F488306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 586 | 786 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100013974|Ga0070711_1000139742 |
| Length | 448 |
| Sequence | MAASHRSGRGHERRENGASQPASEERGKRHGLLLCARSRVVPMMVGPVVIVGAGHAGFQLAASLRQDGFAEPIALINDEGHLPYQRPPLSKAYLKGTGGSDSLMFRPDKFYSDQHIDLITDCAAAIDRSARKVTLASGAVLDYQHLVLATGARNRLLDIPNANLEAVRYLRTLDESEALRHLLAPDLRVVVIGAGFIGLEFAATARAKGLEVDVVELAPRVMARAVTAEISEFSQARHTSAGIRIHLGVQVTSIEADGTKVAGVSLSDGRHIPADLVVVGVGVLPNVELASAAGLPVASGIIVDDHLLTADQNISAVGDCALYASPRFGGSLRLESVQNATDHARCVAARLTGNAKVYDGLPWFWSDQGPDKLQMVGLTTGYDRVVVRGDREQGAFSAFCYRGEQLLGIESVNRAGDHMFGRRLLVAGGSITPEEAADASFDLKRALG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 25 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 30 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 31 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 35 | 2791355199 | |||
| 36 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 37 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 38 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 39 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 40 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 41 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 42 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 43 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 44 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 45 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 46 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 47 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 48 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 49 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 50 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 51 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 52 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 53 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 54 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 55 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 56 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 57 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 58 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 59 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 60 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 61 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 62 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 63 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 64 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 65 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 66 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 69 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 70 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 71 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 72 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 73 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 74 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 75 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 76 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 77 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 78 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 79 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 80 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 81 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 82 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 83 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 84 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 92 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 93 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 94 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 95 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 96 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904699407 | |||
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 111 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 112 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 113 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 114 | 2922368715 | |||
| 115 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 116 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 117 | 2922425934 | |||
| 118 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 119 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 120 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 121 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 122 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 123 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 124 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 125 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 126 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 127 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 128 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 129 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 130 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 131 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 132 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 133 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 134 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 135 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 136 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 137 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 138 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 139 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 140 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 141 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 142 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 143 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 144 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 145 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 146 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 147 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 148 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 149 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 150 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 151 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 152 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 153 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 154 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 155 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 156 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 157 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 158 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 159 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 160 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 161 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 162 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 163 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 164 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 165 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 166 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 167 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 168 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 169 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 170 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 171 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 172 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 173 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 174 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 175 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 176 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 177 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 178 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 179 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 180 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 181 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 182 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 183 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 184 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 185 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 186 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 187 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 188 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 189 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 190 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 191 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 192 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 193 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 194 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 195 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 196 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 198 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 199 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 201 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 202 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 203 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 210 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 220 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 223 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 225 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 227 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 228 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 229 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 230 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 231 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 232 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 233 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 234 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 235 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 236 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 237 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 238 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 239 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 241 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 242 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 243 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 247 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 248 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 250 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 251 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 252 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 253 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 254 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 255 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 266 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 281 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 282 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 283 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 284 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 285 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 286 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 287 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 288 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 289 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 293 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 295 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 342 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 343 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 344 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 351 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 352 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 353 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 354 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 355 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 356 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 357 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 358 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 359 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 360 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 361 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 362 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 363 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 364 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 365 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 366 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 367 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 368 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 369 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 370 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 371 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 372 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 373 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 374 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 375 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 376 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 377 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 378 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 379 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 380 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 381 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 382 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 383 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 384 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 385 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 386 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 387 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 388 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 389 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 390 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 391 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 392 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 393 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 394 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 395 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 396 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 397 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 398 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 399 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 400 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 401 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 402 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 403 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 404 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 405 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 406 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 469 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 471 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 472 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 473 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 474 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 475 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 476 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 479 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 480 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 481 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 482 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 483 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 484 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 485 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 486 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 487 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 488 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 489 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 490 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 491 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 492 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 515 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 518 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 520 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 523 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 524 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 525 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 527 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 528 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 530 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 531 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 532 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 533 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 534 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 535 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 536 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 537 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 538 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 539 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 540 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 541 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 542 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 543 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 544 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 545 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 546 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 547 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 548 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 549 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 550 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 551 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 552 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 553 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 554 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 555 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 556 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 557 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 558 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 559 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 560 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 561 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 562 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 563 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 564 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 565 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 566 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 567 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 568 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 569 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 570 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 571 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 572 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 573 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 574 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 575 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 576 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 577 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 578 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 579 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 580 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 581 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 582 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 583 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 584 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 585 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 586 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.49 |
| Metatranscriptomes | 0.1 |
| Isolates | 22.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.86 |
| Nodule | 18.37 |
| Rhizoplane | 5.99 |
| Rhizosphere | 54.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004915 | 3300001979 | Bacteria | 5689 |
| 2 | JGI24739J22299_10002391 | 3300001989 | Bacteria | 7241 |
| 3 | JGI24737J22298_10008032 | 3300001990 | Bacteria | 3546 |
| 4 | JGI25153J46596_10005337 | 3300003215 | Bacteria | 6755 |
| 5 | rootL2_10160148 | 3300003322 | Bacteria | 2053 |
| 6 | JGI25160J50197_1011835 | 3300003354 | Bacteria | 3064 |
| 7 | JGI25404J52841_10009163 | 3300003659 | Bacteria | 2115 |
| 8 | Ga0055531_10006567 | 3300003794 | Bacteria | 6572 |
| 9 | Ga0055543_1000462 | 3300004625 | Bacteria | 24016 |
| 10 | Ga0055543_1001763 | 3300004625 | Bacteria | 8077 |
| 11 | Ga0065165_1000799 | 3300005262 | Bacteria | 42051 |
| 12 | Ga0065165_1002416 | 3300005262 | Bacteria | 15929 |
| 13 | Ga0065165_1002642 | 3300005262 | Bacteria | 14515 |
| 14 | Ga0065165_1006433 | 3300005262 | Bacteria | 6161 |
| 15 | Ga0070658_10048283 | 3300005327 | Bacteria | 3446 |
| 16 | Ga0070683_100005122 | 3300005329 | Bacteria | 10899 |
| 17 | Ga0070680_100009353 | 3300005336 | Bacteria | 7529 |
| 18 | Ga0070680_100162926 | 3300005336 | Bacteria | 1874 |
| 19 | Ga0068868_100053615 | 3300005338 | Bacteria | 3177 |
| 20 | Ga0070660_100018873 | 3300005339 | Bacteria | 5048 |
| 21 | Ga0070668_100026976 | 3300005347 | Bacteria | 4360 |
| 22 | Ga0070668_100082935 | 3300005347 | Bacteria | 2515 |
| 23 | Ga0070668_100229075 | 3300005347 | Bacteria | 1535 |
| 24 | Ga0070675_100167579 | 3300005354 | Bacteria | 1893 |
| 25 | Ga0070671_100019025 | 3300005355 | Bacteria | 5586 |
| 26 | Ga0070671_100154588 | 3300005355 | Bacteria | 1938 |
| 27 | Ga0070674_100011327 | 3300005356 | Bacteria | 5427 |
| 28 | Ga0070673_100042244 | 3300005364 | Bacteria | 3514 |
| 29 | Ga0070688_100028924 | 3300005365 | Bacteria | 3313 |
| 30 | Ga0070659_100065131 | 3300005366 | Bacteria | 2886 |
| 31 | Ga0070667_100053462 | 3300005367 | Bacteria | 3408 |
| 32 | Ga0070709_10001228 | 3300005434 | Bacteria | 14056 |
| 33 | Ga0070709_10115955 | 3300005434 | Bacteria | 1807 |
| 34 | Ga0070709_10160673 | 3300005434 | Bacteria | 1562 |
| 35 | Ga0070714_100006930 | 3300005435 | Bacteria | 8786 |
| 36 | Ga0070714_100012311 | 3300005435 | Bacteria | 6825 |
| 37 | Ga0070714_100083680 | 3300005435 | Bacteria | 2783 |
| 38 | Ga0070714_100264909 | 3300005435 | Bacteria | 1592 |
| 39 | Ga0070713_100019837 | 3300005436 | Bacteria | 5145 |
| 40 | Ga0070713_100099622 | 3300005436 | Bacteria | 2514 |
| 41 | Ga0070713_100155497 | 3300005436 | Bacteria | 2038 |
| 42 | Ga0070713_100252074 | 3300005436 | Bacteria | 1610 |
| 43 | Ga0070713_100340281 | 3300005436 | Bacteria | 1390 |
| 44 | Ga0070710_10000929 | 3300005437 | Bacteria | 13965 |
| 45 | Ga0070711_100005942 | 3300005439 | Bacteria | 7326 |
| 46 | Ga0070711_100013974 | 3300005439 | Bacteria | 5050 |
| 47 | Ga0070711_100015536 | 3300005439 | Bacteria | 4819 |
| 48 | Ga0070711_100039484 | 3300005439 | Bacteria | 3180 |
| 49 | Ga0070711_100043582 | 3300005439 | Bacteria | 3040 |
| 50 | Ga0070711_100072675 | 3300005439 | Bacteria | 2427 |
| 51 | Ga0070663_100008307 | 3300005455 | Bacteria | 6379 |
| 52 | Ga0070663_100010106 | 3300005455 | Bacteria | 5870 |
| 53 | Ga0070663_100015280 | 3300005455 | Bacteria | 4951 |
| 54 | Ga0070663_100035288 | 3300005455 | Bacteria | 3469 |
| 55 | Ga0070663_100080401 | 3300005455 | Bacteria | 2393 |
| 56 | Ga0070662_100010158 | 3300005457 | Bacteria | 6169 |
| 57 | Ga0070681_10037204 | 3300005458 | Bacteria | 4885 |
| 58 | Ga0070681_10076829 | 3300005458 | Bacteria | 3297 |
| 59 | Ga0070681_10088746 | 3300005458 | Bacteria | 3043 |
| 60 | Ga0070681_10094083 | 3300005458 | Bacteria | 2945 |
| 61 | Ga0070707_100312288 | 3300005468 | Bacteria | 1528 |
| 62 | Ga0070699_100171307 | 3300005518 | Bacteria | 1924 |
| 63 | Ga0070679_100032475 | 3300005530 | Bacteria | 5164 |
| 64 | Ga0070679_100058920 | 3300005530 | Bacteria | 3827 |
| 65 | Ga0070679_100094456 | 3300005530 | Bacteria | 2977 |
| 66 | Ga0070684_100015626 | 3300005535 | Bacteria | 6190 |
| 67 | Ga0070684_100017917 | 3300005535 | Bacteria | 5821 |
| 68 | Ga0070684_100033654 | 3300005535 | Bacteria | 4377 |
| 69 | Ga0068853_100007930 | 3300005539 | Bacteria | 8513 |
| 70 | Ga0068853_100022387 | 3300005539 | Bacteria | 5278 |
| 71 | Ga0068853_100137259 | 3300005539 | Bacteria | 2193 |
| 72 | Ga0068853_100210070 | 3300005539 | Bacteria | 1774 |
| 73 | Ga0068853_100268660 | 3300005539 | Bacteria | 1570 |
| 74 | Ga0070665_100016320 | 3300005548 | Bacteria | 7448 |
| 75 | Ga0070665_100051187 | 3300005548 | Bacteria | 4142 |
| 76 | Ga0068855_100012869 | 3300005563 | Bacteria | 10096 |
| 77 | Ga0068855_100021640 | 3300005563 | Bacteria | 7714 |
| 78 | Ga0068855_100059343 | 3300005563 | Bacteria | 4476 |
| 79 | Ga0068857_100015877 | 3300005577 | Bacteria | 6590 |
| 80 | Ga0068857_100050153 | 3300005577 | Bacteria | 3703 |
| 81 | Ga0068856_100001803 | 3300005614 | Bacteria | 22366 |
| 82 | Ga0068856_100001867 | 3300005614 | Bacteria | 21986 |
| 83 | Ga0068856_100019754 | 3300005614 | Bacteria | 6537 |
| 84 | Ga0068852_100014573 | 3300005616 | Bacteria | 6058 |
| 85 | Ga0068852_100063882 | 3300005616 | Bacteria | 3207 |
| 86 | Ga0068859_100053671 | 3300005617 | Bacteria | 4054 |
| 87 | Ga0068851_10000250 | 3300005834 | Bacteria | 25377 |
| 88 | Ga0068851_10042123 | 3300005834 | Bacteria | 2298 |
| 89 | Ga0068863_100231921 | 3300005841 | Bacteria | 1781 |
| 90 | Ga0068863_100294077 | 3300005841 | Bacteria | 1574 |
| 91 | Ga0068858_100018788 | 3300005842 | Bacteria | 6466 |
| 92 | Ga0068860_100005407 | 3300005843 | Bacteria | 12960 |
| 93 | Ga0068860_100123813 | 3300005843 | Bacteria | 2478 |
| 94 | Ga0068862_100057926 | 3300005844 | Bacteria | 3323 |
| 95 | Ga0081455_10002800 | 3300005937 | Bacteria | 20533 |
| 96 | Ga0081455_10008855 | 3300005937 | Bacteria | 10411 |
| 97 | Ga0081455_10037499 | 3300005937 | Bacteria | 4304 |
| 98 | Ga0081455_10056307 | 3300005937 | Bacteria | 3340 |
| 99 | Ga0081455_10061238 | 3300005937 | Bacteria | 3168 |
| 100 | Ga0081455_10108720 | 3300005937 | Bacteria | 2208 |
| 101 | Ga0081540_1000178 | 3300005983 | Bacteria | 66386 |
| 102 | Ga0081540_1001968 | 3300005983 | Bacteria | 17139 |
| 103 | Ga0081540_1011207 | 3300005983 | Bacteria | 6010 |
| 104 | Ga0081540_1012098 | 3300005983 | Bacteria | 5709 |
| 105 | Ga0081540_1018972 | 3300005983 | Bacteria | 4200 |
| 106 | Ga0081540_1019008 | 3300005983 | Bacteria | 4194 |
| 107 | Ga0081540_1021450 | 3300005983 | Bacteria | 3845 |
| 108 | Ga0081540_1021620 | 3300005983 | Bacteria | 3823 |
| 109 | Ga0081540_1040971 | 3300005983 | Bacteria | 2407 |
| 110 | Ga0081540_1043139 | 3300005983 | Bacteria | 2318 |
| 111 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 112 | Ga0070717_10005875 | 3300006028 | Bacteria | 8987 |
| 113 | Ga0070717_10012278 | 3300006028 | Bacteria | 6529 |
| 114 | Ga0070717_10058625 | 3300006028 | Bacteria | 3184 |
| 115 | Ga0070717_10094177 | 3300006028 | Bacteria | 2533 |
| 116 | Ga0075365_10018146 | 3300006038 | Bacteria | 4320 |
| 117 | Ga0075368_10011128 | 3300006042 | Bacteria | 3269 |
| 118 | Ga0075363_100018753 | 3300006048 | Bacteria | 3451 |
| 119 | Ga0075363_100072104 | 3300006048 | Bacteria | 1878 |
| 120 | Ga0070715_10003054 | 3300006163 | Bacteria | 5249 |
| 121 | Ga0070716_100004705 | 3300006173 | Bacteria | 6546 |
| 122 | Ga0070716_100012347 | 3300006173 | Bacteria | 4328 |
| 123 | Ga0070712_100005481 | 3300006175 | Bacteria | 7854 |
| 124 | Ga0070712_100006535 | 3300006175 | Bacteria | 7235 |
| 125 | Ga0070712_100044651 | 3300006175 | Bacteria | 3056 |
| 126 | Ga0070712_100054530 | 3300006175 | Bacteria | 2795 |
| 127 | Ga0075370_10003000 | 3300006353 | Bacteria | 7950 |
| 128 | Ga0075370_10042424 | 3300006353 | Bacteria | 2570 |
| 129 | Ga0068871_100080431 | 3300006358 | Bacteria | 2698 |
| 130 | Ga0097620_100053665 | 3300006931 | Bacteria | 4054 |
| 131 | Ga0099825_1030562 | 3300006941 | Bacteria | 2374 |
| 132 | Ga0099824_1004802 | 3300006942 | Bacteria | 19329 |
| 133 | Ga0099824_1020023 | 3300006942 | Bacteria | 5032 |
| 134 | Ga0099822_1001244 | 3300006943 | Bacteria | 29011 |
| 135 | Ga0099823_1042587 | 3300006944 | Bacteria | 3170 |
| 136 | Ga0099794_10005646 | 3300007265 | Bacteria | 5036 |
| 137 | Ga0099794_10007699 | 3300007265 | Bacteria | 4440 |
| 138 | Ga0099794_10101182 | 3300007265 | Bacteria | 1438 |
| 139 | Ga0099795_10002778 | 3300007788 | Bacteria | 4209 |
| 140 | Ga0105240_10016329 | 3300009093 | Bacteria | 10056 |
| 141 | Ga0105240_10016971 | 3300009093 | Bacteria | 9835 |
| 142 | Ga0105240_10075310 | 3300009093 | Bacteria | 4163 |
| 143 | Ga0111539_10083826 | 3300009094 | Bacteria | 3748 |
| 144 | Ga0111539_10135696 | 3300009094 | Bacteria | 2882 |
| 145 | Ga0105245_10051090 | 3300009098 | Bacteria | 3706 |
| 146 | Ga0105245_10171978 | 3300009098 | Bacteria | 2063 |
| 147 | Ga0105245_10310676 | 3300009098 | Bacteria | 1550 |
| 148 | Ga0105247_10033772 | 3300009101 | Bacteria | 3114 |
| 149 | Ga0114129_10090903 | 3300009147 | Bacteria | 4230 |
| 150 | Ga0105243_10142575 | 3300009148 | Bacteria | 2046 |
| 151 | Ga0105241_10005015 | 3300009174 | Bacteria | 9775 |
| 152 | Ga0105241_10039748 | 3300009174 | Bacteria | 3550 |
| 153 | Ga0105241_10085631 | 3300009174 | Bacteria | 2477 |
| 154 | Ga0105248_10077527 | 3300009177 | Bacteria | 3736 |
| 155 | Ga0105248_10078907 | 3300009177 | Bacteria | 3700 |
| 156 | Ga0105248_10244393 | 3300009177 | Bacteria | 2020 |
| 157 | Ga0105248_10267166 | 3300009177 | Bacteria | 1926 |
| 158 | Ga0105237_10037283 | 3300009545 | Bacteria | 4916 |
| 159 | Ga0105237_10058475 | 3300009545 | Bacteria | 3858 |
| 160 | Ga0105237_10064196 | 3300009545 | Bacteria | 3668 |
| 161 | Ga0105237_10205408 | 3300009545 | Bacteria | 1970 |
| 162 | Ga0105238_10002659 | 3300009551 | Bacteria | 17766 |
| 163 | Ga0105238_10006063 | 3300009551 | Bacteria | 11992 |
| 164 | Ga0105238_10009836 | 3300009551 | Bacteria | 9579 |
| 165 | Ga0105238_10298165 | 3300009551 | Bacteria | 1595 |
| 166 | Ga0105238_10407541 | 3300009551 | Bacteria | 1353 |
| 167 | Ga0099796_10011117 | 3300010159 | Bacteria | 2500 |
| 168 | Ga0099796_10013869 | 3300010159 | Bacteria | 2313 |
| 169 | Ga0105239_10003585 | 3300010375 | Bacteria | 18979 |
| 170 | Ga0105239_10003896 | 3300010375 | Bacteria | 18087 |
| 171 | Ga0105239_10017767 | 3300010375 | Bacteria | 7867 |
| 172 | Ga0105239_10021644 | 3300010375 | Bacteria | 7089 |
| 173 | Ga0105239_10027720 | 3300010375 | Bacteria | 6233 |
| 174 | Ga0105239_10059197 | 3300010375 | Bacteria | 4205 |
| 175 | Ga0105239_10103968 | 3300010375 | Bacteria | 3144 |
| 176 | Ga0105239_10431802 | 3300010375 | Bacteria | 1493 |
| 177 | Ga0105246_10027867 | 3300011119 | Bacteria | 3707 |
| 178 | Ga0157373_10052924 | 3300013100 | Bacteria | 2887 |
| 179 | Ga0157370_10059165 | 3300013104 | Bacteria | 3642 |
| 180 | Ga0157370_10202043 | 3300013104 | Bacteria | 1843 |
| 181 | Ga0157369_10030087 | 3300013105 | Bacteria | 5992 |
| 182 | Ga0157369_10047249 | 3300013105 | Bacteria | 4675 |
| 183 | Ga0157374_10087900 | 3300013296 | Bacteria | 2959 |
| 184 | Ga0157374_10199027 | 3300013296 | Bacteria | 1961 |
| 185 | Ga0157378_10004346 | 3300013297 | Bacteria | 12466 |
| 186 | Ga0157378_10078233 | 3300013297 | Bacteria | 2983 |
| 187 | Ga0163162_10069584 | 3300013306 | Bacteria | 3571 |
| 188 | Ga0157375_10054992 | 3300013308 | Bacteria | 3922 |
| 189 | Ga0157375_10121305 | 3300013308 | Bacteria | 2724 |
| 190 | Ga0157375_10214264 | 3300013308 | Bacteria | 2084 |
| 191 | Ga0163163_10052220 | 3300014325 | Bacteria | 4032 |
| 192 | Ga0163163_10160664 | 3300014325 | Bacteria | 2292 |
| 193 | Ga0163163_10185491 | 3300014325 | Bacteria | 2128 |
| 194 | Ga0157377_10015118 | 3300014745 | Bacteria | 3939 |
| 195 | Ga0157379_10026231 | 3300014968 | Bacteria | 5186 |
| 196 | Ga0157379_10287761 | 3300014968 | Bacteria | 1496 |
| 197 | Ga0157376_10037246 | 3300014969 | Bacteria | 3946 |
| 198 | Ga0163161_10039459 | 3300017792 | Bacteria | 3390 |
| 199 | Ga0197907_10707499 | 3300020069 | Bacteria | 1816 |
| 200 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 201 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 202 | Ga0214542_1000879 | 3300021321 | Bacteria | 58206 |
| 203 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 204 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 205 | Ga0213874_10003673 | 3300021377 | Bacteria | 3433 |
| 206 | Ga0213876_10005607 | 3300021384 | Bacteria | 6890 |
| 207 | Ga0213875_10000382 | 3300021388 | Bacteria | 39987 |
| 208 | Ga0213875_10000390 | 3300021388 | Bacteria | 39140 |
| 209 | Ga0213875_10003220 | 3300021388 | Bacteria | 9371 |
| 210 | Ga0213871_10003817 | 3300021441 | Bacteria | 2951 |
| 211 | Ga0209148_1000462 | 3300025254 | Bacteria | 43711 |
| 212 | Ga0209233_1002214 | 3300025261 | Bacteria | 7295 |
| 213 | Ga0209455_1009328 | 3300025272 | Bacteria | 2588 |
| 214 | Ga0209455_1014740 | 3300025272 | Bacteria | 1754 |
| 215 | Ga0209564_1005201 | 3300025295 | Bacteria | 7533 |
| 216 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 217 | Ga0209758_1000845 | 3300025297 | Bacteria | 42737 |
| 218 | Ga0209758_1003253 | 3300025297 | Bacteria | 15067 |
| 219 | Ga0209758_1008620 | 3300025297 | Bacteria | 6550 |
| 220 | Ga0209758_1032205 | 3300025297 | Bacteria | 2133 |
| 221 | Ga0209256_1008471 | 3300025299 | Bacteria | 4761 |
| 222 | Ga0209256_1012600 | 3300025299 | Bacteria | 3213 |
| 223 | Ga0207426_1000228 | 3300025302 | Bacteria | 129261 |
| 224 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 225 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 226 | Ga0207426_1010723 | 3300025302 | Bacteria | 3540 |
| 227 | Ga0209257_1001242 | 3300025304 | Bacteria | 31529 |
| 228 | Ga0209257_1018129 | 3300025304 | Bacteria | 2730 |
| 229 | Ga0207656_10029312 | 3300025321 | Bacteria | 2266 |
| 230 | Ga0207653_10032516 | 3300025885 | Bacteria | 1688 |
| 231 | Ga0207692_10001555 | 3300025898 | Bacteria | 8634 |
| 232 | Ga0207692_10029149 | 3300025898 | Bacteria | 2620 |
| 233 | Ga0207688_10031893 | 3300025901 | Bacteria | 2910 |
| 234 | Ga0207647_10000496 | 3300025904 | Bacteria | 31496 |
| 235 | Ga0207647_10017643 | 3300025904 | Bacteria | 4850 |
| 236 | Ga0207699_10000605 | 3300025906 | Bacteria | 17554 |
| 237 | Ga0207699_10002358 | 3300025906 | Bacteria | 8919 |
| 238 | Ga0207699_10008980 | 3300025906 | Bacteria | 4955 |
| 239 | Ga0207699_10063547 | 3300025906 | Bacteria | 2230 |
| 240 | Ga0207705_10097865 | 3300025909 | Bacteria | 2155 |
| 241 | Ga0207705_10158797 | 3300025909 | Bacteria | 1698 |
| 242 | Ga0207654_10000634 | 3300025911 | Bacteria | 19851 |
| 243 | Ga0207707_10002844 | 3300025912 | Bacteria | 15450 |
| 244 | Ga0207707_10007520 | 3300025912 | Bacteria | 9493 |
| 245 | Ga0207707_10008335 | 3300025912 | Bacteria | 8992 |
| 246 | Ga0207707_10133882 | 3300025912 | Bacteria | 2167 |
| 247 | Ga0207707_10161806 | 3300025912 | Bacteria | 1957 |
| 248 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 249 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 250 | Ga0207695_10002936 | 3300025913 | Bacteria | 24601 |
| 251 | Ga0207695_10011660 | 3300025913 | Bacteria | 10622 |
| 252 | Ga0207695_10046333 | 3300025913 | Bacteria | 4609 |
| 253 | Ga0207695_10068273 | 3300025913 | Bacteria | 3642 |
| 254 | Ga0207695_10089987 | 3300025913 | Bacteria | 3085 |
| 255 | Ga0207671_10060370 | 3300025914 | Bacteria | 2813 |
| 256 | Ga0207671_10088927 | 3300025914 | Bacteria | 2324 |
| 257 | Ga0207693_10000085 | 3300025915 | Bacteria | 83879 |
| 258 | Ga0207693_10005576 | 3300025915 | Bacteria | 10474 |
| 259 | Ga0207693_10009623 | 3300025915 | Bacteria | 7870 |
| 260 | Ga0207693_10020299 | 3300025915 | Bacteria | 5286 |
| 261 | Ga0207693_10059873 | 3300025915 | Bacteria | 2983 |
| 262 | Ga0207693_10060930 | 3300025915 | Bacteria | 2956 |
| 263 | Ga0207693_10070878 | 3300025915 | Bacteria | 2727 |
| 264 | Ga0207693_10264604 | 3300025915 | Bacteria | 1348 |
| 265 | Ga0207663_10000739 | 3300025916 | Bacteria | 14580 |
| 266 | Ga0207663_10003946 | 3300025916 | Bacteria | 7338 |
| 267 | Ga0207663_10009965 | 3300025916 | Bacteria | 5032 |
| 268 | Ga0207660_10023909 | 3300025917 | Bacteria | 4131 |
| 269 | Ga0207660_10068885 | 3300025917 | Bacteria | 2568 |
| 270 | Ga0207662_10106494 | 3300025918 | Bacteria | 1744 |
| 271 | Ga0207657_10003303 | 3300025919 | Bacteria | 17242 |
| 272 | Ga0207657_10016929 | 3300025919 | Bacteria | 7015 |
| 273 | Ga0207649_10027939 | 3300025920 | Bacteria | 3317 |
| 274 | Ga0207652_10026123 | 3300025921 | Bacteria | 4860 |
| 275 | Ga0207652_10045400 | 3300025921 | Bacteria | 3746 |
| 276 | Ga0207652_10115771 | 3300025921 | Bacteria | 2381 |
| 277 | Ga0207646_10258566 | 3300025922 | Bacteria | 1574 |
| 278 | Ga0207694_10000119 | 3300025924 | Bacteria | 83771 |
| 279 | Ga0207694_10003295 | 3300025924 | Bacteria | 12847 |
| 280 | Ga0207694_10005677 | 3300025924 | Bacteria | 9572 |
| 281 | Ga0207694_10180364 | 3300025924 | Bacteria | 1712 |
| 282 | Ga0207694_10241511 | 3300025924 | Bacteria | 1476 |
| 283 | Ga0207687_10018479 | 3300025927 | Bacteria | 4603 |
| 284 | Ga0207687_10062646 | 3300025927 | Bacteria | 2631 |
| 285 | Ga0207687_10076825 | 3300025927 | Bacteria | 2400 |
| 286 | Ga0207700_10003531 | 3300025928 | Bacteria | 9108 |
| 287 | Ga0207700_10011210 | 3300025928 | Bacteria | 5706 |
| 288 | Ga0207700_10011837 | 3300025928 | Bacteria | 5587 |
| 289 | Ga0207700_10045438 | 3300025928 | Bacteria | 3241 |
| 290 | Ga0207700_10069649 | 3300025928 | Bacteria | 2701 |
| 291 | Ga0207664_10005139 | 3300025929 | Bacteria | 8917 |
| 292 | Ga0207664_10159233 | 3300025929 | Bacteria | 1924 |
| 293 | Ga0207644_10155132 | 3300025931 | Bacteria | 1775 |
| 294 | Ga0207690_10164031 | 3300025932 | Bacteria | 1659 |
| 295 | Ga0207706_10041553 | 3300025933 | Bacteria | 4076 |
| 296 | Ga0207665_10000066 | 3300025939 | Bacteria | 68434 |
| 297 | Ga0207665_10004190 | 3300025939 | Bacteria | 9594 |
| 298 | Ga0207665_10042629 | 3300025939 | Bacteria | 3034 |
| 299 | Ga0207665_10209318 | 3300025939 | Bacteria | 1424 |
| 300 | Ga0207691_10059114 | 3300025940 | Bacteria | 3486 |
| 301 | Ga0207689_10013332 | 3300025942 | Bacteria | 7013 |
| 302 | Ga0207661_10000917 | 3300025944 | Bacteria | 19380 |
| 303 | Ga0207661_10023556 | 3300025944 | Bacteria | 4653 |
| 304 | Ga0207661_10046472 | 3300025944 | Bacteria | 3443 |
| 305 | Ga0207667_10003981 | 3300025949 | Bacteria | 18159 |
| 306 | Ga0207667_10021239 | 3300025949 | Bacteria | 7197 |
| 307 | Ga0207667_10033464 | 3300025949 | Bacteria | 5525 |
| 308 | Ga0207667_10201110 | 3300025949 | Bacteria | 2044 |
| 309 | Ga0207651_10207135 | 3300025960 | Bacteria | 1576 |
| 310 | Ga0207677_10098362 | 3300026023 | Bacteria | 2146 |
| 311 | Ga0207703_10026127 | 3300026035 | Bacteria | 4594 |
| 312 | Ga0207703_10128295 | 3300026035 | Bacteria | 2187 |
| 313 | Ga0207703_10205158 | 3300026035 | Bacteria | 1754 |
| 314 | Ga0207639_10004828 | 3300026041 | Bacteria | 9091 |
| 315 | Ga0207639_10005470 | 3300026041 | Bacteria | 8583 |
| 316 | Ga0207639_10058471 | 3300026041 | Bacteria | 2965 |
| 317 | Ga0207639_10158117 | 3300026041 | Bacteria | 1906 |
| 318 | Ga0207678_10010709 | 3300026067 | Bacteria | 8055 |
| 319 | Ga0207678_10020027 | 3300026067 | Bacteria | 5877 |
| 320 | Ga0207678_10026116 | 3300026067 | Bacteria | 5096 |
| 321 | Ga0207678_10047784 | 3300026067 | Bacteria | 3700 |
| 322 | Ga0207678_10055282 | 3300026067 | Bacteria | 3419 |
| 323 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 324 | Ga0207702_10001708 | 3300026078 | Bacteria | 21655 |
| 325 | Ga0207702_10008470 | 3300026078 | Bacteria | 8673 |
| 326 | Ga0207702_10111571 | 3300026078 | Bacteria | 2432 |
| 327 | Ga0207702_10301380 | 3300026078 | Bacteria | 1521 |
| 328 | Ga0207641_10296379 | 3300026088 | Bacteria | 1526 |
| 329 | Ga0207648_10010213 | 3300026089 | Bacteria | 8930 |
| 330 | Ga0207674_10006543 | 3300026116 | Bacteria | 13703 |
| 331 | Ga0207674_10009969 | 3300026116 | Bacteria | 10811 |
| 332 | Ga0207674_10023678 | 3300026116 | Bacteria | 6573 |
| 333 | Ga0207675_100069671 | 3300026118 | Bacteria | 3287 |
| 334 | Ga0207675_100377031 | 3300026118 | Bacteria | 1394 |
| 335 | Ga0207683_10117952 | 3300026121 | Bacteria | 2380 |
| 336 | Ga0207698_10029719 | 3300026142 | Bacteria | 3918 |
| 337 | Ga0207698_10124851 | 3300026142 | Bacteria | 2187 |
| 338 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 339 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 340 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 341 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 342 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 343 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 344 | Ga0209489_101114 | 3300027361 | Bacteria | 54578 |
| 345 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 346 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 347 | Ga0209179_1002935 | 3300027512 | Bacteria | 2382 |
| 348 | Ga0209588_1005193 | 3300027671 | Bacteria | 3717 |
| 349 | Ga0209813_10006595 | 3300027866 | Bacteria | 2873 |
| 350 | Ga0268266_10014609 | 3300028379 | Bacteria | 6747 |
| 351 | Ga0268266_10055520 | 3300028379 | Bacteria | 3405 |
| 352 | Ga0268266_10163085 | 3300028379 | Bacteria | 2018 |
| 353 | Ga0268266_10200158 | 3300028379 | Bacteria | 1828 |
| 354 | Ga0268265_10017139 | 3300028380 | Bacteria | 4991 |
| 355 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 356 | Ga0265337_1007120 | 3300028556 | Bacteria | 4223 |
| 357 | Ga0265319_1017390 | 3300028563 | Bacteria | 2734 |
| 358 | Ga0265334_10007339 | 3300028573 | Bacteria | 4730 |
| 359 | Ga0265323_10001453 | 3300028653 | Bacteria | 11630 |
| 360 | Ga0265336_10000251 | 3300028666 | Bacteria | 38092 |
| 361 | Ga0307517_10000386 | 3300028786 | Bacteria | 75442 |
| 362 | Ga0307515_10017392 | 3300028794 | Bacteria | 13100 |
| 363 | Ga0265338_10000582 | 3300028800 | Bacteria | 64301 |
| 364 | Ga0265324_10011228 | 3300029957 | Bacteria | 3419 |
| 365 | Ga0265330_10007549 | 3300031235 | Bacteria | 5291 |
| 366 | Ga0265330_10009772 | 3300031235 | Bacteria | 4545 |
| 367 | Ga0265332_10047350 | 3300031238 | Bacteria | 1850 |
| 368 | Ga0265325_10015246 | 3300031241 | Bacteria | 4325 |
| 369 | Ga0265339_10012020 | 3300031249 | Bacteria | 5306 |
| 370 | Ga0265339_10016403 | 3300031249 | Bacteria | 4416 |
| 371 | Ga0265339_10065301 | 3300031249 | Bacteria | 1951 |
| 372 | Ga0265331_10046688 | 3300031250 | Bacteria | 2087 |
| 373 | Ga0307513_10216665 | 3300031456 | Bacteria | 1740 |
| 374 | Ga0307509_10029551 | 3300031507 | Bacteria | 6080 |
| 375 | Ga0307509_10099121 | 3300031507 | Bacteria | 2956 |
| 376 | Ga0307508_10023817 | 3300031616 | Bacteria | 5559 |
| 377 | Ga0307508_10078529 | 3300031616 | Bacteria | 2881 |
| 378 | Ga0307508_10099956 | 3300031616 | Bacteria | 2495 |
| 379 | Ga0307508_10100608 | 3300031616 | Bacteria | 2485 |
| 380 | Ga0265314_10010113 | 3300031711 | Bacteria | 7906 |
| 381 | Ga0265314_10017398 | 3300031711 | Bacteria | 5645 |
| 382 | Ga0265342_10002383 | 3300031712 | Bacteria | 16284 |
| 383 | Ga0307516_10010095 | 3300031730 | Bacteria | 10442 |
| 384 | Ga0307516_10038399 | 3300031730 | Bacteria | 4779 |
| 385 | Ga0307516_10180578 | 3300031730 | Bacteria | 1844 |
| 386 | Ga0307516_10183224 | 3300031730 | Bacteria | 1826 |
| 387 | Ga0307415_100150974 | 3300032126 | Bacteria | 1788 |
| 388 | Ga0307510_10017574 | 3300033180 | Bacteria | 8432 |
| 389 | Ga0307510_10055165 | 3300033180 | Bacteria | 4153 |
| 390 | Ga0307510_10151640 | 3300033180 | Bacteria | 1935 |
| 391 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 392 | Ga0373926_0034888 | 3300035083 | Bacteria | 1783 |
| 393 | Ga0373934_0007901 | 3300035086 | Bacteria | 3958 |
| 394 | Ga0373936_0014396 | 3300035113 | Bacteria | 3023 |
| 395 | Ga0373953_0000506 | 3300035117 | Bacteria | 10848 |
| 396 | Ga0373954_0000386 | 3300035118 | Bacteria | 16413 |
| 397 | Ga0373954_0014978 | 3300035118 | Bacteria | 3462 |
| 398 | Ga0373956_0005816 | 3300035119 | Bacteria | 4931 |
| 399 | Ga0373956_0013430 | 3300035119 | Bacteria | 3406 |
| 400 | Ga0373943_0002708 | 3300035170 | Bacteria | 8046 |
| 401 | Ga0373943_0040646 | 3300035170 | Bacteria | 2246 |
| 402 | Ga0373946_0005868 | 3300035171 | Bacteria | 4447 |
| 403 | Ga0373946_0020617 | 3300035171 | Bacteria | 2549 |
| 404 | Ga0373955_0000286 | 3300035172 | Bacteria | 20971 |
| 405 | Ga0373955_0059552 | 3300035172 | Bacteria | 2103 |
| 406 | Ga0373931_0005603 | 3300035691 | Bacteria | 5822 |
| 407 | Ga0373935_0001308 | 3300035692 | Bacteria | 13756 |
| 408 | Ga0373927_0018861 | 3300035695 | Bacteria | 4526 |
| 409 | Ga0373927_0053411 | 3300035695 | Bacteria | 2614 |
| 410 | Ga0373927_0094628 | 3300035695 | Bacteria | 1941 |
| 411 | Ga0373933_0000525 | 3300035724 | Bacteria | 23898 |
| 412 | Ga0373933_0000952 | 3300035724 | Bacteria | 17650 |
| 413 | Ga0373947_0012265 | 3300035725 | Bacteria | 4910 |
| 414 | Ga0373947_0042908 | 3300035725 | Bacteria | 2700 |
| 415 | Ga0373947_0196609 | 3300035725 | Bacteria | 1318 |
| 416 | Ga0373937_0001493 | 3300036401 | Bacteria | 19622 |
| 417 | Ga0373925_0007302 | 3300037068 | Bacteria | 8072 |
| 418 | Ga0395899_0058078 | 3300037312 | Bacteria | 2854 |
| 419 | Ga0395900_0001070 | 3300037418 | Bacteria | 34841 |
| 420 | Ga0395898_0005530 | 3300037466 | Bacteria | 13635 |
| 421 | Ga0395898_0017205 | 3300037466 | Bacteria | 7384 |
| 422 | Ga0395898_0038983 | 3300037466 | Bacteria | 4705 |
| 423 | Ga0395898_0096005 | 3300037466 | Bacteria | 2848 |
| 424 | Ga0395898_0147538 | 3300037466 | Bacteria | 2251 |
| 425 | Ga0395905_0007330 | 3300037471 | Bacteria | 10988 |
| 426 | Ga0395905_0102640 | 3300037471 | Bacteria | 2685 |
| 427 | Ga0436364_0042928 | 3300037853 | Bacteria | 71182 |
| 428 | Ga0436364_0108855 | 3300037853 | Bacteria | 36564 |
| 429 | Ga0436364_0346617 | 3300037853 | Bacteria | 24321 |
| 430 | Ga0436364_0817898 | 3300037853 | Bacteria | 3234 |
| 431 | Ga0436364_1343008 | 3300037853 | Bacteria | 2668 |
| 432 | Ga0395901_0014261 | 3300038443 | Bacteria | 8091 |
| 433 | Ga0395901_0015950 | 3300038443 | Bacteria | 7653 |
| 434 | Ga0395901_0124736 | 3300038443 | Bacteria | 2706 |
| 435 | Ga0395901_0129939 | 3300038443 | Bacteria | 2647 |
| 436 | Ga0395901_0185322 | 3300038443 | Bacteria | 2183 |
| 437 | Ga0436365_0064270 | 3300039437 | Bacteria | 1714 |
| 438 | Ga0436365_0161372 | 3300039437 | Bacteria | 1921 |
| 439 | Ga0436365_0234716 | 3300039437 | Bacteria | 3747 |
| 440 | Ga0436365_0369560 | 3300039437 | Bacteria | 2372 |
| 441 | Ga0436365_0383201 | 3300039437 | Bacteria | 1661 |
| 442 | Ga0436365_0677006 | 3300039437 | Bacteria | 6765 |
| 443 | Ga0436365_1301574 | 3300039437 | Bacteria | 3498 |
| 444 | Ga0436365_1424648 | 3300039437 | Bacteria | 18159 |
| 445 | Ga0436360_0078764 | 3300039438 | Bacteria | 6661 |
| 446 | Ga0436360_0466793 | 3300039438 | Bacteria | 2383 |
| 447 | Ga0436361_1169803 | 3300039447 | Bacteria | 4792 |
| 448 | Ga0436363_0383878 | 3300039450 | Bacteria | 1576 |
| 449 | Ga0436363_0693677 | 3300039450 | Bacteria | 3554 |
| 450 | Ga0436362_0187516 | 3300039453 | Bacteria | 1755 |
| 451 | Ga0436362_0618850 | 3300039453 | Bacteria | 7570 |
| 452 | Ga0451841_0603492 | 3300041498 | Bacteria | 1342 |
| 453 | Ga0439459_0021517 | 3300042438 | Bacteria | 1240 |
| 454 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 455 | Ga0466966_0000094 | 3300044684 | Bacteria | 54427 |
| 456 | Ga0466961_0000118 | 3300044693 | Bacteria | 52882 |
| 457 | Ga0466961_0134432 | 3300044693 | Bacteria | 1550 |
| 458 | Ga0466970_0058039 | 3300044765 | Bacteria | 2071 |
| 459 | Ga0495592_0001573 | 3300046454 | Bacteria | 15952 |
| 460 | Ga0495592_0021108 | 3300046454 | Bacteria | 4952 |
| 461 | Ga0495592_0041596 | 3300046454 | Bacteria | 3444 |
| 462 | Ga0495592_0059415 | 3300046454 | Bacteria | 2816 |
| 463 | Ga0495592_0118930 | 3300046454 | Bacteria | 1861 |
| 464 | Ga0495592_0184676 | 3300046454 | Bacteria | 1418 |
| 465 | Ga0495603_0030969 | 3300046455 | Bacteria | 3221 |
| 466 | Ga0495603_0082601 | 3300046455 | Bacteria | 1882 |
| 467 | Ga0495590_0034179 | 3300046457 | Bacteria | 1776 |
| 468 | Ga0495629_0000133 | 3300046459 | Bacteria | 64806 |
| 469 | Ga0495629_0010755 | 3300046459 | Bacteria | 6656 |
| 470 | Ga0495629_0018014 | 3300046459 | Bacteria | 5061 |
| 471 | Ga0495629_0048075 | 3300046459 | Bacteria | 2991 |
| 472 | Ga0495638_0007773 | 3300046460 | Bacteria | 7657 |
| 473 | Ga0495638_0092624 | 3300046460 | Bacteria | 1819 |
| 474 | Ga0495641_0003044 | 3300046461 | Bacteria | 12816 |
| 475 | Ga0495651_0009251 | 3300046462 | Bacteria | 7559 |
| 476 | Ga0495653_0001313 | 3300046463 | Bacteria | 19271 |
| 477 | Ga0495653_0081656 | 3300046463 | Bacteria | 2388 |
| 478 | Ga0495580_0006086 | 3300046472 | Bacteria | 9874 |
| 479 | Ga0495580_0172160 | 3300046472 | Bacteria | 1497 |
| 480 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 481 | Ga0495582_0013313 | 3300046473 | Bacteria | 4529 |
| 482 | Ga0495605_0031333 | 3300046474 | Bacteria | 2717 |
| 483 | Ga0495639_0000014 | 3300046475 | Bacteria | 82866 |
| 484 | Ga0495639_0031073 | 3300046475 | Bacteria | 2376 |
| 485 | Ga0495662_0000086 | 3300046476 | Bacteria | 33465 |
| 486 | Ga0495664_0004447 | 3300046477 | Bacteria | 7671 |
| 487 | Ga0495664_0007306 | 3300046477 | Bacteria | 6130 |
| 488 | Ga0495664_0145578 | 3300046477 | Bacteria | 1437 |
| 489 | Ga0495594_0000051 | 3300046499 | Bacteria | 52030 |
| 490 | Ga0495594_0112428 | 3300046499 | Bacteria | 1536 |
| 491 | Ga0495607_0103073 | 3300046501 | Bacteria | 1525 |
| 492 | Ga0495606_0016667 | 3300046507 | Bacteria | 5590 |
| 493 | Ga0495608_0003757 | 3300046511 | Bacteria | 10900 |
| 494 | Ga0495616_0026879 | 3300046513 | Bacteria | 3057 |
| 495 | Ga0495616_0049990 | 3300046513 | Bacteria | 2093 |
| 496 | Ga0495616_0090587 | 3300046513 | Bacteria | 1448 |
| 497 | Ga0495618_0114154 | 3300046514 | Bacteria | 1729 |
| 498 | Ga0495628_0004462 | 3300046516 | Bacteria | 12408 |
| 499 | Ga0495628_0007774 | 3300046516 | Bacteria | 9242 |
| 500 | Ga0495628_0010553 | 3300046516 | Bacteria | 7841 |
| 501 | Ga0495628_0184958 | 3300046516 | Bacteria | 1575 |
| 502 | Ga0495643_0019976 | 3300046522 | Bacteria | 3869 |
| 503 | Ga0495648_0001270 | 3300046524 | Bacteria | 25160 |
| 504 | Ga0495648_0022088 | 3300046524 | Bacteria | 4391 |
| 505 | Ga0495666_0020761 | 3300046526 | Bacteria | 3252 |
| 506 | Ga0495652_0008371 | 3300046529 | Bacteria | 9446 |
| 507 | Ga0495652_0036434 | 3300046529 | Bacteria | 4278 |
| 508 | Ga0495652_0056592 | 3300046529 | Bacteria | 3329 |
| 509 | Ga0495652_0121007 | 3300046529 | Bacteria | 2088 |
| 510 | Ga0495665_0000477 | 3300046531 | Bacteria | 20160 |
| 511 | Ga0495640_0001817 | 3300046533 | Bacteria | 16924 |
| 512 | Ga0495640_0007412 | 3300046533 | Bacteria | 8626 |
| 513 | Ga0495640_0011794 | 3300046533 | Bacteria | 6706 |
| 514 | Ga0495640_0015035 | 3300046533 | Bacteria | 5832 |
| 515 | Ga0495587_0000862 | 3300046536 | Bacteria | 20057 |
| 516 | Ga0495587_0008087 | 3300046536 | Bacteria | 6782 |
| 517 | Ga0495609_0026863 | 3300046538 | Bacteria | 2634 |
| 518 | Ga0495609_0077158 | 3300046538 | Bacteria | 1459 |
| 519 | Ga0495597_0025529 | 3300046542 | Bacteria | 2720 |
| 520 | Ga0495645_0024663 | 3300046543 | Bacteria | 4364 |
| 521 | Ga0495645_0099885 | 3300046543 | Bacteria | 2064 |
| 522 | Ga0495622_0006671 | 3300046557 | Bacteria | 5354 |
| 523 | Ga0495622_0012877 | 3300046557 | Bacteria | 3878 |
| 524 | Ga0495667_0000424 | 3300046559 | Bacteria | 27001 |
| 525 | Ga0495667_0015829 | 3300046559 | Bacteria | 5098 |
| 526 | Ga0495667_0058901 | 3300046559 | Bacteria | 2521 |
| 527 | Ga0495656_0002167 | 3300046615 | Bacteria | 6489 |
| 528 | Ga0495668_0019915 | 3300046616 | Bacteria | 3860 |
| 529 | Ga0495668_0080465 | 3300046616 | Bacteria | 1788 |
| 530 | Ga0495634_0003306 | 3300046642 | Bacteria | 12988 |
| 531 | Ga0495634_0006805 | 3300046642 | Bacteria | 8651 |
| 532 | Ga0495625_0061107 | 3300046660 | Bacteria | 2667 |
| 533 | Ga0495625_0070923 | 3300046660 | Bacteria | 2446 |
| 534 | Ga0495635_0000792 | 3300046663 | Bacteria | 20615 |
| 535 | Ga0495635_0002703 | 3300046663 | Bacteria | 12140 |
| 536 | Ga0495635_0005278 | 3300046663 | Bacteria | 8985 |
| 537 | Ga0495635_0026165 | 3300046663 | Bacteria | 4063 |
| 538 | Ga0495659_0011741 | 3300046664 | Bacteria | 2825 |
| 539 | Ga0495657_0001449 | 3300046675 | Bacteria | 20519 |
| 540 | Ga0495657_0013673 | 3300046675 | Bacteria | 5978 |
| 541 | Ga0495657_0022741 | 3300046675 | Bacteria | 4486 |
| 542 | Ga0495599_0000879 | 3300046678 | Bacteria | 16765 |
| 543 | Ga0495599_0013798 | 3300046678 | Bacteria | 4999 |
| 544 | Ga0495599_0048778 | 3300046678 | Bacteria | 2655 |
| 545 | Ga0495623_0002249 | 3300046679 | Bacteria | 12858 |
| 546 | Ga0495646_0002245 | 3300046680 | Bacteria | 11802 |
| 547 | Ga0495646_0032854 | 3300046680 | Bacteria | 3227 |
| 548 | Ga0495646_0105597 | 3300046680 | Bacteria | 1609 |
| 549 | Ga0495658_0001354 | 3300046683 | Bacteria | 12855 |
| 550 | Ga0495658_0044624 | 3300046683 | Bacteria | 2485 |
| 551 | Ga0495658_0048318 | 3300046683 | Bacteria | 2399 |
| 552 | Ga0495613_0006655 | 3300046689 | Bacteria | 8632 |
| 553 | Ga0495613_0024354 | 3300046689 | Bacteria | 4510 |
| 554 | Ga0495624_0000138 | 3300046690 | Bacteria | 52220 |
| 555 | Ga0495624_0010671 | 3300046690 | Bacteria | 6327 |
| 556 | Ga0495671_0053471 | 3300046692 | Bacteria | 2004 |
| 557 | Ga0495649_0042779 | 3300046694 | Bacteria | 2474 |
| 558 | Ga0495600_0000337 | 3300046809 | Bacteria | 25017 |
| 559 | Ga0495600_0005193 | 3300046809 | Bacteria | 7827 |
| 560 | Ga0495600_0151690 | 3300046809 | Bacteria | 1500 |
| 561 | Ga0495581_0000001 | 3300047315 | Bacteria | 104278 |
| 562 | Ga0495581_0023521 | 3300047315 | Bacteria | 3570 |
| 563 | Ga0495581_0081996 | 3300047315 | Bacteria | 1868 |
| 564 | Ga0495604_0001626 | 3300047317 | Bacteria | 18533 |
| 565 | Ga0495604_0017599 | 3300047317 | Bacteria | 5722 |
| 566 | Ga0495604_0169005 | 3300047317 | Bacteria | 1539 |
| 567 | Ga0495674_0002545 | 3300047319 | Bacteria | 17760 |
| 568 | Ga0495674_0018873 | 3300047319 | Bacteria | 6414 |
| 569 | Ga0495674_0145940 | 3300047319 | Bacteria | 1986 |
| 570 | Ga0495674_0311730 | 3300047319 | Bacteria | 1284 |
| 571 | Ga0495672_0007184 | 3300047320 | Bacteria | 8418 |
| 572 | Ga0495672_0031356 | 3300047320 | Bacteria | 3319 |
| 573 | Ga0495676_0003317 | 3300047321 | Bacteria | 14549 |
| 574 | Ga0495676_0143571 | 3300047321 | Bacteria | 1708 |
| 575 | Ga0495680_0002491 | 3300047322 | Bacteria | 18828 |
| 576 | Ga0495680_0005089 | 3300047322 | Bacteria | 12405 |
| 577 | Ga0495680_0156052 | 3300047322 | Bacteria | 1660 |
| 578 | Ga0495687_014891 | 3300047443 | Bacteria | 3975 |
| 579 | Ga0495675_0012328 | 3300047444 | Bacteria | 5380 |
| 580 | Ga0495675_0024995 | 3300047444 | Bacteria | 3809 |
| 581 | Ga0495675_0035435 | 3300047444 | Bacteria | 3187 |
| 582 | Ga0495673_0069111 | 3300047469 | Bacteria | 1491 |
| 583 | Ga0495673_0090619 | 3300047469 | Unclassified | 1250 |
| 584 | Ga0495684_0001407 | 3300047471 | Bacteria | 19272 |
| 585 | Ga0495684_0005971 | 3300047471 | Bacteria | 9460 |
| 586 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 587 | Ga0495593_0002446 | 3300047673 | Bacteria | 11170 |
| 588 | Ga0495602_0007241 | 3300048088 | Bacteria | 11617 |
| 589 | Ga0495602_0019961 | 3300048088 | Bacteria | 6634 |
| 590 | Ga0495602_0039312 | 3300048088 | Bacteria | 4359 |
| 591 | Ga0495602_0115379 | 3300048088 | Bacteria | 2173 |
| 592 | Ga0495614_0006055 | 3300048089 | Bacteria | 5438 |
| 593 | Ga0496100_0007585 | 3300048903 | Bacteria | 5998 |
| 594 | Ga0496100_0042150 | 3300048903 | Bacteria | 2914 |
| 595 | Ga0496100_0119453 | 3300048903 | Bacteria | 1842 |
| 596 | Ga0496101_0127876 | 3300048904 | Bacteria | 1927 |
| 597 | Ga0496102_0014231 | 3300048905 | Bacteria | 6913 |
| 598 | Ga0496102_0018355 | 3300048905 | Bacteria | 6145 |
| 599 | Ga0496102_0083203 | 3300048905 | Bacteria | 2953 |
| 600 | Ga0496103_0022816 | 3300048906 | Bacteria | 3770 |
| 601 | Ga0496104_0022932 | 3300048907 | Bacteria | 5736 |
| 602 | Ga0496104_0024758 | 3300048907 | Bacteria | 5526 |
| 603 | Ga0496104_0036043 | 3300048907 | Bacteria | 4621 |
| 604 | Ga0496104_0073880 | 3300048907 | Bacteria | 3244 |
| 605 | Ga0496104_0130155 | 3300048907 | Bacteria | 2417 |
| 606 | Ga0496104_0203556 | 3300048907 | Bacteria | 1891 |
| 607 | Ga0496105_0002092 | 3300048908 | Bacteria | 14435 |
| 608 | Ga0496105_0011739 | 3300048908 | Bacteria | 6932 |
| 609 | Ga0496105_0041425 | 3300048908 | Bacteria | 3796 |
| 610 | Ga0496105_0044963 | 3300048908 | Bacteria | 3643 |
| 611 | Ga0496105_0050731 | 3300048908 | Bacteria | 3428 |
| 612 | Ga0496105_0267569 | 3300048908 | Bacteria | 1381 |
| 613 | Ga0496106_0001202 | 3300048909 | Bacteria | 19326 |
| 614 | Ga0496106_0011446 | 3300048909 | Bacteria | 6562 |
| 615 | Ga0496106_0015453 | 3300048909 | Bacteria | 5650 |
| 616 | Ga0496106_0018182 | 3300048909 | Bacteria | 5199 |
| 617 | Ga0496106_0068108 | 3300048909 | Bacteria | 2715 |
| 618 | Ga0496106_0265684 | 3300048909 | Bacteria | 1373 |
| 619 | Ga0496107_0002624 | 3300048910 | Bacteria | 11754 |
| 620 | Ga0496107_0009825 | 3300048910 | Bacteria | 6636 |
| 621 | Ga0496107_0011885 | 3300048910 | Bacteria | 6082 |
| 622 | Ga0496108_0001960 | 3300048911 | Bacteria | 16479 |
| 623 | Ga0496108_0018478 | 3300048911 | Bacteria | 5708 |
| 624 | Ga0496108_0050815 | 3300048911 | Bacteria | 3472 |
| 625 | Ga0496108_0180764 | 3300048911 | Bacteria | 1826 |
| 626 | Ga0496109_0000432 | 3300048912 | Bacteria | 36461 |
| 627 | Ga0496109_0010188 | 3300048912 | Bacteria | 8024 |
| 628 | Ga0496109_0055955 | 3300048912 | Bacteria | 3599 |
| 629 | Ga0496109_0234299 | 3300048912 | Bacteria | 1728 |
| 630 | Ga0496110_0012555 | 3300048913 | Bacteria | 6968 |
| 631 | Ga0496110_0027219 | 3300048913 | Bacteria | 4900 |
| 632 | Ga0496110_0029803 | 3300048913 | Bacteria | 4701 |
| 633 | Ga0496110_0187050 | 3300048913 | Bacteria | 1881 |
| 634 | Ga0496110_0211027 | 3300048913 | Bacteria | 1765 |
| 635 | Ga0496111_0013188 | 3300048914 | Bacteria | 5620 |
| 636 | Ga0496111_0039393 | 3300048914 | Bacteria | 3388 |
| 637 | Ga0496111_0091744 | 3300048914 | Bacteria | 2226 |
| 638 | Ga0496112_0015915 | 3300048915 | Bacteria | 7029 |
| 639 | Ga0496112_0033682 | 3300048915 | Bacteria | 4980 |
| 640 | Ga0496112_0061568 | 3300048915 | Bacteria | 3700 |
| 641 | Ga0496112_0100707 | 3300048915 | Bacteria | 2859 |
| 642 | Ga0496112_0112903 | 3300048915 | Bacteria | 2688 |
| 643 | Ga0496112_0194315 | 3300048915 | Bacteria | 1990 |
| 644 | Ga0496112_0206592 | 3300048915 | Bacteria | 1922 |
| 645 | Ga0496113_0014649 | 3300048916 | Bacteria | 5359 |
| 646 | Ga0496113_0032600 | 3300048916 | Bacteria | 3786 |
| 647 | Ga0496114_0008432 | 3300048917 | Bacteria | 8162 |
| 648 | Ga0496115_0009310 | 3300048918 | Bacteria | 7298 |
| 649 | Ga0496115_0033310 | 3300048918 | Bacteria | 4067 |
| 650 | Ga0496115_0063699 | 3300048918 | Bacteria | 2975 |
| 651 | Ga0496115_0078069 | 3300048918 | Bacteria | 2693 |
| 652 | Ga0496115_0133099 | 3300048918 | Bacteria | 2050 |
| 653 | Ga0496118_0019947 | 3300048921 | Bacteria | 5966 |
| 654 | Ga0496118_0029396 | 3300048921 | Bacteria | 4609 |
| 655 | Ga0496118_0036940 | 3300048921 | Bacteria | 3940 |
| 656 | Ga0496118_0134801 | 3300048921 | Bacteria | 1578 |
| 657 | Ga0496119_0013953 | 3300048922 | Bacteria | 6336 |
| 658 | Ga0496120_0007436 | 3300048923 | Bacteria | 8144 |
| 659 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 660 | Ga0496121_0003563 | 3300048924 | Bacteria | 22031 |
| 661 | Ga0496121_0005352 | 3300048924 | Bacteria | 16504 |
| 662 | Ga0496121_0009890 | 3300048924 | Bacteria | 10868 |
| 663 | Ga0496121_0028205 | 3300048924 | Bacteria | 5231 |
| 664 | Ga0496121_0039020 | 3300048924 | Bacteria | 4193 |
| 665 | Ga0496121_0071909 | 3300048924 | Bacteria | 2780 |
| 666 | Ga0496121_0100982 | 3300048924 | Bacteria | 2226 |
| 667 | Ga0496121_0111107 | 3300048924 | Bacteria | 2091 |
| 668 | Ga0496122_0030990 | 3300048925 | Bacteria | 4464 |
| 669 | Ga0496124_0000624 | 3300048927 | Bacteria | 58976 |
| 670 | Ga0496124_0040676 | 3300048927 | Bacteria | 4019 |
| 671 | Ga0496125_0036744 | 3300048928 | Bacteria | 4270 |
| 672 | Ga0496125_0040200 | 3300048928 | Bacteria | 4014 |
| 673 | Ga0496125_0053440 | 3300048928 | Bacteria | 3311 |
| 674 | Ga0496125_0075947 | 3300048928 | Bacteria | 2597 |
| 675 | Ga0496125_0092232 | 3300048928 | Bacteria | 2265 |
| 676 | Ga0496126_0002321 | 3300048929 | Bacteria | 26096 |
| 677 | Ga0496126_0008801 | 3300048929 | Bacteria | 10829 |
| 678 | Ga0496126_0010022 | 3300048929 | Bacteria | 10000 |
| 679 | Ga0496126_0015516 | 3300048929 | Bacteria | 7659 |
| 680 | Ga0496126_0018293 | 3300048929 | Bacteria | 6951 |
| 681 | Ga0496126_0029558 | 3300048929 | Bacteria | 5204 |
| 682 | Ga0496126_0030071 | 3300048929 | Bacteria | 5153 |
| 683 | Ga0496126_0032840 | 3300048929 | Bacteria | 4885 |
| 684 | Ga0496126_0051884 | 3300048929 | Bacteria | 3732 |
| 685 | Ga0496126_0198822 | 3300048929 | Bacteria | 1694 |
| 686 | Ga0496126_0206653 | 3300048929 | Bacteria | 1655 |
| 687 | Ga0496126_0255689 | 3300048929 | Bacteria | 1458 |
| 688 | Ga0496126_0351501 | 3300048929 | Bacteria | 1205 |
| 689 | Ga0501032_0005102 | 3300049569 | Bacteria | 9799 |
| 690 | Ga0501032_0076754 | 3300049569 | Bacteria | 2224 |
| 691 | Ga0501033_0001834 | 3300049570 | Bacteria | 18512 |
| 692 | Ga0501033_0051989 | 3300049570 | Bacteria | 3036 |
| 693 | Ga0501034_0001471 | 3300049571 | Bacteria | 31174 |
| 694 | Ga0501034_0134384 | 3300049571 | Bacteria | 2455 |
| 695 | Ga0501034_0444984 | 3300049571 | Bacteria | 1214 |
| 696 | Ga0501036_0050117 | 3300049572 | Bacteria | 3536 |
| 697 | Ga0501036_0053755 | 3300049572 | Bacteria | 3410 |
| 698 | Ga0501037_0005747 | 3300049573 | Bacteria | 9056 |
| 699 | Ga0501037_0086729 | 3300049573 | Bacteria | 2265 |
| 700 | Ga0501038_0002435 | 3300049574 | Bacteria | 17326 |
| 701 | Ga0501038_0014916 | 3300049574 | Bacteria | 7074 |
| 702 | Ga0501038_0042310 | 3300049574 | Bacteria | 3967 |
| 703 | Ga0501039_0010117 | 3300049575 | Bacteria | 7185 |
| 704 | Ga0501040_0054616 | 3300049576 | Bacteria | 2738 |
| 705 | Ga0501042_0045227 | 3300049578 | Bacteria | 3137 |
| 706 | Ga0501043_0019449 | 3300049579 | Bacteria | 5330 |
| 707 | Ga0501043_0020212 | 3300049579 | Bacteria | 5228 |
| 708 | Ga0501043_0061463 | 3300049579 | Bacteria | 2950 |
| 709 | Ga0501046_0007012 | 3300049580 | Bacteria | 9927 |
| 710 | Ga0501046_0073620 | 3300049580 | Bacteria | 2651 |
| 711 | Ga0501046_0075087 | 3300049580 | Bacteria | 2621 |
| 712 | Ga0501047_0014876 | 3300049581 | Bacteria | 7407 |
| 713 | Ga0501047_0082968 | 3300049581 | Bacteria | 3081 |
| 714 | Ga0501047_0140691 | 3300049581 | Bacteria | 2292 |
| 715 | Ga0501048_0006412 | 3300049582 | Bacteria | 8942 |
| 716 | Ga0501068_0024706 | 3300049584 | Bacteria | 3529 |
| 717 | Ga0501074_0149427 | 3300049590 | Bacteria | 1670 |
| 718 | Ga0501076_0100259 | 3300049592 | Bacteria | 2333 |
| 719 | Ga0501079_0236102 | 3300049741 | Bacteria | 1428 |
| 720 | Ga0501080_0088666 | 3300049742 | Bacteria | 2874 |
| 721 | Ga0501080_0108978 | 3300049742 | Bacteria | 2566 |
| 722 | Ga0501080_0130979 | 3300049742 | Bacteria | 2322 |
| 723 | Ga0501035_0002268 | 3300049822 | Bacteria | 18995 |
| 724 | Ga0501035_0026433 | 3300049822 | Bacteria | 5310 |
| 725 | Ga0501035_0055661 | 3300049822 | Bacteria | 3531 |
| 726 | Ga0501044_0007852 | 3300049823 | Bacteria | 11732 |
| 727 | Ga0501044_0020966 | 3300049823 | Bacteria | 6978 |
| 728 | Ga0501044_0060417 | 3300049823 | Bacteria | 3881 |
| 729 | Ga0501045_0032361 | 3300049824 | Bacteria | 3789 |
| 730 | nmdc:mga0yw44_23996_c1 | 3300050492 | Bacteria | 3444 |
| 731 | nmdc:mga0yw44_31714_c1 | 3300050492 | Bacteria | 3075 |
| 732 | nmdc:mga0yw44_5423_c1 | 3300050492 | Bacteria | 6024 |
| 733 | nmdc:mga06z11_27907_c1 | 3300050494 | Bacteria | 2703 |
| 734 | nmdc:mga0rr50_147154_c1 | 3300050513 | Bacteria | 1900 |
| 735 | nmdc:mga0a205_317757_c1 | 3300050515 | Bacteria | 1428 |
| 736 | nmdc:mga0sz30_14368_c1 | 3300050516 | Bacteria | 1556 |
| 737 | nmdc:mga0sz30_64384_c1 | 3300050516 | Bacteria | 1570 |
| 738 | Ga0495601_0054028 | 3300053077 | Bacteria | 2540 |
| 739 | Ga0495601_0112208 | 3300053077 | Bacteria | 1766 |
| 740 | Ga0500635_0015520 | 3300053080 | Bacteria | 2251 |
| 741 | Ga0495595_0001668 | 3300053084 | Bacteria | 8691 |
| 742 | Ga0495595_0003281 | 3300053084 | Bacteria | 6426 |
| 743 | Ga0495595_0011648 | 3300053084 | Bacteria | 3680 |
| 744 | Ga0495619_0025449 | 3300053085 | Bacteria | 3801 |
| 745 | Ga0495619_0076189 | 3300053085 | Bacteria | 2251 |
| 746 | Ga0495619_0159548 | 3300053085 | Bacteria | 1557 |
| 747 | Ga0500643_001180 | 3300053087 | Bacteria | 15589 |
| 748 | Ga0500647_0036075 | 3300053091 | Bacteria | 2363 |
| 749 | Ga0500647_0095598 | 3300053091 | Bacteria | 1421 |
| 750 | Ga0500583_0079752 | 3300053092 | Bacteria | 1579 |
| 751 | Ga0500566_0000062 | 3300053094 | Bacteria | 51144 |
| 752 | Ga0500566_0000112 | 3300053094 | Bacteria | 41687 |
| 753 | Ga0500566_0002624 | 3300053094 | Bacteria | 10704 |
| 754 | Ga0500640_000394 | 3300053095 | Bacteria | 10451 |
| 755 | Ga0500554_001136 | 3300053102 | Bacteria | 5151 |
| 756 | Ga0500556_0000750 | 3300053104 | Bacteria | 19347 |
| 757 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 758 | Ga0500562_023587 | 3300053108 | Bacteria | 1606 |
| 759 | Ga0500572_000239 | 3300053111 | Bacteria | 19483 |
| 760 | Ga0500572_000775 | 3300053111 | Bacteria | 10244 |
| 761 | Ga0500591_066690 | 3300053115 | Bacteria | 1642 |
| 762 | Ga0500595_017745 | 3300053119 | Bacteria | 2620 |
| 763 | Ga0500595_031296 | 3300053119 | Bacteria | 1786 |
| 764 | Ga0500614_021021 | 3300053123 | Bacteria | 1511 |
| 765 | Ga0500642_0002011 | 3300053130 | Bacteria | 5902 |
| 766 | Ga0500642_0025721 | 3300053130 | Bacteria | 2394 |
| 767 | Ga0500642_0121700 | 3300053130 | Bacteria | 1221 |
| 768 | Ga0500559_0001790 | 3300053136 | Bacteria | 11801 |
| 769 | Ga0500559_0004994 | 3300053136 | Bacteria | 6162 |
| 770 | Ga0500603_001625 | 3300053150 | Bacteria | 5069 |
| 771 | Ga0500616_0006635 | 3300053153 | Bacteria | 7533 |
| 772 | Ga0500622_0025785 | 3300053156 | Bacteria | 3104 |
| 773 | Ga0500627_0051117 | 3300053158 | Bacteria | 1802 |
| 774 | Ga0500630_003625 | 3300053159 | Bacteria | 7477 |
| 775 | Ga0500638_001061 | 3300053162 | Bacteria | 8066 |
| 776 | Ga0500639_000061 | 3300053163 | Bacteria | 49500 |
| 777 | Ga0500636_0000284 | 3300053177 | Bacteria | 28033 |
| 778 | Ga0500636_0023548 | 3300053177 | Bacteria | 3640 |
| 779 | Ga0500637_0000098 | 3300053178 | Bacteria | 31362 |
| 780 | Ga0500625_000220 | 3300053729 | Bacteria | 13001 |
| 781 | Ga0500596_000699 | 3300053735 | Bacteria | 6539 |
| 782 | Ga0500596_000998 | 3300053735 | Bacteria | 5669 |
| 783 | Ga0500596_003937 | 3300053735 | Bacteria | 2773 |
| 784 | Ga0500601_000233 | 3300053737 | Bacteria | 10949 |
| 785 | Ga0500601_001561 | 3300053737 | Bacteria | 2483 |
| 786 | Ga0501084_0076301 | 3300054114 | Bacteria | 2809 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046524 | Ga0495648_0022088 | Ga0495648_0022088_3148_4275 | 345 |
| 2 | 3300047469 | Ga0495673_0090619 | Ga0495673_0090619_79_1206 | 345 |
| 3 | 3300025932 | Ga0207690_10164031 | Ga0207690_101640312 | 352 |
| 4 | 3300047320 | Ga0495672_0031356 | Ga0495672_0031356_1392_2582 | 354 |
| 5 | 3300048909 | Ga0496106_0265684 | Ga0496106_0265684_277_1359 | 354 |
| 6 | 3300048913 | Ga0496110_0211027 | Ga0496110_0211027_666_1748 | 354 |
| 7 | 3300049571 | Ga0501034_0444984 | Ga0501034_0444984_18_1100 | 354 |
| 8 | 3300053130 | Ga0500642_0121700 | Ga0500642_0121700_115_1197 | 354 |
| 9 | 3300047322 | Ga0495680_0002491 | Ga0495680_0002491_3108_4208 | 358 |
| 10 | 3300035725 | Ga0373947_0196609 | Ga0373947_0196609_11_1168 | 369 |
| 11 | 3300049580 | Ga0501046_0073620 | Ga0501046_0073620_1509_2639 | 370 |
| 12 | 3300053153 | Ga0500616_0006635 | Ga0500616_0006635_4655_5878 | 372 |
| 13 | 3300010159 | Ga0099796_10013869 | Ga0099796_100138692 | 374 |
| 14 | 3300037853 | Ga0436364_0817898 | Ga0436364_0817898_1478_2713 | 375 |
| 15 | 3300037466 | Ga0395898_0096005 | Ga0395898_0096005_130_1365 | 377 |
| 16 | 3300025915 | Ga0207693_10264604 | Ga0207693_102646042 | 379 |
| 17 | 3300048908 | Ga0496105_0267569 | Ga0496105_0267569_191_1348 | 379 |
| 18 | 3300005843 | Ga0068860_100005407 | Ga0068860_10000540710 | 381 |
| 19 | 3300009545 | Ga0105237_10064196 | Ga0105237_100641963 | 381 |
| 20 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030341 | 381 |
| 21 | 3300042438 | Ga0439459_0021517 | Ga0439459_0021517_37_1200 | 381 |
| 22 | 3300048929 | Ga0496126_0351501 | Ga0496126_0351501_21_1184 | 381 |
| 23 | iso_pu_bacteria | 8019608314 | 8019609273 | 382 |
| 24 | 3300025914 | Ga0207671_10060370 | Ga0207671_100603702 | 383 |
| 25 | 3300031235 | Ga0265330_10009772 | Ga0265330_100097723 | 383 |
| 26 | 3300031507 | Ga0307509_10029551 | Ga0307509_100295516 | 383 |
| 27 | 3300031730 | Ga0307516_10038399 | Ga0307516_100383992 | 383 |
| 28 | 3300039437 | Ga0436365_0383201 | Ga0436365_0383201_81_1328 | 383 |
| 29 | 3300025912 | Ga0207707_10161806 | Ga0207707_101618062 | 384 |
| 30 | 3300021388 | Ga0213875_10003220 | Ga0213875_100032204 | 390 |
| 31 | 3300037853 | Ga0436364_0108855 | Ga0436364_0108855_24433_25662 | 390 |
| 32 | iso_pu_bacteria | 3005594810 | 3005600435 | 391 |
| 33 | 3300028794 | Ga0307515_10017392 | Ga0307515_100173927 | 392 |
| 34 | 3300009148 | Ga0105243_10142575 | Ga0105243_101425752 | 393 |
| 35 | 3300009177 | Ga0105248_10077527 | Ga0105248_100775272 | 393 |
| 36 | 3300010375 | Ga0105239_10021644 | Ga0105239_100216446 | 393 |
| 37 | 3300013308 | Ga0157375_10214264 | Ga0157375_102142642 | 393 |
| 38 | 3300021388 | Ga0213875_10000382 | Ga0213875_100003829 | 393 |
| 39 | 3300021388 | Ga0213875_10000390 | Ga0213875_1000039037 | 393 |
| 40 | 3300031730 | Ga0307516_10010095 | Ga0307516_100100957 | 393 |
| 41 | 3300035691 | Ga0373931_0005603 | Ga0373931_0005603_4533_5732 | 393 |
| 42 | 3300037853 | Ga0436364_0042928 | Ga0436364_0042928_46150_47382 | 393 |
| 43 | 3300037853 | Ga0436364_0346617 | Ga0436364_0346617_41_1267 | 393 |
| 44 | 3300037853 | Ga0436364_1343008 | Ga0436364_1343008_1181_2413 | 393 |
| 45 | 3300047315 | Ga0495581_0023521 | Ga0495581_0023521_1227_2426 | 393 |
| 46 | 3300048903 | Ga0496100_0119453 | Ga0496100_0119453_269_1468 | 393 |
| 47 | 3300048908 | Ga0496105_0011739 | Ga0496105_0011739_5509_6708 | 393 |
| 48 | 3300048910 | Ga0496107_0002624 | Ga0496107_0002624_4146_5345 | 393 |
| 49 | 3300048911 | Ga0496108_0018478 | Ga0496108_0018478_4309_5508 | 393 |
| 50 | 3300048917 | Ga0496114_0008432 | Ga0496114_0008432_3347_4546 | 393 |
| 51 | 3300048918 | Ga0496115_0063699 | Ga0496115_0063699_1499_2698 | 393 |
| 52 | 3300053084 | Ga0495595_0011648 | Ga0495595_0011648_245_1444 | 393 |
| 53 | 3300039437 | Ga0436365_0064270 | Ga0436365_0064270_208_1452 | 394 |
| 54 | 3300047320 | Ga0495672_0007184 | Ga0495672_0007184_2768_3970 | 394 |
| 55 | 3300048929 | Ga0496126_0051884 | Ga0496126_0051884_1996_3198 | 394 |
| 56 | 3300005355 | Ga0070671_100019025 | Ga0070671_1000190254 | 395 |
| 57 | 3300005434 | Ga0070709_10115955 | Ga0070709_101159551 | 395 |
| 58 | 3300005435 | Ga0070714_100264909 | Ga0070714_1002649091 | 395 |
| 59 | 3300005436 | Ga0070713_100252074 | Ga0070713_1002520742 | 395 |
| 60 | 3300005439 | Ga0070711_100039484 | Ga0070711_1000394841 | 395 |
| 61 | 3300005458 | Ga0070681_10037204 | Ga0070681_100372043 | 395 |
| 62 | 3300006028 | Ga0070717_10094177 | Ga0070717_100941773 | 395 |
| 63 | 3300006175 | Ga0070712_100054530 | Ga0070712_1000545303 | 395 |
| 64 | 3300007788 | Ga0099795_10002778 | Ga0099795_100027784 | 395 |
| 65 | 3300025915 | Ga0207693_10059873 | Ga0207693_100598733 | 395 |
| 66 | 3300025915 | Ga0207693_10070878 | Ga0207693_100708782 | 395 |
| 67 | 3300025928 | Ga0207700_10011837 | Ga0207700_100118375 | 395 |
| 68 | 3300025939 | Ga0207665_10209318 | Ga0207665_102093182 | 395 |
| 69 | 3300029957 | Ga0265324_10011228 | Ga0265324_100112281 | 395 |
| 70 | 3300031249 | Ga0265339_10016403 | Ga0265339_100164033 | 395 |
| 71 | 3300031249 | Ga0265339_10065301 | Ga0265339_100653012 | 395 |
| 72 | 3300035170 | Ga0373943_0040646 | Ga0373943_0040646_875_2113 | 395 |
| 73 | 3300039437 | Ga0436365_0369560 | Ga0436365_0369560_722_1960 | 395 |
| 74 | 3300039437 | Ga0436365_0677006 | Ga0436365_0677006_830_2068 | 395 |
| 75 | 3300053084 | Ga0495595_0001668 | Ga0495595_0001668_5814_7052 | 395 |
| 76 | 3300053085 | Ga0495619_0025449 | Ga0495619_0025449_520_1758 | 395 |
| 77 | iso_pu_bacteria | 2508501009 | 2508541673 | 395 |
| 78 | iso_pu_bacteria | 2508501042 | 2508692788 | 395 |
| 79 | iso_pu_bacteria | 2508501128 | 2509152953 | 395 |
| 80 | iso_pu_bacteria | 2511231028 | 2511394850 | 395 |
| 81 | iso_pu_bacteria | 2513237092 | 2513621750 | 395 |
| 82 | iso_pu_bacteria | 2513237094 | 2513636808 | 395 |
| 83 | iso_pu_bacteria | 2513237095 | 2513651250 | 395 |
| 84 | iso_pu_bacteria | 2513237098 | 2513674875 | 395 |
| 85 | iso_pu_bacteria | 2513237101 | 2513697138 | 395 |
| 86 | iso_pu_bacteria | 2513237102 | 2513704455 | 395 |
| 87 | iso_pu_bacteria | 2513237104 | 2513720784 | 395 |
| 88 | iso_pu_bacteria | 2513237137 | 2513856950 | 395 |
| 89 | iso_pu_bacteria | 2513237139 | 2513878752 | 395 |
| 90 | iso_pu_bacteria | 2513237161 | 2514011818 | 395 |
| 91 | iso_pu_bacteria | 2517093001 | 2517104275 | 395 |
| 92 | iso_pu_bacteria | 2524023210 | 2524468253 | 395 |
| 93 | iso_pu_bacteria | 2524023228 | 2524533576 | 395 |
| 94 | iso_pu_bacteria | 2528768022 | 2528848869 | 395 |
| 95 | iso_pu_bacteria | 2529292951 | 2530646710 | 395 |
| 96 | iso_pu_bacteria | 2617270735 | 2617346909 | 395 |
| 97 | iso_pu_bacteria | 2617270741 | 2617372839 | 395 |
| 98 | iso_pu_bacteria | 2721755755 | 2723843588 | 395 |
| 99 | iso_pu_bacteria | 2728368998 | 2728749927 | 395 |
| 100 | iso_pu_bacteria | 2744054633 | 2745080874 | 395 |
| 101 | iso_pu_bacteria | 2791355196 | 2793060982 | 395 |
| 102 | iso_pu_bacteria | 2791355197 | 2793066584 | 395 |
| 103 | iso_pu_bacteria | 2791355199 | 2793083894 | 395 |
| 104 | iso_pu_bacteria | 2802429603 | 2805921401 | 395 |
| 105 | iso_pu_bacteria | 2816332527 | 2818236671 | 395 |
| 106 | iso_pu_bacteria | 2824600985 | 2824602891 | 395 |
| 107 | iso_pu_bacteria | 2824609381 | 2824611886 | 395 |
| 108 | iso_pu_bacteria | 2824617872 | 2824621477 | 395 |
| 109 | iso_pu_bacteria | 2824626560 | 2824630589 | 395 |
| 110 | iso_pu_bacteria | 2824635225 | 2824638707 | 395 |
| 111 | iso_pu_bacteria | 2824644064 | 2824650098 | 395 |
| 112 | iso_pu_bacteria | 2824653114 | 2824660923 | 395 |
| 113 | iso_pu_bacteria | 2824661429 | 2824664500 | 395 |
| 114 | iso_pu_bacteria | 2824671348 | 2824672213 | 395 |
| 115 | iso_pu_bacteria | 2824679649 | 2824682162 | 395 |
| 116 | iso_pu_bacteria | 2824687955 | 2824688904 | 395 |
| 117 | iso_pu_bacteria | 2824696289 | 2824697741 | 395 |
| 118 | iso_pu_bacteria | 2824704595 | 2824709247 | 395 |
| 119 | iso_pu_bacteria | 2824714736 | 2824719056 | 395 |
| 120 | iso_pu_bacteria | 2824723954 | 2824730391 | 395 |
| 121 | iso_pu_bacteria | 2824732956 | 2824733921 | 395 |
| 122 | iso_pu_bacteria | 2824746037 | 2824748354 | 395 |
| 123 | iso_pu_bacteria | 2824753945 | 2824758020 | 395 |
| 124 | iso_pu_bacteria | 2824763712 | 2824766445 | 395 |
| 125 | iso_pu_bacteria | 2824773399 | 2824776572 | 395 |
| 126 | iso_pu_bacteria | 2838122688 | 2838129330 | 395 |
| 127 | iso_pu_bacteria | 2841941048 | 2841948014 | 395 |
| 128 | iso_pu_bacteria | 2841949485 | 2841953588 | 395 |
| 129 | iso_pu_bacteria | 2841957949 | 2841962805 | 395 |
| 130 | iso_pu_bacteria | 2841966195 | 2841973007 | 395 |
| 131 | iso_pu_bacteria | 2841974524 | 2841978315 | 395 |
| 132 | iso_pu_bacteria | 2841983080 | 2841990535 | 395 |
| 133 | iso_pu_bacteria | 2842038055 | 2842040756 | 395 |
| 134 | iso_pu_bacteria | 2842045827 | 2842046298 | 395 |
| 135 | iso_pu_bacteria | 2844315083 | 2844320136 | 395 |
| 136 | iso_pu_bacteria | 2847930680 | 2847933258 | 395 |
| 137 | iso_pu_bacteria | 2847930680 | 2847937431 | 395 |
| 138 | iso_pu_bacteria | 2847939898 | 2847947855 | 395 |
| 139 | iso_pu_bacteria | 2849076700 | 2849078290 | 395 |
| 140 | iso_pu_bacteria | 2857509624 | 2857512666 | 395 |
| 141 | iso_pu_bacteria | 2874590934 | 2874598670 | 395 |
| 142 | iso_pu_bacteria | 2874604998 | 2874607203 | 395 |
| 143 | iso_pu_bacteria | 2874612657 | 2874614456 | 395 |
| 144 | iso_pu_bacteria | 2874620515 | 2874628187 | 395 |
| 145 | iso_pu_bacteria | 2874628541 | 2874630210 | 395 |
| 146 | iso_pu_bacteria | 2874645413 | 2874652125 | 395 |
| 147 | iso_pu_bacteria | 2876761206 | 2876768198 | 395 |
| 148 | iso_pu_bacteria | 2876771140 | 2876778709 | 395 |
| 149 | iso_pu_bacteria | 2876808645 | 2876818316 | 395 |
| 150 | iso_pu_bacteria | 2876818435 | 2876823513 | 395 |
| 151 | iso_pu_bacteria | 2879074833 | 2879082502 | 395 |
| 152 | iso_pu_bacteria | 2879099564 | 2879107821 | 395 |
| 153 | iso_pu_bacteria | 2879110137 | 2879114093 | 395 |
| 154 | iso_pu_bacteria | 2879127579 | 2879131718 | 395 |
| 155 | iso_pu_bacteria | 2879142872 | 2879150054 | 395 |
| 156 | iso_pu_bacteria | 2881364244 | 2881371350 | 395 |
| 157 | iso_pu_bacteria | 2881665667 | 2881672204 | 395 |
| 158 | iso_pu_bacteria | 2885366525 | 2885370076 | 395 |
| 159 | iso_pu_bacteria | 2885374607 | 2885383123 | 395 |
| 160 | iso_pu_bacteria | 2885383462 | 2885391947 | 395 |
| 161 | iso_pu_bacteria | 2885409591 | 2885415622 | 395 |
| 162 | iso_pu_bacteria | 2888378607 | 2888385573 | 395 |
| 163 | iso_pu_bacteria | 2888388044 | 2888392676 | 395 |
| 164 | iso_pu_bacteria | 2888419890 | 2888425703 | 395 |
| 165 | iso_pu_bacteria | 2889033259 | 2889037906 | 395 |
| 166 | iso_pu_bacteria | 2903727486 | 2903731270 | 395 |
| 167 | iso_pu_bacteria | 2903748898 | 2903753330 | 395 |
| 168 | iso_pu_bacteria | 2903768456 | 2903774854 | 395 |
| 169 | iso_pu_bacteria | 2904666416 | 2904674195 | 395 |
| 170 | iso_pu_bacteria | 2904690495 | 2904694150 | 395 |
| 171 | iso_pu_bacteria | 2904699407 | 2904701134 | 395 |
| 172 | iso_pu_bacteria | 2904711408 | 2904711857 | 395 |
| 173 | iso_pu_bacteria | 2906602504 | 2906609961 | 395 |
| 174 | iso_pu_bacteria | 2906610324 | 2906616413 | 395 |
| 175 | iso_pu_bacteria | 2906626472 | 2906627716 | 395 |
| 176 | iso_pu_bacteria | 2906635258 | 2906638132 | 395 |
| 177 | iso_pu_bacteria | 2906643746 | 2906649617 | 395 |
| 178 | iso_pu_bacteria | 2906660503 | 2906662807 | 395 |
| 179 | iso_pu_bacteria | 2908739725 | 2908741558 | 395 |
| 180 | iso_pu_bacteria | 2908756301 | 2908758996 | 395 |
| 181 | iso_pu_bacteria | 2908775508 | 2908781286 | 395 |
| 182 | iso_pu_bacteria | 2922361189 | 2922361843 | 395 |
| 183 | iso_pu_bacteria | 2922368715 | 2922372293 | 395 |
| 184 | iso_pu_bacteria | 2922386360 | 2922386925 | 395 |
| 185 | iso_pu_bacteria | 2922393267 | 2922396961 | 395 |
| 186 | iso_pu_bacteria | 2922425934 | 2922431582 | 395 |
| 187 | iso_pu_bacteria | 2929615660 | 2929621141 | 395 |
| 188 | iso_pu_bacteria | 2929624759 | 2929626028 | 395 |
| 189 | iso_pu_bacteria | 2932784394 | 2932785092 | 395 |
| 190 | iso_pu_bacteria | 2932794094 | 2932795036 | 395 |
| 191 | iso_pu_bacteria | 2932801729 | 2932805564 | 395 |
| 192 | iso_pu_bacteria | 2932809354 | 2932810120 | 395 |
| 193 | iso_pu_bacteria | 2932818245 | 2932821693 | 395 |
| 194 | iso_pu_bacteria | 2932828146 | 2932828929 | 395 |
| 195 | iso_pu_bacteria | 2933577622 | 2933582990 | 395 |
| 196 | iso_pu_bacteria | 2935608549 | 2935609938 | 395 |
| 197 | iso_pu_bacteria | 2935616580 | 2935619652 | 395 |
| 198 | iso_pu_bacteria | 2935630451 | 2935636117 | 395 |
| 199 | iso_pu_bacteria | 2935630451 | 2935638147 | 395 |
| 200 | iso_pu_bacteria | 2935638405 | 2935638632 | 395 |
| 201 | iso_pu_bacteria | 2935648319 | 2935652031 | 395 |
| 202 | iso_pu_bacteria | 2935656913 | 2935659996 | 395 |
| 203 | iso_pu_bacteria | 2935665750 | 2935666516 | 395 |
| 204 | iso_pu_bacteria | 2935675223 | 2935676441 | 395 |
| 205 | iso_pu_bacteria | 2935684952 | 2935691043 | 395 |
| 206 | iso_pu_bacteria | 2935694250 | 2935694523 | 395 |
| 207 | iso_pu_bacteria | 2935703347 | 2935703638 | 395 |
| 208 | iso_pu_bacteria | 2935713505 | 2935718424 | 395 |
| 209 | iso_pu_bacteria | 2935722832 | 2935727596 | 395 |
| 210 | iso_pu_bacteria | 2935732158 | 2935736299 | 395 |
| 211 | iso_pu_bacteria | 2935741537 | 2935745679 | 395 |
| 212 | iso_pu_bacteria | 2935750917 | 2935756060 | 395 |
| 213 | iso_pu_bacteria | 2935760218 | 2935760680 | 395 |
| 214 | iso_pu_bacteria | 2935769743 | 2935776097 | 395 |
| 215 | iso_pu_bacteria | 2935777560 | 2935785148 | 395 |
| 216 | iso_pu_bacteria | 2935785616 | 2935791890 | 395 |
| 217 | iso_pu_bacteria | 2935793552 | 2935800300 | 395 |
| 218 | iso_pu_bacteria | 2935801545 | 2935801776 | 395 |
| 219 | iso_pu_bacteria | 2935810662 | 2935814809 | 395 |
| 220 | iso_pu_bacteria | 2935819856 | 2935823098 | 395 |
| 221 | iso_pu_bacteria | 2935819856 | 2935827761 | 395 |
| 222 | iso_pu_bacteria | 2935827899 | 2935828126 | 395 |
| 223 | iso_pu_bacteria | 2935837841 | 2935842331 | 395 |
| 224 | iso_pu_bacteria | 2935847175 | 2935848680 | 395 |
| 225 | iso_pu_bacteria | 2935847175 | 2935855075 | 395 |
| 226 | iso_pu_bacteria | 2935855204 | 2935858033 | 395 |
| 227 | iso_pu_bacteria | 2935864058 | 2935867937 | 395 |
| 228 | iso_pu_bacteria | 2935873716 | 2935874039 | 395 |
| 229 | iso_pu_bacteria | 2935883170 | 2935885765 | 395 |
| 230 | iso_pu_bacteria | 2935908558 | 2935909515 | 395 |
| 231 | iso_pu_bacteria | 2935916978 | 2935917239 | 395 |
| 232 | iso_pu_bacteria | 2935926038 | 2935926996 | 395 |
| 233 | iso_pu_bacteria | 2935934488 | 2935937160 | 395 |
| 234 | iso_pu_bacteria | 2935942939 | 2935944537 | 395 |
| 235 | iso_pu_bacteria | 2935951376 | 2935952974 | 395 |
| 236 | iso_pu_bacteria | 2935959822 | 2935962833 | 395 |
| 237 | iso_pu_bacteria | 2935967501 | 2935969814 | 395 |
| 238 | iso_pu_bacteria | 2935975950 | 2935976411 | 395 |
| 239 | iso_pu_bacteria | 2935984226 | 2935987141 | 395 |
| 240 | iso_pu_bacteria | 2935992306 | 2935993036 | 395 |
| 241 | iso_pu_bacteria | 2936002035 | 2936002948 | 395 |
| 242 | iso_pu_bacteria | 2936011229 | 2936014412 | 395 |
| 243 | iso_pu_bacteria | 2936019824 | 2936023748 | 395 |
| 244 | iso_pu_bacteria | 2936028420 | 2936031391 | 395 |
| 245 | iso_pu_bacteria | 2936037263 | 2936040548 | 395 |
| 246 | iso_pu_bacteria | 2936046547 | 2936049518 | 395 |
| 247 | iso_pu_bacteria | 2936055302 | 2936061266 | 395 |
| 248 | iso_pu_bacteria | 2940556831 | 2940561965 | 395 |
| 249 | iso_pu_bacteria | 2941507105 | 2941512748 | 395 |
| 250 | iso_pu_bacteria | 2941507105 | 2941514780 | 395 |
| 251 | iso_pu_bacteria | 2941515067 | 2941520685 | 395 |
| 252 | iso_pu_bacteria | 2941515067 | 2941522762 | 395 |
| 253 | iso_pu_bacteria | 2941523033 | 2941528699 | 395 |
| 254 | iso_pu_bacteria | 2941523033 | 2941530673 | 395 |
| 255 | iso_pu_bacteria | 2941531003 | 2941531318 | 395 |
| 256 | iso_pu_bacteria | 2941538514 | 2941542380 | 395 |
| 257 | iso_pu_bacteria | 3005483717 | 3005485515 | 395 |
| 258 | iso_pu_bacteria | 3005506211 | 3005508329 | 395 |
| 259 | iso_pu_bacteria | 3005587118 | 3005588171 | 395 |
| 260 | iso_pu_bacteria | 3005710791 | 3005715916 | 395 |
| 261 | iso_pu_bacteria | 3005718088 | 3005723271 | 395 |
| 262 | iso_pu_bacteria | 8006926726 | 8006933195 | 395 |
| 263 | iso_pu_bacteria | 8006933436 | 8006939332 | 395 |
| 264 | iso_pu_bacteria | 8006964411 | 8006968863 | 395 |
| 265 | iso_pu_bacteria | 8006973647 | 8006978989 | 395 |
| 266 | iso_pu_bacteria | 8006984368 | 8006984543 | 395 |
| 267 | iso_pu_bacteria | 8006994254 | 8006997169 | 395 |
| 268 | iso_pu_bacteria | 8016511872 | 8016520534 | 395 |
| 269 | iso_pu_bacteria | 8016522445 | 8016528575 | 395 |
| 270 | iso_pu_bacteria | 8016548790 | 8016555150 | 395 |
| 271 | iso_pu_bacteria | 8016557553 | 8016563519 | 395 |
| 272 | iso_pu_bacteria | 8016566248 | 8016572076 | 395 |
| 273 | iso_pu_bacteria | 8016583857 | 8016594487 | 395 |
| 274 | iso_pu_bacteria | 8016595262 | 8016601259 | 395 |
| 275 | iso_pu_bacteria | 8016603502 | 8016609174 | 395 |
| 276 | iso_pu_bacteria | 8016613128 | 8016615728 | 395 |
| 277 | iso_pu_bacteria | 8016622563 | 8016625500 | 395 |
| 278 | iso_pu_bacteria | 8016630954 | 8016639056 | 395 |
| 279 | iso_pu_bacteria | 8017057580 | 8017065041 | 395 |
| 280 | iso_pu_bacteria | 8019530166 | 8019533520 | 395 |
| 281 | iso_pu_bacteria | 8019538911 | 8019546157 | 395 |
| 282 | iso_pu_bacteria | 8019547302 | 8019552550 | 395 |
| 283 | iso_pu_bacteria | 8019565922 | 8019575303 | 395 |
| 284 | iso_pu_bacteria | 8019586578 | 8019592197 | 395 |
| 285 | iso_pu_bacteria | 8019597564 | 8019599087 | 395 |
| 286 | iso_pu_bacteria | 8019629233 | 8019633182 | 395 |
| 287 | iso_pu_bacteria | 8019638758 | 8019646714 | 395 |
| 288 | iso_pu_bacteria | 8019648815 | 8019649487 | 395 |
| 289 | iso_pu_bacteria | 8019659431 | 8019661057 | 395 |
| 290 | iso_pu_bacteria | 8019668869 | 8019670621 | 395 |
| 291 | iso_pu_bacteria | 8019678201 | 8019685614 | 395 |
| 292 | iso_pu_bacteria | 8019687851 | 8019691185 | 395 |
| 293 | iso_pu_bacteria | 8055742211 | 8055744997 | 395 |
| 294 | iso_pu_bacteria | 8056673599 | 8056677519 | 395 |
| 295 | iso_pu_bacteria | 8056681323 | 8056687300 | 395 |
| 296 | iso_pu_bacteria | 8056689827 | 8056690686 | 395 |
| 297 | iso_pu_bacteria | 8056967851 | 8056974950 | 395 |
| 298 | 3300039437 | Ga0436365_0161372 | Ga0436365_0161372_96_1331 | 396 |
| 299 | iso_pu_bacteria | 2562617112 | 2563055992 | 396 |
| 300 | iso_pu_bacteria | 2711768613 | 2713472194 | 396 |
| 301 | 3300003354 | JGI25160J50197_1011835 | JGI25160J50197_10118353 | 397 |
| 302 | 3300003659 | JGI25404J52841_10009163 | JGI25404J52841_100091633 | 397 |
| 303 | 3300004625 | Ga0055543_1000462 | Ga0055543_10004628 | 397 |
| 304 | 3300005262 | Ga0065165_1000799 | Ga0065165_100079928 | 397 |
| 305 | 3300005548 | Ga0070665_100051187 | Ga0070665_1000511873 | 397 |
| 306 | 3300005937 | Ga0081455_10002800 | Ga0081455_1000280010 | 397 |
| 307 | 3300005937 | Ga0081455_10056307 | Ga0081455_100563074 | 397 |
| 308 | 3300005937 | Ga0081455_10108720 | Ga0081455_101087202 | 397 |
| 309 | 3300005983 | Ga0081540_1011207 | Ga0081540_10112073 | 397 |
| 310 | 3300005983 | Ga0081540_1021620 | Ga0081540_10216205 | 397 |
| 311 | 3300005983 | Ga0081540_1043139 | Ga0081540_10431393 | 397 |
| 312 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001648 | 397 |
| 313 | 3300021321 | Ga0214542_1000037 | Ga0214542_100003733 | 397 |
| 314 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003112 | 397 |
| 315 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002653 | 397 |
| 316 | 3300025261 | Ga0209233_1002214 | Ga0209233_10022146 | 397 |
| 317 | 3300025295 | Ga0209564_1005201 | Ga0209564_10052014 | 397 |
| 318 | 3300025297 | Ga0209758_1032205 | Ga0209758_10322051 | 397 |
| 319 | 3300025299 | Ga0209256_1012600 | Ga0209256_10126003 | 397 |
| 320 | 3300025302 | Ga0207426_1000228 | Ga0207426_100022862 | 397 |
| 321 | 3300028379 | Ga0268266_10055520 | Ga0268266_100555203 | 397 |
| 322 | 3300031616 | Ga0307508_10023817 | Ga0307508_100238172 | 397 |
| 323 | 3300039437 | Ga0436365_1424648 | Ga0436365_1424648_3840_5057 | 397 |
| 324 | 3300039453 | Ga0436362_0618850 | Ga0436362_0618850_2040_3257 | 397 |
| 325 | 3300048924 | Ga0496121_0071909 | Ga0496121_0071909_199_1416 | 397 |
| 326 | 3300049823 | Ga0501044_0060417 | Ga0501044_0060417_1511_2728 | 397 |
| 327 | 3300050513 | nmdc:mga0rr50_147154_c1 | nmdc:mga0rr50_147154_c1_239_1456 | 397 |
| 328 | 3300003215 | JGI25153J46596_10005337 | JGI25153J46596_100053374 | 398 |
| 329 | 3300003322 | rootL2_10160148 | rootL2_101601482 | 398 |
| 330 | 3300003794 | Ga0055531_10006567 | Ga0055531_100065676 | 398 |
| 331 | 3300004625 | Ga0055543_1001763 | Ga0055543_10017637 | 398 |
| 332 | 3300005262 | Ga0065165_1002416 | Ga0065165_10024169 | 398 |
| 333 | 3300005262 | Ga0065165_1002642 | Ga0065165_10026427 | 398 |
| 334 | 3300005262 | Ga0065165_1006433 | Ga0065165_10064333 | 398 |
| 335 | 3300005327 | Ga0070658_10048283 | Ga0070658_100482833 | 398 |
| 336 | 3300005329 | Ga0070683_100005122 | Ga0070683_10000512210 | 398 |
| 337 | 3300005336 | Ga0070680_100009353 | Ga0070680_1000093537 | 398 |
| 338 | 3300005336 | Ga0070680_100162926 | Ga0070680_1001629262 | 398 |
| 339 | 3300005338 | Ga0068868_100053615 | Ga0068868_1000536152 | 398 |
| 340 | 3300005339 | Ga0070660_100018873 | Ga0070660_1000188734 | 398 |
| 341 | 3300005347 | Ga0070668_100026976 | Ga0070668_1000269764 | 398 |
| 342 | 3300005347 | Ga0070668_100082935 | Ga0070668_1000829352 | 398 |
| 343 | 3300005347 | Ga0070668_100229075 | Ga0070668_1002290751 | 398 |
| 344 | 3300005354 | Ga0070675_100167579 | Ga0070675_1001675792 | 398 |
| 345 | 3300005355 | Ga0070671_100154588 | Ga0070671_1001545882 | 398 |
| 346 | 3300005356 | Ga0070674_100011327 | Ga0070674_1000113273 | 398 |
| 347 | 3300005364 | Ga0070673_100042244 | Ga0070673_1000422441 | 398 |
| 348 | 3300005365 | Ga0070688_100028924 | Ga0070688_1000289244 | 398 |
| 349 | 3300005366 | Ga0070659_100065131 | Ga0070659_1000651312 | 398 |
| 350 | 3300005367 | Ga0070667_100053462 | Ga0070667_1000534623 | 398 |
| 351 | 3300005434 | Ga0070709_10001228 | Ga0070709_100012288 | 398 |
| 352 | 3300005434 | Ga0070709_10160673 | Ga0070709_101606732 | 398 |
| 353 | 3300005435 | Ga0070714_100006930 | Ga0070714_1000069306 | 398 |
| 354 | 3300005435 | Ga0070714_100012311 | Ga0070714_1000123112 | 398 |
| 355 | 3300005435 | Ga0070714_100083680 | Ga0070714_1000836802 | 398 |
| 356 | 3300005436 | Ga0070713_100019837 | Ga0070713_1000198373 | 398 |
| 357 | 3300005436 | Ga0070713_100099622 | Ga0070713_1000996222 | 398 |
| 358 | 3300005436 | Ga0070713_100155497 | Ga0070713_1001554972 | 398 |
| 359 | 3300005436 | Ga0070713_100340281 | Ga0070713_1003402811 | 398 |
| 360 | 3300005437 | Ga0070710_10000929 | Ga0070710_1000092910 | 398 |
| 361 | 3300005439 | Ga0070711_100005942 | Ga0070711_1000059422 | 398 |
| 362 | 3300005439 | Ga0070711_100015536 | Ga0070711_1000155364 | 398 |
| 363 | 3300005439 | Ga0070711_100043582 | Ga0070711_1000435821 | 398 |
| 364 | 3300005439 | Ga0070711_100072675 | Ga0070711_1000726751 | 398 |
| 365 | 3300005455 | Ga0070663_100008307 | Ga0070663_1000083075 | 398 |
| 366 | 3300005455 | Ga0070663_100010106 | Ga0070663_1000101064 | 398 |
| 367 | 3300005455 | Ga0070663_100035288 | Ga0070663_1000352882 | 398 |
| 368 | 3300005455 | Ga0070663_100080401 | Ga0070663_1000804012 | 398 |
| 369 | 3300005458 | Ga0070681_10076829 | Ga0070681_100768293 | 398 |
| 370 | 3300005458 | Ga0070681_10088746 | Ga0070681_100887461 | 398 |
| 371 | 3300005458 | Ga0070681_10094083 | Ga0070681_100940834 | 398 |
| 372 | 3300005468 | Ga0070707_100312288 | Ga0070707_1003122882 | 398 |
| 373 | 3300005518 | Ga0070699_100171307 | Ga0070699_1001713072 | 398 |
| 374 | 3300005530 | Ga0070679_100032475 | Ga0070679_1000324753 | 398 |
| 375 | 3300005530 | Ga0070679_100058920 | Ga0070679_1000589201 | 398 |
| 376 | 3300005535 | Ga0070684_100015626 | Ga0070684_1000156263 | 398 |
| 377 | 3300005535 | Ga0070684_100017917 | Ga0070684_1000179171 | 398 |
| 378 | 3300005535 | Ga0070684_100033654 | Ga0070684_1000336542 | 398 |
| 379 | 3300005539 | Ga0068853_100137259 | Ga0068853_1001372592 | 398 |
| 380 | 3300005539 | Ga0068853_100210070 | Ga0068853_1002100702 | 398 |
| 381 | 3300005539 | Ga0068853_100268660 | Ga0068853_1002686601 | 398 |
| 382 | 3300005548 | Ga0070665_100016320 | Ga0070665_1000163205 | 398 |
| 383 | 3300005563 | Ga0068855_100012869 | Ga0068855_1000128699 | 398 |
| 384 | 3300005563 | Ga0068855_100059343 | Ga0068855_1000593434 | 398 |
| 385 | 3300005614 | Ga0068856_100001803 | Ga0068856_1000018038 | 398 |
| 386 | 3300005616 | Ga0068852_100063882 | Ga0068852_1000638823 | 398 |
| 387 | 3300005617 | Ga0068859_100053671 | Ga0068859_1000536712 | 398 |
| 388 | 3300005834 | Ga0068851_10042123 | Ga0068851_100421232 | 398 |
| 389 | 3300005841 | Ga0068863_100231921 | Ga0068863_1002319212 | 398 |
| 390 | 3300005841 | Ga0068863_100294077 | Ga0068863_1002940771 | 398 |
| 391 | 3300005842 | Ga0068858_100018788 | Ga0068858_1000187886 | 398 |
| 392 | 3300005843 | Ga0068860_100123813 | Ga0068860_1001238133 | 398 |
| 393 | 3300005844 | Ga0068862_100057926 | Ga0068862_1000579262 | 398 |
| 394 | 3300005937 | Ga0081455_10008855 | Ga0081455_1000885510 | 398 |
| 395 | 3300005937 | Ga0081455_10037499 | Ga0081455_100374993 | 398 |
| 396 | 3300005937 | Ga0081455_10061238 | Ga0081455_100612382 | 398 |
| 397 | 3300005983 | Ga0081540_1000178 | Ga0081540_10001787 | 398 |
| 398 | 3300005983 | Ga0081540_1001968 | Ga0081540_10019688 | 398 |
| 399 | 3300005983 | Ga0081540_1012098 | Ga0081540_10120984 | 398 |
| 400 | 3300005983 | Ga0081540_1018972 | Ga0081540_10189725 | 398 |
| 401 | 3300005983 | Ga0081540_1019008 | Ga0081540_10190084 | 398 |
| 402 | 3300005983 | Ga0081540_1021450 | Ga0081540_10214503 | 398 |
| 403 | 3300005983 | Ga0081540_1040971 | Ga0081540_10409712 | 398 |
| 404 | 3300005985 | Ga0081539_10000220 | Ga0081539_10000220130 | 398 |
| 405 | 3300006028 | Ga0070717_10005875 | Ga0070717_100058752 | 398 |
| 406 | 3300006028 | Ga0070717_10012278 | Ga0070717_100122784 | 398 |
| 407 | 3300006028 | Ga0070717_10058625 | Ga0070717_100586252 | 398 |
| 408 | 3300006038 | Ga0075365_10018146 | Ga0075365_100181464 | 398 |
| 409 | 3300006042 | Ga0075368_10011128 | Ga0075368_100111283 | 398 |
| 410 | 3300006048 | Ga0075363_100018753 | Ga0075363_1000187533 | 398 |
| 411 | 3300006048 | Ga0075363_100072104 | Ga0075363_1000721042 | 398 |
| 412 | 3300006163 | Ga0070715_10003054 | Ga0070715_100030544 | 398 |
| 413 | 3300006173 | Ga0070716_100004705 | Ga0070716_1000047055 | 398 |
| 414 | 3300006173 | Ga0070716_100012347 | Ga0070716_1000123473 | 398 |
| 415 | 3300006175 | Ga0070712_100005481 | Ga0070712_1000054816 | 398 |
| 416 | 3300006175 | Ga0070712_100006535 | Ga0070712_1000065355 | 398 |
| 417 | 3300006175 | Ga0070712_100044651 | Ga0070712_1000446512 | 398 |
| 418 | 3300006353 | Ga0075370_10003000 | Ga0075370_100030005 | 398 |
| 419 | 3300006353 | Ga0075370_10042424 | Ga0075370_100424243 | 398 |
| 420 | 3300006358 | Ga0068871_100080431 | Ga0068871_1000804313 | 398 |
| 421 | 3300006931 | Ga0097620_100053665 | Ga0097620_1000536653 | 398 |
| 422 | 3300006941 | Ga0099825_1030562 | Ga0099825_10305622 | 398 |
| 423 | 3300006942 | Ga0099824_1004802 | Ga0099824_100480214 | 398 |
| 424 | 3300006942 | Ga0099824_1020023 | Ga0099824_10200233 | 398 |
| 425 | 3300006943 | Ga0099822_1001244 | Ga0099822_10012443 | 398 |
| 426 | 3300006944 | Ga0099823_1042587 | Ga0099823_10425871 | 398 |
| 427 | 3300007265 | Ga0099794_10005646 | Ga0099794_100056463 | 398 |
| 428 | 3300007265 | Ga0099794_10007699 | Ga0099794_100076993 | 398 |
| 429 | 3300007265 | Ga0099794_10101182 | Ga0099794_101011822 | 398 |
| 430 | 3300009093 | Ga0105240_10016329 | Ga0105240_100163292 | 398 |
| 431 | 3300009093 | Ga0105240_10075310 | Ga0105240_100753103 | 398 |
| 432 | 3300009094 | Ga0111539_10083826 | Ga0111539_100838263 | 398 |
| 433 | 3300009094 | Ga0111539_10135696 | Ga0111539_101356961 | 398 |
| 434 | 3300009098 | Ga0105245_10051090 | Ga0105245_100510903 | 398 |
| 435 | 3300009098 | Ga0105245_10171978 | Ga0105245_101719782 | 398 |
| 436 | 3300009098 | Ga0105245_10310676 | Ga0105245_103106762 | 398 |
| 437 | 3300009101 | Ga0105247_10033772 | Ga0105247_100337722 | 398 |
| 438 | 3300009147 | Ga0114129_10090903 | Ga0114129_100909031 | 398 |
| 439 | 3300009174 | Ga0105241_10039748 | Ga0105241_100397483 | 398 |
| 440 | 3300009174 | Ga0105241_10085631 | Ga0105241_100856312 | 398 |
| 441 | 3300009177 | Ga0105248_10078907 | Ga0105248_100789073 | 398 |
| 442 | 3300009177 | Ga0105248_10244393 | Ga0105248_102443932 | 398 |
| 443 | 3300009177 | Ga0105248_10267166 | Ga0105248_102671662 | 398 |
| 444 | 3300009545 | Ga0105237_10037283 | Ga0105237_100372833 | 398 |
| 445 | 3300009545 | Ga0105237_10058475 | Ga0105237_100584754 | 398 |
| 446 | 3300009545 | Ga0105237_10205408 | Ga0105237_102054082 | 398 |
| 447 | 3300009551 | Ga0105238_10009836 | Ga0105238_100098362 | 398 |
| 448 | 3300009551 | Ga0105238_10298165 | Ga0105238_102981652 | 398 |
| 449 | 3300009551 | Ga0105238_10407541 | Ga0105238_104075411 | 398 |
| 450 | 3300010159 | Ga0099796_10011117 | Ga0099796_100111172 | 398 |
| 451 | 3300010375 | Ga0105239_10017767 | Ga0105239_100177676 | 398 |
| 452 | 3300010375 | Ga0105239_10027720 | Ga0105239_100277205 | 398 |
| 453 | 3300010375 | Ga0105239_10059197 | Ga0105239_100591974 | 398 |
| 454 | 3300010375 | Ga0105239_10103968 | Ga0105239_101039683 | 398 |
| 455 | 3300011119 | Ga0105246_10027867 | Ga0105246_100278672 | 398 |
| 456 | 3300013104 | Ga0157370_10059165 | Ga0157370_100591652 | 398 |
| 457 | 3300013105 | Ga0157369_10030087 | Ga0157369_100300872 | 398 |
| 458 | 3300013105 | Ga0157369_10047249 | Ga0157369_100472494 | 398 |
| 459 | 3300013296 | Ga0157374_10087900 | Ga0157374_100879002 | 398 |
| 460 | 3300013296 | Ga0157374_10199027 | Ga0157374_101990272 | 398 |
| 461 | 3300013297 | Ga0157378_10004346 | Ga0157378_100043466 | 398 |
| 462 | 3300013297 | Ga0157378_10078233 | Ga0157378_100782332 | 398 |
| 463 | 3300013306 | Ga0163162_10069584 | Ga0163162_100695843 | 398 |
| 464 | 3300013308 | Ga0157375_10054992 | Ga0157375_100549921 | 398 |
| 465 | 3300013308 | Ga0157375_10121305 | Ga0157375_101213052 | 398 |
| 466 | 3300014325 | Ga0163163_10052220 | Ga0163163_100522202 | 398 |
| 467 | 3300014325 | Ga0163163_10160664 | Ga0163163_101606642 | 398 |
| 468 | 3300014325 | Ga0163163_10185491 | Ga0163163_101854912 | 398 |
| 469 | 3300014745 | Ga0157377_10015118 | Ga0157377_100151183 | 398 |
| 470 | 3300014968 | Ga0157379_10026231 | Ga0157379_100262315 | 398 |
| 471 | 3300014968 | Ga0157379_10287761 | Ga0157379_102877612 | 398 |
| 472 | 3300014969 | Ga0157376_10037246 | Ga0157376_100372463 | 398 |
| 473 | 3300017792 | Ga0163161_10039459 | Ga0163161_100394592 | 398 |
| 474 | 3300020069 | Ga0197907_10707499 | Ga0197907_107074992 | 398 |
| 475 | 3300021321 | Ga0214542_1000879 | Ga0214542_10008799 | 398 |
| 476 | 3300021377 | Ga0213874_10003673 | Ga0213874_100036732 | 398 |
| 477 | 3300021384 | Ga0213876_10005607 | Ga0213876_100056075 | 398 |
| 478 | 3300021441 | Ga0213871_10003817 | Ga0213871_100038171 | 398 |
| 479 | 3300025254 | Ga0209148_1000462 | Ga0209148_100046225 | 398 |
| 480 | 3300025272 | Ga0209455_1009328 | Ga0209455_10093282 | 398 |
| 481 | 3300025272 | Ga0209455_1014740 | Ga0209455_10147402 | 398 |
| 482 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011433 | 398 |
| 483 | 3300025297 | Ga0209758_1000845 | Ga0209758_10008452 | 398 |
| 484 | 3300025297 | Ga0209758_1003253 | Ga0209758_10032534 | 398 |
| 485 | 3300025297 | Ga0209758_1008620 | Ga0209758_10086202 | 398 |
| 486 | 3300025299 | Ga0209256_1008471 | Ga0209256_10084714 | 398 |
| 487 | 3300025302 | Ga0207426_1000270 | Ga0207426_100027086 | 398 |
| 488 | 3300025302 | Ga0207426_1000292 | Ga0207426_100029263 | 398 |
| 489 | 3300025302 | Ga0207426_1010723 | Ga0207426_10107232 | 398 |
| 490 | 3300025304 | Ga0209257_1001242 | Ga0209257_10012423 | 398 |
| 491 | 3300025304 | Ga0209257_1018129 | Ga0209257_10181293 | 398 |
| 492 | 3300025321 | Ga0207656_10029312 | Ga0207656_100293122 | 398 |
| 493 | 3300025885 | Ga0207653_10032516 | Ga0207653_100325162 | 398 |
| 494 | 3300025898 | Ga0207692_10001555 | Ga0207692_100015551 | 398 |
| 495 | 3300025898 | Ga0207692_10029149 | Ga0207692_100291492 | 398 |
| 496 | 3300025901 | Ga0207688_10031893 | Ga0207688_100318931 | 398 |
| 497 | 3300025904 | Ga0207647_10017643 | Ga0207647_100176432 | 398 |
| 498 | 3300025906 | Ga0207699_10000605 | Ga0207699_100006055 | 398 |
| 499 | 3300025906 | Ga0207699_10002358 | Ga0207699_100023582 | 398 |
| 500 | 3300025906 | Ga0207699_10008980 | Ga0207699_100089802 | 398 |
| 501 | 3300025906 | Ga0207699_10063547 | Ga0207699_100635472 | 398 |
| 502 | 3300025909 | Ga0207705_10097865 | Ga0207705_100978652 | 398 |
| 503 | 3300025909 | Ga0207705_10158797 | Ga0207705_101587972 | 398 |
| 504 | 3300025912 | Ga0207707_10002844 | Ga0207707_1000284412 | 398 |
| 505 | 3300025912 | Ga0207707_10007520 | Ga0207707_100075202 | 398 |
| 506 | 3300025912 | Ga0207707_10008335 | Ga0207707_100083354 | 398 |
| 507 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006505 | 398 |
| 508 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008914 | 398 |
| 509 | 3300025913 | Ga0207695_10046333 | Ga0207695_100463332 | 398 |
| 510 | 3300025913 | Ga0207695_10068273 | Ga0207695_100682733 | 398 |
| 511 | 3300025913 | Ga0207695_10089987 | Ga0207695_100899871 | 398 |
| 512 | 3300025914 | Ga0207671_10088927 | Ga0207671_100889272 | 398 |
| 513 | 3300025915 | Ga0207693_10000085 | Ga0207693_1000008535 | 398 |
| 514 | 3300025915 | Ga0207693_10005576 | Ga0207693_100055766 | 398 |
| 515 | 3300025915 | Ga0207693_10009623 | Ga0207693_100096234 | 398 |
| 516 | 3300025915 | Ga0207693_10020299 | Ga0207693_100202995 | 398 |
| 517 | 3300025915 | Ga0207693_10060930 | Ga0207693_100609302 | 398 |
| 518 | 3300025916 | Ga0207663_10000739 | Ga0207663_1000073913 | 398 |
| 519 | 3300025916 | Ga0207663_10003946 | Ga0207663_100039463 | 398 |
| 520 | 3300025916 | Ga0207663_10009965 | Ga0207663_100099652 | 398 |
| 521 | 3300025917 | Ga0207660_10023909 | Ga0207660_100239093 | 398 |
| 522 | 3300025917 | Ga0207660_10068885 | Ga0207660_100688852 | 398 |
| 523 | 3300025918 | Ga0207662_10106494 | Ga0207662_101064942 | 398 |
| 524 | 3300025919 | Ga0207657_10003303 | Ga0207657_1000330310 | 398 |
| 525 | 3300025920 | Ga0207649_10027939 | Ga0207649_100279393 | 398 |
| 526 | 3300025921 | Ga0207652_10026123 | Ga0207652_100261233 | 398 |
| 527 | 3300025921 | Ga0207652_10045400 | Ga0207652_100454002 | 398 |
| 528 | 3300025922 | Ga0207646_10258566 | Ga0207646_102585661 | 398 |
| 529 | 3300025924 | Ga0207694_10005677 | Ga0207694_100056772 | 398 |
| 530 | 3300025924 | Ga0207694_10180364 | Ga0207694_101803642 | 398 |
| 531 | 3300025924 | Ga0207694_10241511 | Ga0207694_102415111 | 398 |
| 532 | 3300025927 | Ga0207687_10018479 | Ga0207687_100184794 | 398 |
| 533 | 3300025927 | Ga0207687_10062646 | Ga0207687_100626462 | 398 |
| 534 | 3300025927 | Ga0207687_10076825 | Ga0207687_100768252 | 398 |
| 535 | 3300025928 | Ga0207700_10003531 | Ga0207700_100035312 | 398 |
| 536 | 3300025928 | Ga0207700_10011210 | Ga0207700_100112103 | 398 |
| 537 | 3300025928 | Ga0207700_10045438 | Ga0207700_100454382 | 398 |
| 538 | 3300025928 | Ga0207700_10069649 | Ga0207700_100696491 | 398 |
| 539 | 3300025929 | Ga0207664_10005139 | Ga0207664_100051398 | 398 |
| 540 | 3300025929 | Ga0207664_10159233 | Ga0207664_101592332 | 398 |
| 541 | 3300025931 | Ga0207644_10155132 | Ga0207644_101551322 | 398 |
| 542 | 3300025939 | Ga0207665_10000066 | Ga0207665_100000662 | 398 |
| 543 | 3300025939 | Ga0207665_10004190 | Ga0207665_100041906 | 398 |
| 544 | 3300025939 | Ga0207665_10042629 | Ga0207665_100426292 | 398 |
| 545 | 3300025940 | Ga0207691_10059114 | Ga0207691_100591141 | 398 |
| 546 | 3300025942 | Ga0207689_10013332 | Ga0207689_100133324 | 398 |
| 547 | 3300025944 | Ga0207661_10000917 | Ga0207661_1000091714 | 398 |
| 548 | 3300025944 | Ga0207661_10023556 | Ga0207661_100235562 | 398 |
| 549 | 3300025944 | Ga0207661_10046472 | Ga0207661_100464723 | 398 |
| 550 | 3300025949 | Ga0207667_10021239 | Ga0207667_100212397 | 398 |
| 551 | 3300025949 | Ga0207667_10033464 | Ga0207667_100334645 | 398 |
| 552 | 3300025949 | Ga0207667_10201110 | Ga0207667_102011102 | 398 |
| 553 | 3300025960 | Ga0207651_10207135 | Ga0207651_102071351 | 398 |
| 554 | 3300026023 | Ga0207677_10098362 | Ga0207677_100983621 | 398 |
| 555 | 3300026035 | Ga0207703_10026127 | Ga0207703_100261274 | 398 |
| 556 | 3300026035 | Ga0207703_10128295 | Ga0207703_101282952 | 398 |
| 557 | 3300026035 | Ga0207703_10205158 | Ga0207703_102051582 | 398 |
| 558 | 3300026041 | Ga0207639_10058471 | Ga0207639_100584712 | 398 |
| 559 | 3300026041 | Ga0207639_10158117 | Ga0207639_101581172 | 398 |
| 560 | 3300026067 | Ga0207678_10010709 | Ga0207678_100107094 | 398 |
| 561 | 3300026067 | Ga0207678_10020027 | Ga0207678_100200272 | 398 |
| 562 | 3300026067 | Ga0207678_10026116 | Ga0207678_100261162 | 398 |
| 563 | 3300026067 | Ga0207678_10047784 | Ga0207678_100477843 | 398 |
| 564 | 3300026067 | Ga0207678_10055282 | Ga0207678_100552823 | 398 |
| 565 | 3300026078 | Ga0207702_10001708 | Ga0207702_100017088 | 398 |
| 566 | 3300026078 | Ga0207702_10111571 | Ga0207702_101115713 | 398 |
| 567 | 3300026078 | Ga0207702_10301380 | Ga0207702_103013802 | 398 |
| 568 | 3300026088 | Ga0207641_10296379 | Ga0207641_102963791 | 398 |
| 569 | 3300026089 | Ga0207648_10010213 | Ga0207648_100102138 | 398 |
| 570 | 3300026116 | Ga0207674_10006543 | Ga0207674_1000654310 | 398 |
| 571 | 3300026118 | Ga0207675_100069671 | Ga0207675_1000696712 | 398 |
| 572 | 3300026118 | Ga0207675_100377031 | Ga0207675_1003770311 | 398 |
| 573 | 3300026121 | Ga0207683_10117952 | Ga0207683_101179522 | 398 |
| 574 | 3300026142 | Ga0207698_10124851 | Ga0207698_101248512 | 398 |
| 575 | 3300027296 | Ga0209389_1000001 | Ga0209389_100000123 | 398 |
| 576 | 3300027296 | Ga0209389_1000014 | Ga0209389_100001456 | 398 |
| 577 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011111 | 398 |
| 578 | 3300027357 | Ga0209589_1000020 | Ga0209589_100002056 | 398 |
| 579 | 3300027361 | Ga0209489_100012 | Ga0209489_100012111 | 398 |
| 580 | 3300027361 | Ga0209489_100060 | Ga0209489_10006015 | 398 |
| 581 | 3300027361 | Ga0209489_101114 | Ga0209489_10111438 | 398 |
| 582 | 3300027363 | Ga0209700_100007 | Ga0209700_100007381 | 398 |
| 583 | 3300027363 | Ga0209700_100019 | Ga0209700_100019111 | 398 |
| 584 | 3300027512 | Ga0209179_1002935 | Ga0209179_10029352 | 398 |
| 585 | 3300027671 | Ga0209588_1005193 | Ga0209588_10051932 | 398 |
| 586 | 3300027866 | Ga0209813_10006595 | Ga0209813_100065952 | 398 |
| 587 | 3300028379 | Ga0268266_10014609 | Ga0268266_100146093 | 398 |
| 588 | 3300028379 | Ga0268266_10163085 | Ga0268266_101630852 | 398 |
| 589 | 3300028380 | Ga0268265_10017139 | Ga0268265_100171394 | 398 |
| 590 | 3300028556 | Ga0265337_1007120 | Ga0265337_10071203 | 398 |
| 591 | 3300028563 | Ga0265319_1017390 | Ga0265319_10173901 | 398 |
| 592 | 3300028573 | Ga0265334_10007339 | Ga0265334_100073393 | 398 |
| 593 | 3300028653 | Ga0265323_10001453 | Ga0265323_100014533 | 398 |
| 594 | 3300028666 | Ga0265336_10000251 | Ga0265336_100002516 | 398 |
| 595 | 3300028786 | Ga0307517_10000386 | Ga0307517_1000038656 | 398 |
| 596 | 3300028800 | Ga0265338_10000582 | Ga0265338_100005826 | 398 |
| 597 | 3300031235 | Ga0265330_10007549 | Ga0265330_100075494 | 398 |
| 598 | 3300031238 | Ga0265332_10047350 | Ga0265332_100473502 | 398 |
| 599 | 3300031241 | Ga0265325_10015246 | Ga0265325_100152461 | 398 |
| 600 | 3300031249 | Ga0265339_10012020 | Ga0265339_100120204 | 398 |
| 601 | 3300031507 | Ga0307509_10099121 | Ga0307509_100991213 | 398 |
| 602 | 3300031616 | Ga0307508_10078529 | Ga0307508_100785292 | 398 |
| 603 | 3300031616 | Ga0307508_10099956 | Ga0307508_100999562 | 398 |
| 604 | 3300031616 | Ga0307508_10100608 | Ga0307508_101006082 | 398 |
| 605 | 3300031730 | Ga0307516_10183224 | Ga0307516_101832241 | 398 |
| 606 | 3300032126 | Ga0307415_100150974 | Ga0307415_1001509741 | 398 |
| 607 | 3300033180 | Ga0307510_10055165 | Ga0307510_100551654 | 398 |
| 608 | 3300033180 | Ga0307510_10151640 | Ga0307510_101516402 | 398 |
| 609 | 3300035083 | Ga0373926_0034888 | Ga0373926_0034888_202_1422 | 398 |
| 610 | 3300035086 | Ga0373934_0007901 | Ga0373934_0007901_2081_3301 | 398 |
| 611 | 3300035113 | Ga0373936_0014396 | Ga0373936_0014396_95_1312 | 398 |
| 612 | 3300035117 | Ga0373953_0000506 | Ga0373953_0000506_6409_7629 | 398 |
| 613 | 3300035118 | Ga0373954_0000386 | Ga0373954_0000386_4323_5543 | 398 |
| 614 | 3300035118 | Ga0373954_0014978 | Ga0373954_0014978_1663_2880 | 398 |
| 615 | 3300035119 | Ga0373956_0005816 | Ga0373956_0005816_2603_3823 | 398 |
| 616 | 3300035119 | Ga0373956_0013430 | Ga0373956_0013430_368_1585 | 398 |
| 617 | 3300035170 | Ga0373943_0002708 | Ga0373943_0002708_3073_4293 | 398 |
| 618 | 3300035171 | Ga0373946_0005868 | Ga0373946_0005868_473_1693 | 398 |
| 619 | 3300035171 | Ga0373946_0020617 | Ga0373946_0020617_520_1737 | 398 |
| 620 | 3300035172 | Ga0373955_0000286 | Ga0373955_0000286_9143_10363 | 398 |
| 621 | 3300035172 | Ga0373955_0059552 | Ga0373955_0059552_527_1744 | 398 |
| 622 | 3300035692 | Ga0373935_0001308 | Ga0373935_0001308_9328_10548 | 398 |
| 623 | 3300035695 | Ga0373927_0018861 | Ga0373927_0018861_1156_2376 | 398 |
| 624 | 3300035695 | Ga0373927_0053411 | Ga0373927_0053411_734_1954 | 398 |
| 625 | 3300035695 | Ga0373927_0094628 | Ga0373927_0094628_532_1749 | 398 |
| 626 | 3300035724 | Ga0373933_0000525 | Ga0373933_0000525_18624_19844 | 398 |
| 627 | 3300035724 | Ga0373933_0000952 | Ga0373933_0000952_8707_9927 | 398 |
| 628 | 3300035725 | Ga0373947_0012265 | Ga0373947_0012265_1670_2890 | 398 |
| 629 | 3300035725 | Ga0373947_0042908 | Ga0373947_0042908_1404_2624 | 398 |
| 630 | 3300036401 | Ga0373937_0001493 | Ga0373937_0001493_15219_16439 | 398 |
| 631 | 3300037068 | Ga0373925_0007302 | Ga0373925_0007302_3842_5059 | 398 |
| 632 | 3300037418 | Ga0395900_0001070 | Ga0395900_0001070_6273_7493 | 398 |
| 633 | 3300037466 | Ga0395898_0005530 | Ga0395898_0005530_7342_8562 | 398 |
| 634 | 3300037466 | Ga0395898_0017205 | Ga0395898_0017205_5727_6947 | 398 |
| 635 | 3300037466 | Ga0395898_0038983 | Ga0395898_0038983_3205_4425 | 398 |
| 636 | 3300037471 | Ga0395905_0007330 | Ga0395905_0007330_6058_7278 | 398 |
| 637 | 3300037471 | Ga0395905_0102640 | Ga0395905_0102640_444_1664 | 398 |
| 638 | 3300038443 | Ga0395901_0014261 | Ga0395901_0014261_4408_5628 | 398 |
| 639 | 3300038443 | Ga0395901_0015950 | Ga0395901_0015950_55_1275 | 398 |
| 640 | 3300038443 | Ga0395901_0124736 | Ga0395901_0124736_1466_2686 | 398 |
| 641 | 3300038443 | Ga0395901_0129939 | Ga0395901_0129939_1092_2312 | 398 |
| 642 | 3300038443 | Ga0395901_0185322 | Ga0395901_0185322_906_2126 | 398 |
| 643 | 3300039437 | Ga0436365_0234716 | Ga0436365_0234716_1826_3046 | 398 |
| 644 | 3300039437 | Ga0436365_1301574 | Ga0436365_1301574_583_1803 | 398 |
| 645 | 3300039438 | Ga0436360_0078764 | Ga0436360_0078764_1344_2564 | 398 |
| 646 | 3300039438 | Ga0436360_0466793 | Ga0436360_0466793_421_1641 | 398 |
| 647 | 3300039450 | Ga0436363_0383878 | Ga0436363_0383878_107_1327 | 398 |
| 648 | 3300039450 | Ga0436363_0693677 | Ga0436363_0693677_629_1849 | 398 |
| 649 | 3300039453 | Ga0436362_0187516 | Ga0436362_0187516_273_1493 | 398 |
| 650 | 3300041498 | Ga0451841_0603492 | Ga0451841_0603492_111_1331 | 398 |
| 651 | 3300044658 | Ga0466972_0000113 | Ga0466972_0000113_10971_12191 | 398 |
| 652 | 3300044684 | Ga0466966_0000094 | Ga0466966_0000094_19558_20778 | 398 |
| 653 | 3300044693 | Ga0466961_0000118 | Ga0466961_0000118_2989_4209 | 398 |
| 654 | 3300044693 | Ga0466961_0134432 | Ga0466961_0134432_201_1421 | 398 |
| 655 | 3300046454 | Ga0495592_0001573 | Ga0495592_0001573_10432_11652 | 398 |
| 656 | 3300046454 | Ga0495592_0021108 | Ga0495592_0021108_3362_4582 | 398 |
| 657 | 3300046454 | Ga0495592_0041596 | Ga0495592_0041596_594_1814 | 398 |
| 658 | 3300046454 | Ga0495592_0059415 | Ga0495592_0059415_935_2152 | 398 |
| 659 | 3300046454 | Ga0495592_0118930 | Ga0495592_0118930_483_1703 | 398 |
| 660 | 3300046454 | Ga0495592_0184676 | Ga0495592_0184676_107_1327 | 398 |
| 661 | 3300046455 | Ga0495603_0030969 | Ga0495603_0030969_639_1859 | 398 |
| 662 | 3300046455 | Ga0495603_0082601 | Ga0495603_0082601_608_1828 | 398 |
| 663 | 3300046457 | Ga0495590_0034179 | Ga0495590_0034179_480_1700 | 398 |
| 664 | 3300046459 | Ga0495629_0000133 | Ga0495629_0000133_5944_7164 | 398 |
| 665 | 3300046459 | Ga0495629_0010755 | Ga0495629_0010755_1148_2368 | 398 |
| 666 | 3300046459 | Ga0495629_0018014 | Ga0495629_0018014_3591_4811 | 398 |
| 667 | 3300046459 | Ga0495629_0048075 | Ga0495629_0048075_776_1993 | 398 |
| 668 | 3300046460 | Ga0495638_0007773 | Ga0495638_0007773_27_1247 | 398 |
| 669 | 3300046460 | Ga0495638_0092624 | Ga0495638_0092624_164_1384 | 398 |
| 670 | 3300046461 | Ga0495641_0003044 | Ga0495641_0003044_10449_11669 | 398 |
| 671 | 3300046462 | Ga0495651_0009251 | Ga0495651_0009251_1995_3215 | 398 |
| 672 | 3300046463 | Ga0495653_0001313 | Ga0495653_0001313_4333_5553 | 398 |
| 673 | 3300046463 | Ga0495653_0081656 | Ga0495653_0081656_109_1329 | 398 |
| 674 | 3300046472 | Ga0495580_0006086 | Ga0495580_0006086_2604_3821 | 398 |
| 675 | 3300046472 | Ga0495580_0172160 | Ga0495580_0172160_141_1361 | 398 |
| 676 | 3300046473 | Ga0495582_0000016 | Ga0495582_0000016_82035_83255 | 398 |
| 677 | 3300046473 | Ga0495582_0013313 | Ga0495582_0013313_2535_3752 | 398 |
| 678 | 3300046474 | Ga0495605_0031333 | Ga0495605_0031333_243_1463 | 398 |
| 679 | 3300046475 | Ga0495639_0000014 | Ga0495639_0000014_24812_26032 | 398 |
| 680 | 3300046475 | Ga0495639_0031073 | Ga0495639_0031073_892_2112 | 398 |
| 681 | 3300046476 | Ga0495662_0000086 | Ga0495662_0000086_22014_23234 | 398 |
| 682 | 3300046477 | Ga0495664_0004447 | Ga0495664_0004447_3015_4235 | 398 |
| 683 | 3300046477 | Ga0495664_0007306 | Ga0495664_0007306_1072_2292 | 398 |
| 684 | 3300046499 | Ga0495594_0000051 | Ga0495594_0000051_46366_47586 | 398 |
| 685 | 3300046499 | Ga0495594_0112428 | Ga0495594_0112428_191_1411 | 398 |
| 686 | 3300046501 | Ga0495607_0103073 | Ga0495607_0103073_105_1325 | 398 |
| 687 | 3300046507 | Ga0495606_0016667 | Ga0495606_0016667_3085_4305 | 398 |
| 688 | 3300046511 | Ga0495608_0003757 | Ga0495608_0003757_4575_5795 | 398 |
| 689 | 3300046513 | Ga0495616_0026879 | Ga0495616_0026879_1650_2870 | 398 |
| 690 | 3300046513 | Ga0495616_0049990 | Ga0495616_0049990_135_1355 | 398 |
| 691 | 3300046513 | Ga0495616_0090587 | Ga0495616_0090587_140_1360 | 398 |
| 692 | 3300046514 | Ga0495618_0114154 | Ga0495618_0114154_399_1619 | 398 |
| 693 | 3300046516 | Ga0495628_0004462 | Ga0495628_0004462_1844_3064 | 398 |
| 694 | 3300046516 | Ga0495628_0007774 | Ga0495628_0007774_3667_4887 | 398 |
| 695 | 3300046516 | Ga0495628_0010553 | Ga0495628_0010553_1162_2382 | 398 |
| 696 | 3300046522 | Ga0495643_0019976 | Ga0495643_0019976_1549_2769 | 398 |
| 697 | 3300046524 | Ga0495648_0001270 | Ga0495648_0001270_6940_8160 | 398 |
| 698 | 3300046526 | Ga0495666_0020761 | Ga0495666_0020761_841_2061 | 398 |
| 699 | 3300046529 | Ga0495652_0008371 | Ga0495652_0008371_4689_5909 | 398 |
| 700 | 3300046529 | Ga0495652_0036434 | Ga0495652_0036434_2554_3774 | 398 |
| 701 | 3300046529 | Ga0495652_0056592 | Ga0495652_0056592_520_1740 | 398 |
| 702 | 3300046529 | Ga0495652_0121007 | Ga0495652_0121007_313_1530 | 398 |
| 703 | 3300046531 | Ga0495665_0000477 | Ga0495665_0000477_6692_7912 | 398 |
| 704 | 3300046533 | Ga0495640_0001817 | Ga0495640_0001817_1176_2396 | 398 |
| 705 | 3300046533 | Ga0495640_0007412 | Ga0495640_0007412_935_2152 | 398 |
| 706 | 3300046533 | Ga0495640_0011794 | Ga0495640_0011794_1144_2364 | 398 |
| 707 | 3300046533 | Ga0495640_0015035 | Ga0495640_0015035_2668_3888 | 398 |
| 708 | 3300046536 | Ga0495587_0000862 | Ga0495587_0000862_17840_19060 | 398 |
| 709 | 3300046536 | Ga0495587_0008087 | Ga0495587_0008087_3250_4470 | 398 |
| 710 | 3300046538 | Ga0495609_0026863 | Ga0495609_0026863_1229_2449 | 398 |
| 711 | 3300046538 | Ga0495609_0077158 | Ga0495609_0077158_142_1362 | 398 |
| 712 | 3300046542 | Ga0495597_0025529 | Ga0495597_0025529_106_1326 | 398 |
| 713 | 3300046543 | Ga0495645_0024663 | Ga0495645_0024663_1101_2321 | 398 |
| 714 | 3300046543 | Ga0495645_0099885 | Ga0495645_0099885_834_2054 | 398 |
| 715 | 3300046557 | Ga0495622_0006671 | Ga0495622_0006671_395_1615 | 398 |
| 716 | 3300046557 | Ga0495622_0012877 | Ga0495622_0012877_63_1283 | 398 |
| 717 | 3300046559 | Ga0495667_0000424 | Ga0495667_0000424_7942_9162 | 398 |
| 718 | 3300046559 | Ga0495667_0015829 | Ga0495667_0015829_2814_4034 | 398 |
| 719 | 3300046559 | Ga0495667_0058901 | Ga0495667_0058901_281_1501 | 398 |
| 720 | 3300046615 | Ga0495656_0002167 | Ga0495656_0002167_4939_6159 | 398 |
| 721 | 3300046616 | Ga0495668_0019915 | Ga0495668_0019915_1986_3206 | 398 |
| 722 | 3300046616 | Ga0495668_0080465 | Ga0495668_0080465_480_1700 | 398 |
| 723 | 3300046642 | Ga0495634_0003306 | Ga0495634_0003306_4998_6218 | 398 |
| 724 | 3300046642 | Ga0495634_0006805 | Ga0495634_0006805_4358_5578 | 398 |
| 725 | 3300046660 | Ga0495625_0061107 | Ga0495625_0061107_31_1251 | 398 |
| 726 | 3300046660 | Ga0495625_0070923 | Ga0495625_0070923_519_1739 | 398 |
| 727 | 3300046663 | Ga0495635_0000792 | Ga0495635_0000792_8036_9256 | 398 |
| 728 | 3300046663 | Ga0495635_0002703 | Ga0495635_0002703_3282_4502 | 398 |
| 729 | 3300046663 | Ga0495635_0005278 | Ga0495635_0005278_113_1333 | 398 |
| 730 | 3300046663 | Ga0495635_0026165 | Ga0495635_0026165_2356_3573 | 398 |
| 731 | 3300046664 | Ga0495659_0011741 | Ga0495659_0011741_1187_2407 | 398 |
| 732 | 3300046675 | Ga0495657_0001449 | Ga0495657_0001449_3787_5007 | 398 |
| 733 | 3300046675 | Ga0495657_0013673 | Ga0495657_0013673_88_1308 | 398 |
| 734 | 3300046675 | Ga0495657_0022741 | Ga0495657_0022741_239_1459 | 398 |
| 735 | 3300046678 | Ga0495599_0000879 | Ga0495599_0000879_7501_8721 | 398 |
| 736 | 3300046678 | Ga0495599_0013798 | Ga0495599_0013798_2078_3298 | 398 |
| 737 | 3300046678 | Ga0495599_0048778 | Ga0495599_0048778_1176_2396 | 398 |
| 738 | 3300046679 | Ga0495623_0002249 | Ga0495623_0002249_4978_6198 | 398 |
| 739 | 3300046680 | Ga0495646_0002245 | Ga0495646_0002245_8450_9670 | 398 |
| 740 | 3300046680 | Ga0495646_0032854 | Ga0495646_0032854_975_2195 | 398 |
| 741 | 3300046680 | Ga0495646_0105597 | Ga0495646_0105597_248_1465 | 398 |
| 742 | 3300046683 | Ga0495658_0001354 | Ga0495658_0001354_2793_4013 | 398 |
| 743 | 3300046683 | Ga0495658_0044624 | Ga0495658_0044624_1217_2434 | 398 |
| 744 | 3300046689 | Ga0495613_0006655 | Ga0495613_0006655_4249_5469 | 398 |
| 745 | 3300046689 | Ga0495613_0024354 | Ga0495613_0024354_943_2163 | 398 |
| 746 | 3300046690 | Ga0495624_0000138 | Ga0495624_0000138_6393_7613 | 398 |
| 747 | 3300046690 | Ga0495624_0010671 | Ga0495624_0010671_3499_4716 | 398 |
| 748 | 3300046692 | Ga0495671_0053471 | Ga0495671_0053471_86_1306 | 398 |
| 749 | 3300046694 | Ga0495649_0042779 | Ga0495649_0042779_324_1544 | 398 |
| 750 | 3300046809 | Ga0495600_0000337 | Ga0495600_0000337_3787_5007 | 398 |
| 751 | 3300046809 | Ga0495600_0005193 | Ga0495600_0005193_3877_5097 | 398 |
| 752 | 3300046809 | Ga0495600_0151690 | Ga0495600_0151690_81_1301 | 398 |
| 753 | 3300047315 | Ga0495581_0000001 | Ga0495581_0000001_73159_74379 | 398 |
| 754 | 3300047315 | Ga0495581_0081996 | Ga0495581_0081996_333_1553 | 398 |
| 755 | 3300047317 | Ga0495604_0001626 | Ga0495604_0001626_10248_11468 | 398 |
| 756 | 3300047317 | Ga0495604_0017599 | Ga0495604_0017599_3547_4767 | 398 |
| 757 | 3300047317 | Ga0495604_0169005 | Ga0495604_0169005_234_1451 | 398 |
| 758 | 3300047319 | Ga0495674_0002545 | Ga0495674_0002545_11790_13010 | 398 |
| 759 | 3300047319 | Ga0495674_0018873 | Ga0495674_0018873_3084_4304 | 398 |
| 760 | 3300047319 | Ga0495674_0145940 | Ga0495674_0145940_205_1422 | 398 |
| 761 | 3300047321 | Ga0495676_0003317 | Ga0495676_0003317_7609_8829 | 398 |
| 762 | 3300047321 | Ga0495676_0143571 | Ga0495676_0143571_242_1459 | 398 |
| 763 | 3300047322 | Ga0495680_0005089 | Ga0495680_0005089_462_1682 | 398 |
| 764 | 3300047322 | Ga0495680_0156052 | Ga0495680_0156052_21_1241 | 398 |
| 765 | 3300047443 | Ga0495687_014891 | Ga0495687_014891_1678_2898 | 398 |
| 766 | 3300047444 | Ga0495675_0012328 | Ga0495675_0012328_4027_5247 | 398 |
| 767 | 3300047444 | Ga0495675_0024995 | Ga0495675_0024995_2085_3305 | 398 |
| 768 | 3300047444 | Ga0495675_0035435 | Ga0495675_0035435_378_1598 | 398 |
| 769 | 3300047469 | Ga0495673_0069111 | Ga0495673_0069111_67_1287 | 398 |
| 770 | 3300047471 | Ga0495684_0001407 | Ga0495684_0001407_3283_4503 | 398 |
| 771 | 3300047471 | Ga0495684_0005971 | Ga0495684_0005971_4566_5783 | 398 |
| 772 | 3300047673 | Ga0495593_0000003 | Ga0495593_0000003_119290_120510 | 398 |
| 773 | 3300047673 | Ga0495593_0002446 | Ga0495593_0002446_6958_8178 | 398 |
| 774 | 3300048088 | Ga0495602_0007241 | Ga0495602_0007241_1934_3154 | 398 |
| 775 | 3300048088 | Ga0495602_0019961 | Ga0495602_0019961_3243_4463 | 398 |
| 776 | 3300048088 | Ga0495602_0039312 | Ga0495602_0039312_2889_4109 | 398 |
| 777 | 3300048088 | Ga0495602_0115379 | Ga0495602_0115379_889_2109 | 398 |
| 778 | 3300048089 | Ga0495614_0006055 | Ga0495614_0006055_2151_3371 | 398 |
| 779 | 3300048903 | Ga0496100_0007585 | Ga0496100_0007585_736_1956 | 398 |
| 780 | 3300048903 | Ga0496100_0042150 | Ga0496100_0042150_540_1760 | 398 |
| 781 | 3300048904 | Ga0496101_0127876 | Ga0496101_0127876_228_1448 | 398 |
| 782 | 3300048905 | Ga0496102_0014231 | Ga0496102_0014231_4704_5924 | 398 |
| 783 | 3300048905 | Ga0496102_0018355 | Ga0496102_0018355_398_1618 | 398 |
| 784 | 3300048905 | Ga0496102_0083203 | Ga0496102_0083203_1034_2251 | 398 |
| 785 | 3300048906 | Ga0496103_0022816 | Ga0496103_0022816_888_2108 | 398 |
| 786 | 3300048907 | Ga0496104_0022932 | Ga0496104_0022932_4245_5465 | 398 |
| 787 | 3300048907 | Ga0496104_0024758 | Ga0496104_0024758_4280_5500 | 398 |
| 788 | 3300048907 | Ga0496104_0036043 | Ga0496104_0036043_93_1313 | 398 |
| 789 | 3300048907 | Ga0496104_0073880 | Ga0496104_0073880_750_1970 | 398 |
| 790 | 3300048907 | Ga0496104_0203556 | Ga0496104_0203556_641_1861 | 398 |
| 791 | 3300048908 | Ga0496105_0002092 | Ga0496105_0002092_6886_8106 | 398 |
| 792 | 3300048908 | Ga0496105_0041425 | Ga0496105_0041425_902_2122 | 398 |
| 793 | 3300048908 | Ga0496105_0044963 | Ga0496105_0044963_2099_3319 | 398 |
| 794 | 3300048908 | Ga0496105_0050731 | Ga0496105_0050731_380_1600 | 398 |
| 795 | 3300048909 | Ga0496106_0001202 | Ga0496106_0001202_12467_13687 | 398 |
| 796 | 3300048909 | Ga0496106_0011446 | Ga0496106_0011446_4491_5711 | 398 |
| 797 | 3300048909 | Ga0496106_0015453 | Ga0496106_0015453_1084_2304 | 398 |
| 798 | 3300048909 | Ga0496106_0018182 | Ga0496106_0018182_3311_4531 | 398 |
| 799 | 3300048909 | Ga0496106_0068108 | Ga0496106_0068108_531_1751 | 398 |
| 800 | 3300048910 | Ga0496107_0009825 | Ga0496107_0009825_4589_5809 | 398 |
| 801 | 3300048910 | Ga0496107_0011885 | Ga0496107_0011885_828_2048 | 398 |
| 802 | 3300048911 | Ga0496108_0001960 | Ga0496108_0001960_12095_13315 | 398 |
| 803 | 3300048911 | Ga0496108_0050815 | Ga0496108_0050815_303_1523 | 398 |
| 804 | 3300048911 | Ga0496108_0180764 | Ga0496108_0180764_397_1617 | 398 |
| 805 | 3300048912 | Ga0496109_0000432 | Ga0496109_0000432_18261_19481 | 398 |
| 806 | 3300048912 | Ga0496109_0010188 | Ga0496109_0010188_6199_7419 | 398 |
| 807 | 3300048912 | Ga0496109_0055955 | Ga0496109_0055955_690_1910 | 398 |
| 808 | 3300048912 | Ga0496109_0234299 | Ga0496109_0234299_356_1576 | 398 |
| 809 | 3300048913 | Ga0496110_0012555 | Ga0496110_0012555_3833_5053 | 398 |
| 810 | 3300048913 | Ga0496110_0027219 | Ga0496110_0027219_2932_4152 | 398 |
| 811 | 3300048913 | Ga0496110_0029803 | Ga0496110_0029803_1221_2441 | 398 |
| 812 | 3300048913 | Ga0496110_0187050 | Ga0496110_0187050_517_1737 | 398 |
| 813 | 3300048914 | Ga0496111_0013188 | Ga0496111_0013188_187_1407 | 398 |
| 814 | 3300048914 | Ga0496111_0039393 | Ga0496111_0039393_697_1917 | 398 |
| 815 | 3300048914 | Ga0496111_0091744 | Ga0496111_0091744_677_1897 | 398 |
| 816 | 3300048915 | Ga0496112_0015915 | Ga0496112_0015915_3488_4708 | 398 |
| 817 | 3300048915 | Ga0496112_0033682 | Ga0496112_0033682_1314_2534 | 398 |
| 818 | 3300048915 | Ga0496112_0061568 | Ga0496112_0061568_1842_3062 | 398 |
| 819 | 3300048915 | Ga0496112_0100707 | Ga0496112_0100707_750_1970 | 398 |
| 820 | 3300048915 | Ga0496112_0112903 | Ga0496112_0112903_1024_2244 | 398 |
| 821 | 3300048915 | Ga0496112_0194315 | Ga0496112_0194315_315_1535 | 398 |
| 822 | 3300048915 | Ga0496112_0206592 | Ga0496112_0206592_225_1445 | 398 |
| 823 | 3300048916 | Ga0496113_0014649 | Ga0496113_0014649_2767_3987 | 398 |
| 824 | 3300048916 | Ga0496113_0032600 | Ga0496113_0032600_2085_3305 | 398 |
| 825 | 3300048918 | Ga0496115_0009310 | Ga0496115_0009310_2474_3694 | 398 |
| 826 | 3300048918 | Ga0496115_0033310 | Ga0496115_0033310_1794_3014 | 398 |
| 827 | 3300048918 | Ga0496115_0078069 | Ga0496115_0078069_220_1440 | 398 |
| 828 | 3300048918 | Ga0496115_0133099 | Ga0496115_0133099_739_1959 | 398 |
| 829 | 3300048921 | Ga0496118_0019947 | Ga0496118_0019947_3001_4221 | 398 |
| 830 | 3300048921 | Ga0496118_0029396 | Ga0496118_0029396_49_1269 | 398 |
| 831 | 3300048921 | Ga0496118_0036940 | Ga0496118_0036940_1303_2538 | 398 |
| 832 | 3300048921 | Ga0496118_0134801 | Ga0496118_0134801_225_1445 | 398 |
| 833 | 3300048922 | Ga0496119_0013953 | Ga0496119_0013953_1548_2768 | 398 |
| 834 | 3300048923 | Ga0496120_0007436 | Ga0496120_0007436_6265_7485 | 398 |
| 835 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_114672_115892 | 398 |
| 836 | 3300048924 | Ga0496121_0003563 | Ga0496121_0003563_4372_5592 | 398 |
| 837 | 3300048924 | Ga0496121_0005352 | Ga0496121_0005352_3074_4300 | 398 |
| 838 | 3300048924 | Ga0496121_0009890 | Ga0496121_0009890_1351_2571 | 398 |
| 839 | 3300048924 | Ga0496121_0028205 | Ga0496121_0028205_1729_2964 | 398 |
| 840 | 3300048924 | Ga0496121_0039020 | Ga0496121_0039020_2745_3965 | 398 |
| 841 | 3300048924 | Ga0496121_0100982 | Ga0496121_0100982_31_1251 | 398 |
| 842 | 3300048924 | Ga0496121_0111107 | Ga0496121_0111107_313_1533 | 398 |
| 843 | 3300048925 | Ga0496122_0030990 | Ga0496122_0030990_3083_4303 | 398 |
| 844 | 3300048927 | Ga0496124_0000624 | Ga0496124_0000624_19492_20712 | 398 |
| 845 | 3300048928 | Ga0496125_0036744 | Ga0496125_0036744_30_1250 | 398 |
| 846 | 3300048928 | Ga0496125_0040200 | Ga0496125_0040200_1056_2276 | 398 |
| 847 | 3300048928 | Ga0496125_0053440 | Ga0496125_0053440_884_2104 | 398 |
| 848 | 3300048928 | Ga0496125_0075947 | Ga0496125_0075947_1197_2432 | 398 |
| 849 | 3300048929 | Ga0496126_0002321 | Ga0496126_0002321_16042_17262 | 398 |
| 850 | 3300048929 | Ga0496126_0008801 | Ga0496126_0008801_2029_3249 | 398 |
| 851 | 3300048929 | Ga0496126_0010022 | Ga0496126_0010022_2170_3390 | 398 |
| 852 | 3300048929 | Ga0496126_0015516 | Ga0496126_0015516_2127_3347 | 398 |
| 853 | 3300048929 | Ga0496126_0018293 | Ga0496126_0018293_1004_2224 | 398 |
| 854 | 3300048929 | Ga0496126_0029558 | Ga0496126_0029558_2710_3930 | 398 |
| 855 | 3300048929 | Ga0496126_0030071 | Ga0496126_0030071_2190_3410 | 398 |
| 856 | 3300048929 | Ga0496126_0032840 | Ga0496126_0032840_1219_2439 | 398 |
| 857 | 3300048929 | Ga0496126_0198822 | Ga0496126_0198822_240_1460 | 398 |
| 858 | 3300048929 | Ga0496126_0206653 | Ga0496126_0206653_337_1557 | 398 |
| 859 | 3300048929 | Ga0496126_0255689 | Ga0496126_0255689_107_1327 | 398 |
| 860 | 3300049569 | Ga0501032_0005102 | Ga0501032_0005102_2086_3306 | 398 |
| 861 | 3300049569 | Ga0501032_0076754 | Ga0501032_0076754_697_1917 | 398 |
| 862 | 3300049570 | Ga0501033_0001834 | Ga0501033_0001834_8470_9690 | 398 |
| 863 | 3300049570 | Ga0501033_0051989 | Ga0501033_0051989_1636_2856 | 398 |
| 864 | 3300049571 | Ga0501034_0001471 | Ga0501034_0001471_21175_22428 | 398 |
| 865 | 3300049571 | Ga0501034_0134384 | Ga0501034_0134384_344_1564 | 398 |
| 866 | 3300049572 | Ga0501036_0050117 | Ga0501036_0050117_1043_2263 | 398 |
| 867 | 3300049573 | Ga0501037_0005747 | Ga0501037_0005747_2072_3292 | 398 |
| 868 | 3300049573 | Ga0501037_0086729 | Ga0501037_0086729_865_2085 | 398 |
| 869 | 3300049574 | Ga0501038_0002435 | Ga0501038_0002435_11866_13086 | 398 |
| 870 | 3300049574 | Ga0501038_0014916 | Ga0501038_0014916_3248_4468 | 398 |
| 871 | 3300049574 | Ga0501038_0042310 | Ga0501038_0042310_638_1858 | 398 |
| 872 | 3300049575 | Ga0501039_0010117 | Ga0501039_0010117_4979_6199 | 398 |
| 873 | 3300049576 | Ga0501040_0054616 | Ga0501040_0054616_1086_2306 | 398 |
| 874 | 3300049578 | Ga0501042_0045227 | Ga0501042_0045227_432_1652 | 398 |
| 875 | 3300049579 | Ga0501043_0019449 | Ga0501043_0019449_2370_3590 | 398 |
| 876 | 3300049579 | Ga0501043_0061463 | Ga0501043_0061463_1573_2793 | 398 |
| 877 | 3300049580 | Ga0501046_0007012 | Ga0501046_0007012_2001_3221 | 398 |
| 878 | 3300049580 | Ga0501046_0075087 | Ga0501046_0075087_688_1908 | 398 |
| 879 | 3300049581 | Ga0501047_0014876 | Ga0501047_0014876_3896_5116 | 398 |
| 880 | 3300049581 | Ga0501047_0140691 | Ga0501047_0140691_986_2206 | 398 |
| 881 | 3300049582 | Ga0501048_0006412 | Ga0501048_0006412_455_1675 | 398 |
| 882 | 3300049584 | Ga0501068_0024706 | Ga0501068_0024706_83_1303 | 398 |
| 883 | 3300049590 | Ga0501074_0149427 | Ga0501074_0149427_181_1401 | 398 |
| 884 | 3300049592 | Ga0501076_0100259 | Ga0501076_0100259_538_1758 | 398 |
| 885 | 3300049741 | Ga0501079_0236102 | Ga0501079_0236102_28_1248 | 398 |
| 886 | 3300049742 | Ga0501080_0088666 | Ga0501080_0088666_598_1818 | 398 |
| 887 | 3300049742 | Ga0501080_0108978 | Ga0501080_0108978_289_1509 | 398 |
| 888 | 3300049822 | Ga0501035_0002268 | Ga0501035_0002268_12180_13400 | 398 |
| 889 | 3300049822 | Ga0501035_0026433 | Ga0501035_0026433_1242_2462 | 398 |
| 890 | 3300049823 | Ga0501044_0007852 | Ga0501044_0007852_7890_9110 | 398 |
| 891 | 3300049824 | Ga0501045_0032361 | Ga0501045_0032361_1331_2551 | 398 |
| 892 | 3300050492 | nmdc:mga0yw44_23996_c1 | nmdc:mga0yw44_23996_c1_497_1717 | 398 |
| 893 | 3300050492 | nmdc:mga0yw44_31714_c1 | nmdc:mga0yw44_31714_c1_1340_2560 | 398 |
| 894 | 3300050492 | nmdc:mga0yw44_5423_c1 | nmdc:mga0yw44_5423_c1_4093_5313 | 398 |
| 895 | 3300050494 | nmdc:mga06z11_27907_c1 | nmdc:mga06z11_27907_c1_250_1470 | 398 |
| 896 | 3300050515 | nmdc:mga0a205_317757_c1 | nmdc:mga0a205_317757_c1_12_1232 | 398 |
| 897 | 3300050516 | nmdc:mga0sz30_14368_c1 | nmdc:mga0sz30_14368_c1_122_1342 | 398 |
| 898 | 3300050516 | nmdc:mga0sz30_64384_c1 | nmdc:mga0sz30_64384_c1_141_1361 | 398 |
| 899 | 3300053077 | Ga0495601_0054028 | Ga0495601_0054028_134_1354 | 398 |
| 900 | 3300053080 | Ga0500635_0015520 | Ga0500635_0015520_532_1752 | 398 |
| 901 | 3300053084 | Ga0495595_0003281 | Ga0495595_0003281_647_1867 | 398 |
| 902 | 3300053085 | Ga0495619_0076189 | Ga0495619_0076189_415_1635 | 398 |
| 903 | 3300053085 | Ga0495619_0159548 | Ga0495619_0159548_263_1483 | 398 |
| 904 | 3300053087 | Ga0500643_001180 | Ga0500643_001180_10215_11435 | 398 |
| 905 | 3300053091 | Ga0500647_0036075 | Ga0500647_0036075_675_1895 | 398 |
| 906 | 3300053091 | Ga0500647_0095598 | Ga0500647_0095598_176_1396 | 398 |
| 907 | 3300053092 | Ga0500583_0079752 | Ga0500583_0079752_300_1520 | 398 |
| 908 | 3300053094 | Ga0500566_0000062 | Ga0500566_0000062_5016_6236 | 398 |
| 909 | 3300053094 | Ga0500566_0000112 | Ga0500566_0000112_11266_12486 | 398 |
| 910 | 3300053094 | Ga0500566_0002624 | Ga0500566_0002624_7810_9030 | 398 |
| 911 | 3300053095 | Ga0500640_000394 | Ga0500640_000394_4213_5433 | 398 |
| 912 | 3300053102 | Ga0500554_001136 | Ga0500554_001136_2473_3693 | 398 |
| 913 | 3300053104 | Ga0500556_0000750 | Ga0500556_0000750_16439_17662 | 398 |
| 914 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_151277_152497 | 398 |
| 915 | 3300053108 | Ga0500562_023587 | Ga0500562_023587_313_1533 | 398 |
| 916 | 3300053111 | Ga0500572_000239 | Ga0500572_000239_5227_6462 | 398 |
| 917 | 3300053111 | Ga0500572_000775 | Ga0500572_000775_5045_6265 | 398 |
| 918 | 3300053115 | Ga0500591_066690 | Ga0500591_066690_246_1466 | 398 |
| 919 | 3300053119 | Ga0500595_017745 | Ga0500595_017745_928_2148 | 398 |
| 920 | 3300053119 | Ga0500595_031296 | Ga0500595_031296_36_1256 | 398 |
| 921 | 3300053130 | Ga0500642_0002011 | Ga0500642_0002011_3477_4697 | 398 |
| 922 | 3300053130 | Ga0500642_0025721 | Ga0500642_0025721_690_1910 | 398 |
| 923 | 3300053136 | Ga0500559_0001790 | Ga0500559_0001790_5887_7122 | 398 |
| 924 | 3300053136 | Ga0500559_0004994 | Ga0500559_0004994_3733_4953 | 398 |
| 925 | 3300053150 | Ga0500603_001625 | Ga0500603_001625_2613_3833 | 398 |
| 926 | 3300053156 | Ga0500622_0025785 | Ga0500622_0025785_1274_2494 | 398 |
| 927 | 3300053158 | Ga0500627_0051117 | Ga0500627_0051117_47_1267 | 398 |
| 928 | 3300053159 | Ga0500630_003625 | Ga0500630_003625_5016_6236 | 398 |
| 929 | 3300053162 | Ga0500638_001061 | Ga0500638_001061_1854_3074 | 398 |
| 930 | 3300053163 | Ga0500639_000061 | Ga0500639_000061_17421_18641 | 398 |
| 931 | 3300053177 | Ga0500636_0000284 | Ga0500636_0000284_24540_25760 | 398 |
| 932 | 3300053177 | Ga0500636_0023548 | Ga0500636_0023548_1367_2602 | 398 |
| 933 | 3300053178 | Ga0500637_0000098 | Ga0500637_0000098_9079_10299 | 398 |
| 934 | 3300053729 | Ga0500625_000220 | Ga0500625_000220_6771_7991 | 398 |
| 935 | 3300053735 | Ga0500596_000699 | Ga0500596_000699_303_1523 | 398 |
| 936 | 3300053735 | Ga0500596_000998 | Ga0500596_000998_1200_2420 | 398 |
| 937 | 3300053735 | Ga0500596_003937 | Ga0500596_003937_1031_2266 | 398 |
| 938 | 3300053737 | Ga0500601_000233 | Ga0500601_000233_3636_4856 | 398 |
| 939 | 3300053737 | Ga0500601_001561 | Ga0500601_001561_913_2148 | 398 |
| 940 | 3300054114 | Ga0501084_0076301 | Ga0501084_0076301_585_1805 | 398 |
| 941 | iso_pu_bacteria | 2507262055 | 2507507555 | 398 |
| 942 | 3300037312 | Ga0395899_0058078 | Ga0395899_0058078_253_1473 | 399 |
| 943 | 3300049572 | Ga0501036_0053755 | Ga0501036_0053755_1255_2475 | 399 |
| 944 | 3300049579 | Ga0501043_0020212 | Ga0501043_0020212_3179_4399 | 399 |
| 945 | 3300049581 | Ga0501047_0082968 | Ga0501047_0082968_1541_2761 | 399 |
| 946 | 3300049822 | Ga0501035_0055661 | Ga0501035_0055661_1295_2515 | 399 |
| 947 | 3300049823 | Ga0501044_0020966 | Ga0501044_0020966_2597_3817 | 399 |
| 948 | iso_pu_bacteria | 2513237141 | 2513894154 | 399 |
| 949 | 3300001989 | JGI24739J22299_10002391 | JGI24739J22299_100023912 | 400 |
| 950 | 3300001990 | JGI24737J22298_10008032 | JGI24737J22298_100080322 | 400 |
| 951 | 3300005457 | Ga0070662_100010158 | Ga0070662_1000101584 | 400 |
| 952 | 3300005539 | Ga0068853_100022387 | Ga0068853_1000223873 | 400 |
| 953 | 3300005563 | Ga0068855_100021640 | Ga0068855_1000216405 | 400 |
| 954 | 3300005577 | Ga0068857_100015877 | Ga0068857_1000158775 | 400 |
| 955 | 3300005614 | Ga0068856_100019754 | Ga0068856_1000197545 | 400 |
| 956 | 3300010375 | Ga0105239_10003585 | Ga0105239_100035855 | 400 |
| 957 | 3300010375 | Ga0105239_10003896 | Ga0105239_100038962 | 400 |
| 958 | 3300013100 | Ga0157373_10052924 | Ga0157373_100529242 | 400 |
| 959 | 3300025904 | Ga0207647_10000496 | Ga0207647_1000049617 | 400 |
| 960 | 3300025912 | Ga0207707_10133882 | Ga0207707_101338822 | 400 |
| 961 | 3300025913 | Ga0207695_10011660 | Ga0207695_100116605 | 400 |
| 962 | 3300025919 | Ga0207657_10016929 | Ga0207657_100169293 | 400 |
| 963 | 3300025921 | Ga0207652_10115771 | Ga0207652_101157712 | 400 |
| 964 | 3300025924 | Ga0207694_10003295 | Ga0207694_100032958 | 400 |
| 965 | 3300025933 | Ga0207706_10041553 | Ga0207706_100415532 | 400 |
| 966 | 3300025949 | Ga0207667_10003981 | Ga0207667_100039815 | 400 |
| 967 | 3300026041 | Ga0207639_10004828 | Ga0207639_100048286 | 400 |
| 968 | 3300026078 | Ga0207702_10008470 | Ga0207702_100084705 | 400 |
| 969 | 3300026116 | Ga0207674_10023678 | Ga0207674_100236784 | 400 |
| 970 | 3300026142 | Ga0207698_10029719 | Ga0207698_100297193 | 400 |
| 971 | 3300031711 | Ga0265314_10010113 | Ga0265314_100101133 | 400 |
| 972 | 3300049742 | Ga0501080_0130979 | Ga0501080_0130979_683_1906 | 400 |
| 973 | 3300010375 | Ga0105239_10431802 | Ga0105239_104318021 | 401 |
| 974 | 3300031730 | Ga0307516_10180578 | Ga0307516_101805781 | 401 |
| 975 | 3300048927 | Ga0496124_0040676 | Ga0496124_0040676_1260_2504 | 401 |
| 976 | 3300048928 | Ga0496125_0092232 | Ga0496125_0092232_296_1540 | 401 |
| 977 | 3300031456 | Ga0307513_10216665 | Ga0307513_102166651 | 402 |
| 978 | 3300033180 | Ga0307510_10017574 | Ga0307510_100175742 | 402 |
| 979 | 3300046477 | Ga0495664_0145578 | Ga0495664_0145578_74_1306 | 402 |
| 980 | 3300046516 | Ga0495628_0184958 | Ga0495628_0184958_203_1435 | 402 |
| 981 | 3300046683 | Ga0495658_0048318 | Ga0495658_0048318_1124_2356 | 402 |
| 982 | 3300047319 | Ga0495674_0311730 | Ga0495674_0311730_28_1260 | 402 |
| 983 | 3300048907 | Ga0496104_0130155 | Ga0496104_0130155_1084_2316 | 402 |
| 984 | 3300053077 | Ga0495601_0112208 | Ga0495601_0112208_255_1487 | 402 |
| 985 | 3300053123 | Ga0500614_021021 | Ga0500614_021021_130_1362 | 402 |
| 986 | 3300028379 | Ga0268266_10200158 | Ga0268266_102001582 | 403 |
| 987 | 3300039447 | Ga0436361_1169803 | Ga0436361_1169803_2733_3968 | 403 |
| 988 | 3300044765 | Ga0466970_0058039 | Ga0466970_0058039_340_1575 | 403 |
| 989 | 3300009551 | Ga0105238_10002659 | Ga0105238_100026595 | 404 |
| 990 | 3300031250 | Ga0265331_10046688 | Ga0265331_100466882 | 411 |
| 991 | 3300031711 | Ga0265314_10017398 | Ga0265314_100173982 | 411 |
| 992 | 3300031712 | Ga0265342_10002383 | Ga0265342_100023838 | 411 |
| 993 | 3300037466 | Ga0395898_0147538 | Ga0395898_0147538_220_1476 | 411 |
| 994 | 3300005530 | Ga0070679_100094456 | Ga0070679_1000944562 | 414 |
| 995 | 3300013104 | Ga0157370_10202043 | Ga0157370_102020432 | 414 |
| 996 | 3300033442 | Ga0315911_1000002 | Ga0315911_100000225 | 417 |
| 997 | iso_pu_bacteria | 2513237096 | 2513654195 | 417 |
| 998 | iso_pu_bacteria | 2513237145 | 2513918535 | 417 |
| 999 | iso_pu_bacteria | 2517572143 | 2517891229 | 417 |
| 1000 | iso_pu_bacteria | 2667528175 | 2671123164 | 417 |
| 1001 | iso_pu_bacteria | 3005474847 | 3005481375 | 417 |
| 1002 | 3300005439 | Ga0070711_100013974 | Ga0070711_1000139742 | 418 |
| 1003 | 3300001979 | JGI24740J21852_10004915 | JGI24740J21852_100049153 | 422 |
| 1004 | 3300005455 | Ga0070663_100015280 | Ga0070663_1000152802 | 422 |
| 1005 | 3300005539 | Ga0068853_100007930 | Ga0068853_1000079306 | 422 |
| 1006 | 3300005577 | Ga0068857_100050153 | Ga0068857_1000501533 | 422 |
| 1007 | 3300005614 | Ga0068856_100001867 | Ga0068856_10000186715 | 422 |
| 1008 | 3300005616 | Ga0068852_100014573 | Ga0068852_1000145735 | 422 |
| 1009 | 3300005834 | Ga0068851_10000250 | Ga0068851_1000025016 | 422 |
| 1010 | 3300009093 | Ga0105240_10016971 | Ga0105240_100169718 | 422 |
| 1011 | 3300009174 | Ga0105241_10005015 | Ga0105241_100050155 | 422 |
| 1012 | 3300009551 | Ga0105238_10006063 | Ga0105238_1000606311 | 422 |
| 1013 | 3300025911 | Ga0207654_10000634 | Ga0207654_1000063411 | 422 |
| 1014 | 3300025913 | Ga0207695_10002936 | Ga0207695_100029369 | 422 |
| 1015 | 3300025924 | Ga0207694_10000119 | Ga0207694_1000011925 | 422 |
| 1016 | 3300026041 | Ga0207639_10005470 | Ga0207639_100054707 | 422 |
| 1017 | 3300026078 | Ga0207702_10000002 | Ga0207702_1000000225 | 422 |
| 1018 | 3300026116 | Ga0207674_10009969 | Ga0207674_100099698 | 422 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c0i-assembly1.cif.gz_A | crystal structure of d-amino acid oxidase in complex with two anthranylate molecules | 1.003 | 167 | 195 |
| 1sez-assembly1.cif.gz_A | crystal structure of protoporphyrinogen ix oxidase | 0.9967 | 167 | 201 |
| 6lqc-assembly1.cif.gz_A | crystal structure of cyclohexylamine oxidase from erythrobacteraceae bacterium | 0.9919 | 169 | 201 |
| 3fg2-assembly1.cif.gz_P | crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris | 0.9868 | 26 | 422 |
| 1q1r-assembly1.cif.gz_A | crystal structure of putidaredoxin reductase from pseudomonas putida | 0.9749 | 27 | 421 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5VQP1_29_415_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9992 | 169 | 202 | 3.50.50.60 |
| af_Q0D7W4_71_358_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.991 | 168 | 201 | 3.50.50.60 |
| 3fg2P02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9891 | 137 | 255 | 3.50.50.60 |
| af_A0A1D6LYX0_29_117_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9868 | 167 | 228 | 3.50.50.60 |
| af_A0A1D6HRY4_17_247_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9838 | 168 | 198 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840GUG1-F1-model_v4 | 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit (EC 1.18.1.3) | 0.9929 | 27 | 422 |
GO:0005737
GO:0016651 GO:0051213 |
| AF-B3QHG5-F1-model_v4 | deleted | 0.9886 | 27 | 422 |
|
| AF-A0A431R372-F1-model_v4 | deleted | 0.988 | 27 | 217 |
|
| AF-A0A6M6JJ77-F1-model_v4 | FAD-dependent oxidoreductase | 0.9873 | 28 | 421 |
GO:0005737
GO:0016651 |
| AF-A0A2G8MD65-F1-model_v4 | deleted | 0.9853 | 178 | 421 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar