1602 Ga0439460_0151314
1603 Ga0450893_0016581
1604 Ga0466969_0020496
1605 Ga0466969_0045057
1606 Ga0466972_0007057
1607 Ga0466972_0013289
1608 Ga0466972_0139847
1609 Ga0466972_0621125
1610 Ga0466965_0446689
1611 Ga0466966_0012619
1612 Ga0466966_0290131
1613 Ga0466961_0019506
1614 Ga0466961_0026723
1615 Ga0466961_0171730
1616 Ga0466963_0023612
1617 Ga0466963_0046778
1618 Ga0466964_0045742
1619 Ga0466964_0046761
1620 Ga0466971_0013985
1621 Ga0466971_0235231
1622 Ga0466968_0003477
1623 Ga0466968_0013252
1624 Ga0466968_0054924
1625 Ga0466968_0170000
1626 Ga0466970_0045561
1627 Ga0466970_0109183
1628 Ga0466970_0115115
1629 Ga0466970_0165459
1630 Ga0466970_0776843
1631 Ga0466957_0204418
1632 Ga0466957_1301351
1633 Ga0466960_0011715
1634 Ga0466960_0015043
1635 Ga0466960_0061209
1636 Ga0466960_0127334
1637 Ga0466960_0538870
1638 Ga0466960_0562661
1639 Ga0466960_0602736
1640 Ga0466959_0027067
1641 Ga0466959_0146439
1642 Ga0466959_0361069
1643 Ga0451576_0861574
1644 Ga0466958_0001930
1645 Ga0466958_0258283
1646 Ga0466967_0042891
1647 Ga0466967_0195376
1648 Ga0466967_0219775
1649 Ga0466967_0234972
1650 Ga0466967_0331305
1651 Ga0466967_0492976
1652 Ga0466967_0499147
1653 Ga0466967_0877783
1654 Ga0466967_2036727
1655 Ga0495617_007078
1656 Ga0495627_031049
1657 Ga0495592_0046118
1658 Ga0495592_0236177
1659 Ga0495603_0011194
1660 Ga0495603_0020447
1661 Ga0495603_0064159
1662 Ga0495590_0101900
1663 Ga0495629_0000826
1664 Ga0495629_0089285
1665 Ga0495629_0129549
1666 Ga0495629_0183071
1667 Ga0495638_0134535
1668 Ga0495651_0039768
1669 Ga0495651_0067319
1670 Ga0495651_0551112
1671 Ga0495653_0532159
1672 Ga0495653_0811526
1673 Ga0495650_0004071
1674 Ga0495650_0122923
1675 Ga0495580_0274634
1676 Ga0495582_0080172
1677 Ga0495605_0003700
1678 Ga0495639_0001006
1679 Ga0495639_0003852
1680 Ga0495662_0005228
1681 Ga0495664_0556275
1682 Ga0495584_0133047
1683 Ga0495594_0000177
1684 Ga0495594_0139607
1685 Ga0495583_0059830
1686 Ga0495606_0016399
1687 Ga0495608_0090288
1688 Ga0495608_0222705
1689 Ga0495610_0060642
1690 Ga0495616_0018753
1691 Ga0495618_0050137
1692 Ga0495620_0050344
1693 Ga0495628_0066026
1694 Ga0495628_0321781
1695 Ga0495628_0740758
1696 Ga0495630_0684128
1697 Ga0495631_0005737
1698 Ga0495632_0170772
1699 Ga0495643_0005063
1700 Ga0495643_0095385
1701 Ga0495648_0013270
1702 Ga0495663_0009814
1703 Ga0495666_0010356
1704 Ga0495642_0010168
1705 Ga0495642_0532180
1706 Ga0495652_0012460
1707 Ga0495654_0078989
1708 Ga0495665_0593313
1709 Ga0495640_0009264
1710 Ga0495640_0145921
1711 Ga0495586_0089819
1712 Ga0495586_0470595
1713 Ga0495587_0419179
1714 Ga0495621_0322780
1715 Ga0495645_0160416
1716 Ga0495645_0287484
1717 Ga0495645_0358971
1718 Ga0495622_0047154
1719 Ga0495622_0065903
1720 Ga0495622_0101223
1721 Ga0495633_0042904
1722 Ga0495633_0573919
1723 Ga0495656_0000073
1724 Ga0495668_0012473
1725 Ga0495634_0044708
1726 Ga0495611_0046736
1727 Ga0495625_0038753
1728 Ga0495625_0183547
1729 Ga0495635_0021267
1730 Ga0495635_0335406
1731 Ga0495659_0370794
1732 Ga0495661_0029347
1733 Ga0495588_0002150
1734 Ga0495588_0089506
1735 Ga0495588_0096693
1736 Ga0495588_0242631
1737 Ga0495588_0543978
1738 Ga0495657_0099059
1739 Ga0495599_0271547
1740 Ga0495599_0275980
1741 Ga0495599_0554923
1742 Ga0495623_0047241
1743 Ga0495658_0060684
1744 Ga0495658_0438519
1745 Ga0495669_0383665
1746 Ga0495613_0021244
1747 Ga0495613_0170537
1748 Ga0495613_0570427
1749 Ga0495624_0021994
1750 Ga0495624_0065203
1751 Ga0495624_0699164
1752 Ga0495670_0129399
1753 Ga0495649_0031727
1754 Ga0495589_0212769
1755 Ga0495600_0125983
1756 Ga0495600_0166548
1757 Ga0495660_0208771
1758 Ga0495581_0094891
1759 Ga0495581_0235632
1760 Ga0495604_0151764
1761 Ga0495604_0225515
1762 Ga0495604_0625339
1763 Ga0495636_0009829
1764 Ga0495636_0063959
1765 Ga0495636_0367052
1766 Ga0495674_0066221
1767 Ga0495674_0108554
1768 Ga0495676_0008000
1769 Ga0495676_0066306
1770 Ga0495676_0105305
1771 Ga0495680_0091481
1772 Ga0495687_001616
1773 Ga0495687_055125
1774 Ga0495687_084167
1775 Ga0495675_0006543
1776 Ga0495675_0668309
1777 Ga0495677_0046213
1778 Ga0495677_0351579
1779 Ga0495685_001871
1780 Ga0495685_005147
1781 Ga0495681_0064080
1782 Ga0495681_0198968
1783 Ga0495684_0130016
1784 Ga0495686_0111878
1785 Ga0495686_0498386
1786 Ga0495686_0509102
1787 Ga0495686_0568431
1788 Ga0495593_0090469
1789 Ga0495593_0096633
1790 Ga0495602_0446839
1791 Ga0495614_0033238
1792 Ga0495626_0111202
1793 Ga0495626_0115705
1794 Ga0496100_0003006
1795 Ga0496100_0009927
1796 Ga0496100_0262922
1797 Ga0496101_0003437
1798 Ga0496101_0003632
1799 Ga0496101_0005647
1800 Ga0496101_0296101
1801 Ga0496101_0342137
1802 Ga0496101_0378587
1803 Ga0496101_0441698
1804 Ga0496101_1078930
1805 Ga0496102_0000044
1806 Ga0496102_0005443
1807 Ga0496102_0014277
1808 Ga0496102_0074466
1809 Ga0496102_0347129
1810 Ga0496102_1100422
1811 Ga0496103_0000123
1812 Ga0496103_0002209
1813 Ga0496103_0029536
1814 Ga0496103_0085105
1815 Ga0496103_0108051
1816 Ga0496104_0001352
1817 Ga0496104_0013914
1818 Ga0496104_0037452
1819 Ga0496104_0040299
1820 Ga0496104_0069434
1821 Ga0496104_0647129
1822 Ga0496104_1466524
1823 Ga0496105_0001642
1824 Ga0496105_0062883
1825 Ga0496105_0111863
1826 Ga0496105_0148916
1827 Ga0496105_0242187
1828 Ga0496105_1003590
1829 Ga0496105_1196171
1830 Ga0496106_0003811
1831 Ga0496106_0131730
1832 Ga0496106_0167838
1833 Ga0496106_0187073
1834 Ga0496107_0005200
1835 Ga0496107_0017687
1836 Ga0496107_0300023
1837 Ga0496107_0477407
1838 Ga0496108_0001073
1839 Ga0496108_0010591
1840 Ga0496108_0221656
1841 Ga0496108_1160860
1842 Ga0496109_0001427
1843 Ga0496109_0031889
1844 Ga0496109_0032893
1845 Ga0496109_0158597
1846 Ga0496109_0291856
1847 Ga0496109_0308043
1848 Ga0496109_0945495
1849 Ga0496110_0019879
1850 Ga0496110_0091020
1851 Ga0496110_0114355
1852 Ga0496110_0114747
1853 Ga0496110_0118502
1854 Ga0496110_0212754
1855 Ga0496110_0632040
1856 Ga0496110_1347307
1857 Ga0496111_0002651
1858 Ga0496111_0088090
1859 Ga0496111_0102392
1860 Ga0496112_0105661
1861 Ga0496112_0144537
1862 Ga0496112_0903852
1863 Ga0496113_0172971
1864 Ga0496113_0271922
1865 Ga0496113_1190826
1866 Ga0496114_0003033
1867 Ga0496114_0014718
1868 Ga0496114_0025803
1869 Ga0496114_0028600
1870 Ga0496114_0085365
1871 Ga0496114_0093689
1872 Ga0496114_0159218
1873 Ga0496114_0160327
1874 Ga0496114_1177035
1875 Ga0496114_1519473
1876 Ga0496115_0018895
1877 Ga0496115_0217946
1878 Ga0496117_0345407
1879 Ga0496118_0106977
1880 Ga0496119_0015393
1881 Ga0496121_0008995
1882 Ga0496121_0711222
1883 Ga0496122_0260143
1884 Ga0496125_0519795
1885 Ga0496126_0000026
1886 Ga0495678_040874
1887 Ga0501320_019591
1888 Ga0501325_056979
1889 Ga0501031_0023018
1890 Ga0501031_0073073
1891 Ga0501031_0343690
1892 Ga0501032_0173014
1893 Ga0501032_0320542
1894 Ga0501033_0189168
1895 Ga0501033_0192909
1896 Ga0501034_0023509
1897 Ga0501034_0481555
1898 Ga0501034_0742682
1899 Ga0501034_1332925
1900 Ga0501036_0166222
1901 Ga0501036_0632376
1902 Ga0501037_0014653
1903 Ga0501037_0640389
1904 Ga0501038_0528442
1905 Ga0501039_0037309
1906 Ga0501039_0068441
1907 Ga0501039_0335445
1908 Ga0501040_0063758
1909 Ga0501040_0273327
1910 Ga0501040_0725630
1911 Ga0501041_0027304
1912 Ga0501041_0048489
1913 Ga0501041_0249025
1914 Ga0501042_0048239
1915 Ga0501042_0064138
1916 Ga0501042_0406136
1917 Ga0501042_0548212
1918 Ga0501043_0053889
1919 Ga0501043_0291779
1920 Ga0501043_0675573
1921 Ga0501046_0045749
1922 Ga0501046_0459756
1923 Ga0501046_1274242
1924 Ga0501047_0039795
1925 Ga0501048_0025305
1926 Ga0501048_0132673
1927 Ga0501067_0222949
1928 Ga0501068_0218630
1929 Ga0501069_0324543
1930 Ga0501070_0003499
1931 Ga0501070_1334663
1932 Ga0501071_0080329
1933 Ga0501071_0246643
1934 Ga0501071_0440933
1935 Ga0501072_0016033
1936 Ga0501072_0019727
1937 Ga0501072_0617195
1938 Ga0501074_0137136
1939 Ga0501074_0450420
1940 Ga0501074_1290099
1941 Ga0501075_0121026
1942 Ga0501075_0156975
1943 Ga0501076_0037194
1944 Ga0501076_0121735
1945 Ga0501076_0433121
1946 Ga0501076_0553768
1947 Ga0501077_0039288
1948 Ga0501077_0147522
1949 Ga0501077_0694437
1950 Ga0501079_0068644
1951 Ga0501080_0328331
1952 Ga0501081_0038825
1953 Ga0501081_0164928
1954 Ga0501081_1278983
1955 Ga0501083_0201281
1956 Ga0501083_0708608
1957 Ga0501035_0035383
1958 Ga0501044_0000854
1959 Ga0501044_0426551
1960 Ga0501045_0077963
1961 Ga0501045_0118141
1962 Ga0501045_0298601
1963 Ga0501045_0345218
1964 nmdc:mga03683_304756_c1
1965 nmdc:mga03683_508175_c1
1966 nmdc:mga03n38_27148_c1
1967 nmdc:mga03n38_6707_c1
1968 nmdc:mga03n38_911639_c1
1969 nmdc:mga0yw44_43246_c1
1970 nmdc:mga0yw44_521209_c1
1971 nmdc:mga0yw44_84242_c1
1972 nmdc:mga0k408_250805_c1
1973 nmdc:mga0k408_26286_c1
1974 nmdc:mga0k408_743818_c1
1975 nmdc:mga06z11_308684_c1
1976 nmdc:mga06z11_338566_c1
1977 nmdc:mga04h51_114965_c1
1978 nmdc:mga07m45_542831_c1
1979 nmdc:mga07m45_64778_c1
1980 nmdc:mga05p37_1106233_c1
1981 nmdc:mga05p37_391874_c1
1982 nmdc:mga05p37_63568_c1
1983 nmdc:mga0qj67_104126_c1
1984 nmdc:mga06r32_116320_c1
1985 nmdc:mga0n895_18784_c1
1986 nmdc:mga0rr50_14251_c1
1987 nmdc:mga0a205_98967_c2
1988 nmdc:mga0sz30_353798_c1
1989 Ga0495619_0162262
1990 Ga0500643_215482
1991 Ga0500644_0018445
1992 Ga0500646_0053454
1993 Ga0500650_0174622
1994 Ga0500554_030720
1995 Ga0500562_001750
1996 Ga0500568_0180783
1997 Ga0500573_0143528
1998 Ga0500586_004324
1999 Ga0500590_031916
2000 Ga0500600_0069878
2001 Ga0500619_000013
2002 Ga0501084_0017861
2003 Ga0501084_0119084
2004 Ga0590071_002328
2005 Ga0501082_0079810
2006 Ga0501082_0575828
2007 Ga0466962_0026001
2008 Ga0466962_0182206
2009 Ga0466962_0204940
2010 Ga0530510_0035937
2011 Ga0530510_0370493
2012 Ga0530510_0474942
2013 Ga0530510_1295287
2014 2501941712
2015 2559426176
2016 2616693470
2017 2644607862
2018 2729905317
2019 2739247849
2020 2793980085
2021 2842734119
2022 2856863314
2023 2858874511
2024 2866613216
2025 2885195364
2026 2899372111
2027 2902582960
2028 2919704965
2029 2997601797
2030 649814921
2031 8008575993
2032 8047900101
2033 8048358826
2034 8048377048
2035 8048386103
2036 8056834290

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9837 2 130
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9688 2 130
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8756 2 128
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8524 2 128
2dtt-assembly2.cif.gz_E crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8448 2 128
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9745 2 130 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9597 2 130 3.30.479.10
af_Q3TQ88_34_148_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8385 111 130 2.60.40.10
af_Q58668_4_160_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8193 9 130 3.30.479.10
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8055 2 130 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A841CCW2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9946 35 130 GO:0016829
GO:0046872
AF-A0A2R8AFA4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9882 1 130 GO:0046872
GO:0070497
AF-A0A1V2QES6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9861 1 129 GO:0046872
GO:0070497
AF-A0A1Q9SV15-F1-model_v4 deleted 0.9855 1 130
AF-L0DYM8-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9853 1 130 GO:0046872
GO:0070497

Map