F488306

General Info

Members Datasets Scaffolds Average Seq Length
1018 586 786 405

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100013974|Ga0070711_1000139742
Length 448
Sequence MAASHRSGRGHERRENGASQPASEERGKRHGLLLCARSRVVPMMVGPVVIVGAGHAGFQLAASLRQDGFAEPIALINDEGHLPYQRPPLSKAYLKGTGGSDSLMFRPDKFYSDQHIDLITDCAAAIDRSARKVTLASGAVLDYQHLVLATGARNRLLDIPNANLEAVRYLRTLDESEALRHLLAPDLRVVVIGAGFIGLEFAATARAKGLEVDVVELAPRVMARAVTAEISEFSQARHTSAGIRIHLGVQVTSIEADGTKVAGVSLSDGRHIPADLVVVGVGVLPNVELASAAGLPVASGIIVDDHLLTADQNISAVGDCALYASPRFGGSLRLESVQNATDHARCVAARLTGNAKVYDGLPWFWSDQGPDKLQMVGLTTGYDRVVVRGDREQGAFSAFCYRGEQLLGIESVNRAGDHMFGRRLLVAGGSITPEEAADASFDLKRALG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
25 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
30 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
31 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
52 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
53 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
69 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
70 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
74 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
75 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
76 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
77 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
78 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
79 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
80 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
81 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
82 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
83 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
84 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
92 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
93 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
94 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
97 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
98 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
102 2904699407
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
111 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
112 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
113 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
114 2922368715
115 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
116 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
117 2922425934
118 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
119 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
120 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
121 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
122 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
123 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
124 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
125 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
126 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
127 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
128 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
129 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
130 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
131 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
132 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
133 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
134 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
135 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
136 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
137 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
138 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
139 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
140 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
141 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
142 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
143 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
144 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
145 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
146 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
147 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
148 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
149 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
150 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
151 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
152 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
153 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
154 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
155 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
156 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
157 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
158 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
159 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
160 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
161 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
162 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
163 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
164 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
165 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
166 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
167 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
168 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
169 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
170 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
171 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
172 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
173 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
174 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
175 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
176 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
177 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
178 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
179 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
180 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
181 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
182 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
183 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
184 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
185 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
186 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
187 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
188 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
189 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
190 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
191 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
192 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
193 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
194 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
195 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
196 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
197 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
198 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
199 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
200 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
201 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
202 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
203 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
204 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
205 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
206 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
207 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
208 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
209 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
210 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
211 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
212 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
213 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
214 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
215 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
216 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
217 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
218 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
219 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
220 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
221 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
222 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
223 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
224 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
231 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
232 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
233 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
236 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
237 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
238 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
239 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
240 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
241 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
242 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
243 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
244 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
245 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
248 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
250 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
251 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
252 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
253 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
254 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
255 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
256 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
257 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
258 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
259 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
260 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
261 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
262 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
263 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
264 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
265 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
266 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
267 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
268 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
269 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
270 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
271 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
272 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
273 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
274 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
275 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
276 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
277 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
278 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
279 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
280 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
282 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
283 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
284 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
285 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
286 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
287 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
288 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
289 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
291 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
294 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
341 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
342 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
343 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
344 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
347 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
351 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
352 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
353 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
354 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
355 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
356 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
357 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
358 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
359 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
360 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
361 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
362 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
363 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
364 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
365 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
366 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
367 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
368 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
369 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
370 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
371 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
372 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
373 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
374 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
375 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
376 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
377 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
378 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
379 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
380 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
381 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
382 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
383 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
384 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
385 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
386 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
387 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
388 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
389 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
390 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
391 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
392 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
393 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
394 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
395 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
396 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
397 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
398 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
399 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
400 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
401 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
402 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
403 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
404 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
405 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
406 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
407 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
408 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
409 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
410 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
411 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
412 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
413 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
414 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
415 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
416 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
417 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
418 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
419 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
420 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
421 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
422 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
423 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
424 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
425 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
426 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
427 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
428 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
429 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
430 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
431 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
432 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
433 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
434 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
435 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
436 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
437 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
438 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
439 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
440 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
441 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
442 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
445 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
446 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
447 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
448 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
449 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
450 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
451 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
452 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
453 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
454 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
455 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
456 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
457 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
458 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
459 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
460 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
461 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
462 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
463 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
464 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
465 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
466 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
467 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
468 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
469 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
470 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
471 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
472 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
473 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
474 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
475 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
476 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
477 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
478 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
479 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
480 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
481 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
482 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
485 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
486 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
487 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
488 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
489 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
490 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
491 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
492 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
506 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
507 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
508 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
509 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
510 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
513 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
514 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
515 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
516 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
517 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
518 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
519 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
520 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
521 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
522 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
523 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
524 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
525 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
526 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
527 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
528 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
529 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
530 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
531 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
532 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
533 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
534 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
535 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
536 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
537 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
538 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
539 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
540 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
541 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
542 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
543 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
544 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
545 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
546 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
547 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
548 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
549 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
550 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
551 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
552 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
553 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
554 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
555 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
556 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
557 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
558 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
559 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
560 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
561 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
562 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
563 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
564 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
565 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
566 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
567 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
568 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
569 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
570 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
571 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
572 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
573 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
574 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
575 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
576 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
577 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
578 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
579 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
580 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
581 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
582 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
583 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
584 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
585 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
586 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.49
Metatranscriptomes 0.1
Isolates 22.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 18.37
Rhizoplane 5.99
Rhizosphere 54.52
Stem 0
Stem Tuber 0
Unclassified 13.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004915 3300001979 Bacteria 5689
2 JGI24739J22299_10002391 3300001989 Bacteria 7241
3 JGI24737J22298_10008032 3300001990 Bacteria 3546
4 JGI25153J46596_10005337 3300003215 Bacteria 6755
5 rootL2_10160148 3300003322 Bacteria 2053
6 JGI25160J50197_1011835 3300003354 Bacteria 3064
7 JGI25404J52841_10009163 3300003659 Bacteria 2115
8 Ga0055531_10006567 3300003794 Bacteria 6572
9 Ga0055543_1000462 3300004625 Bacteria 24016
10 Ga0055543_1001763 3300004625 Bacteria 8077
11 Ga0065165_1000799 3300005262 Bacteria 42051
12 Ga0065165_1002416 3300005262 Bacteria 15929
13 Ga0065165_1002642 3300005262 Bacteria 14515
14 Ga0065165_1006433 3300005262 Bacteria 6161
15 Ga0070658_10048283 3300005327 Bacteria 3446
16 Ga0070683_100005122 3300005329 Bacteria 10899
17 Ga0070680_100009353 3300005336 Bacteria 7529
18 Ga0070680_100162926 3300005336 Bacteria 1874
19 Ga0068868_100053615 3300005338 Bacteria 3177
20 Ga0070660_100018873 3300005339 Bacteria 5048
21 Ga0070668_100026976 3300005347 Bacteria 4360
22 Ga0070668_100082935 3300005347 Bacteria 2515
23 Ga0070668_100229075 3300005347 Bacteria 1535
24 Ga0070675_100167579 3300005354 Bacteria 1893
25 Ga0070671_100019025 3300005355 Bacteria 5586
26 Ga0070671_100154588 3300005355 Bacteria 1938
27 Ga0070674_100011327 3300005356 Bacteria 5427
28 Ga0070673_100042244 3300005364 Bacteria 3514
29 Ga0070688_100028924 3300005365 Bacteria 3313
30 Ga0070659_100065131 3300005366 Bacteria 2886
31 Ga0070667_100053462 3300005367 Bacteria 3408
32 Ga0070709_10001228 3300005434 Bacteria 14056
33 Ga0070709_10115955 3300005434 Bacteria 1807
34 Ga0070709_10160673 3300005434 Bacteria 1562
35 Ga0070714_100006930 3300005435 Bacteria 8786
36 Ga0070714_100012311 3300005435 Bacteria 6825
37 Ga0070714_100083680 3300005435 Bacteria 2783
38 Ga0070714_100264909 3300005435 Bacteria 1592
39 Ga0070713_100019837 3300005436 Bacteria 5145
40 Ga0070713_100099622 3300005436 Bacteria 2514
41 Ga0070713_100155497 3300005436 Bacteria 2038
42 Ga0070713_100252074 3300005436 Bacteria 1610
43 Ga0070713_100340281 3300005436 Bacteria 1390
44 Ga0070710_10000929 3300005437 Bacteria 13965
45 Ga0070711_100005942 3300005439 Bacteria 7326
46 Ga0070711_100013974 3300005439 Bacteria 5050
47 Ga0070711_100015536 3300005439 Bacteria 4819
48 Ga0070711_100039484 3300005439 Bacteria 3180
49 Ga0070711_100043582 3300005439 Bacteria 3040
50 Ga0070711_100072675 3300005439 Bacteria 2427
51 Ga0070663_100008307 3300005455 Bacteria 6379
52 Ga0070663_100010106 3300005455 Bacteria 5870
53 Ga0070663_100015280 3300005455 Bacteria 4951
54 Ga0070663_100035288 3300005455 Bacteria 3469
55 Ga0070663_100080401 3300005455 Bacteria 2393
56 Ga0070662_100010158 3300005457 Bacteria 6169
57 Ga0070681_10037204 3300005458 Bacteria 4885
58 Ga0070681_10076829 3300005458 Bacteria 3297
59 Ga0070681_10088746 3300005458 Bacteria 3043
60 Ga0070681_10094083 3300005458 Bacteria 2945
61 Ga0070707_100312288 3300005468 Bacteria 1528
62 Ga0070699_100171307 3300005518 Bacteria 1924
63 Ga0070679_100032475 3300005530 Bacteria 5164
64 Ga0070679_100058920 3300005530 Bacteria 3827
65 Ga0070679_100094456 3300005530 Bacteria 2977
66 Ga0070684_100015626 3300005535 Bacteria 6190
67 Ga0070684_100017917 3300005535 Bacteria 5821
68 Ga0070684_100033654 3300005535 Bacteria 4377
69 Ga0068853_100007930 3300005539 Bacteria 8513
70 Ga0068853_100022387 3300005539 Bacteria 5278
71 Ga0068853_100137259 3300005539 Bacteria 2193
72 Ga0068853_100210070 3300005539 Bacteria 1774
73 Ga0068853_100268660 3300005539 Bacteria 1570
74 Ga0070665_100016320 3300005548 Bacteria 7448
75 Ga0070665_100051187 3300005548 Bacteria 4142
76 Ga0068855_100012869 3300005563 Bacteria 10096
77 Ga0068855_100021640 3300005563 Bacteria 7714
78 Ga0068855_100059343 3300005563 Bacteria 4476
79 Ga0068857_100015877 3300005577 Bacteria 6590
80 Ga0068857_100050153 3300005577 Bacteria 3703
81 Ga0068856_100001803 3300005614 Bacteria 22366
82 Ga0068856_100001867 3300005614 Bacteria 21986
83 Ga0068856_100019754 3300005614 Bacteria 6537
84 Ga0068852_100014573 3300005616 Bacteria 6058
85 Ga0068852_100063882 3300005616 Bacteria 3207
86 Ga0068859_100053671 3300005617 Bacteria 4054
87 Ga0068851_10000250 3300005834 Bacteria 25377
88 Ga0068851_10042123 3300005834 Bacteria 2298
89 Ga0068863_100231921 3300005841 Bacteria 1781
90 Ga0068863_100294077 3300005841 Bacteria 1574
91 Ga0068858_100018788 3300005842 Bacteria 6466
92 Ga0068860_100005407 3300005843 Bacteria 12960
93 Ga0068860_100123813 3300005843 Bacteria 2478
94 Ga0068862_100057926 3300005844 Bacteria 3323
95 Ga0081455_10002800 3300005937 Bacteria 20533
96 Ga0081455_10008855 3300005937 Bacteria 10411
97 Ga0081455_10037499 3300005937 Bacteria 4304
98 Ga0081455_10056307 3300005937 Bacteria 3340
99 Ga0081455_10061238 3300005937 Bacteria 3168
100 Ga0081455_10108720 3300005937 Bacteria 2208
101 Ga0081540_1000178 3300005983 Bacteria 66386
102 Ga0081540_1001968 3300005983 Bacteria 17139
103 Ga0081540_1011207 3300005983 Bacteria 6010
104 Ga0081540_1012098 3300005983 Bacteria 5709
105 Ga0081540_1018972 3300005983 Bacteria 4200
106 Ga0081540_1019008 3300005983 Bacteria 4194
107 Ga0081540_1021450 3300005983 Bacteria 3845
108 Ga0081540_1021620 3300005983 Bacteria 3823
109 Ga0081540_1040971 3300005983 Bacteria 2407
110 Ga0081540_1043139 3300005983 Bacteria 2318
111 Ga0081539_10000220 3300005985 Bacteria 133834
112 Ga0070717_10005875 3300006028 Bacteria 8987
113 Ga0070717_10012278 3300006028 Bacteria 6529
114 Ga0070717_10058625 3300006028 Bacteria 3184
115 Ga0070717_10094177 3300006028 Bacteria 2533
116 Ga0075365_10018146 3300006038 Bacteria 4320
117 Ga0075368_10011128 3300006042 Bacteria 3269
118 Ga0075363_100018753 3300006048 Bacteria 3451
119 Ga0075363_100072104 3300006048 Bacteria 1878
120 Ga0070715_10003054 3300006163 Bacteria 5249
121 Ga0070716_100004705 3300006173 Bacteria 6546
122 Ga0070716_100012347 3300006173 Bacteria 4328
123 Ga0070712_100005481 3300006175 Bacteria 7854
124 Ga0070712_100006535 3300006175 Bacteria 7235
125 Ga0070712_100044651 3300006175 Bacteria 3056
126 Ga0070712_100054530 3300006175 Bacteria 2795
127 Ga0075370_10003000 3300006353 Bacteria 7950
128 Ga0075370_10042424 3300006353 Bacteria 2570
129 Ga0068871_100080431 3300006358 Bacteria 2698
130 Ga0097620_100053665 3300006931 Bacteria 4054
131 Ga0099825_1030562 3300006941 Bacteria 2374
132 Ga0099824_1004802 3300006942 Bacteria 19329
133 Ga0099824_1020023 3300006942 Bacteria 5032
134 Ga0099822_1001244 3300006943 Bacteria 29011
135 Ga0099823_1042587 3300006944 Bacteria 3170
136 Ga0099794_10005646 3300007265 Bacteria 5036
137 Ga0099794_10007699 3300007265 Bacteria 4440
138 Ga0099794_10101182 3300007265 Bacteria 1438
139 Ga0099795_10002778 3300007788 Bacteria 4209
140 Ga0105240_10016329 3300009093 Bacteria 10056
141 Ga0105240_10016971 3300009093 Bacteria 9835
142 Ga0105240_10075310 3300009093 Bacteria 4163
143 Ga0111539_10083826 3300009094 Bacteria 3748
144 Ga0111539_10135696 3300009094 Bacteria 2882
145 Ga0105245_10051090 3300009098 Bacteria 3706
146 Ga0105245_10171978 3300009098 Bacteria 2063
147 Ga0105245_10310676 3300009098 Bacteria 1550
148 Ga0105247_10033772 3300009101 Bacteria 3114
149 Ga0114129_10090903 3300009147 Bacteria 4230
150 Ga0105243_10142575 3300009148 Bacteria 2046
151 Ga0105241_10005015 3300009174 Bacteria 9775
152 Ga0105241_10039748 3300009174 Bacteria 3550
153 Ga0105241_10085631 3300009174 Bacteria 2477
154 Ga0105248_10077527 3300009177 Bacteria 3736
155 Ga0105248_10078907 3300009177 Bacteria 3700
156 Ga0105248_10244393 3300009177 Bacteria 2020
157 Ga0105248_10267166 3300009177 Bacteria 1926
158 Ga0105237_10037283 3300009545 Bacteria 4916
159 Ga0105237_10058475 3300009545 Bacteria 3858
160 Ga0105237_10064196 3300009545 Bacteria 3668
161 Ga0105237_10205408 3300009545 Bacteria 1970
162 Ga0105238_10002659 3300009551 Bacteria 17766
163 Ga0105238_10006063 3300009551 Bacteria 11992
164 Ga0105238_10009836 3300009551 Bacteria 9579
165 Ga0105238_10298165 3300009551 Bacteria 1595
166 Ga0105238_10407541 3300009551 Bacteria 1353
167 Ga0099796_10011117 3300010159 Bacteria 2500
168 Ga0099796_10013869 3300010159 Bacteria 2313
169 Ga0105239_10003585 3300010375 Bacteria 18979
170 Ga0105239_10003896 3300010375 Bacteria 18087
171 Ga0105239_10017767 3300010375 Bacteria 7867
172 Ga0105239_10021644 3300010375 Bacteria 7089
173 Ga0105239_10027720 3300010375 Bacteria 6233
174 Ga0105239_10059197 3300010375 Bacteria 4205
175 Ga0105239_10103968 3300010375 Bacteria 3144
176 Ga0105239_10431802 3300010375 Bacteria 1493
177 Ga0105246_10027867 3300011119 Bacteria 3707
178 Ga0157373_10052924 3300013100 Bacteria 2887
179 Ga0157370_10059165 3300013104 Bacteria 3642
180 Ga0157370_10202043 3300013104 Bacteria 1843
181 Ga0157369_10030087 3300013105 Bacteria 5992
182 Ga0157369_10047249 3300013105 Bacteria 4675
183 Ga0157374_10087900 3300013296 Bacteria 2959
184 Ga0157374_10199027 3300013296 Bacteria 1961
185 Ga0157378_10004346 3300013297 Bacteria 12466
186 Ga0157378_10078233 3300013297 Bacteria 2983
187 Ga0163162_10069584 3300013306 Bacteria 3571
188 Ga0157375_10054992 3300013308 Bacteria 3922
189 Ga0157375_10121305 3300013308 Bacteria 2724
190 Ga0157375_10214264 3300013308 Bacteria 2084
191 Ga0163163_10052220 3300014325 Bacteria 4032
192 Ga0163163_10160664 3300014325 Bacteria 2292
193 Ga0163163_10185491 3300014325 Bacteria 2128
194 Ga0157377_10015118 3300014745 Bacteria 3939
195 Ga0157379_10026231 3300014968 Bacteria 5186
196 Ga0157379_10287761 3300014968 Bacteria 1496
197 Ga0157376_10037246 3300014969 Bacteria 3946
198 Ga0163161_10039459 3300017792 Bacteria 3390
199 Ga0197907_10707499 3300020069 Bacteria 1816
200 Ga0214544_1000001 3300021320 Bacteria 783667
201 Ga0214542_1000037 3300021321 Bacteria 159256
202 Ga0214542_1000879 3300021321 Bacteria 58206
203 Ga0214545_1000003 3300021324 Bacteria 720274
204 Ga0214543_1000002 3300021327 Bacteria 712733
205 Ga0213874_10003673 3300021377 Bacteria 3433
206 Ga0213876_10005607 3300021384 Bacteria 6890
207 Ga0213875_10000382 3300021388 Bacteria 39987
208 Ga0213875_10000390 3300021388 Bacteria 39140
209 Ga0213875_10003220 3300021388 Bacteria 9371
210 Ga0213871_10003817 3300021441 Bacteria 2951
211 Ga0209148_1000462 3300025254 Bacteria 43711
212 Ga0209233_1002214 3300025261 Bacteria 7295
213 Ga0209455_1009328 3300025272 Bacteria 2588
214 Ga0209455_1014740 3300025272 Bacteria 1754
215 Ga0209564_1005201 3300025295 Bacteria 7533
216 Ga0209758_1000011 3300025297 Bacteria 1049685
217 Ga0209758_1000845 3300025297 Bacteria 42737
218 Ga0209758_1003253 3300025297 Bacteria 15067
219 Ga0209758_1008620 3300025297 Bacteria 6550
220 Ga0209758_1032205 3300025297 Bacteria 2133
221 Ga0209256_1008471 3300025299 Bacteria 4761
222 Ga0209256_1012600 3300025299 Bacteria 3213
223 Ga0207426_1000228 3300025302 Bacteria 129261
224 Ga0207426_1000270 3300025302 Bacteria 108404
225 Ga0207426_1000292 3300025302 Bacteria 99342
226 Ga0207426_1010723 3300025302 Bacteria 3540
227 Ga0209257_1001242 3300025304 Bacteria 31529
228 Ga0209257_1018129 3300025304 Bacteria 2730
229 Ga0207656_10029312 3300025321 Bacteria 2266
230 Ga0207653_10032516 3300025885 Bacteria 1688
231 Ga0207692_10001555 3300025898 Bacteria 8634
232 Ga0207692_10029149 3300025898 Bacteria 2620
233 Ga0207688_10031893 3300025901 Bacteria 2910
234 Ga0207647_10000496 3300025904 Bacteria 31496
235 Ga0207647_10017643 3300025904 Bacteria 4850
236 Ga0207699_10000605 3300025906 Bacteria 17554
237 Ga0207699_10002358 3300025906 Bacteria 8919
238 Ga0207699_10008980 3300025906 Bacteria 4955
239 Ga0207699_10063547 3300025906 Bacteria 2230
240 Ga0207705_10097865 3300025909 Bacteria 2155
241 Ga0207705_10158797 3300025909 Bacteria 1698
242 Ga0207654_10000634 3300025911 Bacteria 19851
243 Ga0207707_10002844 3300025912 Bacteria 15450
244 Ga0207707_10007520 3300025912 Bacteria 9493
245 Ga0207707_10008335 3300025912 Bacteria 8992
246 Ga0207707_10133882 3300025912 Bacteria 2167
247 Ga0207707_10161806 3300025912 Bacteria 1957
248 Ga0207695_10000006 3300025913 Bacteria 1135309
249 Ga0207695_10000008 3300025913 Bacteria 1058268
250 Ga0207695_10002936 3300025913 Bacteria 24601
251 Ga0207695_10011660 3300025913 Bacteria 10622
252 Ga0207695_10046333 3300025913 Bacteria 4609
253 Ga0207695_10068273 3300025913 Bacteria 3642
254 Ga0207695_10089987 3300025913 Bacteria 3085
255 Ga0207671_10060370 3300025914 Bacteria 2813
256 Ga0207671_10088927 3300025914 Bacteria 2324
257 Ga0207693_10000085 3300025915 Bacteria 83879
258 Ga0207693_10005576 3300025915 Bacteria 10474
259 Ga0207693_10009623 3300025915 Bacteria 7870
260 Ga0207693_10020299 3300025915 Bacteria 5286
261 Ga0207693_10059873 3300025915 Bacteria 2983
262 Ga0207693_10060930 3300025915 Bacteria 2956
263 Ga0207693_10070878 3300025915 Bacteria 2727
264 Ga0207693_10264604 3300025915 Bacteria 1348
265 Ga0207663_10000739 3300025916 Bacteria 14580
266 Ga0207663_10003946 3300025916 Bacteria 7338
267 Ga0207663_10009965 3300025916 Bacteria 5032
268 Ga0207660_10023909 3300025917 Bacteria 4131
269 Ga0207660_10068885 3300025917 Bacteria 2568
270 Ga0207662_10106494 3300025918 Bacteria 1744
271 Ga0207657_10003303 3300025919 Bacteria 17242
272 Ga0207657_10016929 3300025919 Bacteria 7015
273 Ga0207649_10027939 3300025920 Bacteria 3317
274 Ga0207652_10026123 3300025921 Bacteria 4860
275 Ga0207652_10045400 3300025921 Bacteria 3746
276 Ga0207652_10115771 3300025921 Bacteria 2381
277 Ga0207646_10258566 3300025922 Bacteria 1574
278 Ga0207694_10000119 3300025924 Bacteria 83771
279 Ga0207694_10003295 3300025924 Bacteria 12847
280 Ga0207694_10005677 3300025924 Bacteria 9572
281 Ga0207694_10180364 3300025924 Bacteria 1712
282 Ga0207694_10241511 3300025924 Bacteria 1476
283 Ga0207687_10018479 3300025927 Bacteria 4603
284 Ga0207687_10062646 3300025927 Bacteria 2631
285 Ga0207687_10076825 3300025927 Bacteria 2400
286 Ga0207700_10003531 3300025928 Bacteria 9108
287 Ga0207700_10011210 3300025928 Bacteria 5706
288 Ga0207700_10011837 3300025928 Bacteria 5587
289 Ga0207700_10045438 3300025928 Bacteria 3241
290 Ga0207700_10069649 3300025928 Bacteria 2701
291 Ga0207664_10005139 3300025929 Bacteria 8917
292 Ga0207664_10159233 3300025929 Bacteria 1924
293 Ga0207644_10155132 3300025931 Bacteria 1775
294 Ga0207690_10164031 3300025932 Bacteria 1659
295 Ga0207706_10041553 3300025933 Bacteria 4076
296 Ga0207665_10000066 3300025939 Bacteria 68434
297 Ga0207665_10004190 3300025939 Bacteria 9594
298 Ga0207665_10042629 3300025939 Bacteria 3034
299 Ga0207665_10209318 3300025939 Bacteria 1424
300 Ga0207691_10059114 3300025940 Bacteria 3486
301 Ga0207689_10013332 3300025942 Bacteria 7013
302 Ga0207661_10000917 3300025944 Bacteria 19380
303 Ga0207661_10023556 3300025944 Bacteria 4653
304 Ga0207661_10046472 3300025944 Bacteria 3443
305 Ga0207667_10003981 3300025949 Bacteria 18159
306 Ga0207667_10021239 3300025949 Bacteria 7197
307 Ga0207667_10033464 3300025949 Bacteria 5525
308 Ga0207667_10201110 3300025949 Bacteria 2044
309 Ga0207651_10207135 3300025960 Bacteria 1576
310 Ga0207677_10098362 3300026023 Bacteria 2146
311 Ga0207703_10026127 3300026035 Bacteria 4594
312 Ga0207703_10128295 3300026035 Bacteria 2187
313 Ga0207703_10205158 3300026035 Bacteria 1754
314 Ga0207639_10004828 3300026041 Bacteria 9091
315 Ga0207639_10005470 3300026041 Bacteria 8583
316 Ga0207639_10058471 3300026041 Bacteria 2965
317 Ga0207639_10158117 3300026041 Bacteria 1906
318 Ga0207678_10010709 3300026067 Bacteria 8055
319 Ga0207678_10020027 3300026067 Bacteria 5877
320 Ga0207678_10026116 3300026067 Bacteria 5096
321 Ga0207678_10047784 3300026067 Bacteria 3700
322 Ga0207678_10055282 3300026067 Bacteria 3419
323 Ga0207702_10000002 3300026078 Bacteria 491507
324 Ga0207702_10001708 3300026078 Bacteria 21655
325 Ga0207702_10008470 3300026078 Bacteria 8673
326 Ga0207702_10111571 3300026078 Bacteria 2432
327 Ga0207702_10301380 3300026078 Bacteria 1521
328 Ga0207641_10296379 3300026088 Bacteria 1526
329 Ga0207648_10010213 3300026089 Bacteria 8930
330 Ga0207674_10006543 3300026116 Bacteria 13703
331 Ga0207674_10009969 3300026116 Bacteria 10811
332 Ga0207674_10023678 3300026116 Bacteria 6573
333 Ga0207675_100069671 3300026118 Bacteria 3287
334 Ga0207675_100377031 3300026118 Bacteria 1394
335 Ga0207683_10117952 3300026121 Bacteria 2380
336 Ga0207698_10029719 3300026142 Bacteria 3918
337 Ga0207698_10124851 3300026142 Bacteria 2187
338 Ga0209389_1000001 3300027296 Bacteria 463799
339 Ga0209389_1000014 3300027296 Bacteria 188621
340 Ga0209589_1000011 3300027357 Bacteria 236981
341 Ga0209589_1000020 3300027357 Bacteria 188617
342 Ga0209489_100012 3300027361 Bacteria 236981
343 Ga0209489_100060 3300027361 Bacteria 147091
344 Ga0209489_101114 3300027361 Bacteria 54578
345 Ga0209700_100007 3300027363 Bacteria 454608
346 Ga0209700_100019 3300027363 Bacteria 236981
347 Ga0209179_1002935 3300027512 Bacteria 2382
348 Ga0209588_1005193 3300027671 Bacteria 3717
349 Ga0209813_10006595 3300027866 Bacteria 2873
350 Ga0268266_10014609 3300028379 Bacteria 6747
351 Ga0268266_10055520 3300028379 Bacteria 3405
352 Ga0268266_10163085 3300028379 Bacteria 2018
353 Ga0268266_10200158 3300028379 Bacteria 1828
354 Ga0268265_10017139 3300028380 Bacteria 4991
355 Ga0268264_10000030 3300028381 Bacteria 418542
356 Ga0265337_1007120 3300028556 Bacteria 4223
357 Ga0265319_1017390 3300028563 Bacteria 2734
358 Ga0265334_10007339 3300028573 Bacteria 4730
359 Ga0265323_10001453 3300028653 Bacteria 11630
360 Ga0265336_10000251 3300028666 Bacteria 38092
361 Ga0307517_10000386 3300028786 Bacteria 75442
362 Ga0307515_10017392 3300028794 Bacteria 13100
363 Ga0265338_10000582 3300028800 Bacteria 64301
364 Ga0265324_10011228 3300029957 Bacteria 3419
365 Ga0265330_10007549 3300031235 Bacteria 5291
366 Ga0265330_10009772 3300031235 Bacteria 4545
367 Ga0265332_10047350 3300031238 Bacteria 1850
368 Ga0265325_10015246 3300031241 Bacteria 4325
369 Ga0265339_10012020 3300031249 Bacteria 5306
370 Ga0265339_10016403 3300031249 Bacteria 4416
371 Ga0265339_10065301 3300031249 Bacteria 1951
372 Ga0265331_10046688 3300031250 Bacteria 2087
373 Ga0307513_10216665 3300031456 Bacteria 1740
374 Ga0307509_10029551 3300031507 Bacteria 6080
375 Ga0307509_10099121 3300031507 Bacteria 2956
376 Ga0307508_10023817 3300031616 Bacteria 5559
377 Ga0307508_10078529 3300031616 Bacteria 2881
378 Ga0307508_10099956 3300031616 Bacteria 2495
379 Ga0307508_10100608 3300031616 Bacteria 2485
380 Ga0265314_10010113 3300031711 Bacteria 7906
381 Ga0265314_10017398 3300031711 Bacteria 5645
382 Ga0265342_10002383 3300031712 Bacteria 16284
383 Ga0307516_10010095 3300031730 Bacteria 10442
384 Ga0307516_10038399 3300031730 Bacteria 4779
385 Ga0307516_10180578 3300031730 Bacteria 1844
386 Ga0307516_10183224 3300031730 Bacteria 1826
387 Ga0307415_100150974 3300032126 Bacteria 1788
388 Ga0307510_10017574 3300033180 Bacteria 8432
389 Ga0307510_10055165 3300033180 Bacteria 4153
390 Ga0307510_10151640 3300033180 Bacteria 1935
391 Ga0315911_1000002 3300033442 Bacteria 926833
392 Ga0373926_0034888 3300035083 Bacteria 1783
393 Ga0373934_0007901 3300035086 Bacteria 3958
394 Ga0373936_0014396 3300035113 Bacteria 3023
395 Ga0373953_0000506 3300035117 Bacteria 10848
396 Ga0373954_0000386 3300035118 Bacteria 16413
397 Ga0373954_0014978 3300035118 Bacteria 3462
398 Ga0373956_0005816 3300035119 Bacteria 4931
399 Ga0373956_0013430 3300035119 Bacteria 3406
400 Ga0373943_0002708 3300035170 Bacteria 8046
401 Ga0373943_0040646 3300035170 Bacteria 2246
402 Ga0373946_0005868 3300035171 Bacteria 4447
403 Ga0373946_0020617 3300035171 Bacteria 2549
404 Ga0373955_0000286 3300035172 Bacteria 20971
405 Ga0373955_0059552 3300035172 Bacteria 2103
406 Ga0373931_0005603 3300035691 Bacteria 5822
407 Ga0373935_0001308 3300035692 Bacteria 13756
408 Ga0373927_0018861 3300035695 Bacteria 4526
409 Ga0373927_0053411 3300035695 Bacteria 2614
410 Ga0373927_0094628 3300035695 Bacteria 1941
411 Ga0373933_0000525 3300035724 Bacteria 23898
412 Ga0373933_0000952 3300035724 Bacteria 17650
413 Ga0373947_0012265 3300035725 Bacteria 4910
414 Ga0373947_0042908 3300035725 Bacteria 2700
415 Ga0373947_0196609 3300035725 Bacteria 1318
416 Ga0373937_0001493 3300036401 Bacteria 19622
417 Ga0373925_0007302 3300037068 Bacteria 8072
418 Ga0395899_0058078 3300037312 Bacteria 2854
419 Ga0395900_0001070 3300037418 Bacteria 34841
420 Ga0395898_0005530 3300037466 Bacteria 13635
421 Ga0395898_0017205 3300037466 Bacteria 7384
422 Ga0395898_0038983 3300037466 Bacteria 4705
423 Ga0395898_0096005 3300037466 Bacteria 2848
424 Ga0395898_0147538 3300037466 Bacteria 2251
425 Ga0395905_0007330 3300037471 Bacteria 10988
426 Ga0395905_0102640 3300037471 Bacteria 2685
427 Ga0436364_0042928 3300037853 Bacteria 71182
428 Ga0436364_0108855 3300037853 Bacteria 36564
429 Ga0436364_0346617 3300037853 Bacteria 24321
430 Ga0436364_0817898 3300037853 Bacteria 3234
431 Ga0436364_1343008 3300037853 Bacteria 2668
432 Ga0395901_0014261 3300038443 Bacteria 8091
433 Ga0395901_0015950 3300038443 Bacteria 7653
434 Ga0395901_0124736 3300038443 Bacteria 2706
435 Ga0395901_0129939 3300038443 Bacteria 2647
436 Ga0395901_0185322 3300038443 Bacteria 2183
437 Ga0436365_0064270 3300039437 Bacteria 1714
438 Ga0436365_0161372 3300039437 Bacteria 1921
439 Ga0436365_0234716 3300039437 Bacteria 3747
440 Ga0436365_0369560 3300039437 Bacteria 2372
441 Ga0436365_0383201 3300039437 Bacteria 1661
442 Ga0436365_0677006 3300039437 Bacteria 6765
443 Ga0436365_1301574 3300039437 Bacteria 3498
444 Ga0436365_1424648 3300039437 Bacteria 18159
445 Ga0436360_0078764 3300039438 Bacteria 6661
446 Ga0436360_0466793 3300039438 Bacteria 2383
447 Ga0436361_1169803 3300039447 Bacteria 4792
448 Ga0436363_0383878 3300039450 Bacteria 1576
449 Ga0436363_0693677 3300039450 Bacteria 3554
450 Ga0436362_0187516 3300039453 Bacteria 1755
451 Ga0436362_0618850 3300039453 Bacteria 7570
452 Ga0451841_0603492 3300041498 Bacteria 1342
453 Ga0439459_0021517 3300042438 Bacteria 1240
454 Ga0466972_0000113 3300044658 Bacteria 69042
455 Ga0466966_0000094 3300044684 Bacteria 54427
456 Ga0466961_0000118 3300044693 Bacteria 52882
457 Ga0466961_0134432 3300044693 Bacteria 1550
458 Ga0466970_0058039 3300044765 Bacteria 2071
459 Ga0495592_0001573 3300046454 Bacteria 15952
460 Ga0495592_0021108 3300046454 Bacteria 4952
461 Ga0495592_0041596 3300046454 Bacteria 3444
462 Ga0495592_0059415 3300046454 Bacteria 2816
463 Ga0495592_0118930 3300046454 Bacteria 1861
464 Ga0495592_0184676 3300046454 Bacteria 1418
465 Ga0495603_0030969 3300046455 Bacteria 3221
466 Ga0495603_0082601 3300046455 Bacteria 1882
467 Ga0495590_0034179 3300046457 Bacteria 1776
468 Ga0495629_0000133 3300046459 Bacteria 64806
469 Ga0495629_0010755 3300046459 Bacteria 6656
470 Ga0495629_0018014 3300046459 Bacteria 5061
471 Ga0495629_0048075 3300046459 Bacteria 2991
472 Ga0495638_0007773 3300046460 Bacteria 7657
473 Ga0495638_0092624 3300046460 Bacteria 1819
474 Ga0495641_0003044 3300046461 Bacteria 12816
475 Ga0495651_0009251 3300046462 Bacteria 7559
476 Ga0495653_0001313 3300046463 Bacteria 19271
477 Ga0495653_0081656 3300046463 Bacteria 2388
478 Ga0495580_0006086 3300046472 Bacteria 9874
479 Ga0495580_0172160 3300046472 Bacteria 1497
480 Ga0495582_0000016 3300046473 Bacteria 100714
481 Ga0495582_0013313 3300046473 Bacteria 4529
482 Ga0495605_0031333 3300046474 Bacteria 2717
483 Ga0495639_0000014 3300046475 Bacteria 82866
484 Ga0495639_0031073 3300046475 Bacteria 2376
485 Ga0495662_0000086 3300046476 Bacteria 33465
486 Ga0495664_0004447 3300046477 Bacteria 7671
487 Ga0495664_0007306 3300046477 Bacteria 6130
488 Ga0495664_0145578 3300046477 Bacteria 1437
489 Ga0495594_0000051 3300046499 Bacteria 52030
490 Ga0495594_0112428 3300046499 Bacteria 1536
491 Ga0495607_0103073 3300046501 Bacteria 1525
492 Ga0495606_0016667 3300046507 Bacteria 5590
493 Ga0495608_0003757 3300046511 Bacteria 10900
494 Ga0495616_0026879 3300046513 Bacteria 3057
495 Ga0495616_0049990 3300046513 Bacteria 2093
496 Ga0495616_0090587 3300046513 Bacteria 1448
497 Ga0495618_0114154 3300046514 Bacteria 1729
498 Ga0495628_0004462 3300046516 Bacteria 12408
499 Ga0495628_0007774 3300046516 Bacteria 9242
500 Ga0495628_0010553 3300046516 Bacteria 7841
501 Ga0495628_0184958 3300046516 Bacteria 1575
502 Ga0495643_0019976 3300046522 Bacteria 3869
503 Ga0495648_0001270 3300046524 Bacteria 25160
504 Ga0495648_0022088 3300046524 Bacteria 4391
505 Ga0495666_0020761 3300046526 Bacteria 3252
506 Ga0495652_0008371 3300046529 Bacteria 9446
507 Ga0495652_0036434 3300046529 Bacteria 4278
508 Ga0495652_0056592 3300046529 Bacteria 3329
509 Ga0495652_0121007 3300046529 Bacteria 2088
510 Ga0495665_0000477 3300046531 Bacteria 20160
511 Ga0495640_0001817 3300046533 Bacteria 16924
512 Ga0495640_0007412 3300046533 Bacteria 8626
513 Ga0495640_0011794 3300046533 Bacteria 6706
514 Ga0495640_0015035 3300046533 Bacteria 5832
515 Ga0495587_0000862 3300046536 Bacteria 20057
516 Ga0495587_0008087 3300046536 Bacteria 6782
517 Ga0495609_0026863 3300046538 Bacteria 2634
518 Ga0495609_0077158 3300046538 Bacteria 1459
519 Ga0495597_0025529 3300046542 Bacteria 2720
520 Ga0495645_0024663 3300046543 Bacteria 4364
521 Ga0495645_0099885 3300046543 Bacteria 2064
522 Ga0495622_0006671 3300046557 Bacteria 5354
523 Ga0495622_0012877 3300046557 Bacteria 3878
524 Ga0495667_0000424 3300046559 Bacteria 27001
525 Ga0495667_0015829 3300046559 Bacteria 5098
526 Ga0495667_0058901 3300046559 Bacteria 2521
527 Ga0495656_0002167 3300046615 Bacteria 6489
528 Ga0495668_0019915 3300046616 Bacteria 3860
529 Ga0495668_0080465 3300046616 Bacteria 1788
530 Ga0495634_0003306 3300046642 Bacteria 12988
531 Ga0495634_0006805 3300046642 Bacteria 8651
532 Ga0495625_0061107 3300046660 Bacteria 2667
533 Ga0495625_0070923 3300046660 Bacteria 2446
534 Ga0495635_0000792 3300046663 Bacteria 20615
535 Ga0495635_0002703 3300046663 Bacteria 12140
536 Ga0495635_0005278 3300046663 Bacteria 8985
537 Ga0495635_0026165 3300046663 Bacteria 4063
538 Ga0495659_0011741 3300046664 Bacteria 2825
539 Ga0495657_0001449 3300046675 Bacteria 20519
540 Ga0495657_0013673 3300046675 Bacteria 5978
541 Ga0495657_0022741 3300046675 Bacteria 4486
542 Ga0495599_0000879 3300046678 Bacteria 16765
543 Ga0495599_0013798 3300046678 Bacteria 4999
544 Ga0495599_0048778 3300046678 Bacteria 2655
545 Ga0495623_0002249 3300046679 Bacteria 12858
546 Ga0495646_0002245 3300046680 Bacteria 11802
547 Ga0495646_0032854 3300046680 Bacteria 3227
548 Ga0495646_0105597 3300046680 Bacteria 1609
549 Ga0495658_0001354 3300046683 Bacteria 12855
550 Ga0495658_0044624 3300046683 Bacteria 2485
551 Ga0495658_0048318 3300046683 Bacteria 2399
552 Ga0495613_0006655 3300046689 Bacteria 8632
553 Ga0495613_0024354 3300046689 Bacteria 4510
554 Ga0495624_0000138 3300046690 Bacteria 52220
555 Ga0495624_0010671 3300046690 Bacteria 6327
556 Ga0495671_0053471 3300046692 Bacteria 2004
557 Ga0495649_0042779 3300046694 Bacteria 2474
558 Ga0495600_0000337 3300046809 Bacteria 25017
559 Ga0495600_0005193 3300046809 Bacteria 7827
560 Ga0495600_0151690 3300046809 Bacteria 1500
561 Ga0495581_0000001 3300047315 Bacteria 104278
562 Ga0495581_0023521 3300047315 Bacteria 3570
563 Ga0495581_0081996 3300047315 Bacteria 1868
564 Ga0495604_0001626 3300047317 Bacteria 18533
565 Ga0495604_0017599 3300047317 Bacteria 5722
566 Ga0495604_0169005 3300047317 Bacteria 1539
567 Ga0495674_0002545 3300047319 Bacteria 17760
568 Ga0495674_0018873 3300047319 Bacteria 6414
569 Ga0495674_0145940 3300047319 Bacteria 1986
570 Ga0495674_0311730 3300047319 Bacteria 1284
571 Ga0495672_0007184 3300047320 Bacteria 8418
572 Ga0495672_0031356 3300047320 Bacteria 3319
573 Ga0495676_0003317 3300047321 Bacteria 14549
574 Ga0495676_0143571 3300047321 Bacteria 1708
575 Ga0495680_0002491 3300047322 Bacteria 18828
576 Ga0495680_0005089 3300047322 Bacteria 12405
577 Ga0495680_0156052 3300047322 Bacteria 1660
578 Ga0495687_014891 3300047443 Bacteria 3975
579 Ga0495675_0012328 3300047444 Bacteria 5380
580 Ga0495675_0024995 3300047444 Bacteria 3809
581 Ga0495675_0035435 3300047444 Bacteria 3187
582 Ga0495673_0069111 3300047469 Bacteria 1491
583 Ga0495673_0090619 3300047469 Unclassified 1250
584 Ga0495684_0001407 3300047471 Bacteria 19272
585 Ga0495684_0005971 3300047471 Bacteria 9460
586 Ga0495593_0000003 3300047673 Bacteria 120744
587 Ga0495593_0002446 3300047673 Bacteria 11170
588 Ga0495602_0007241 3300048088 Bacteria 11617
589 Ga0495602_0019961 3300048088 Bacteria 6634
590 Ga0495602_0039312 3300048088 Bacteria 4359
591 Ga0495602_0115379 3300048088 Bacteria 2173
592 Ga0495614_0006055 3300048089 Bacteria 5438
593 Ga0496100_0007585 3300048903 Bacteria 5998
594 Ga0496100_0042150 3300048903 Bacteria 2914
595 Ga0496100_0119453 3300048903 Bacteria 1842
596 Ga0496101_0127876 3300048904 Bacteria 1927
597 Ga0496102_0014231 3300048905 Bacteria 6913
598 Ga0496102_0018355 3300048905 Bacteria 6145
599 Ga0496102_0083203 3300048905 Bacteria 2953
600 Ga0496103_0022816 3300048906 Bacteria 3770
601 Ga0496104_0022932 3300048907 Bacteria 5736
602 Ga0496104_0024758 3300048907 Bacteria 5526
603 Ga0496104_0036043 3300048907 Bacteria 4621
604 Ga0496104_0073880 3300048907 Bacteria 3244
605 Ga0496104_0130155 3300048907 Bacteria 2417
606 Ga0496104_0203556 3300048907 Bacteria 1891
607 Ga0496105_0002092 3300048908 Bacteria 14435
608 Ga0496105_0011739 3300048908 Bacteria 6932
609 Ga0496105_0041425 3300048908 Bacteria 3796
610 Ga0496105_0044963 3300048908 Bacteria 3643
611 Ga0496105_0050731 3300048908 Bacteria 3428
612 Ga0496105_0267569 3300048908 Bacteria 1381
613 Ga0496106_0001202 3300048909 Bacteria 19326
614 Ga0496106_0011446 3300048909 Bacteria 6562
615 Ga0496106_0015453 3300048909 Bacteria 5650
616 Ga0496106_0018182 3300048909 Bacteria 5199
617 Ga0496106_0068108 3300048909 Bacteria 2715
618 Ga0496106_0265684 3300048909 Bacteria 1373
619 Ga0496107_0002624 3300048910 Bacteria 11754
620 Ga0496107_0009825 3300048910 Bacteria 6636
621 Ga0496107_0011885 3300048910 Bacteria 6082
622 Ga0496108_0001960 3300048911 Bacteria 16479
623 Ga0496108_0018478 3300048911 Bacteria 5708
624 Ga0496108_0050815 3300048911 Bacteria 3472
625 Ga0496108_0180764 3300048911 Bacteria 1826
626 Ga0496109_0000432 3300048912 Bacteria 36461
627 Ga0496109_0010188 3300048912 Bacteria 8024
628 Ga0496109_0055955 3300048912 Bacteria 3599
629 Ga0496109_0234299 3300048912 Bacteria 1728
630 Ga0496110_0012555 3300048913 Bacteria 6968
631 Ga0496110_0027219 3300048913 Bacteria 4900
632 Ga0496110_0029803 3300048913 Bacteria 4701
633 Ga0496110_0187050 3300048913 Bacteria 1881
634 Ga0496110_0211027 3300048913 Bacteria 1765
635 Ga0496111_0013188 3300048914 Bacteria 5620
636 Ga0496111_0039393 3300048914 Bacteria 3388
637 Ga0496111_0091744 3300048914 Bacteria 2226
638 Ga0496112_0015915 3300048915 Bacteria 7029
639 Ga0496112_0033682 3300048915 Bacteria 4980
640 Ga0496112_0061568 3300048915 Bacteria 3700
641 Ga0496112_0100707 3300048915 Bacteria 2859
642 Ga0496112_0112903 3300048915 Bacteria 2688
643 Ga0496112_0194315 3300048915 Bacteria 1990
644 Ga0496112_0206592 3300048915 Bacteria 1922
645 Ga0496113_0014649 3300048916 Bacteria 5359
646 Ga0496113_0032600 3300048916 Bacteria 3786
647 Ga0496114_0008432 3300048917 Bacteria 8162
648 Ga0496115_0009310 3300048918 Bacteria 7298
649 Ga0496115_0033310 3300048918 Bacteria 4067
650 Ga0496115_0063699 3300048918 Bacteria 2975
651 Ga0496115_0078069 3300048918 Bacteria 2693
652 Ga0496115_0133099 3300048918 Bacteria 2050
653 Ga0496118_0019947 3300048921 Bacteria 5966
654 Ga0496118_0029396 3300048921 Bacteria 4609
655 Ga0496118_0036940 3300048921 Bacteria 3940
656 Ga0496118_0134801 3300048921 Bacteria 1578
657 Ga0496119_0013953 3300048922 Bacteria 6336
658 Ga0496120_0007436 3300048923 Bacteria 8144
659 Ga0496121_0000041 3300048924 Bacteria 346686
660 Ga0496121_0003563 3300048924 Bacteria 22031
661 Ga0496121_0005352 3300048924 Bacteria 16504
662 Ga0496121_0009890 3300048924 Bacteria 10868
663 Ga0496121_0028205 3300048924 Bacteria 5231
664 Ga0496121_0039020 3300048924 Bacteria 4193
665 Ga0496121_0071909 3300048924 Bacteria 2780
666 Ga0496121_0100982 3300048924 Bacteria 2226
667 Ga0496121_0111107 3300048924 Bacteria 2091
668 Ga0496122_0030990 3300048925 Bacteria 4464
669 Ga0496124_0000624 3300048927 Bacteria 58976
670 Ga0496124_0040676 3300048927 Bacteria 4019
671 Ga0496125_0036744 3300048928 Bacteria 4270
672 Ga0496125_0040200 3300048928 Bacteria 4014
673 Ga0496125_0053440 3300048928 Bacteria 3311
674 Ga0496125_0075947 3300048928 Bacteria 2597
675 Ga0496125_0092232 3300048928 Bacteria 2265
676 Ga0496126_0002321 3300048929 Bacteria 26096
677 Ga0496126_0008801 3300048929 Bacteria 10829
678 Ga0496126_0010022 3300048929 Bacteria 10000
679 Ga0496126_0015516 3300048929 Bacteria 7659
680 Ga0496126_0018293 3300048929 Bacteria 6951
681 Ga0496126_0029558 3300048929 Bacteria 5204
682 Ga0496126_0030071 3300048929 Bacteria 5153
683 Ga0496126_0032840 3300048929 Bacteria 4885
684 Ga0496126_0051884 3300048929 Bacteria 3732
685 Ga0496126_0198822 3300048929 Bacteria 1694
686 Ga0496126_0206653 3300048929 Bacteria 1655
687 Ga0496126_0255689 3300048929 Bacteria 1458
688 Ga0496126_0351501 3300048929 Bacteria 1205
689 Ga0501032_0005102 3300049569 Bacteria 9799
690 Ga0501032_0076754 3300049569 Bacteria 2224
691 Ga0501033_0001834 3300049570 Bacteria 18512
692 Ga0501033_0051989 3300049570 Bacteria 3036
693 Ga0501034_0001471 3300049571 Bacteria 31174
694 Ga0501034_0134384 3300049571 Bacteria 2455
695 Ga0501034_0444984 3300049571 Bacteria 1214
696 Ga0501036_0050117 3300049572 Bacteria 3536
697 Ga0501036_0053755 3300049572 Bacteria 3410
698 Ga0501037_0005747 3300049573 Bacteria 9056
699 Ga0501037_0086729 3300049573 Bacteria 2265
700 Ga0501038_0002435 3300049574 Bacteria 17326
701 Ga0501038_0014916 3300049574 Bacteria 7074
702 Ga0501038_0042310 3300049574 Bacteria 3967
703 Ga0501039_0010117 3300049575 Bacteria 7185
704 Ga0501040_0054616 3300049576 Bacteria 2738
705 Ga0501042_0045227 3300049578 Bacteria 3137
706 Ga0501043_0019449 3300049579 Bacteria 5330
707 Ga0501043_0020212 3300049579 Bacteria 5228
708 Ga0501043_0061463 3300049579 Bacteria 2950
709 Ga0501046_0007012 3300049580 Bacteria 9927
710 Ga0501046_0073620 3300049580 Bacteria 2651
711 Ga0501046_0075087 3300049580 Bacteria 2621
712 Ga0501047_0014876 3300049581 Bacteria 7407
713 Ga0501047_0082968 3300049581 Bacteria 3081
714 Ga0501047_0140691 3300049581 Bacteria 2292
715 Ga0501048_0006412 3300049582 Bacteria 8942
716 Ga0501068_0024706 3300049584 Bacteria 3529
717 Ga0501074_0149427 3300049590 Bacteria 1670
718 Ga0501076_0100259 3300049592 Bacteria 2333
719 Ga0501079_0236102 3300049741 Bacteria 1428
720 Ga0501080_0088666 3300049742 Bacteria 2874
721 Ga0501080_0108978 3300049742 Bacteria 2566
722 Ga0501080_0130979 3300049742 Bacteria 2322
723 Ga0501035_0002268 3300049822 Bacteria 18995
724 Ga0501035_0026433 3300049822 Bacteria 5310
725 Ga0501035_0055661 3300049822 Bacteria 3531
726 Ga0501044_0007852 3300049823 Bacteria 11732
727 Ga0501044_0020966 3300049823 Bacteria 6978
728 Ga0501044_0060417 3300049823 Bacteria 3881
729 Ga0501045_0032361 3300049824 Bacteria 3789
730 nmdc:mga0yw44_23996_c1 3300050492 Bacteria 3444
731 nmdc:mga0yw44_31714_c1 3300050492 Bacteria 3075
732 nmdc:mga0yw44_5423_c1 3300050492 Bacteria 6024
733 nmdc:mga06z11_27907_c1 3300050494 Bacteria 2703
734 nmdc:mga0rr50_147154_c1 3300050513 Bacteria 1900
735 nmdc:mga0a205_317757_c1 3300050515 Bacteria 1428
736 nmdc:mga0sz30_14368_c1 3300050516 Bacteria 1556
737 nmdc:mga0sz30_64384_c1 3300050516 Bacteria 1570
738 Ga0495601_0054028 3300053077 Bacteria 2540
739 Ga0495601_0112208 3300053077 Bacteria 1766
740 Ga0500635_0015520 3300053080 Bacteria 2251
741 Ga0495595_0001668 3300053084 Bacteria 8691
742 Ga0495595_0003281 3300053084 Bacteria 6426
743 Ga0495595_0011648 3300053084 Bacteria 3680
744 Ga0495619_0025449 3300053085 Bacteria 3801
745 Ga0495619_0076189 3300053085 Bacteria 2251
746 Ga0495619_0159548 3300053085 Bacteria 1557
747 Ga0500643_001180 3300053087 Bacteria 15589
748 Ga0500647_0036075 3300053091 Bacteria 2363
749 Ga0500647_0095598 3300053091 Bacteria 1421
750 Ga0500583_0079752 3300053092 Bacteria 1579
751 Ga0500566_0000062 3300053094 Bacteria 51144
752 Ga0500566_0000112 3300053094 Bacteria 41687
753 Ga0500566_0002624 3300053094 Bacteria 10704
754 Ga0500640_000394 3300053095 Bacteria 10451
755 Ga0500554_001136 3300053102 Bacteria 5151
756 Ga0500556_0000750 3300053104 Bacteria 19347
757 Ga0500557_000003 3300053105 Bacteria 228429
758 Ga0500562_023587 3300053108 Bacteria 1606
759 Ga0500572_000239 3300053111 Bacteria 19483
760 Ga0500572_000775 3300053111 Bacteria 10244
761 Ga0500591_066690 3300053115 Bacteria 1642
762 Ga0500595_017745 3300053119 Bacteria 2620
763 Ga0500595_031296 3300053119 Bacteria 1786
764 Ga0500614_021021 3300053123 Bacteria 1511
765 Ga0500642_0002011 3300053130 Bacteria 5902
766 Ga0500642_0025721 3300053130 Bacteria 2394
767 Ga0500642_0121700 3300053130 Bacteria 1221
768 Ga0500559_0001790 3300053136 Bacteria 11801
769 Ga0500559_0004994 3300053136 Bacteria 6162
770 Ga0500603_001625 3300053150 Bacteria 5069
771 Ga0500616_0006635 3300053153 Bacteria 7533
772 Ga0500622_0025785 3300053156 Bacteria 3104
773 Ga0500627_0051117 3300053158 Bacteria 1802
774 Ga0500630_003625 3300053159 Bacteria 7477
775 Ga0500638_001061 3300053162 Bacteria 8066
776 Ga0500639_000061 3300053163 Bacteria 49500
777 Ga0500636_0000284 3300053177 Bacteria 28033
778 Ga0500636_0023548 3300053177 Bacteria 3640
779 Ga0500637_0000098 3300053178 Bacteria 31362
780 Ga0500625_000220 3300053729 Bacteria 13001
781 Ga0500596_000699 3300053735 Bacteria 6539
782 Ga0500596_000998 3300053735 Bacteria 5669
783 Ga0500596_003937 3300053735 Bacteria 2773
784 Ga0500601_000233 3300053737 Bacteria 10949
785 Ga0500601_001561 3300053737 Bacteria 2483
786 Ga0501084_0076301 3300054114 Bacteria 2809

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0022088 Ga0495648_0022088_3148_4275 345
2 3300047469 Ga0495673_0090619 Ga0495673_0090619_79_1206 345
3 3300025932 Ga0207690_10164031 Ga0207690_101640312 352
4 3300047320 Ga0495672_0031356 Ga0495672_0031356_1392_2582 354
5 3300048909 Ga0496106_0265684 Ga0496106_0265684_277_1359 354
6 3300048913 Ga0496110_0211027 Ga0496110_0211027_666_1748 354
7 3300049571 Ga0501034_0444984 Ga0501034_0444984_18_1100 354
8 3300053130 Ga0500642_0121700 Ga0500642_0121700_115_1197 354
9 3300047322 Ga0495680_0002491 Ga0495680_0002491_3108_4208 358
10 3300035725 Ga0373947_0196609 Ga0373947_0196609_11_1168 369
11 3300049580 Ga0501046_0073620 Ga0501046_0073620_1509_2639 370
12 3300053153 Ga0500616_0006635 Ga0500616_0006635_4655_5878 372
13 3300010159 Ga0099796_10013869 Ga0099796_100138692 374
14 3300037853 Ga0436364_0817898 Ga0436364_0817898_1478_2713 375
15 3300037466 Ga0395898_0096005 Ga0395898_0096005_130_1365 377
16 3300025915 Ga0207693_10264604 Ga0207693_102646042 379
17 3300048908 Ga0496105_0267569 Ga0496105_0267569_191_1348 379
18 3300005843 Ga0068860_100005407 Ga0068860_10000540710 381
19 3300009545 Ga0105237_10064196 Ga0105237_100641963 381
20 3300028381 Ga0268264_10000030 Ga0268264_10000030341 381
21 3300042438 Ga0439459_0021517 Ga0439459_0021517_37_1200 381
22 3300048929 Ga0496126_0351501 Ga0496126_0351501_21_1184 381
23 iso_pu_bacteria 8019608314 8019609273 382
24 3300025914 Ga0207671_10060370 Ga0207671_100603702 383
25 3300031235 Ga0265330_10009772 Ga0265330_100097723 383
26 3300031507 Ga0307509_10029551 Ga0307509_100295516 383
27 3300031730 Ga0307516_10038399 Ga0307516_100383992 383
28 3300039437 Ga0436365_0383201 Ga0436365_0383201_81_1328 383
29 3300025912 Ga0207707_10161806 Ga0207707_101618062 384
30 3300021388 Ga0213875_10003220 Ga0213875_100032204 390
31 3300037853 Ga0436364_0108855 Ga0436364_0108855_24433_25662 390
32 iso_pu_bacteria 3005594810 3005600435 391
33 3300028794 Ga0307515_10017392 Ga0307515_100173927 392
34 3300009148 Ga0105243_10142575 Ga0105243_101425752 393
35 3300009177 Ga0105248_10077527 Ga0105248_100775272 393
36 3300010375 Ga0105239_10021644 Ga0105239_100216446 393
37 3300013308 Ga0157375_10214264 Ga0157375_102142642 393
38 3300021388 Ga0213875_10000382 Ga0213875_100003829 393
39 3300021388 Ga0213875_10000390 Ga0213875_1000039037 393
40 3300031730 Ga0307516_10010095 Ga0307516_100100957 393
41 3300035691 Ga0373931_0005603 Ga0373931_0005603_4533_5732 393
42 3300037853 Ga0436364_0042928 Ga0436364_0042928_46150_47382 393
43 3300037853 Ga0436364_0346617 Ga0436364_0346617_41_1267 393
44 3300037853 Ga0436364_1343008 Ga0436364_1343008_1181_2413 393
45 3300047315 Ga0495581_0023521 Ga0495581_0023521_1227_2426 393
46 3300048903 Ga0496100_0119453 Ga0496100_0119453_269_1468 393
47 3300048908 Ga0496105_0011739 Ga0496105_0011739_5509_6708 393
48 3300048910 Ga0496107_0002624 Ga0496107_0002624_4146_5345 393
49 3300048911 Ga0496108_0018478 Ga0496108_0018478_4309_5508 393
50 3300048917 Ga0496114_0008432 Ga0496114_0008432_3347_4546 393
51 3300048918 Ga0496115_0063699 Ga0496115_0063699_1499_2698 393
52 3300053084 Ga0495595_0011648 Ga0495595_0011648_245_1444 393
53 3300039437 Ga0436365_0064270 Ga0436365_0064270_208_1452 394
54 3300047320 Ga0495672_0007184 Ga0495672_0007184_2768_3970 394
55 3300048929 Ga0496126_0051884 Ga0496126_0051884_1996_3198 394
56 3300005355 Ga0070671_100019025 Ga0070671_1000190254 395
57 3300005434 Ga0070709_10115955 Ga0070709_101159551 395
58 3300005435 Ga0070714_100264909 Ga0070714_1002649091 395
59 3300005436 Ga0070713_100252074 Ga0070713_1002520742 395
60 3300005439 Ga0070711_100039484 Ga0070711_1000394841 395
61 3300005458 Ga0070681_10037204 Ga0070681_100372043 395
62 3300006028 Ga0070717_10094177 Ga0070717_100941773 395
63 3300006175 Ga0070712_100054530 Ga0070712_1000545303 395
64 3300007788 Ga0099795_10002778 Ga0099795_100027784 395
65 3300025915 Ga0207693_10059873 Ga0207693_100598733 395
66 3300025915 Ga0207693_10070878 Ga0207693_100708782 395
67 3300025928 Ga0207700_10011837 Ga0207700_100118375 395
68 3300025939 Ga0207665_10209318 Ga0207665_102093182 395
69 3300029957 Ga0265324_10011228 Ga0265324_100112281 395
70 3300031249 Ga0265339_10016403 Ga0265339_100164033 395
71 3300031249 Ga0265339_10065301 Ga0265339_100653012 395
72 3300035170 Ga0373943_0040646 Ga0373943_0040646_875_2113 395
73 3300039437 Ga0436365_0369560 Ga0436365_0369560_722_1960 395
74 3300039437 Ga0436365_0677006 Ga0436365_0677006_830_2068 395
75 3300053084 Ga0495595_0001668 Ga0495595_0001668_5814_7052 395
76 3300053085 Ga0495619_0025449 Ga0495619_0025449_520_1758 395
77 iso_pu_bacteria 2508501009 2508541673 395
78 iso_pu_bacteria 2508501042 2508692788 395
79 iso_pu_bacteria 2508501128 2509152953 395
80 iso_pu_bacteria 2511231028 2511394850 395
81 iso_pu_bacteria 2513237092 2513621750 395
82 iso_pu_bacteria 2513237094 2513636808 395
83 iso_pu_bacteria 2513237095 2513651250 395
84 iso_pu_bacteria 2513237098 2513674875 395
85 iso_pu_bacteria 2513237101 2513697138 395
86 iso_pu_bacteria 2513237102 2513704455 395
87 iso_pu_bacteria 2513237104 2513720784 395
88 iso_pu_bacteria 2513237137 2513856950 395
89 iso_pu_bacteria 2513237139 2513878752 395
90 iso_pu_bacteria 2513237161 2514011818 395
91 iso_pu_bacteria 2517093001 2517104275 395
92 iso_pu_bacteria 2524023210 2524468253 395
93 iso_pu_bacteria 2524023228 2524533576 395
94 iso_pu_bacteria 2528768022 2528848869 395
95 iso_pu_bacteria 2529292951 2530646710 395
96 iso_pu_bacteria 2617270735 2617346909 395
97 iso_pu_bacteria 2617270741 2617372839 395
98 iso_pu_bacteria 2721755755 2723843588 395
99 iso_pu_bacteria 2728368998 2728749927 395
100 iso_pu_bacteria 2744054633 2745080874 395
101 iso_pu_bacteria 2791355196 2793060982 395
102 iso_pu_bacteria 2791355197 2793066584 395
103 iso_pu_bacteria 2791355199 2793083894 395
104 iso_pu_bacteria 2802429603 2805921401 395
105 iso_pu_bacteria 2816332527 2818236671 395
106 iso_pu_bacteria 2824600985 2824602891 395
107 iso_pu_bacteria 2824609381 2824611886 395
108 iso_pu_bacteria 2824617872 2824621477 395
109 iso_pu_bacteria 2824626560 2824630589 395
110 iso_pu_bacteria 2824635225 2824638707 395
111 iso_pu_bacteria 2824644064 2824650098 395
112 iso_pu_bacteria 2824653114 2824660923 395
113 iso_pu_bacteria 2824661429 2824664500 395
114 iso_pu_bacteria 2824671348 2824672213 395
115 iso_pu_bacteria 2824679649 2824682162 395
116 iso_pu_bacteria 2824687955 2824688904 395
117 iso_pu_bacteria 2824696289 2824697741 395
118 iso_pu_bacteria 2824704595 2824709247 395
119 iso_pu_bacteria 2824714736 2824719056 395
120 iso_pu_bacteria 2824723954 2824730391 395
121 iso_pu_bacteria 2824732956 2824733921 395
122 iso_pu_bacteria 2824746037 2824748354 395
123 iso_pu_bacteria 2824753945 2824758020 395
124 iso_pu_bacteria 2824763712 2824766445 395
125 iso_pu_bacteria 2824773399 2824776572 395
126 iso_pu_bacteria 2838122688 2838129330 395
127 iso_pu_bacteria 2841941048 2841948014 395
128 iso_pu_bacteria 2841949485 2841953588 395
129 iso_pu_bacteria 2841957949 2841962805 395
130 iso_pu_bacteria 2841966195 2841973007 395
131 iso_pu_bacteria 2841974524 2841978315 395
132 iso_pu_bacteria 2841983080 2841990535 395
133 iso_pu_bacteria 2842038055 2842040756 395
134 iso_pu_bacteria 2842045827 2842046298 395
135 iso_pu_bacteria 2844315083 2844320136 395
136 iso_pu_bacteria 2847930680 2847933258 395
137 iso_pu_bacteria 2847930680 2847937431 395
138 iso_pu_bacteria 2847939898 2847947855 395
139 iso_pu_bacteria 2849076700 2849078290 395
140 iso_pu_bacteria 2857509624 2857512666 395
141 iso_pu_bacteria 2874590934 2874598670 395
142 iso_pu_bacteria 2874604998 2874607203 395
143 iso_pu_bacteria 2874612657 2874614456 395
144 iso_pu_bacteria 2874620515 2874628187 395
145 iso_pu_bacteria 2874628541 2874630210 395
146 iso_pu_bacteria 2874645413 2874652125 395
147 iso_pu_bacteria 2876761206 2876768198 395
148 iso_pu_bacteria 2876771140 2876778709 395
149 iso_pu_bacteria 2876808645 2876818316 395
150 iso_pu_bacteria 2876818435 2876823513 395
151 iso_pu_bacteria 2879074833 2879082502 395
152 iso_pu_bacteria 2879099564 2879107821 395
153 iso_pu_bacteria 2879110137 2879114093 395
154 iso_pu_bacteria 2879127579 2879131718 395
155 iso_pu_bacteria 2879142872 2879150054 395
156 iso_pu_bacteria 2881364244 2881371350 395
157 iso_pu_bacteria 2881665667 2881672204 395
158 iso_pu_bacteria 2885366525 2885370076 395
159 iso_pu_bacteria 2885374607 2885383123 395
160 iso_pu_bacteria 2885383462 2885391947 395
161 iso_pu_bacteria 2885409591 2885415622 395
162 iso_pu_bacteria 2888378607 2888385573 395
163 iso_pu_bacteria 2888388044 2888392676 395
164 iso_pu_bacteria 2888419890 2888425703 395
165 iso_pu_bacteria 2889033259 2889037906 395
166 iso_pu_bacteria 2903727486 2903731270 395
167 iso_pu_bacteria 2903748898 2903753330 395
168 iso_pu_bacteria 2903768456 2903774854 395
169 iso_pu_bacteria 2904666416 2904674195 395
170 iso_pu_bacteria 2904690495 2904694150 395
171 iso_pu_bacteria 2904699407 2904701134 395
172 iso_pu_bacteria 2904711408 2904711857 395
173 iso_pu_bacteria 2906602504 2906609961 395
174 iso_pu_bacteria 2906610324 2906616413 395
175 iso_pu_bacteria 2906626472 2906627716 395
176 iso_pu_bacteria 2906635258 2906638132 395
177 iso_pu_bacteria 2906643746 2906649617 395
178 iso_pu_bacteria 2906660503 2906662807 395
179 iso_pu_bacteria 2908739725 2908741558 395
180 iso_pu_bacteria 2908756301 2908758996 395
181 iso_pu_bacteria 2908775508 2908781286 395
182 iso_pu_bacteria 2922361189 2922361843 395
183 iso_pu_bacteria 2922368715 2922372293 395
184 iso_pu_bacteria 2922386360 2922386925 395
185 iso_pu_bacteria 2922393267 2922396961 395
186 iso_pu_bacteria 2922425934 2922431582 395
187 iso_pu_bacteria 2929615660 2929621141 395
188 iso_pu_bacteria 2929624759 2929626028 395
189 iso_pu_bacteria 2932784394 2932785092 395
190 iso_pu_bacteria 2932794094 2932795036 395
191 iso_pu_bacteria 2932801729 2932805564 395
192 iso_pu_bacteria 2932809354 2932810120 395
193 iso_pu_bacteria 2932818245 2932821693 395
194 iso_pu_bacteria 2932828146 2932828929 395
195 iso_pu_bacteria 2933577622 2933582990 395
196 iso_pu_bacteria 2935608549 2935609938 395
197 iso_pu_bacteria 2935616580 2935619652 395
198 iso_pu_bacteria 2935630451 2935636117 395
199 iso_pu_bacteria 2935630451 2935638147 395
200 iso_pu_bacteria 2935638405 2935638632 395
201 iso_pu_bacteria 2935648319 2935652031 395
202 iso_pu_bacteria 2935656913 2935659996 395
203 iso_pu_bacteria 2935665750 2935666516 395
204 iso_pu_bacteria 2935675223 2935676441 395
205 iso_pu_bacteria 2935684952 2935691043 395
206 iso_pu_bacteria 2935694250 2935694523 395
207 iso_pu_bacteria 2935703347 2935703638 395
208 iso_pu_bacteria 2935713505 2935718424 395
209 iso_pu_bacteria 2935722832 2935727596 395
210 iso_pu_bacteria 2935732158 2935736299 395
211 iso_pu_bacteria 2935741537 2935745679 395
212 iso_pu_bacteria 2935750917 2935756060 395
213 iso_pu_bacteria 2935760218 2935760680 395
214 iso_pu_bacteria 2935769743 2935776097 395
215 iso_pu_bacteria 2935777560 2935785148 395
216 iso_pu_bacteria 2935785616 2935791890 395
217 iso_pu_bacteria 2935793552 2935800300 395
218 iso_pu_bacteria 2935801545 2935801776 395
219 iso_pu_bacteria 2935810662 2935814809 395
220 iso_pu_bacteria 2935819856 2935823098 395
221 iso_pu_bacteria 2935819856 2935827761 395
222 iso_pu_bacteria 2935827899 2935828126 395
223 iso_pu_bacteria 2935837841 2935842331 395
224 iso_pu_bacteria 2935847175 2935848680 395
225 iso_pu_bacteria 2935847175 2935855075 395
226 iso_pu_bacteria 2935855204 2935858033 395
227 iso_pu_bacteria 2935864058 2935867937 395
228 iso_pu_bacteria 2935873716 2935874039 395
229 iso_pu_bacteria 2935883170 2935885765 395
230 iso_pu_bacteria 2935908558 2935909515 395
231 iso_pu_bacteria 2935916978 2935917239 395
232 iso_pu_bacteria 2935926038 2935926996 395
233 iso_pu_bacteria 2935934488 2935937160 395
234 iso_pu_bacteria 2935942939 2935944537 395
235 iso_pu_bacteria 2935951376 2935952974 395
236 iso_pu_bacteria 2935959822 2935962833 395
237 iso_pu_bacteria 2935967501 2935969814 395
238 iso_pu_bacteria 2935975950 2935976411 395
239 iso_pu_bacteria 2935984226 2935987141 395
240 iso_pu_bacteria 2935992306 2935993036 395
241 iso_pu_bacteria 2936002035 2936002948 395
242 iso_pu_bacteria 2936011229 2936014412 395
243 iso_pu_bacteria 2936019824 2936023748 395
244 iso_pu_bacteria 2936028420 2936031391 395
245 iso_pu_bacteria 2936037263 2936040548 395
246 iso_pu_bacteria 2936046547 2936049518 395
247 iso_pu_bacteria 2936055302 2936061266 395
248 iso_pu_bacteria 2940556831 2940561965 395
249 iso_pu_bacteria 2941507105 2941512748 395
250 iso_pu_bacteria 2941507105 2941514780 395
251 iso_pu_bacteria 2941515067 2941520685 395
252 iso_pu_bacteria 2941515067 2941522762 395
253 iso_pu_bacteria 2941523033 2941528699 395
254 iso_pu_bacteria 2941523033 2941530673 395
255 iso_pu_bacteria 2941531003 2941531318 395
256 iso_pu_bacteria 2941538514 2941542380 395
257 iso_pu_bacteria 3005483717 3005485515 395
258 iso_pu_bacteria 3005506211 3005508329 395
259 iso_pu_bacteria 3005587118 3005588171 395
260 iso_pu_bacteria 3005710791 3005715916 395
261 iso_pu_bacteria 3005718088 3005723271 395
262 iso_pu_bacteria 8006926726 8006933195 395
263 iso_pu_bacteria 8006933436 8006939332 395
264 iso_pu_bacteria 8006964411 8006968863 395
265 iso_pu_bacteria 8006973647 8006978989 395
266 iso_pu_bacteria 8006984368 8006984543 395
267 iso_pu_bacteria 8006994254 8006997169 395
268 iso_pu_bacteria 8016511872 8016520534 395
269 iso_pu_bacteria 8016522445 8016528575 395
270 iso_pu_bacteria 8016548790 8016555150 395
271 iso_pu_bacteria 8016557553 8016563519 395
272 iso_pu_bacteria 8016566248 8016572076 395
273 iso_pu_bacteria 8016583857 8016594487 395
274 iso_pu_bacteria 8016595262 8016601259 395
275 iso_pu_bacteria 8016603502 8016609174 395
276 iso_pu_bacteria 8016613128 8016615728 395
277 iso_pu_bacteria 8016622563 8016625500 395
278 iso_pu_bacteria 8016630954 8016639056 395
279 iso_pu_bacteria 8017057580 8017065041 395
280 iso_pu_bacteria 8019530166 8019533520 395
281 iso_pu_bacteria 8019538911 8019546157 395
282 iso_pu_bacteria 8019547302 8019552550 395
283 iso_pu_bacteria 8019565922 8019575303 395
284 iso_pu_bacteria 8019586578 8019592197 395
285 iso_pu_bacteria 8019597564 8019599087 395
286 iso_pu_bacteria 8019629233 8019633182 395
287 iso_pu_bacteria 8019638758 8019646714 395
288 iso_pu_bacteria 8019648815 8019649487 395
289 iso_pu_bacteria 8019659431 8019661057 395
290 iso_pu_bacteria 8019668869 8019670621 395
291 iso_pu_bacteria 8019678201 8019685614 395
292 iso_pu_bacteria 8019687851 8019691185 395
293 iso_pu_bacteria 8055742211 8055744997 395
294 iso_pu_bacteria 8056673599 8056677519 395
295 iso_pu_bacteria 8056681323 8056687300 395
296 iso_pu_bacteria 8056689827 8056690686 395
297 iso_pu_bacteria 8056967851 8056974950 395
298 3300039437 Ga0436365_0161372 Ga0436365_0161372_96_1331 396
299 iso_pu_bacteria 2562617112 2563055992 396
300 iso_pu_bacteria 2711768613 2713472194 396
301 3300003354 JGI25160J50197_1011835 JGI25160J50197_10118353 397
302 3300003659 JGI25404J52841_10009163 JGI25404J52841_100091633 397
303 3300004625 Ga0055543_1000462 Ga0055543_10004628 397
304 3300005262 Ga0065165_1000799 Ga0065165_100079928 397
305 3300005548 Ga0070665_100051187 Ga0070665_1000511873 397
306 3300005937 Ga0081455_10002800 Ga0081455_1000280010 397
307 3300005937 Ga0081455_10056307 Ga0081455_100563074 397
308 3300005937 Ga0081455_10108720 Ga0081455_101087202 397
309 3300005983 Ga0081540_1011207 Ga0081540_10112073 397
310 3300005983 Ga0081540_1021620 Ga0081540_10216205 397
311 3300005983 Ga0081540_1043139 Ga0081540_10431393 397
312 3300021320 Ga0214544_1000001 Ga0214544_1000001648 397
313 3300021321 Ga0214542_1000037 Ga0214542_100003733 397
314 3300021324 Ga0214545_1000003 Ga0214545_1000003112 397
315 3300021327 Ga0214543_1000002 Ga0214543_1000002653 397
316 3300025261 Ga0209233_1002214 Ga0209233_10022146 397
317 3300025295 Ga0209564_1005201 Ga0209564_10052014 397
318 3300025297 Ga0209758_1032205 Ga0209758_10322051 397
319 3300025299 Ga0209256_1012600 Ga0209256_10126003 397
320 3300025302 Ga0207426_1000228 Ga0207426_100022862 397
321 3300028379 Ga0268266_10055520 Ga0268266_100555203 397
322 3300031616 Ga0307508_10023817 Ga0307508_100238172 397
323 3300039437 Ga0436365_1424648 Ga0436365_1424648_3840_5057 397
324 3300039453 Ga0436362_0618850 Ga0436362_0618850_2040_3257 397
325 3300048924 Ga0496121_0071909 Ga0496121_0071909_199_1416 397
326 3300049823 Ga0501044_0060417 Ga0501044_0060417_1511_2728 397
327 3300050513 nmdc:mga0rr50_147154_c1 nmdc:mga0rr50_147154_c1_239_1456 397
328 3300003215 JGI25153J46596_10005337 JGI25153J46596_100053374 398
329 3300003322 rootL2_10160148 rootL2_101601482 398
330 3300003794 Ga0055531_10006567 Ga0055531_100065676 398
331 3300004625 Ga0055543_1001763 Ga0055543_10017637 398
332 3300005262 Ga0065165_1002416 Ga0065165_10024169 398
333 3300005262 Ga0065165_1002642 Ga0065165_10026427 398
334 3300005262 Ga0065165_1006433 Ga0065165_10064333 398
335 3300005327 Ga0070658_10048283 Ga0070658_100482833 398
336 3300005329 Ga0070683_100005122 Ga0070683_10000512210 398
337 3300005336 Ga0070680_100009353 Ga0070680_1000093537 398
338 3300005336 Ga0070680_100162926 Ga0070680_1001629262 398
339 3300005338 Ga0068868_100053615 Ga0068868_1000536152 398
340 3300005339 Ga0070660_100018873 Ga0070660_1000188734 398
341 3300005347 Ga0070668_100026976 Ga0070668_1000269764 398
342 3300005347 Ga0070668_100082935 Ga0070668_1000829352 398
343 3300005347 Ga0070668_100229075 Ga0070668_1002290751 398
344 3300005354 Ga0070675_100167579 Ga0070675_1001675792 398
345 3300005355 Ga0070671_100154588 Ga0070671_1001545882 398
346 3300005356 Ga0070674_100011327 Ga0070674_1000113273 398
347 3300005364 Ga0070673_100042244 Ga0070673_1000422441 398
348 3300005365 Ga0070688_100028924 Ga0070688_1000289244 398
349 3300005366 Ga0070659_100065131 Ga0070659_1000651312 398
350 3300005367 Ga0070667_100053462 Ga0070667_1000534623 398
351 3300005434 Ga0070709_10001228 Ga0070709_100012288 398
352 3300005434 Ga0070709_10160673 Ga0070709_101606732 398
353 3300005435 Ga0070714_100006930 Ga0070714_1000069306 398
354 3300005435 Ga0070714_100012311 Ga0070714_1000123112 398
355 3300005435 Ga0070714_100083680 Ga0070714_1000836802 398
356 3300005436 Ga0070713_100019837 Ga0070713_1000198373 398
357 3300005436 Ga0070713_100099622 Ga0070713_1000996222 398
358 3300005436 Ga0070713_100155497 Ga0070713_1001554972 398
359 3300005436 Ga0070713_100340281 Ga0070713_1003402811 398
360 3300005437 Ga0070710_10000929 Ga0070710_1000092910 398
361 3300005439 Ga0070711_100005942 Ga0070711_1000059422 398
362 3300005439 Ga0070711_100015536 Ga0070711_1000155364 398
363 3300005439 Ga0070711_100043582 Ga0070711_1000435821 398
364 3300005439 Ga0070711_100072675 Ga0070711_1000726751 398
365 3300005455 Ga0070663_100008307 Ga0070663_1000083075 398
366 3300005455 Ga0070663_100010106 Ga0070663_1000101064 398
367 3300005455 Ga0070663_100035288 Ga0070663_1000352882 398
368 3300005455 Ga0070663_100080401 Ga0070663_1000804012 398
369 3300005458 Ga0070681_10076829 Ga0070681_100768293 398
370 3300005458 Ga0070681_10088746 Ga0070681_100887461 398
371 3300005458 Ga0070681_10094083 Ga0070681_100940834 398
372 3300005468 Ga0070707_100312288 Ga0070707_1003122882 398
373 3300005518 Ga0070699_100171307 Ga0070699_1001713072 398
374 3300005530 Ga0070679_100032475 Ga0070679_1000324753 398
375 3300005530 Ga0070679_100058920 Ga0070679_1000589201 398
376 3300005535 Ga0070684_100015626 Ga0070684_1000156263 398
377 3300005535 Ga0070684_100017917 Ga0070684_1000179171 398
378 3300005535 Ga0070684_100033654 Ga0070684_1000336542 398
379 3300005539 Ga0068853_100137259 Ga0068853_1001372592 398
380 3300005539 Ga0068853_100210070 Ga0068853_1002100702 398
381 3300005539 Ga0068853_100268660 Ga0068853_1002686601 398
382 3300005548 Ga0070665_100016320 Ga0070665_1000163205 398
383 3300005563 Ga0068855_100012869 Ga0068855_1000128699 398
384 3300005563 Ga0068855_100059343 Ga0068855_1000593434 398
385 3300005614 Ga0068856_100001803 Ga0068856_1000018038 398
386 3300005616 Ga0068852_100063882 Ga0068852_1000638823 398
387 3300005617 Ga0068859_100053671 Ga0068859_1000536712 398
388 3300005834 Ga0068851_10042123 Ga0068851_100421232 398
389 3300005841 Ga0068863_100231921 Ga0068863_1002319212 398
390 3300005841 Ga0068863_100294077 Ga0068863_1002940771 398
391 3300005842 Ga0068858_100018788 Ga0068858_1000187886 398
392 3300005843 Ga0068860_100123813 Ga0068860_1001238133 398
393 3300005844 Ga0068862_100057926 Ga0068862_1000579262 398
394 3300005937 Ga0081455_10008855 Ga0081455_1000885510 398
395 3300005937 Ga0081455_10037499 Ga0081455_100374993 398
396 3300005937 Ga0081455_10061238 Ga0081455_100612382 398
397 3300005983 Ga0081540_1000178 Ga0081540_10001787 398
398 3300005983 Ga0081540_1001968 Ga0081540_10019688 398
399 3300005983 Ga0081540_1012098 Ga0081540_10120984 398
400 3300005983 Ga0081540_1018972 Ga0081540_10189725 398
401 3300005983 Ga0081540_1019008 Ga0081540_10190084 398
402 3300005983 Ga0081540_1021450 Ga0081540_10214503 398
403 3300005983 Ga0081540_1040971 Ga0081540_10409712 398
404 3300005985 Ga0081539_10000220 Ga0081539_10000220130 398
405 3300006028 Ga0070717_10005875 Ga0070717_100058752 398
406 3300006028 Ga0070717_10012278 Ga0070717_100122784 398
407 3300006028 Ga0070717_10058625 Ga0070717_100586252 398
408 3300006038 Ga0075365_10018146 Ga0075365_100181464 398
409 3300006042 Ga0075368_10011128 Ga0075368_100111283 398
410 3300006048 Ga0075363_100018753 Ga0075363_1000187533 398
411 3300006048 Ga0075363_100072104 Ga0075363_1000721042 398
412 3300006163 Ga0070715_10003054 Ga0070715_100030544 398
413 3300006173 Ga0070716_100004705 Ga0070716_1000047055 398
414 3300006173 Ga0070716_100012347 Ga0070716_1000123473 398
415 3300006175 Ga0070712_100005481 Ga0070712_1000054816 398
416 3300006175 Ga0070712_100006535 Ga0070712_1000065355 398
417 3300006175 Ga0070712_100044651 Ga0070712_1000446512 398
418 3300006353 Ga0075370_10003000 Ga0075370_100030005 398
419 3300006353 Ga0075370_10042424 Ga0075370_100424243 398
420 3300006358 Ga0068871_100080431 Ga0068871_1000804313 398
421 3300006931 Ga0097620_100053665 Ga0097620_1000536653 398
422 3300006941 Ga0099825_1030562 Ga0099825_10305622 398
423 3300006942 Ga0099824_1004802 Ga0099824_100480214 398
424 3300006942 Ga0099824_1020023 Ga0099824_10200233 398
425 3300006943 Ga0099822_1001244 Ga0099822_10012443 398
426 3300006944 Ga0099823_1042587 Ga0099823_10425871 398
427 3300007265 Ga0099794_10005646 Ga0099794_100056463 398
428 3300007265 Ga0099794_10007699 Ga0099794_100076993 398
429 3300007265 Ga0099794_10101182 Ga0099794_101011822 398
430 3300009093 Ga0105240_10016329 Ga0105240_100163292 398
431 3300009093 Ga0105240_10075310 Ga0105240_100753103 398
432 3300009094 Ga0111539_10083826 Ga0111539_100838263 398
433 3300009094 Ga0111539_10135696 Ga0111539_101356961 398
434 3300009098 Ga0105245_10051090 Ga0105245_100510903 398
435 3300009098 Ga0105245_10171978 Ga0105245_101719782 398
436 3300009098 Ga0105245_10310676 Ga0105245_103106762 398
437 3300009101 Ga0105247_10033772 Ga0105247_100337722 398
438 3300009147 Ga0114129_10090903 Ga0114129_100909031 398
439 3300009174 Ga0105241_10039748 Ga0105241_100397483 398
440 3300009174 Ga0105241_10085631 Ga0105241_100856312 398
441 3300009177 Ga0105248_10078907 Ga0105248_100789073 398
442 3300009177 Ga0105248_10244393 Ga0105248_102443932 398
443 3300009177 Ga0105248_10267166 Ga0105248_102671662 398
444 3300009545 Ga0105237_10037283 Ga0105237_100372833 398
445 3300009545 Ga0105237_10058475 Ga0105237_100584754 398
446 3300009545 Ga0105237_10205408 Ga0105237_102054082 398
447 3300009551 Ga0105238_10009836 Ga0105238_100098362 398
448 3300009551 Ga0105238_10298165 Ga0105238_102981652 398
449 3300009551 Ga0105238_10407541 Ga0105238_104075411 398
450 3300010159 Ga0099796_10011117 Ga0099796_100111172 398
451 3300010375 Ga0105239_10017767 Ga0105239_100177676 398
452 3300010375 Ga0105239_10027720 Ga0105239_100277205 398
453 3300010375 Ga0105239_10059197 Ga0105239_100591974 398
454 3300010375 Ga0105239_10103968 Ga0105239_101039683 398
455 3300011119 Ga0105246_10027867 Ga0105246_100278672 398
456 3300013104 Ga0157370_10059165 Ga0157370_100591652 398
457 3300013105 Ga0157369_10030087 Ga0157369_100300872 398
458 3300013105 Ga0157369_10047249 Ga0157369_100472494 398
459 3300013296 Ga0157374_10087900 Ga0157374_100879002 398
460 3300013296 Ga0157374_10199027 Ga0157374_101990272 398
461 3300013297 Ga0157378_10004346 Ga0157378_100043466 398
462 3300013297 Ga0157378_10078233 Ga0157378_100782332 398
463 3300013306 Ga0163162_10069584 Ga0163162_100695843 398
464 3300013308 Ga0157375_10054992 Ga0157375_100549921 398
465 3300013308 Ga0157375_10121305 Ga0157375_101213052 398
466 3300014325 Ga0163163_10052220 Ga0163163_100522202 398
467 3300014325 Ga0163163_10160664 Ga0163163_101606642 398
468 3300014325 Ga0163163_10185491 Ga0163163_101854912 398
469 3300014745 Ga0157377_10015118 Ga0157377_100151183 398
470 3300014968 Ga0157379_10026231 Ga0157379_100262315 398
471 3300014968 Ga0157379_10287761 Ga0157379_102877612 398
472 3300014969 Ga0157376_10037246 Ga0157376_100372463 398
473 3300017792 Ga0163161_10039459 Ga0163161_100394592 398
474 3300020069 Ga0197907_10707499 Ga0197907_107074992 398
475 3300021321 Ga0214542_1000879 Ga0214542_10008799 398
476 3300021377 Ga0213874_10003673 Ga0213874_100036732 398
477 3300021384 Ga0213876_10005607 Ga0213876_100056075 398
478 3300021441 Ga0213871_10003817 Ga0213871_100038171 398
479 3300025254 Ga0209148_1000462 Ga0209148_100046225 398
480 3300025272 Ga0209455_1009328 Ga0209455_10093282 398
481 3300025272 Ga0209455_1014740 Ga0209455_10147402 398
482 3300025297 Ga0209758_1000011 Ga0209758_1000011433 398
483 3300025297 Ga0209758_1000845 Ga0209758_10008452 398
484 3300025297 Ga0209758_1003253 Ga0209758_10032534 398
485 3300025297 Ga0209758_1008620 Ga0209758_10086202 398
486 3300025299 Ga0209256_1008471 Ga0209256_10084714 398
487 3300025302 Ga0207426_1000270 Ga0207426_100027086 398
488 3300025302 Ga0207426_1000292 Ga0207426_100029263 398
489 3300025302 Ga0207426_1010723 Ga0207426_10107232 398
490 3300025304 Ga0209257_1001242 Ga0209257_10012423 398
491 3300025304 Ga0209257_1018129 Ga0209257_10181293 398
492 3300025321 Ga0207656_10029312 Ga0207656_100293122 398
493 3300025885 Ga0207653_10032516 Ga0207653_100325162 398
494 3300025898 Ga0207692_10001555 Ga0207692_100015551 398
495 3300025898 Ga0207692_10029149 Ga0207692_100291492 398
496 3300025901 Ga0207688_10031893 Ga0207688_100318931 398
497 3300025904 Ga0207647_10017643 Ga0207647_100176432 398
498 3300025906 Ga0207699_10000605 Ga0207699_100006055 398
499 3300025906 Ga0207699_10002358 Ga0207699_100023582 398
500 3300025906 Ga0207699_10008980 Ga0207699_100089802 398
501 3300025906 Ga0207699_10063547 Ga0207699_100635472 398
502 3300025909 Ga0207705_10097865 Ga0207705_100978652 398
503 3300025909 Ga0207705_10158797 Ga0207705_101587972 398
504 3300025912 Ga0207707_10002844 Ga0207707_1000284412 398
505 3300025912 Ga0207707_10007520 Ga0207707_100075202 398
506 3300025912 Ga0207707_10008335 Ga0207707_100083354 398
507 3300025913 Ga0207695_10000006 Ga0207695_10000006505 398
508 3300025913 Ga0207695_10000008 Ga0207695_10000008914 398
509 3300025913 Ga0207695_10046333 Ga0207695_100463332 398
510 3300025913 Ga0207695_10068273 Ga0207695_100682733 398
511 3300025913 Ga0207695_10089987 Ga0207695_100899871 398
512 3300025914 Ga0207671_10088927 Ga0207671_100889272 398
513 3300025915 Ga0207693_10000085 Ga0207693_1000008535 398
514 3300025915 Ga0207693_10005576 Ga0207693_100055766 398
515 3300025915 Ga0207693_10009623 Ga0207693_100096234 398
516 3300025915 Ga0207693_10020299 Ga0207693_100202995 398
517 3300025915 Ga0207693_10060930 Ga0207693_100609302 398
518 3300025916 Ga0207663_10000739 Ga0207663_1000073913 398
519 3300025916 Ga0207663_10003946 Ga0207663_100039463 398
520 3300025916 Ga0207663_10009965 Ga0207663_100099652 398
521 3300025917 Ga0207660_10023909 Ga0207660_100239093 398
522 3300025917 Ga0207660_10068885 Ga0207660_100688852 398
523 3300025918 Ga0207662_10106494 Ga0207662_101064942 398
524 3300025919 Ga0207657_10003303 Ga0207657_1000330310 398
525 3300025920 Ga0207649_10027939 Ga0207649_100279393 398
526 3300025921 Ga0207652_10026123 Ga0207652_100261233 398
527 3300025921 Ga0207652_10045400 Ga0207652_100454002 398
528 3300025922 Ga0207646_10258566 Ga0207646_102585661 398
529 3300025924 Ga0207694_10005677 Ga0207694_100056772 398
530 3300025924 Ga0207694_10180364 Ga0207694_101803642 398
531 3300025924 Ga0207694_10241511 Ga0207694_102415111 398
532 3300025927 Ga0207687_10018479 Ga0207687_100184794 398
533 3300025927 Ga0207687_10062646 Ga0207687_100626462 398
534 3300025927 Ga0207687_10076825 Ga0207687_100768252 398
535 3300025928 Ga0207700_10003531 Ga0207700_100035312 398
536 3300025928 Ga0207700_10011210 Ga0207700_100112103 398
537 3300025928 Ga0207700_10045438 Ga0207700_100454382 398
538 3300025928 Ga0207700_10069649 Ga0207700_100696491 398
539 3300025929 Ga0207664_10005139 Ga0207664_100051398 398
540 3300025929 Ga0207664_10159233 Ga0207664_101592332 398
541 3300025931 Ga0207644_10155132 Ga0207644_101551322 398
542 3300025939 Ga0207665_10000066 Ga0207665_100000662 398
543 3300025939 Ga0207665_10004190 Ga0207665_100041906 398
544 3300025939 Ga0207665_10042629 Ga0207665_100426292 398
545 3300025940 Ga0207691_10059114 Ga0207691_100591141 398
546 3300025942 Ga0207689_10013332 Ga0207689_100133324 398
547 3300025944 Ga0207661_10000917 Ga0207661_1000091714 398
548 3300025944 Ga0207661_10023556 Ga0207661_100235562 398
549 3300025944 Ga0207661_10046472 Ga0207661_100464723 398
550 3300025949 Ga0207667_10021239 Ga0207667_100212397 398
551 3300025949 Ga0207667_10033464 Ga0207667_100334645 398
552 3300025949 Ga0207667_10201110 Ga0207667_102011102 398
553 3300025960 Ga0207651_10207135 Ga0207651_102071351 398
554 3300026023 Ga0207677_10098362 Ga0207677_100983621 398
555 3300026035 Ga0207703_10026127 Ga0207703_100261274 398
556 3300026035 Ga0207703_10128295 Ga0207703_101282952 398
557 3300026035 Ga0207703_10205158 Ga0207703_102051582 398
558 3300026041 Ga0207639_10058471 Ga0207639_100584712 398
559 3300026041 Ga0207639_10158117 Ga0207639_101581172 398
560 3300026067 Ga0207678_10010709 Ga0207678_100107094 398
561 3300026067 Ga0207678_10020027 Ga0207678_100200272 398
562 3300026067 Ga0207678_10026116 Ga0207678_100261162 398
563 3300026067 Ga0207678_10047784 Ga0207678_100477843 398
564 3300026067 Ga0207678_10055282 Ga0207678_100552823 398
565 3300026078 Ga0207702_10001708 Ga0207702_100017088 398
566 3300026078 Ga0207702_10111571 Ga0207702_101115713 398
567 3300026078 Ga0207702_10301380 Ga0207702_103013802 398
568 3300026088 Ga0207641_10296379 Ga0207641_102963791 398
569 3300026089 Ga0207648_10010213 Ga0207648_100102138 398
570 3300026116 Ga0207674_10006543 Ga0207674_1000654310 398
571 3300026118 Ga0207675_100069671 Ga0207675_1000696712 398
572 3300026118 Ga0207675_100377031 Ga0207675_1003770311 398
573 3300026121 Ga0207683_10117952 Ga0207683_101179522 398
574 3300026142 Ga0207698_10124851 Ga0207698_101248512 398
575 3300027296 Ga0209389_1000001 Ga0209389_100000123 398
576 3300027296 Ga0209389_1000014 Ga0209389_100001456 398
577 3300027357 Ga0209589_1000011 Ga0209589_1000011111 398
578 3300027357 Ga0209589_1000020 Ga0209589_100002056 398
579 3300027361 Ga0209489_100012 Ga0209489_100012111 398
580 3300027361 Ga0209489_100060 Ga0209489_10006015 398
581 3300027361 Ga0209489_101114 Ga0209489_10111438 398
582 3300027363 Ga0209700_100007 Ga0209700_100007381 398
583 3300027363 Ga0209700_100019 Ga0209700_100019111 398
584 3300027512 Ga0209179_1002935 Ga0209179_10029352 398
585 3300027671 Ga0209588_1005193 Ga0209588_10051932 398
586 3300027866 Ga0209813_10006595 Ga0209813_100065952 398
587 3300028379 Ga0268266_10014609 Ga0268266_100146093 398
588 3300028379 Ga0268266_10163085 Ga0268266_101630852 398
589 3300028380 Ga0268265_10017139 Ga0268265_100171394 398
590 3300028556 Ga0265337_1007120 Ga0265337_10071203 398
591 3300028563 Ga0265319_1017390 Ga0265319_10173901 398
592 3300028573 Ga0265334_10007339 Ga0265334_100073393 398
593 3300028653 Ga0265323_10001453 Ga0265323_100014533 398
594 3300028666 Ga0265336_10000251 Ga0265336_100002516 398
595 3300028786 Ga0307517_10000386 Ga0307517_1000038656 398
596 3300028800 Ga0265338_10000582 Ga0265338_100005826 398
597 3300031235 Ga0265330_10007549 Ga0265330_100075494 398
598 3300031238 Ga0265332_10047350 Ga0265332_100473502 398
599 3300031241 Ga0265325_10015246 Ga0265325_100152461 398
600 3300031249 Ga0265339_10012020 Ga0265339_100120204 398
601 3300031507 Ga0307509_10099121 Ga0307509_100991213 398
602 3300031616 Ga0307508_10078529 Ga0307508_100785292 398
603 3300031616 Ga0307508_10099956 Ga0307508_100999562 398
604 3300031616 Ga0307508_10100608 Ga0307508_101006082 398
605 3300031730 Ga0307516_10183224 Ga0307516_101832241 398
606 3300032126 Ga0307415_100150974 Ga0307415_1001509741 398
607 3300033180 Ga0307510_10055165 Ga0307510_100551654 398
608 3300033180 Ga0307510_10151640 Ga0307510_101516402 398
609 3300035083 Ga0373926_0034888 Ga0373926_0034888_202_1422 398
610 3300035086 Ga0373934_0007901 Ga0373934_0007901_2081_3301 398
611 3300035113 Ga0373936_0014396 Ga0373936_0014396_95_1312 398
612 3300035117 Ga0373953_0000506 Ga0373953_0000506_6409_7629 398
613 3300035118 Ga0373954_0000386 Ga0373954_0000386_4323_5543 398
614 3300035118 Ga0373954_0014978 Ga0373954_0014978_1663_2880 398
615 3300035119 Ga0373956_0005816 Ga0373956_0005816_2603_3823 398
616 3300035119 Ga0373956_0013430 Ga0373956_0013430_368_1585 398
617 3300035170 Ga0373943_0002708 Ga0373943_0002708_3073_4293 398
618 3300035171 Ga0373946_0005868 Ga0373946_0005868_473_1693 398
619 3300035171 Ga0373946_0020617 Ga0373946_0020617_520_1737 398
620 3300035172 Ga0373955_0000286 Ga0373955_0000286_9143_10363 398
621 3300035172 Ga0373955_0059552 Ga0373955_0059552_527_1744 398
622 3300035692 Ga0373935_0001308 Ga0373935_0001308_9328_10548 398
623 3300035695 Ga0373927_0018861 Ga0373927_0018861_1156_2376 398
624 3300035695 Ga0373927_0053411 Ga0373927_0053411_734_1954 398
625 3300035695 Ga0373927_0094628 Ga0373927_0094628_532_1749 398
626 3300035724 Ga0373933_0000525 Ga0373933_0000525_18624_19844 398
627 3300035724 Ga0373933_0000952 Ga0373933_0000952_8707_9927 398
628 3300035725 Ga0373947_0012265 Ga0373947_0012265_1670_2890 398
629 3300035725 Ga0373947_0042908 Ga0373947_0042908_1404_2624 398
630 3300036401 Ga0373937_0001493 Ga0373937_0001493_15219_16439 398
631 3300037068 Ga0373925_0007302 Ga0373925_0007302_3842_5059 398
632 3300037418 Ga0395900_0001070 Ga0395900_0001070_6273_7493 398
633 3300037466 Ga0395898_0005530 Ga0395898_0005530_7342_8562 398
634 3300037466 Ga0395898_0017205 Ga0395898_0017205_5727_6947 398
635 3300037466 Ga0395898_0038983 Ga0395898_0038983_3205_4425 398
636 3300037471 Ga0395905_0007330 Ga0395905_0007330_6058_7278 398
637 3300037471 Ga0395905_0102640 Ga0395905_0102640_444_1664 398
638 3300038443 Ga0395901_0014261 Ga0395901_0014261_4408_5628 398
639 3300038443 Ga0395901_0015950 Ga0395901_0015950_55_1275 398
640 3300038443 Ga0395901_0124736 Ga0395901_0124736_1466_2686 398
641 3300038443 Ga0395901_0129939 Ga0395901_0129939_1092_2312 398
642 3300038443 Ga0395901_0185322 Ga0395901_0185322_906_2126 398
643 3300039437 Ga0436365_0234716 Ga0436365_0234716_1826_3046 398
644 3300039437 Ga0436365_1301574 Ga0436365_1301574_583_1803 398
645 3300039438 Ga0436360_0078764 Ga0436360_0078764_1344_2564 398
646 3300039438 Ga0436360_0466793 Ga0436360_0466793_421_1641 398
647 3300039450 Ga0436363_0383878 Ga0436363_0383878_107_1327 398
648 3300039450 Ga0436363_0693677 Ga0436363_0693677_629_1849 398
649 3300039453 Ga0436362_0187516 Ga0436362_0187516_273_1493 398
650 3300041498 Ga0451841_0603492 Ga0451841_0603492_111_1331 398
651 3300044658 Ga0466972_0000113 Ga0466972_0000113_10971_12191 398
652 3300044684 Ga0466966_0000094 Ga0466966_0000094_19558_20778 398
653 3300044693 Ga0466961_0000118 Ga0466961_0000118_2989_4209 398
654 3300044693 Ga0466961_0134432 Ga0466961_0134432_201_1421 398
655 3300046454 Ga0495592_0001573 Ga0495592_0001573_10432_11652 398
656 3300046454 Ga0495592_0021108 Ga0495592_0021108_3362_4582 398
657 3300046454 Ga0495592_0041596 Ga0495592_0041596_594_1814 398
658 3300046454 Ga0495592_0059415 Ga0495592_0059415_935_2152 398
659 3300046454 Ga0495592_0118930 Ga0495592_0118930_483_1703 398
660 3300046454 Ga0495592_0184676 Ga0495592_0184676_107_1327 398
661 3300046455 Ga0495603_0030969 Ga0495603_0030969_639_1859 398
662 3300046455 Ga0495603_0082601 Ga0495603_0082601_608_1828 398
663 3300046457 Ga0495590_0034179 Ga0495590_0034179_480_1700 398
664 3300046459 Ga0495629_0000133 Ga0495629_0000133_5944_7164 398
665 3300046459 Ga0495629_0010755 Ga0495629_0010755_1148_2368 398
666 3300046459 Ga0495629_0018014 Ga0495629_0018014_3591_4811 398
667 3300046459 Ga0495629_0048075 Ga0495629_0048075_776_1993 398
668 3300046460 Ga0495638_0007773 Ga0495638_0007773_27_1247 398
669 3300046460 Ga0495638_0092624 Ga0495638_0092624_164_1384 398
670 3300046461 Ga0495641_0003044 Ga0495641_0003044_10449_11669 398
671 3300046462 Ga0495651_0009251 Ga0495651_0009251_1995_3215 398
672 3300046463 Ga0495653_0001313 Ga0495653_0001313_4333_5553 398
673 3300046463 Ga0495653_0081656 Ga0495653_0081656_109_1329 398
674 3300046472 Ga0495580_0006086 Ga0495580_0006086_2604_3821 398
675 3300046472 Ga0495580_0172160 Ga0495580_0172160_141_1361 398
676 3300046473 Ga0495582_0000016 Ga0495582_0000016_82035_83255 398
677 3300046473 Ga0495582_0013313 Ga0495582_0013313_2535_3752 398
678 3300046474 Ga0495605_0031333 Ga0495605_0031333_243_1463 398
679 3300046475 Ga0495639_0000014 Ga0495639_0000014_24812_26032 398
680 3300046475 Ga0495639_0031073 Ga0495639_0031073_892_2112 398
681 3300046476 Ga0495662_0000086 Ga0495662_0000086_22014_23234 398
682 3300046477 Ga0495664_0004447 Ga0495664_0004447_3015_4235 398
683 3300046477 Ga0495664_0007306 Ga0495664_0007306_1072_2292 398
684 3300046499 Ga0495594_0000051 Ga0495594_0000051_46366_47586 398
685 3300046499 Ga0495594_0112428 Ga0495594_0112428_191_1411 398
686 3300046501 Ga0495607_0103073 Ga0495607_0103073_105_1325 398
687 3300046507 Ga0495606_0016667 Ga0495606_0016667_3085_4305 398
688 3300046511 Ga0495608_0003757 Ga0495608_0003757_4575_5795 398
689 3300046513 Ga0495616_0026879 Ga0495616_0026879_1650_2870 398
690 3300046513 Ga0495616_0049990 Ga0495616_0049990_135_1355 398
691 3300046513 Ga0495616_0090587 Ga0495616_0090587_140_1360 398
692 3300046514 Ga0495618_0114154 Ga0495618_0114154_399_1619 398
693 3300046516 Ga0495628_0004462 Ga0495628_0004462_1844_3064 398
694 3300046516 Ga0495628_0007774 Ga0495628_0007774_3667_4887 398
695 3300046516 Ga0495628_0010553 Ga0495628_0010553_1162_2382 398
696 3300046522 Ga0495643_0019976 Ga0495643_0019976_1549_2769 398
697 3300046524 Ga0495648_0001270 Ga0495648_0001270_6940_8160 398
698 3300046526 Ga0495666_0020761 Ga0495666_0020761_841_2061 398
699 3300046529 Ga0495652_0008371 Ga0495652_0008371_4689_5909 398
700 3300046529 Ga0495652_0036434 Ga0495652_0036434_2554_3774 398
701 3300046529 Ga0495652_0056592 Ga0495652_0056592_520_1740 398
702 3300046529 Ga0495652_0121007 Ga0495652_0121007_313_1530 398
703 3300046531 Ga0495665_0000477 Ga0495665_0000477_6692_7912 398
704 3300046533 Ga0495640_0001817 Ga0495640_0001817_1176_2396 398
705 3300046533 Ga0495640_0007412 Ga0495640_0007412_935_2152 398
706 3300046533 Ga0495640_0011794 Ga0495640_0011794_1144_2364 398
707 3300046533 Ga0495640_0015035 Ga0495640_0015035_2668_3888 398
708 3300046536 Ga0495587_0000862 Ga0495587_0000862_17840_19060 398
709 3300046536 Ga0495587_0008087 Ga0495587_0008087_3250_4470 398
710 3300046538 Ga0495609_0026863 Ga0495609_0026863_1229_2449 398
711 3300046538 Ga0495609_0077158 Ga0495609_0077158_142_1362 398
712 3300046542 Ga0495597_0025529 Ga0495597_0025529_106_1326 398
713 3300046543 Ga0495645_0024663 Ga0495645_0024663_1101_2321 398
714 3300046543 Ga0495645_0099885 Ga0495645_0099885_834_2054 398
715 3300046557 Ga0495622_0006671 Ga0495622_0006671_395_1615 398
716 3300046557 Ga0495622_0012877 Ga0495622_0012877_63_1283 398
717 3300046559 Ga0495667_0000424 Ga0495667_0000424_7942_9162 398
718 3300046559 Ga0495667_0015829 Ga0495667_0015829_2814_4034 398
719 3300046559 Ga0495667_0058901 Ga0495667_0058901_281_1501 398
720 3300046615 Ga0495656_0002167 Ga0495656_0002167_4939_6159 398
721 3300046616 Ga0495668_0019915 Ga0495668_0019915_1986_3206 398
722 3300046616 Ga0495668_0080465 Ga0495668_0080465_480_1700 398
723 3300046642 Ga0495634_0003306 Ga0495634_0003306_4998_6218 398
724 3300046642 Ga0495634_0006805 Ga0495634_0006805_4358_5578 398
725 3300046660 Ga0495625_0061107 Ga0495625_0061107_31_1251 398
726 3300046660 Ga0495625_0070923 Ga0495625_0070923_519_1739 398
727 3300046663 Ga0495635_0000792 Ga0495635_0000792_8036_9256 398
728 3300046663 Ga0495635_0002703 Ga0495635_0002703_3282_4502 398
729 3300046663 Ga0495635_0005278 Ga0495635_0005278_113_1333 398
730 3300046663 Ga0495635_0026165 Ga0495635_0026165_2356_3573 398
731 3300046664 Ga0495659_0011741 Ga0495659_0011741_1187_2407 398
732 3300046675 Ga0495657_0001449 Ga0495657_0001449_3787_5007 398
733 3300046675 Ga0495657_0013673 Ga0495657_0013673_88_1308 398
734 3300046675 Ga0495657_0022741 Ga0495657_0022741_239_1459 398
735 3300046678 Ga0495599_0000879 Ga0495599_0000879_7501_8721 398
736 3300046678 Ga0495599_0013798 Ga0495599_0013798_2078_3298 398
737 3300046678 Ga0495599_0048778 Ga0495599_0048778_1176_2396 398
738 3300046679 Ga0495623_0002249 Ga0495623_0002249_4978_6198 398
739 3300046680 Ga0495646_0002245 Ga0495646_0002245_8450_9670 398
740 3300046680 Ga0495646_0032854 Ga0495646_0032854_975_2195 398
741 3300046680 Ga0495646_0105597 Ga0495646_0105597_248_1465 398
742 3300046683 Ga0495658_0001354 Ga0495658_0001354_2793_4013 398
743 3300046683 Ga0495658_0044624 Ga0495658_0044624_1217_2434 398
744 3300046689 Ga0495613_0006655 Ga0495613_0006655_4249_5469 398
745 3300046689 Ga0495613_0024354 Ga0495613_0024354_943_2163 398
746 3300046690 Ga0495624_0000138 Ga0495624_0000138_6393_7613 398
747 3300046690 Ga0495624_0010671 Ga0495624_0010671_3499_4716 398
748 3300046692 Ga0495671_0053471 Ga0495671_0053471_86_1306 398
749 3300046694 Ga0495649_0042779 Ga0495649_0042779_324_1544 398
750 3300046809 Ga0495600_0000337 Ga0495600_0000337_3787_5007 398
751 3300046809 Ga0495600_0005193 Ga0495600_0005193_3877_5097 398
752 3300046809 Ga0495600_0151690 Ga0495600_0151690_81_1301 398
753 3300047315 Ga0495581_0000001 Ga0495581_0000001_73159_74379 398
754 3300047315 Ga0495581_0081996 Ga0495581_0081996_333_1553 398
755 3300047317 Ga0495604_0001626 Ga0495604_0001626_10248_11468 398
756 3300047317 Ga0495604_0017599 Ga0495604_0017599_3547_4767 398
757 3300047317 Ga0495604_0169005 Ga0495604_0169005_234_1451 398
758 3300047319 Ga0495674_0002545 Ga0495674_0002545_11790_13010 398
759 3300047319 Ga0495674_0018873 Ga0495674_0018873_3084_4304 398
760 3300047319 Ga0495674_0145940 Ga0495674_0145940_205_1422 398
761 3300047321 Ga0495676_0003317 Ga0495676_0003317_7609_8829 398
762 3300047321 Ga0495676_0143571 Ga0495676_0143571_242_1459 398
763 3300047322 Ga0495680_0005089 Ga0495680_0005089_462_1682 398
764 3300047322 Ga0495680_0156052 Ga0495680_0156052_21_1241 398
765 3300047443 Ga0495687_014891 Ga0495687_014891_1678_2898 398
766 3300047444 Ga0495675_0012328 Ga0495675_0012328_4027_5247 398
767 3300047444 Ga0495675_0024995 Ga0495675_0024995_2085_3305 398
768 3300047444 Ga0495675_0035435 Ga0495675_0035435_378_1598 398
769 3300047469 Ga0495673_0069111 Ga0495673_0069111_67_1287 398
770 3300047471 Ga0495684_0001407 Ga0495684_0001407_3283_4503 398
771 3300047471 Ga0495684_0005971 Ga0495684_0005971_4566_5783 398
772 3300047673 Ga0495593_0000003 Ga0495593_0000003_119290_120510 398
773 3300047673 Ga0495593_0002446 Ga0495593_0002446_6958_8178 398
774 3300048088 Ga0495602_0007241 Ga0495602_0007241_1934_3154 398
775 3300048088 Ga0495602_0019961 Ga0495602_0019961_3243_4463 398
776 3300048088 Ga0495602_0039312 Ga0495602_0039312_2889_4109 398
777 3300048088 Ga0495602_0115379 Ga0495602_0115379_889_2109 398
778 3300048089 Ga0495614_0006055 Ga0495614_0006055_2151_3371 398
779 3300048903 Ga0496100_0007585 Ga0496100_0007585_736_1956 398
780 3300048903 Ga0496100_0042150 Ga0496100_0042150_540_1760 398
781 3300048904 Ga0496101_0127876 Ga0496101_0127876_228_1448 398
782 3300048905 Ga0496102_0014231 Ga0496102_0014231_4704_5924 398
783 3300048905 Ga0496102_0018355 Ga0496102_0018355_398_1618 398
784 3300048905 Ga0496102_0083203 Ga0496102_0083203_1034_2251 398
785 3300048906 Ga0496103_0022816 Ga0496103_0022816_888_2108 398
786 3300048907 Ga0496104_0022932 Ga0496104_0022932_4245_5465 398
787 3300048907 Ga0496104_0024758 Ga0496104_0024758_4280_5500 398
788 3300048907 Ga0496104_0036043 Ga0496104_0036043_93_1313 398
789 3300048907 Ga0496104_0073880 Ga0496104_0073880_750_1970 398
790 3300048907 Ga0496104_0203556 Ga0496104_0203556_641_1861 398
791 3300048908 Ga0496105_0002092 Ga0496105_0002092_6886_8106 398
792 3300048908 Ga0496105_0041425 Ga0496105_0041425_902_2122 398
793 3300048908 Ga0496105_0044963 Ga0496105_0044963_2099_3319 398
794 3300048908 Ga0496105_0050731 Ga0496105_0050731_380_1600 398
795 3300048909 Ga0496106_0001202 Ga0496106_0001202_12467_13687 398
796 3300048909 Ga0496106_0011446 Ga0496106_0011446_4491_5711 398
797 3300048909 Ga0496106_0015453 Ga0496106_0015453_1084_2304 398
798 3300048909 Ga0496106_0018182 Ga0496106_0018182_3311_4531 398
799 3300048909 Ga0496106_0068108 Ga0496106_0068108_531_1751 398
800 3300048910 Ga0496107_0009825 Ga0496107_0009825_4589_5809 398
801 3300048910 Ga0496107_0011885 Ga0496107_0011885_828_2048 398
802 3300048911 Ga0496108_0001960 Ga0496108_0001960_12095_13315 398
803 3300048911 Ga0496108_0050815 Ga0496108_0050815_303_1523 398
804 3300048911 Ga0496108_0180764 Ga0496108_0180764_397_1617 398
805 3300048912 Ga0496109_0000432 Ga0496109_0000432_18261_19481 398
806 3300048912 Ga0496109_0010188 Ga0496109_0010188_6199_7419 398
807 3300048912 Ga0496109_0055955 Ga0496109_0055955_690_1910 398
808 3300048912 Ga0496109_0234299 Ga0496109_0234299_356_1576 398
809 3300048913 Ga0496110_0012555 Ga0496110_0012555_3833_5053 398
810 3300048913 Ga0496110_0027219 Ga0496110_0027219_2932_4152 398
811 3300048913 Ga0496110_0029803 Ga0496110_0029803_1221_2441 398
812 3300048913 Ga0496110_0187050 Ga0496110_0187050_517_1737 398
813 3300048914 Ga0496111_0013188 Ga0496111_0013188_187_1407 398
814 3300048914 Ga0496111_0039393 Ga0496111_0039393_697_1917 398
815 3300048914 Ga0496111_0091744 Ga0496111_0091744_677_1897 398
816 3300048915 Ga0496112_0015915 Ga0496112_0015915_3488_4708 398
817 3300048915 Ga0496112_0033682 Ga0496112_0033682_1314_2534 398
818 3300048915 Ga0496112_0061568 Ga0496112_0061568_1842_3062 398
819 3300048915 Ga0496112_0100707 Ga0496112_0100707_750_1970 398
820 3300048915 Ga0496112_0112903 Ga0496112_0112903_1024_2244 398
821 3300048915 Ga0496112_0194315 Ga0496112_0194315_315_1535 398
822 3300048915 Ga0496112_0206592 Ga0496112_0206592_225_1445 398
823 3300048916 Ga0496113_0014649 Ga0496113_0014649_2767_3987 398
824 3300048916 Ga0496113_0032600 Ga0496113_0032600_2085_3305 398
825 3300048918 Ga0496115_0009310 Ga0496115_0009310_2474_3694 398
826 3300048918 Ga0496115_0033310 Ga0496115_0033310_1794_3014 398
827 3300048918 Ga0496115_0078069 Ga0496115_0078069_220_1440 398
828 3300048918 Ga0496115_0133099 Ga0496115_0133099_739_1959 398
829 3300048921 Ga0496118_0019947 Ga0496118_0019947_3001_4221 398
830 3300048921 Ga0496118_0029396 Ga0496118_0029396_49_1269 398
831 3300048921 Ga0496118_0036940 Ga0496118_0036940_1303_2538 398
832 3300048921 Ga0496118_0134801 Ga0496118_0134801_225_1445 398
833 3300048922 Ga0496119_0013953 Ga0496119_0013953_1548_2768 398
834 3300048923 Ga0496120_0007436 Ga0496120_0007436_6265_7485 398
835 3300048924 Ga0496121_0000041 Ga0496121_0000041_114672_115892 398
836 3300048924 Ga0496121_0003563 Ga0496121_0003563_4372_5592 398
837 3300048924 Ga0496121_0005352 Ga0496121_0005352_3074_4300 398
838 3300048924 Ga0496121_0009890 Ga0496121_0009890_1351_2571 398
839 3300048924 Ga0496121_0028205 Ga0496121_0028205_1729_2964 398
840 3300048924 Ga0496121_0039020 Ga0496121_0039020_2745_3965 398
841 3300048924 Ga0496121_0100982 Ga0496121_0100982_31_1251 398
842 3300048924 Ga0496121_0111107 Ga0496121_0111107_313_1533 398
843 3300048925 Ga0496122_0030990 Ga0496122_0030990_3083_4303 398
844 3300048927 Ga0496124_0000624 Ga0496124_0000624_19492_20712 398
845 3300048928 Ga0496125_0036744 Ga0496125_0036744_30_1250 398
846 3300048928 Ga0496125_0040200 Ga0496125_0040200_1056_2276 398
847 3300048928 Ga0496125_0053440 Ga0496125_0053440_884_2104 398
848 3300048928 Ga0496125_0075947 Ga0496125_0075947_1197_2432 398
849 3300048929 Ga0496126_0002321 Ga0496126_0002321_16042_17262 398
850 3300048929 Ga0496126_0008801 Ga0496126_0008801_2029_3249 398
851 3300048929 Ga0496126_0010022 Ga0496126_0010022_2170_3390 398
852 3300048929 Ga0496126_0015516 Ga0496126_0015516_2127_3347 398
853 3300048929 Ga0496126_0018293 Ga0496126_0018293_1004_2224 398
854 3300048929 Ga0496126_0029558 Ga0496126_0029558_2710_3930 398
855 3300048929 Ga0496126_0030071 Ga0496126_0030071_2190_3410 398
856 3300048929 Ga0496126_0032840 Ga0496126_0032840_1219_2439 398
857 3300048929 Ga0496126_0198822 Ga0496126_0198822_240_1460 398
858 3300048929 Ga0496126_0206653 Ga0496126_0206653_337_1557 398
859 3300048929 Ga0496126_0255689 Ga0496126_0255689_107_1327 398
860 3300049569 Ga0501032_0005102 Ga0501032_0005102_2086_3306 398
861 3300049569 Ga0501032_0076754 Ga0501032_0076754_697_1917 398
862 3300049570 Ga0501033_0001834 Ga0501033_0001834_8470_9690 398
863 3300049570 Ga0501033_0051989 Ga0501033_0051989_1636_2856 398
864 3300049571 Ga0501034_0001471 Ga0501034_0001471_21175_22428 398
865 3300049571 Ga0501034_0134384 Ga0501034_0134384_344_1564 398
866 3300049572 Ga0501036_0050117 Ga0501036_0050117_1043_2263 398
867 3300049573 Ga0501037_0005747 Ga0501037_0005747_2072_3292 398
868 3300049573 Ga0501037_0086729 Ga0501037_0086729_865_2085 398
869 3300049574 Ga0501038_0002435 Ga0501038_0002435_11866_13086 398
870 3300049574 Ga0501038_0014916 Ga0501038_0014916_3248_4468 398
871 3300049574 Ga0501038_0042310 Ga0501038_0042310_638_1858 398
872 3300049575 Ga0501039_0010117 Ga0501039_0010117_4979_6199 398
873 3300049576 Ga0501040_0054616 Ga0501040_0054616_1086_2306 398
874 3300049578 Ga0501042_0045227 Ga0501042_0045227_432_1652 398
875 3300049579 Ga0501043_0019449 Ga0501043_0019449_2370_3590 398
876 3300049579 Ga0501043_0061463 Ga0501043_0061463_1573_2793 398
877 3300049580 Ga0501046_0007012 Ga0501046_0007012_2001_3221 398
878 3300049580 Ga0501046_0075087 Ga0501046_0075087_688_1908 398
879 3300049581 Ga0501047_0014876 Ga0501047_0014876_3896_5116 398
880 3300049581 Ga0501047_0140691 Ga0501047_0140691_986_2206 398
881 3300049582 Ga0501048_0006412 Ga0501048_0006412_455_1675 398
882 3300049584 Ga0501068_0024706 Ga0501068_0024706_83_1303 398
883 3300049590 Ga0501074_0149427 Ga0501074_0149427_181_1401 398
884 3300049592 Ga0501076_0100259 Ga0501076_0100259_538_1758 398
885 3300049741 Ga0501079_0236102 Ga0501079_0236102_28_1248 398
886 3300049742 Ga0501080_0088666 Ga0501080_0088666_598_1818 398
887 3300049742 Ga0501080_0108978 Ga0501080_0108978_289_1509 398
888 3300049822 Ga0501035_0002268 Ga0501035_0002268_12180_13400 398
889 3300049822 Ga0501035_0026433 Ga0501035_0026433_1242_2462 398
890 3300049823 Ga0501044_0007852 Ga0501044_0007852_7890_9110 398
891 3300049824 Ga0501045_0032361 Ga0501045_0032361_1331_2551 398
892 3300050492 nmdc:mga0yw44_23996_c1 nmdc:mga0yw44_23996_c1_497_1717 398
893 3300050492 nmdc:mga0yw44_31714_c1 nmdc:mga0yw44_31714_c1_1340_2560 398
894 3300050492 nmdc:mga0yw44_5423_c1 nmdc:mga0yw44_5423_c1_4093_5313 398
895 3300050494 nmdc:mga06z11_27907_c1 nmdc:mga06z11_27907_c1_250_1470 398
896 3300050515 nmdc:mga0a205_317757_c1 nmdc:mga0a205_317757_c1_12_1232 398
897 3300050516 nmdc:mga0sz30_14368_c1 nmdc:mga0sz30_14368_c1_122_1342 398
898 3300050516 nmdc:mga0sz30_64384_c1 nmdc:mga0sz30_64384_c1_141_1361 398
899 3300053077 Ga0495601_0054028 Ga0495601_0054028_134_1354 398
900 3300053080 Ga0500635_0015520 Ga0500635_0015520_532_1752 398
901 3300053084 Ga0495595_0003281 Ga0495595_0003281_647_1867 398
902 3300053085 Ga0495619_0076189 Ga0495619_0076189_415_1635 398
903 3300053085 Ga0495619_0159548 Ga0495619_0159548_263_1483 398
904 3300053087 Ga0500643_001180 Ga0500643_001180_10215_11435 398
905 3300053091 Ga0500647_0036075 Ga0500647_0036075_675_1895 398
906 3300053091 Ga0500647_0095598 Ga0500647_0095598_176_1396 398
907 3300053092 Ga0500583_0079752 Ga0500583_0079752_300_1520 398
908 3300053094 Ga0500566_0000062 Ga0500566_0000062_5016_6236 398
909 3300053094 Ga0500566_0000112 Ga0500566_0000112_11266_12486 398
910 3300053094 Ga0500566_0002624 Ga0500566_0002624_7810_9030 398
911 3300053095 Ga0500640_000394 Ga0500640_000394_4213_5433 398
912 3300053102 Ga0500554_001136 Ga0500554_001136_2473_3693 398
913 3300053104 Ga0500556_0000750 Ga0500556_0000750_16439_17662 398
914 3300053105 Ga0500557_000003 Ga0500557_000003_151277_152497 398
915 3300053108 Ga0500562_023587 Ga0500562_023587_313_1533 398
916 3300053111 Ga0500572_000239 Ga0500572_000239_5227_6462 398
917 3300053111 Ga0500572_000775 Ga0500572_000775_5045_6265 398
918 3300053115 Ga0500591_066690 Ga0500591_066690_246_1466 398
919 3300053119 Ga0500595_017745 Ga0500595_017745_928_2148 398
920 3300053119 Ga0500595_031296 Ga0500595_031296_36_1256 398
921 3300053130 Ga0500642_0002011 Ga0500642_0002011_3477_4697 398
922 3300053130 Ga0500642_0025721 Ga0500642_0025721_690_1910 398
923 3300053136 Ga0500559_0001790 Ga0500559_0001790_5887_7122 398
924 3300053136 Ga0500559_0004994 Ga0500559_0004994_3733_4953 398
925 3300053150 Ga0500603_001625 Ga0500603_001625_2613_3833 398
926 3300053156 Ga0500622_0025785 Ga0500622_0025785_1274_2494 398
927 3300053158 Ga0500627_0051117 Ga0500627_0051117_47_1267 398
928 3300053159 Ga0500630_003625 Ga0500630_003625_5016_6236 398
929 3300053162 Ga0500638_001061 Ga0500638_001061_1854_3074 398
930 3300053163 Ga0500639_000061 Ga0500639_000061_17421_18641 398
931 3300053177 Ga0500636_0000284 Ga0500636_0000284_24540_25760 398
932 3300053177 Ga0500636_0023548 Ga0500636_0023548_1367_2602 398
933 3300053178 Ga0500637_0000098 Ga0500637_0000098_9079_10299 398
934 3300053729 Ga0500625_000220 Ga0500625_000220_6771_7991 398
935 3300053735 Ga0500596_000699 Ga0500596_000699_303_1523 398
936 3300053735 Ga0500596_000998 Ga0500596_000998_1200_2420 398
937 3300053735 Ga0500596_003937 Ga0500596_003937_1031_2266 398
938 3300053737 Ga0500601_000233 Ga0500601_000233_3636_4856 398
939 3300053737 Ga0500601_001561 Ga0500601_001561_913_2148 398
940 3300054114 Ga0501084_0076301 Ga0501084_0076301_585_1805 398
941 iso_pu_bacteria 2507262055 2507507555 398
942 3300037312 Ga0395899_0058078 Ga0395899_0058078_253_1473 399
943 3300049572 Ga0501036_0053755 Ga0501036_0053755_1255_2475 399
944 3300049579 Ga0501043_0020212 Ga0501043_0020212_3179_4399 399
945 3300049581 Ga0501047_0082968 Ga0501047_0082968_1541_2761 399
946 3300049822 Ga0501035_0055661 Ga0501035_0055661_1295_2515 399
947 3300049823 Ga0501044_0020966 Ga0501044_0020966_2597_3817 399
948 iso_pu_bacteria 2513237141 2513894154 399
949 3300001989 JGI24739J22299_10002391 JGI24739J22299_100023912 400
950 3300001990 JGI24737J22298_10008032 JGI24737J22298_100080322 400
951 3300005457 Ga0070662_100010158 Ga0070662_1000101584 400
952 3300005539 Ga0068853_100022387 Ga0068853_1000223873 400
953 3300005563 Ga0068855_100021640 Ga0068855_1000216405 400
954 3300005577 Ga0068857_100015877 Ga0068857_1000158775 400
955 3300005614 Ga0068856_100019754 Ga0068856_1000197545 400
956 3300010375 Ga0105239_10003585 Ga0105239_100035855 400
957 3300010375 Ga0105239_10003896 Ga0105239_100038962 400
958 3300013100 Ga0157373_10052924 Ga0157373_100529242 400
959 3300025904 Ga0207647_10000496 Ga0207647_1000049617 400
960 3300025912 Ga0207707_10133882 Ga0207707_101338822 400
961 3300025913 Ga0207695_10011660 Ga0207695_100116605 400
962 3300025919 Ga0207657_10016929 Ga0207657_100169293 400
963 3300025921 Ga0207652_10115771 Ga0207652_101157712 400
964 3300025924 Ga0207694_10003295 Ga0207694_100032958 400
965 3300025933 Ga0207706_10041553 Ga0207706_100415532 400
966 3300025949 Ga0207667_10003981 Ga0207667_100039815 400
967 3300026041 Ga0207639_10004828 Ga0207639_100048286 400
968 3300026078 Ga0207702_10008470 Ga0207702_100084705 400
969 3300026116 Ga0207674_10023678 Ga0207674_100236784 400
970 3300026142 Ga0207698_10029719 Ga0207698_100297193 400
971 3300031711 Ga0265314_10010113 Ga0265314_100101133 400
972 3300049742 Ga0501080_0130979 Ga0501080_0130979_683_1906 400
973 3300010375 Ga0105239_10431802 Ga0105239_104318021 401
974 3300031730 Ga0307516_10180578 Ga0307516_101805781 401
975 3300048927 Ga0496124_0040676 Ga0496124_0040676_1260_2504 401
976 3300048928 Ga0496125_0092232 Ga0496125_0092232_296_1540 401
977 3300031456 Ga0307513_10216665 Ga0307513_102166651 402
978 3300033180 Ga0307510_10017574 Ga0307510_100175742 402
979 3300046477 Ga0495664_0145578 Ga0495664_0145578_74_1306 402
980 3300046516 Ga0495628_0184958 Ga0495628_0184958_203_1435 402
981 3300046683 Ga0495658_0048318 Ga0495658_0048318_1124_2356 402
982 3300047319 Ga0495674_0311730 Ga0495674_0311730_28_1260 402
983 3300048907 Ga0496104_0130155 Ga0496104_0130155_1084_2316 402
984 3300053077 Ga0495601_0112208 Ga0495601_0112208_255_1487 402
985 3300053123 Ga0500614_021021 Ga0500614_021021_130_1362 402
986 3300028379 Ga0268266_10200158 Ga0268266_102001582 403
987 3300039447 Ga0436361_1169803 Ga0436361_1169803_2733_3968 403
988 3300044765 Ga0466970_0058039 Ga0466970_0058039_340_1575 403
989 3300009551 Ga0105238_10002659 Ga0105238_100026595 404
990 3300031250 Ga0265331_10046688 Ga0265331_100466882 411
991 3300031711 Ga0265314_10017398 Ga0265314_100173982 411
992 3300031712 Ga0265342_10002383 Ga0265342_100023838 411
993 3300037466 Ga0395898_0147538 Ga0395898_0147538_220_1476 411
994 3300005530 Ga0070679_100094456 Ga0070679_1000944562 414
995 3300013104 Ga0157370_10202043 Ga0157370_102020432 414
996 3300033442 Ga0315911_1000002 Ga0315911_100000225 417
997 iso_pu_bacteria 2513237096 2513654195 417
998 iso_pu_bacteria 2513237145 2513918535 417
999 iso_pu_bacteria 2517572143 2517891229 417
1000 iso_pu_bacteria 2667528175 2671123164 417
1001 iso_pu_bacteria 3005474847 3005481375 417
1002 3300005439 Ga0070711_100013974 Ga0070711_1000139742 418
1003 3300001979 JGI24740J21852_10004915 JGI24740J21852_100049153 422
1004 3300005455 Ga0070663_100015280 Ga0070663_1000152802 422
1005 3300005539 Ga0068853_100007930 Ga0068853_1000079306 422
1006 3300005577 Ga0068857_100050153 Ga0068857_1000501533 422
1007 3300005614 Ga0068856_100001867 Ga0068856_10000186715 422
1008 3300005616 Ga0068852_100014573 Ga0068852_1000145735 422
1009 3300005834 Ga0068851_10000250 Ga0068851_1000025016 422
1010 3300009093 Ga0105240_10016971 Ga0105240_100169718 422
1011 3300009174 Ga0105241_10005015 Ga0105241_100050155 422
1012 3300009551 Ga0105238_10006063 Ga0105238_1000606311 422
1013 3300025911 Ga0207654_10000634 Ga0207654_1000063411 422
1014 3300025913 Ga0207695_10002936 Ga0207695_100029369 422
1015 3300025924 Ga0207694_10000119 Ga0207694_1000011925 422
1016 3300026041 Ga0207639_10005470 Ga0207639_100054707 422
1017 3300026078 Ga0207702_10000002 Ga0207702_1000000225 422
1018 3300026116 Ga0207674_10009969 Ga0207674_100099698 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14759

Reductase_C

Reductase C-terminal

363

447

0.99

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

188

269

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

46

344

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 1.003 167 195
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9967 167 201
6lqc-assembly1.cif.gz_A crystal structure of cyclohexylamine oxidase from erythrobacteraceae bacterium 0.9919 169 201
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9868 26 422
1q1r-assembly1.cif.gz_A crystal structure of putidaredoxin reductase from pseudomonas putida 0.9749 27 421
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9992 169 202 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.991 168 201 3.50.50.60
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9891 137 255 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9868 167 228 3.50.50.60
af_A0A1D6HRY4_17_247_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9838 168 198 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A840GUG1-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit (EC 1.18.1.3) 0.9929 27 422 GO:0005737
GO:0016651
GO:0051213
AF-B3QHG5-F1-model_v4 deleted 0.9886 27 422
AF-A0A431R372-F1-model_v4 deleted 0.988 27 217
AF-A0A6M6JJ77-F1-model_v4 FAD-dependent oxidoreductase 0.9873 28 421 GO:0005737
GO:0016651
AF-A0A2G8MD65-F1-model_v4 deleted 0.9853 178 421

Feature Viewer

pLDDT pTM Quality
89.46 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map