F488299

General Info

Members Datasets Scaffolds Average Seq Length
1017 365 2034 114

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_171652_c1|nmdc:mga0rr50_171652_c1_429_833
Length 134
Sequence VLPGDRIIPTDRILNQSTGVEMVQSAVADEVFYALSNATRRKVLEQLSVGPATVSELAAPFDMKLPSFVQHLSVLERSRLVKSKKRGRVRTYVIAPERFKVVEDWLTARRALWEARLDQFDQYVKQLKEKESAS

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
230 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
231 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
232 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
233 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
240 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
245 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
248 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
281 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
297 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
298 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
315 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
316 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
317 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
318 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
319 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
320 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
321 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
322 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
323 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
326 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
327 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
328 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
329 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
330 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
331 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
334 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
335 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
336 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
337 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
338 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
339 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
340 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
341 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
354 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
355 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0
Rhizoplane 2.75
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_171652_c1 3300050513 Bacteria 1767
2 JGI24737J22298_10236793 3300001990 Unclassified 539
3 JGI24035J26624_1011242 3300002126 Bacteria 895
4 JGI25159J45721_1024851 3300002987 Bacteria 1058
5 JGI25151J46595_10086933 3300003187 Bacteria 884
6 Ga0055526_1012111 3300003771 Bacteria 3799
7 Ga0055524_1000951 3300003775 Bacteria 18374
8 Ga0055524_1001641 3300003775 Bacteria 12477
9 Ga0055536_1014134 3300003781 Bacteria 2826
10 Ga0055534_1008563 3300003784 Bacteria 2304
11 Ga0055528_1036653 3300003790 Bacteria 1167
12 Ga0055530_10005594 3300003791 Bacteria 5909
13 Ga0055531_10001261 3300003794 Bacteria 19149
14 Ga0055531_10002230 3300003794 Bacteria 13134
15 Ga0055531_10003072 3300003794 Bacteria 10796
16 Ga0055531_10010188 3300003794 Bacteria 4705
17 Ga0055531_10030703 3300003794 Bacteria 1796
18 Ga0065704_10294183 3300005289 Bacteria 894
19 Ga0065712_10008022 3300005290 Bacteria 2498
20 Ga0065712_10024919 3300005290 Bacteria 1196
21 Ga0065712_10078049 3300005290 Bacteria 3403
22 Ga0065712_10173609 3300005290 Bacteria 1230
23 Ga0065712_10316965 3300005290 Bacteria 834
24 Ga0065715_10348131 3300005293 Bacteria 955
25 Ga0065715_10393698 3300005293 Bacteria 891
26 Ga0065715_11103161 3300005293 Bacteria 519
27 Ga0065707_10110278 3300005295 Bacteria 2436
28 Ga0065707_10115019 3300005295 Bacteria 2279
29 Ga0065707_10122585 3300005295 Bacteria 2085
30 Ga0065707_10140491 3300005295 Bacteria 1754
31 Ga0065707_10531151 3300005295 Bacteria 735
32 Ga0070658_10033753 3300005327 Bacteria 4117
33 Ga0070658_10219627 3300005327 Bacteria 1607
34 Ga0070658_10708727 3300005327 Bacteria 874
35 Ga0070658_10794943 3300005327 Bacteria 822
36 Ga0070658_10917744 3300005327 Bacteria 761
37 Ga0070676_10047197 3300005328 Bacteria 2514
38 Ga0070676_10552157 3300005328 Bacteria 825
39 Ga0070676_11102439 3300005328 Bacteria 600
40 Ga0070683_100002327 3300005329 Bacteria 15074
41 Ga0070683_100022612 3300005329 Bacteria 5622
42 Ga0070683_100049118 3300005329 Bacteria 3902
43 Ga0070683_100087981 3300005329 Bacteria 2914
44 Ga0070683_100106856 3300005329 Bacteria 2639
45 Ga0070683_100148129 3300005329 Bacteria 2225
46 Ga0070683_100164656 3300005329 Bacteria 2104
47 Ga0070683_100190785 3300005329 Bacteria 1946
48 Ga0070683_100204496 3300005329 Bacteria 1875
49 Ga0070683_100890703 3300005329 Bacteria 853
50 Ga0070683_101207398 3300005329 Bacteria 727
51 Ga0070690_100074756 3300005330 Bacteria 2207
52 Ga0070690_100552771 3300005330 Unclassified 868
53 Ga0070670_100091108 3300005331 Bacteria 2621
54 Ga0070670_100555444 3300005331 Bacteria 1025
55 Ga0070670_100559526 3300005331 Bacteria 1021
56 Ga0070670_100618898 3300005331 Bacteria 970
57 Ga0070670_100664503 3300005331 Bacteria 935
58 Ga0070670_101099977 3300005331 Bacteria 725
59 Ga0070677_10371602 3300005333 Bacteria 746
60 Ga0070677_10737192 3300005333 Unclassified 558
61 Ga0068869_100046521 3300005334 Bacteria 3129
62 Ga0068869_100107791 3300005334 Bacteria 2116
63 Ga0068869_100839218 3300005334 Bacteria 792
64 Ga0068869_100848578 3300005334 Bacteria 788
65 Ga0070666_10269224 3300005335 Bacteria 1209
66 Ga0070666_10335169 3300005335 Bacteria 1081
67 Ga0070680_100008898 3300005336 Bacteria 7696
68 Ga0070680_100060199 3300005336 Bacteria 3108
69 Ga0070680_100485896 3300005336 Bacteria 1056
70 Ga0070680_100630449 3300005336 Bacteria 921
71 Ga0070682_100101276 3300005337 Bacteria 1902
72 Ga0070682_100353796 3300005337 Bacteria 1096
73 Ga0070682_101752956 3300005337 Bacteria 541
74 Ga0068868_100022080 3300005338 Bacteria 4799
75 Ga0070660_100046383 3300005339 Bacteria 3331
76 Ga0070660_100085134 3300005339 Bacteria 2486
77 Ga0070689_100016259 3300005340 Bacteria 5442
78 Ga0070689_100071117 3300005340 Bacteria 2717
79 Ga0070689_101144659 3300005340 Bacteria 697
80 Ga0070687_100010285 3300005343 Bacteria 4040
81 Ga0070687_100095140 3300005343 Bacteria 1656
82 Ga0070687_100391455 3300005343 Bacteria 909
83 Ga0070687_101106785 3300005343 Bacteria 580
84 Ga0070661_100002072 3300005344 Bacteria 13801
85 Ga0070661_100021059 3300005344 Bacteria 4656
86 Ga0070661_100022798 3300005344 Bacteria 4483
87 Ga0070661_100804232 3300005344 Bacteria 772
88 Ga0070661_100823882 3300005344 Bacteria 762
89 Ga0070661_101005954 3300005344 Bacteria 692
90 Ga0070692_10064111 3300005345 Bacteria 1943
91 Ga0070668_100034983 3300005347 Bacteria 3829
92 Ga0070668_100054067 3300005347 Bacteria 3097
93 Ga0070668_100785826 3300005347 Bacteria 845
94 Ga0070669_100001824 3300005353 Bacteria 15341
95 Ga0070669_100089004 3300005353 Bacteria 2311
96 Ga0070675_100001147 3300005354 Bacteria 19118
97 Ga0070675_100033024 3300005354 Bacteria 4192
98 Ga0070675_100143974 3300005354 Unclassified 2039
99 Ga0070675_100221505 3300005354 Bacteria 1648
100 Ga0070675_101260582 3300005354 Bacteria 681
101 Ga0070671_100179082 3300005355 Bacteria 1794
102 Ga0070671_100312256 3300005355 Bacteria 1339
103 Ga0070671_100564838 3300005355 Bacteria 982
104 Ga0070673_100062378 3300005364 Bacteria 2961
105 Ga0070673_100419539 3300005364 Bacteria 1199
106 Ga0070688_100038678 3300005365 Bacteria 2914
107 Ga0070688_100343518 3300005365 Bacteria 1091
108 Ga0070688_100485119 3300005365 Bacteria 930
109 Ga0070688_100550927 3300005365 Bacteria 877
110 Ga0070688_100571762 3300005365 Bacteria 862
111 Ga0070659_100037782 3300005366 Bacteria 3765
112 Ga0070659_100087344 3300005366 Bacteria 2496
113 Ga0070659_100117239 3300005366 Bacteria 2153
114 Ga0070659_100264869 3300005366 Bacteria 1427
115 Ga0070659_100448035 3300005366 Bacteria 1095
116 Ga0070659_100483195 3300005366 Bacteria 1054
117 Ga0070659_100771709 3300005366 Bacteria 835
118 Ga0070659_101284901 3300005366 Bacteria 649
119 Ga0070667_100064211 3300005367 Bacteria 3114
120 Ga0070667_100314189 3300005367 Bacteria 1413
121 Ga0070667_100575319 3300005367 Bacteria 1037
122 Ga0070667_100836368 3300005367 Bacteria 855
123 Ga0070667_101047847 3300005367 Bacteria 762
124 Ga0070667_101710805 3300005367 Bacteria 592
125 Ga0070703_10257965 3300005406 Unclassified 710
126 Ga0070703_10575581 3300005406 Bacteria 517
127 Ga0070701_10023737 3300005438 Bacteria 2958
128 Ga0070701_10333854 3300005438 Bacteria 942
129 Ga0070705_100005429 3300005440 Bacteria 6211
130 Ga0070705_101201364 3300005440 Bacteria 625
131 Ga0070705_101390433 3300005440 Bacteria 585
132 Ga0070700_100028866 3300005441 Bacteria 3305
133 Ga0070700_100125557 3300005441 Bacteria 1725
134 Ga0070700_100262775 3300005441 Bacteria 1244
135 Ga0070694_100046697 3300005444 Bacteria 2909
136 Ga0070694_100467427 3300005444 Bacteria 999
137 Ga0070694_100667087 3300005444 Bacteria 843
138 Ga0070663_100624087 3300005455 Bacteria 909
139 Ga0070663_101055043 3300005455 Bacteria 709
140 Ga0070678_100185328 3300005456 Bacteria 1707
141 Ga0070678_101792386 3300005456 Bacteria 579
142 Ga0070662_100013116 3300005457 Bacteria 5508
143 Ga0070662_100064872 3300005457 Bacteria 2675
144 Ga0070662_100066832 3300005457 Bacteria 2639
145 Ga0070662_100225888 3300005457 Bacteria 1496
146 Ga0070662_100422641 3300005457 Bacteria 1103
147 Ga0070662_101260712 3300005457 Bacteria 636
148 Ga0070662_101713121 3300005457 Bacteria 543
149 Ga0070681_10008511 3300005458 Bacteria 10045
150 Ga0070681_10008667 3300005458 Bacteria 9975
151 Ga0070681_10014161 3300005458 Bacteria 7938
152 Ga0070681_10017926 3300005458 Bacteria 7077
153 Ga0070681_10127822 3300005458 Bacteria 2474
154 Ga0070681_10350335 3300005458 Bacteria 1387
155 Ga0070681_10503191 3300005458 Bacteria 1125
156 Ga0070681_10558475 3300005458 Bacteria 1059
157 Ga0070681_10916527 3300005458 Unclassified 795
158 Ga0070681_11340398 3300005458 Bacteria 639
159 Ga0070681_11384466 3300005458 Bacteria 627
160 Ga0068867_101095795 3300005459 Bacteria 727
161 Ga0068867_102136684 3300005459 Bacteria 531
162 Ga0070685_10014935 3300005466 Bacteria 4121
163 Ga0070685_10061086 3300005466 Bacteria 2206
164 Ga0070685_10291930 3300005466 Bacteria 1096
165 Ga0070699_100551056 3300005518 Bacteria 1050
166 Ga0070679_100001702 3300005530 Bacteria 19818
167 Ga0070679_100117134 3300005530 Bacteria 2649
168 Ga0070679_100196255 3300005530 Bacteria 1986
169 Ga0070679_100281350 3300005530 Bacteria 1616
170 Ga0070679_100465364 3300005530 Bacteria 1209
171 Ga0070679_100821206 3300005530 Bacteria 873
172 Ga0070684_100013783 3300005535 Bacteria 6526
173 Ga0070684_100082361 3300005535 Bacteria 2849
174 Ga0070684_100087732 3300005535 Bacteria 2763
175 Ga0070684_100113100 3300005535 Bacteria 2436
176 Ga0070684_100128544 3300005535 Bacteria 2284
177 Ga0070684_100137105 3300005535 Bacteria 2211
178 Ga0070684_100400221 3300005535 Bacteria 1266
179 Ga0070684_100595088 3300005535 Bacteria 1028
180 Ga0070684_101559255 3300005535 Bacteria 623
181 Ga0068853_100005407 3300005539 Bacteria 10005
182 Ga0068853_100015819 3300005539 Bacteria 6195
183 Ga0068853_101136693 3300005539 Bacteria 753
184 Ga0070672_100080600 3300005543 Bacteria 2608
185 Ga0070672_100153463 3300005543 Bacteria 1906
186 Ga0070672_100293531 3300005543 Bacteria 1377
187 Ga0070672_100295777 3300005543 Bacteria 1371
188 Ga0070672_100621980 3300005543 Bacteria 942
189 Ga0070686_100143250 3300005544 Bacteria 1666
190 Ga0070686_100304681 3300005544 Bacteria 1183
191 Ga0070686_100520786 3300005544 Bacteria 926
192 Ga0070693_100069750 3300005547 Bacteria 2067
193 Ga0070693_100598019 3300005547 Bacteria 796
194 Ga0070693_100934846 3300005547 Bacteria 652
195 Ga0070693_101113568 3300005547 Bacteria 603
196 Ga0070665_100092233 3300005548 Bacteria 3034
197 Ga0070665_100124658 3300005548 Bacteria 2578
198 Ga0070665_100946435 3300005548 Bacteria 874
199 Ga0070704_100822956 3300005549 Bacteria 831
200 Ga0070704_101079369 3300005549 Bacteria 728
201 Ga0068855_100034057 3300005563 Bacteria 6077
202 Ga0068855_101620525 3300005563 Bacteria 662
203 Ga0070664_100020581 3300005564 Bacteria 5433
204 Ga0070664_100088840 3300005564 Bacteria 2672
205 Ga0070664_100094612 3300005564 Bacteria 2591
206 Ga0070664_100141951 3300005564 Bacteria 2115
207 Ga0070664_100149326 3300005564 Bacteria 2063
208 Ga0070664_100171061 3300005564 Bacteria 1927
209 Ga0070664_100175576 3300005564 Bacteria 1902
210 Ga0070664_100375557 3300005564 Bacteria 1297
211 Ga0070664_100419906 3300005564 Bacteria 1225
212 Ga0070664_100617040 3300005564 Bacteria 1006
213 Ga0070664_100675394 3300005564 Bacteria 961
214 Ga0070664_101070841 3300005564 Bacteria 759
215 Ga0068857_100043819 3300005577 Bacteria 3969
216 Ga0068857_100051176 3300005577 Bacteria 3663
217 Ga0068857_100068506 3300005577 Bacteria 3158
218 Ga0068857_100112028 3300005577 Bacteria 2453
219 Ga0068857_100459159 3300005577 Bacteria 1192
220 Ga0068854_100540134 3300005578 Bacteria 987
221 Ga0068854_101611583 3300005578 Bacteria 592
222 Ga0068856_100102001 3300005614 Bacteria 2862
223 Ga0068856_100180514 3300005614 Bacteria 2124
224 Ga0068856_100843215 3300005614 Bacteria 936
225 Ga0070702_100052170 3300005615 Bacteria 2345
226 Ga0070702_100976558 3300005615 Bacteria 669
227 Ga0068852_100009459 3300005616 Bacteria 7240
228 Ga0068852_100092675 3300005616 Bacteria 2706
229 Ga0068852_100150106 3300005616 Bacteria 2166
230 Ga0068852_100678330 3300005616 Bacteria 1040
231 Ga0068852_100920858 3300005616 Bacteria 892
232 Ga0068852_101209822 3300005616 Bacteria 777
233 Ga0068852_101352754 3300005616 Bacteria 734
234 Ga0068859_100020078 3300005617 Bacteria 6708
235 Ga0068859_100184489 3300005617 Bacteria 2170
236 Ga0068859_100264811 3300005617 Bacteria 1811
237 Ga0068864_100068876 3300005618 Bacteria 3075
238 Ga0068864_100218966 3300005618 Bacteria 1756
239 Ga0068864_100306502 3300005618 Bacteria 1488
240 Ga0068864_100559129 3300005618 Bacteria 1107
241 Ga0068864_100893879 3300005618 Bacteria 877
242 Ga0068864_101261451 3300005618 Bacteria 739
243 Ga0068864_101417493 3300005618 Bacteria 697
244 Ga0068861_100004625 3300005719 Bacteria 9236
245 Ga0068861_100066574 3300005719 Bacteria 2777
246 Ga0068861_100143628 3300005719 Unclassified 1951
247 Ga0068861_100624850 3300005719 Bacteria 992
248 Ga0068861_102551930 3300005719 Bacteria 515
249 Ga0068851_10016073 3300005834 Bacteria 3576
250 Ga0068851_10220794 3300005834 Bacteria 1065
251 Ga0068870_10029793 3300005840 Bacteria 2752
252 Ga0068870_10060121 3300005840 Bacteria 2039
253 Ga0068870_10395524 3300005840 Bacteria 898
254 Ga0068863_100003611 3300005841 Bacteria 15274
255 Ga0068863_100075877 3300005841 Bacteria 3181
256 Ga0068863_100317582 3300005841 Bacteria 1513
257 Ga0068863_100452830 3300005841 Bacteria 1260
258 Ga0068863_100605585 3300005841 Bacteria 1085
259 Ga0068863_100812642 3300005841 Bacteria 933
260 Ga0068858_100021630 3300005842 Bacteria 6012
261 Ga0068858_100491077 3300005842 Bacteria 1185
262 Ga0068858_101245288 3300005842 Bacteria 732
263 Ga0068858_101377475 3300005842 Bacteria 695
264 Ga0068860_100028624 3300005843 Bacteria 5363
265 Ga0068860_100510746 3300005843 Bacteria 1201
266 Ga0068860_101010530 3300005843 Bacteria 850
267 Ga0068862_100009967 3300005844 Bacteria 7850
268 Ga0068862_100021217 3300005844 Bacteria 5429
269 Ga0068862_100158957 3300005844 Bacteria 2016
270 Ga0068862_100185733 3300005844 Bacteria 1868
271 Ga0068862_100521507 3300005844 Bacteria 1131
272 Ga0081455_10434191 3300005937 Bacteria 902
273 Ga0075363_100311093 3300006048 Bacteria 915
274 Ga0075432_10066695 3300006058 Bacteria 1288
275 Ga0075432_10297490 3300006058 Bacteria 669
276 Ga0070712_100650094 3300006175 Bacteria 896
277 Ga0070712_101247602 3300006175 Bacteria 647
278 Ga0075427_10021685 3300006194 Bacteria 1023
279 Ga0097621_100066116 3300006237 Bacteria 2977
280 Ga0097621_101162523 3300006237 Bacteria 726
281 Ga0075428_100017080 3300006844 Bacteria 8017
282 Ga0075428_100093041 3300006844 Bacteria 3287
283 Ga0075428_101203021 3300006844 Bacteria 799
284 Ga0075428_101391601 3300006844 Bacteria 736
285 Ga0075430_100428689 3300006846 Bacteria 1091
286 Ga0075430_100772785 3300006846 Bacteria 792
287 Ga0075430_101084695 3300006846 Bacteria 659
288 Ga0075430_101155436 3300006846 Bacteria 637
289 Ga0075431_100148241 3300006847 Bacteria 2417
290 Ga0075431_100615164 3300006847 Bacteria 1069
291 Ga0075433_10025380 3300006852 Bacteria 5009
292 Ga0075433_10074113 3300006852 Bacteria 2995
293 Ga0075433_10144868 3300006852 Bacteria 2112
294 Ga0075434_100006240 3300006871 Bacteria 10918
295 Ga0075434_100105101 3300006871 Bacteria 2834
296 Ga0075434_100353241 3300006871 Bacteria 1491
297 Ga0075429_100074976 3300006880 Bacteria 2947
298 Ga0075429_100198819 3300006880 Bacteria 1756
299 Ga0068865_100004671 3300006881 Bacteria 8276
300 Ga0068865_100004928 3300006881 Bacteria 8070
301 Ga0068865_101050681 3300006881 Bacteria 715
302 Ga0075436_100014918 3300006914 Bacteria 5324
303 Ga0097620_100020078 3300006931 Bacteria 6708
304 Ga0097620_100184490 3300006931 Bacteria 2170
305 Ga0097620_100264810 3300006931 Bacteria 1811
306 Ga0075435_100084960 3300007076 Bacteria 2605
307 Ga0075435_100580976 3300007076 Bacteria 971
308 Ga0075435_101385799 3300007076 Bacteria 616
309 Ga0105240_10032792 3300009093 Bacteria 6720
310 Ga0105240_11165800 3300009093 Bacteria 817
311 Ga0111539_10017919 3300009094 Bacteria 8773
312 Ga0111539_10049836 3300009094 Bacteria 4990
313 Ga0111539_10080853 3300009094 Bacteria 3822
314 Ga0111539_10094070 3300009094 Bacteria 3521
315 Ga0111539_10108588 3300009094 Bacteria 3256
316 Ga0111539_10167917 3300009094 Bacteria 2564
317 Ga0111539_10255592 3300009094 Bacteria 2040
318 Ga0111539_10656679 3300009094 Bacteria 1221
319 Ga0111539_10726126 3300009094 Bacteria 1156
320 Ga0105245_10279297 3300009098 Bacteria 1632
321 Ga0105247_10155745 3300009101 Bacteria 1509
322 Ga0105247_10425335 3300009101 Bacteria 952
323 Ga0114129_10088126 3300009147 Bacteria 4304
324 Ga0114129_10121071 3300009147 Bacteria 3602
325 Ga0114129_10817026 3300009147 Bacteria 1188
326 Ga0114129_12070114 3300009147 Bacteria 687
327 Ga0114129_13222569 3300009147 Bacteria 530
328 Ga0105243_10552403 3300009148 Bacteria 1101
329 Ga0105243_10751262 3300009148 Bacteria 956
330 Ga0105243_11693957 3300009148 Bacteria 661
331 Ga0105241_10048790 3300009174 Bacteria 3222
332 Ga0105241_11216060 3300009174 Bacteria 714
333 Ga0105242_10059694 3300009176 Bacteria 3130
334 Ga0105242_10717467 3300009176 Unclassified 980
335 Ga0105242_10745422 3300009176 Bacteria 963
336 Ga0105242_11209334 3300009176 Bacteria 775
337 Ga0105242_12129757 3300009176 Bacteria 605
338 Ga0105248_10056165 3300009177 Bacteria 4416
339 Ga0105248_10070473 3300009177 Bacteria 3926
340 Ga0105248_10253628 3300009177 Bacteria 1980
341 Ga0105248_10511315 3300009177 Bacteria 1354
342 Ga0105248_11199304 3300009177 Bacteria 858
343 Ga0105248_11439451 3300009177 Bacteria 780
344 Ga0105248_11492275 3300009177 Bacteria 765
345 Ga0105237_10721189 3300009545 Bacteria 1003
346 Ga0105237_10888068 3300009545 Bacteria 898
347 Ga0105238_10096002 3300009551 Bacteria 2951
348 Ga0105238_10247955 3300009551 Unclassified 1759
349 Ga0105238_10695910 3300009551 Bacteria 1028
350 Ga0105238_10716294 3300009551 Bacteria 1013
351 Ga0105238_10730448 3300009551 Bacteria 1003
352 Ga0105249_10029865 3300009553 Bacteria 4925
353 Ga0105249_10041058 3300009553 Bacteria 4204
354 Ga0105249_10151644 3300009553 Bacteria 2232
355 Ga0105249_10158694 3300009553 Bacteria 2184
356 Ga0105249_10524989 3300009553 Bacteria 1232
357 Ga0105249_11917200 3300009553 Bacteria 665
358 Ga0105239_10004359 3300010375 Bacteria 16957
359 Ga0105239_12667774 3300010375 Bacteria 583
360 Ga0157315_1013431 3300012508 Bacteria 770
361 Ga0157327_1003733 3300012512 Bacteria 1140
362 Ga0157373_10053842 3300013100 Bacteria 2861
363 Ga0157373_10067088 3300013100 Bacteria 2537
364 Ga0157373_10253994 3300013100 Bacteria 1243
365 Ga0157373_10294390 3300013100 Bacteria 1151
366 Ga0157373_10438985 3300013100 Bacteria 938
367 Ga0157373_10458019 3300013100 Bacteria 918
368 Ga0157373_10556809 3300013100 Bacteria 832
369 Ga0157373_10591866 3300013100 Bacteria 807
370 Ga0157373_10739503 3300013100 Bacteria 722
371 Ga0157371_10036763 3300013102 Bacteria 3506
372 Ga0157371_10198700 3300013102 Bacteria 1437
373 Ga0157371_10697026 3300013102 Bacteria 760
374 Ga0157371_11437521 3300013102 Bacteria 536
375 Ga0157370_10016751 3300013104 Bacteria 7415
376 Ga0157370_10084953 3300013104 Bacteria 2973
377 Ga0157370_10648767 3300013104 Bacteria 965
378 Ga0157370_10733419 3300013104 Bacteria 901
379 Ga0157370_10843135 3300013104 Bacteria 833
380 Ga0157370_11141415 3300013104 Bacteria 704
381 Ga0157369_10027504 3300013105 Bacteria 6304
382 Ga0157369_10040652 3300013105 Bacteria 5076
383 Ga0157369_11322528 3300013105 Bacteria 734
384 Ga0157374_10110905 3300013296 Bacteria 2639
385 Ga0157374_10159090 3300013296 Bacteria 2200
386 Ga0157374_10786660 3300013296 Bacteria 967
387 Ga0157378_10221099 3300013297 Bacteria 1800
388 Ga0157378_11371948 3300013297 Bacteria 749
389 Ga0157378_11834058 3300013297 Bacteria 655
390 Ga0163162_10012258 3300013306 Bacteria 8366
391 Ga0163162_11625390 3300013306 Bacteria 737
392 Ga0163162_12315488 3300013306 Bacteria 617
393 Ga0163162_12761386 3300013306 Bacteria 565
394 Ga0157372_10018905 3300013307 Bacteria 7415
395 Ga0157372_10030499 3300013307 Bacteria 5900
396 Ga0157372_10094890 3300013307 Bacteria 3398
397 Ga0157372_10099327 3300013307 Bacteria 3320
398 Ga0157372_10157722 3300013307 Bacteria 2621
399 Ga0157372_10196009 3300013307 Bacteria 2340
400 Ga0157372_10281497 3300013307 Bacteria 1933
401 Ga0157372_10292597 3300013307 Bacteria 1894
402 Ga0157372_10383648 3300013307 Bacteria 1637
403 Ga0157372_10691515 3300013307 Bacteria 1187
404 Ga0157372_11648719 3300013307 Bacteria 738
405 Ga0157372_11673898 3300013307 Bacteria 732
406 Ga0157372_12141682 3300013307 Bacteria 642
407 Ga0157375_10014319 3300013308 Bacteria 7071
408 Ga0157375_10045132 3300013308 Bacteria 4288
409 Ga0157375_10047652 3300013308 Bacteria 4187
410 Ga0157375_10069477 3300013308 Bacteria 3529
411 Ga0157375_10167683 3300013308 Bacteria 2342
412 Ga0157375_10822861 3300013308 Bacteria 1076
413 Ga0157375_12375921 3300013308 Bacteria 632
414 Ga0163163_10131822 3300014325 Bacteria 2540
415 Ga0163163_10215355 3300014325 Bacteria 1970
416 Ga0157380_10125160 3300014326 Bacteria 2183
417 Ga0157380_10162324 3300014326 Bacteria 1944
418 Ga0157377_10008532 3300014745 Bacteria 5002
419 Ga0157377_10028605 3300014745 Bacteria 3001
420 Ga0157377_10100295 3300014745 Bacteria 1724
421 Ga0157377_10451901 3300014745 Bacteria 887
422 Ga0157379_10012695 3300014968 Bacteria 7362
423 Ga0157379_10288858 3300014968 Bacteria 1493
424 Ga0157379_10560193 3300014968 Bacteria 1064
425 Ga0157376_10189927 3300014969 Bacteria 1883
426 Ga0157376_11630474 3300014969 Bacteria 680
427 Ga0157376_12371917 3300014969 Bacteria 570
428 Ga0157376_12758708 3300014969 Bacteria 531
429 Ga0182007_10301113 3300015262 Bacteria 589
430 Ga0163161_10018510 3300017792 Bacteria 4880
431 Ga0163161_10602091 3300017792 Bacteria 906
432 Ga0163161_11175931 3300017792 Unclassified 662
433 Ga0206353_10233494 3300020082 Bacteria 674
434 Ga0213876_10003094 3300021384 Bacteria 9634
435 Ga0213876_10011231 3300021384 Bacteria 4785
436 Ga0209673_1004145 3300025273 Bacteria 7935
437 Ga0209130_1007131 3300025284 Bacteria 3501
438 Ga0209675_1006161 3300025291 Bacteria 4875
439 Ga0209675_1012769 3300025291 Bacteria 2680
440 Ga0209676_1000764 3300025292 Bacteria 43254
441 Ga0209676_1001068 3300025292 Bacteria 31254
442 Ga0209025_1001810 3300025294 Bacteria 25285
443 Ga0209025_1024030 3300025294 Bacteria 3162
444 Ga0209025_1075421 3300025294 Bacteria 1173
445 Ga0209564_1005861 3300025295 Bacteria 6831
446 Ga0209564_1016181 3300025295 Bacteria 2985
447 Ga0209758_1040504 3300025297 Bacteria 1756
448 Ga0209050_1005038 3300025298 Bacteria 8559
449 Ga0209050_1017947 3300025298 Bacteria 2784
450 Ga0209256_1000575 3300025299 Bacteria 52523
451 Ga0209256_1002249 3300025299 Bacteria 16404
452 Ga0209051_1006260 3300025303 Bacteria 6747
453 Ga0209257_1000065 3300025304 Bacteria 353604
454 Ga0209257_1000498 3300025304 Bacteria 70112
455 Ga0209257_1000593 3300025304 Bacteria 60449
456 Ga0209257_1001112 3300025304 Bacteria 34948
457 Ga0209257_1003126 3300025304 Bacteria 14788
458 Ga0209257_1004270 3300025304 Bacteria 11268
459 Ga0207697_10009866 3300025315 Bacteria 4106
460 Ga0207697_10183676 3300025315 Bacteria 917
461 Ga0207697_10295155 3300025315 Bacteria 719
462 Ga0207656_10016846 3300025321 Bacteria 2851
463 Ga0207656_10046472 3300025321 Bacteria 1863
464 Ga0207656_10060426 3300025321 Bacteria 1661
465 Ga0207682_10139122 3300025893 Bacteria 1089
466 Ga0207682_10431936 3300025893 Unclassified 623
467 Ga0207642_10625636 3300025899 Bacteria 672
468 Ga0207688_10054461 3300025901 Bacteria 2244
469 Ga0207688_10059278 3300025901 Bacteria 2156
470 Ga0207688_10462002 3300025901 Bacteria 792
471 Ga0207680_10094716 3300025903 Bacteria 1907
472 Ga0207680_10278909 3300025903 Bacteria 1161
473 Ga0207647_10050141 3300025904 Bacteria 2586
474 Ga0207647_10257058 3300025904 Bacteria 1001
475 Ga0207645_10011297 3300025907 Bacteria 6102
476 Ga0207643_10042901 3300025908 Bacteria 2551
477 Ga0207643_10201022 3300025908 Bacteria 1213
478 Ga0207705_10024486 3300025909 Bacteria 4307
479 Ga0207705_10049896 3300025909 Bacteria 3012
480 Ga0207705_10200069 3300025909 Bacteria 1513
481 Ga0207705_10656421 3300025909 Bacteria 816
482 Ga0207705_10887568 3300025909 Bacteria 691
483 Ga0207705_10955775 3300025909 Bacteria 663
484 Ga0207705_11400917 3300025909 Bacteria 531
485 Ga0207684_10065996 3300025910 Bacteria 3073
486 Ga0207654_10017730 3300025911 Bacteria 3727
487 Ga0207654_10585418 3300025911 Bacteria 795
488 Ga0207707_10001539 3300025912 Bacteria 21229
489 Ga0207707_10009253 3300025912 Bacteria 8548
490 Ga0207707_10041123 3300025912 Bacteria 4037
491 Ga0207707_10072921 3300025912 Bacteria 2993
492 Ga0207707_10096763 3300025912 Bacteria 2579
493 Ga0207707_10097980 3300025912 Bacteria 2563
494 Ga0207707_10768404 3300025912 Unclassified 805
495 Ga0207695_10064899 3300025913 Bacteria 3756
496 Ga0207671_10567938 3300025914 Bacteria 904
497 Ga0207663_10286707 3300025916 Bacteria 1225
498 Ga0207660_10007070 3300025917 Bacteria 7272
499 Ga0207660_10012283 3300025917 Bacteria 5600
500 Ga0207660_10372285 3300025917 Bacteria 1147
501 Ga0207660_10663877 3300025917 Bacteria 850
502 Ga0207662_10014013 3300025918 Bacteria 4491
503 Ga0207662_10054696 3300025918 Bacteria 2381
504 Ga0207657_10024845 3300025919 Bacteria 5538
505 Ga0207657_10086708 3300025919 Bacteria 2620
506 Ga0207657_10191899 3300025919 Bacteria 1647
507 Ga0207649_10019705 3300025920 Bacteria 3860
508 Ga0207649_10033784 3300025920 Bacteria 3059
509 Ga0207649_10066165 3300025920 Bacteria 2290
510 Ga0207649_10518634 3300025920 Bacteria 908
511 Ga0207652_10067634 3300025921 Bacteria 3098
512 Ga0207652_10104068 3300025921 Bacteria 2510
513 Ga0207652_10618453 3300025921 Bacteria 970
514 Ga0207652_11362043 3300025921 Bacteria 613
515 Ga0207652_11747936 3300025921 Bacteria 527
516 Ga0207681_10013719 3300025923 Bacteria 5018
517 Ga0207681_10511789 3300025923 Bacteria 984
518 Ga0207694_10249068 3300025924 Unclassified 1453
519 Ga0207694_10742799 3300025924 Bacteria 828
520 Ga0207694_10922372 3300025924 Bacteria 739
521 Ga0207650_10050200 3300025925 Bacteria 3084
522 Ga0207650_10067932 3300025925 Bacteria 2676
523 Ga0207650_10333562 3300025925 Bacteria 1244
524 Ga0207650_11131566 3300025925 Bacteria 666
525 Ga0207650_11271985 3300025925 Bacteria 626
526 Ga0207659_10079982 3300025926 Bacteria 2413
527 Ga0207659_10252219 3300025926 Bacteria 1432
528 Ga0207659_10275502 3300025926 Bacteria 1374
529 Ga0207659_10297605 3300025926 Bacteria 1324
530 Ga0207659_10418239 3300025926 Unclassified 1124
531 Ga0207659_10634140 3300025926 Bacteria 912
532 Ga0207659_10733871 3300025926 Bacteria 847
533 Ga0207664_10364119 3300025929 Bacteria 1281
534 Ga0207644_10262683 3300025931 Bacteria 1381
535 Ga0207644_10308870 3300025931 Bacteria 1276
536 Ga0207644_10385769 3300025931 Bacteria 1143
537 Ga0207644_10641008 3300025931 Bacteria 884
538 Ga0207690_10016598 3300025932 Bacteria 4484
539 Ga0207690_10026685 3300025932 Bacteria 3639
540 Ga0207690_10128824 3300025932 Bacteria 1849
541 Ga0207690_10330085 3300025932 Bacteria 1201
542 Ga0207690_10795058 3300025932 Bacteria 782
543 Ga0207690_10872051 3300025932 Bacteria 746
544 Ga0207706_10002237 3300025933 Bacteria 18881
545 Ga0207706_10081778 3300025933 Bacteria 2838
546 Ga0207686_10037265 3300025934 Bacteria 2933
547 Ga0207686_11306938 3300025934 Bacteria 595
548 Ga0207709_10647032 3300025935 Bacteria 841
549 Ga0207670_10066576 3300025936 Bacteria 2475
550 Ga0207670_10337339 3300025936 Bacteria 1190
551 Ga0207670_10959984 3300025936 Bacteria 718
552 Ga0207670_11932016 3300025936 Bacteria 502
553 Ga0207669_10727829 3300025937 Bacteria 817
554 Ga0207704_10027971 3300025938 Bacteria 3121
555 Ga0207704_10124939 3300025938 Bacteria 1769
556 Ga0207704_11716438 3300025938 Bacteria 540
557 Ga0207691_10046847 3300025940 Bacteria 3971
558 Ga0207691_10097144 3300025940 Bacteria 2633
559 Ga0207691_10099416 3300025940 Bacteria 2597
560 Ga0207691_10125146 3300025940 Bacteria 2275
561 Ga0207691_10222306 3300025940 Bacteria 1637
562 Ga0207711_10041786 3300025941 Bacteria 3905
563 Ga0207711_10473336 3300025941 Bacteria 1167
564 Ga0207689_10037078 3300025942 Bacteria 4046
565 Ga0207689_10201212 3300025942 Bacteria 1644
566 Ga0207689_10546033 3300025942 Unclassified 973
567 Ga0207689_11091049 3300025942 Bacteria 673
568 Ga0207661_10002394 3300025944 Bacteria 12915
569 Ga0207661_10028189 3300025944 Bacteria 4298
570 Ga0207661_10085411 3300025944 Bacteria 2616
571 Ga0207661_10106480 3300025944 Bacteria 2364
572 Ga0207661_10168154 3300025944 Bacteria 1907
573 Ga0207661_10189880 3300025944 Bacteria 1800
574 Ga0207661_10362443 3300025944 Bacteria 1309
575 Ga0207661_10868878 3300025944 Bacteria 830
576 Ga0207661_10876897 3300025944 Bacteria 826
577 Ga0207661_10879246 3300025944 Bacteria 825
578 Ga0207679_10002284 3300025945 Bacteria 11824
579 Ga0207679_10041988 3300025945 Bacteria 3283
580 Ga0207679_10077744 3300025945 Bacteria 2526
581 Ga0207679_10163265 3300025945 Bacteria 1826
582 Ga0207679_10185497 3300025945 Bacteria 1724
583 Ga0207679_10208189 3300025945 Bacteria 1638
584 Ga0207679_10288698 3300025945 Bacteria 1409
585 Ga0207679_10380007 3300025945 Bacteria 1238
586 Ga0207679_10424722 3300025945 Bacteria 1174
587 Ga0207679_10453408 3300025945 Bacteria 1138
588 Ga0207679_10613656 3300025945 Bacteria 981
589 Ga0207679_10977952 3300025945 Bacteria 775
590 Ga0207679_11207135 3300025945 Bacteria 694
591 Ga0207679_11826462 3300025945 Bacteria 555
592 Ga0207667_10231860 3300025949 Bacteria 1890
593 Ga0207667_10605382 3300025949 Bacteria 1105
594 Ga0207667_11039029 3300025949 Bacteria 805
595 Ga0207667_11899658 3300025949 Bacteria 557
596 Ga0207667_12032403 3300025949 Bacteria 534
597 Ga0207651_10025055 3300025960 Bacteria 3702
598 Ga0207651_10045633 3300025960 Bacteria 2941
599 Ga0207712_10013793 3300025961 Bacteria 5184
600 Ga0207712_10015567 3300025961 Bacteria 4910
601 Ga0207712_10032907 3300025961 Bacteria 3502
602 Ga0207712_10288438 3300025961 Bacteria 1342
603 Ga0207668_10009889 3300025972 Bacteria 5733
604 Ga0207668_10021866 3300025972 Bacteria 4084
605 Ga0207640_10308730 3300025981 Bacteria 1255
606 Ga0207640_10483521 3300025981 Bacteria 1028
607 Ga0207640_10726259 3300025981 Bacteria 854
608 Ga0207640_11431750 3300025981 Bacteria 620
609 Ga0207640_11514858 3300025981 Bacteria 603
610 Ga0207658_10052857 3300025986 Bacteria 2999
611 Ga0207658_10147742 3300025986 Bacteria 1911
612 Ga0207658_11305173 3300025986 Bacteria 664
613 Ga0207677_10160633 3300026023 Bacteria 1745
614 Ga0207677_10256424 3300026023 Bacteria 1423
615 Ga0207677_11541778 3300026023 Bacteria 614
616 Ga0207703_10023800 3300026035 Bacteria 4817
617 Ga0207703_10425013 3300026035 Bacteria 1237
618 Ga0207703_11019406 3300026035 Bacteria 794
619 Ga0207703_11743076 3300026035 Bacteria 599
620 Ga0207703_11773075 3300026035 Bacteria 593
621 Ga0207639_10016177 3300026041 Bacteria 5271
622 Ga0207639_10063961 3300026041 Bacteria 2851
623 Ga0207639_10336450 3300026041 Bacteria 1345
624 Ga0207639_10592155 3300026041 Bacteria 1022
625 Ga0207639_10915047 3300026041 Bacteria 820
626 Ga0207639_12046953 3300026041 Bacteria 534
627 Ga0207639_12197742 3300026041 Bacteria 513
628 Ga0207678_10044834 3300026067 Bacteria 3824
629 Ga0207678_10411538 3300026067 Bacteria 1172
630 Ga0207708_10032553 3300026075 Bacteria 3959
631 Ga0207708_10528025 3300026075 Bacteria 992
632 Ga0207702_10184662 3300026078 Bacteria 1922
633 Ga0207702_10694463 3300026078 Bacteria 1003
634 Ga0207702_10893626 3300026078 Bacteria 880
635 Ga0207702_11818375 3300026078 Bacteria 601
636 Ga0207641_10103975 3300026088 Bacteria 2506
637 Ga0207641_10325662 3300026088 Bacteria 1458
638 Ga0207641_10693479 3300026088 Bacteria 1002
639 Ga0207641_10913838 3300026088 Bacteria 872
640 Ga0207641_10926881 3300026088 Bacteria 866
641 Ga0207641_11060259 3300026088 Bacteria 808
642 Ga0207648_10040177 3300026089 Bacteria 4111
643 Ga0207648_10146559 3300026089 Bacteria 2082
644 Ga0207648_11191749 3300026089 Bacteria 715
645 Ga0207676_10247055 3300026095 Bacteria 1604
646 Ga0207676_10568584 3300026095 Bacteria 1085
647 Ga0207676_10689996 3300026095 Bacteria 988
648 Ga0207676_10798897 3300026095 Bacteria 920
649 Ga0207676_11063303 3300026095 Bacteria 799
650 Ga0207676_11442351 3300026095 Bacteria 685
651 Ga0207676_12065615 3300026095 Bacteria 568
652 Ga0207674_10008894 3300026116 Bacteria 11548
653 Ga0207674_10047433 3300026116 Bacteria 4404
654 Ga0207674_10056432 3300026116 Bacteria 3988
655 Ga0207674_10122083 3300026116 Bacteria 2571
656 Ga0207674_10488628 3300026116 Bacteria 1190
657 Ga0207675_100000209 3300026118 Bacteria 54603
658 Ga0207675_100002910 3300026118 Bacteria 16833
659 Ga0207675_100594660 3300026118 Bacteria 1109
660 Ga0207675_100668168 3300026118 Bacteria 1046
661 Ga0207675_100805885 3300026118 Bacteria 953
662 Ga0207675_102189842 3300026118 Bacteria 568
663 Ga0207698_10039806 3300026142 Bacteria 3486
664 Ga0207698_10051296 3300026142 Bacteria 3153
665 Ga0207698_10132867 3300026142 Bacteria 2130
666 Ga0207698_11163174 3300026142 Bacteria 785
667 Ga0207698_11330778 3300026142 Bacteria 733
668 Ga0209995_1062771 3300027471 Bacteria 633
669 Ga0209970_1041146 3300027614 Bacteria 822
670 Ga0209974_10093259 3300027876 Bacteria 1046
671 Ga0207428_10009104 3300027907 Bacteria 8925
672 Ga0207428_10054860 3300027907 Bacteria 3172
673 Ga0207428_10067609 3300027907 Bacteria 2813
674 Ga0207428_10155986 3300027907 Bacteria 1736
675 Ga0207428_10221820 3300027907 Bacteria 1417
676 Ga0268266_10237080 3300028379 Bacteria 1682
677 Ga0268266_10246397 3300028379 Bacteria 1651
678 Ga0268266_10383095 3300028379 Bacteria 1327
679 Ga0268266_10691353 3300028379 Bacteria 983
680 Ga0268266_12008685 3300028379 Bacteria 552
681 Ga0268265_10012226 3300028380 Bacteria 5813
682 Ga0268265_10013128 3300028380 Bacteria 5626
683 Ga0268265_10304984 3300028380 Bacteria 1435
684 Ga0268265_11966241 3300028380 Bacteria 592
685 Ga0268264_10087668 3300028381 Bacteria 2676
686 Ga0307517_10549211 3300028786 Bacteria 578
687 Ga0307515_10707329 3300028794 Bacteria 624
688 Ga0307408_100005765 3300031548 Bacteria 8251
689 Ga0307408_100022310 3300031548 Bacteria 4300
690 Ga0307408_100069266 3300031548 Bacteria 2601
691 Ga0307408_100071711 3300031548 Bacteria 2562
692 Ga0307408_100190589 3300031548 Bacteria 1651
693 Ga0307405_10000431 3300031731 Bacteria 15673
694 Ga0307405_10000467 3300031731 Bacteria 15176
695 Ga0307405_10004308 3300031731 Bacteria 6700
696 Ga0307405_10025988 3300031731 Bacteria 3370
697 Ga0307405_10397022 3300031731 Bacteria 1078
698 Ga0307405_10410594 3300031731 Bacteria 1062
699 Ga0307405_11061527 3300031731 Bacteria 694
700 Ga0307405_11490986 3300031731 Bacteria 594
701 Ga0307413_10000553 3300031824 Bacteria 12502
702 Ga0307413_10000611 3300031824 Bacteria 12000
703 Ga0307413_10046328 3300031824 Bacteria 2584
704 Ga0307413_10065562 3300031824 Bacteria 2262
705 Ga0307413_10086659 3300031824 Bacteria 2025
706 Ga0307413_10256133 3300031824 Bacteria 1301
707 Ga0307413_10348001 3300031824 Bacteria 1142
708 Ga0307413_10431682 3300031824 Bacteria 1040
709 Ga0307413_10645769 3300031824 Bacteria 872
710 Ga0307410_10014163 3300031852 Bacteria 4681
711 Ga0307410_10047568 3300031852 Bacteria 2867
712 Ga0307410_10061960 3300031852 Bacteria 2561
713 Ga0307410_10178373 3300031852 Bacteria 1606
714 Ga0307410_10197290 3300031852 Bacteria 1534
715 Ga0307410_10239074 3300031852 Bacteria 1406
716 Ga0307410_10396720 3300031852 Bacteria 1114
717 Ga0307410_10422915 3300031852 Bacteria 1081
718 Ga0307410_11171109 3300031852 Bacteria 669
719 Ga0307406_10002382 3300031901 Bacteria 10212
720 Ga0307406_10005037 3300031901 Bacteria 7202
721 Ga0307406_10014924 3300031901 Bacteria 4481
722 Ga0307406_10035208 3300031901 Bacteria 3077
723 Ga0307406_10053531 3300031901 Bacteria 2571
724 Ga0307406_10063388 3300031901 Bacteria 2394
725 Ga0307406_10143337 3300031901 Bacteria 1694
726 Ga0307406_10200322 3300031901 Bacteria 1469
727 Ga0307406_10229065 3300031901 Bacteria 1386
728 Ga0307407_10000511 3300031903 Bacteria 12005
729 Ga0307407_10004075 3300031903 Bacteria 6139
730 Ga0307407_10041261 3300031903 Bacteria 2579
731 Ga0307407_10161929 3300031903 Bacteria 1465
732 Ga0307407_10250093 3300031903 Bacteria 1214
733 Ga0307407_10275083 3300031903 Bacteria 1164
734 Ga0307407_10329993 3300031903 Bacteria 1073
735 Ga0307407_10883291 3300031903 Bacteria 685
736 Ga0307407_11094928 3300031903 Bacteria 619
737 Ga0307412_10001715 3300031911 Bacteria 12127
738 Ga0307412_10010522 3300031911 Bacteria 5330
739 Ga0307412_10029005 3300031911 Bacteria 3469
740 Ga0307412_10059476 3300031911 Bacteria 2561
741 Ga0307412_10372344 3300031911 Bacteria 1154
742 Ga0307412_10454780 3300031911 Bacteria 1056
743 Ga0307412_12315555 3300031911 Bacteria 501
744 Ga0307409_100000474 3300031995 Bacteria 17172
745 Ga0307409_100004192 3300031995 Bacteria 8035
746 Ga0307409_100066532 3300031995 Bacteria 2842
747 Ga0307409_100072959 3300031995 Bacteria 2735
748 Ga0307409_100462768 3300031995 Bacteria 1226
749 Ga0307409_100913706 3300031995 Bacteria 892
750 Ga0307409_101398726 3300031995 Bacteria 726
751 Ga0307409_101635213 3300031995 Bacteria 672
752 Ga0307416_100000163 3300032002 Bacteria 38138
753 Ga0307416_100000912 3300032002 Bacteria 15587
754 Ga0307416_100001181 3300032002 Bacteria 14007
755 Ga0307416_100018472 3300032002 Bacteria 4911
756 Ga0307416_100040050 3300032002 Bacteria 3635
757 Ga0307416_100092765 3300032002 Bacteria 2599
758 Ga0307416_100252872 3300032002 Bacteria 1716
759 Ga0307416_100310937 3300032002 Bacteria 1572
760 Ga0307416_100716573 3300032002 Bacteria 1091
761 Ga0307416_100854641 3300032002 Bacteria 1008
762 Ga0307416_101074897 3300032002 Bacteria 909
763 Ga0307416_101810145 3300032002 Bacteria 714
764 Ga0307416_102070073 3300032002 Bacteria 671
765 Ga0307414_10001031 3300032004 Bacteria 14232
766 Ga0307414_10002523 3300032004 Bacteria 9608
767 Ga0307414_10129588 3300032004 Bacteria 1956
768 Ga0307414_10143624 3300032004 Bacteria 1872
769 Ga0307414_10314665 3300032004 Bacteria 1330
770 Ga0307414_10326140 3300032004 Bacteria 1309
771 Ga0307414_10460805 3300032004 Bacteria 1117
772 Ga0307411_10000120 3300032005 Bacteria 24490
773 Ga0307411_10003303 3300032005 Bacteria 7454
774 Ga0307411_10010089 3300032005 Bacteria 5013
775 Ga0307411_10058094 3300032005 Bacteria 2558
776 Ga0307411_10122995 3300032005 Bacteria 1881
777 Ga0307411_10163960 3300032005 Bacteria 1668
778 Ga0307411_10262565 3300032005 Bacteria 1364
779 Ga0307411_10276649 3300032005 Bacteria 1334
780 Ga0307411_10798627 3300032005 Bacteria 831
781 Ga0307411_11181599 3300032005 Bacteria 693
782 Ga0307415_100001591 3300032126 Bacteria 10958
783 Ga0307415_100022540 3300032126 Bacteria 3888
784 Ga0307415_100113318 3300032126 Bacteria 2016
785 Ga0307415_100173143 3300032126 Bacteria 1685
786 Ga0307415_100534568 3300032126 Bacteria 1031
787 Ga0307415_100651072 3300032126 Bacteria 944
788 Ga0307415_101396334 3300032126 Bacteria 666
789 Ga0307510_10000276 3300033180 Bacteria 47201
790 Ga0373952_0058003 3300035092 Bacteria 940
791 Ga0373960_0178499 3300035121 Bacteria 740
792 Ga0373946_0419620 3300035171 Unclassified 678
793 Ga0373961_0129810 3300035241 Bacteria 843
794 Ga0373962_0086014 3300035242 Bacteria 962
795 Ga0395899_0122473 3300037312 Bacteria 1861
796 Ga0395900_0001278 3300037418 Bacteria 30720
797 Ga0395900_0261130 3300037418 Bacteria 1730
798 Ga0395898_0002604 3300037466 Bacteria 21051
799 Ga0395898_0023538 3300037466 Bacteria 6222
800 Ga0395898_0170279 3300037466 Bacteria 2082
801 Ga0395905_0086560 3300037471 Bacteria 2937
802 Ga0395905_0247916 3300037471 Bacteria 1664
803 Ga0395905_1815990 3300037471 Bacteria 515
804 Ga0436364_1168503 3300037853 Bacteria 1213
805 Ga0395901_0000327 3300038443 Bacteria 58568
806 Ga0395901_0020475 3300038443 Bacteria 6770
807 Ga0395901_0028345 3300038443 Bacteria 5758
808 Ga0436365_0137719 3300039437 Bacteria 9772
809 Ga0436365_0173963 3300039437 Bacteria 7447
810 Ga0436365_0223687 3300039437 Bacteria 4786
811 Ga0436362_1069022 3300039453 Bacteria 584
812 Ga0439439_0059749 3300041406 Bacteria 1011
813 Ga0439439_0131204 3300041406 Bacteria 704
814 Ga0439453_0017774 3300041408 Bacteria 1252
815 Ga0439461_0012170 3300041410 Bacteria 1606
816 Ga0451800_0683371 3300041459 Bacteria 697
817 Ga0451847_0370653 3300041503 Bacteria 742
818 Ga0451853_1340511 3300041512 Bacteria 656
819 Ga0439433_0031208 3300041999 Bacteria 1219
820 Ga0439441_023866 3300042001 Bacteria 1145
821 Ga0439443_016136 3300042003 Bacteria 1139
822 Ga0439448_0017521 3300042005 Bacteria 2188
823 Ga0439454_048451 3300042011 Bacteria 712
824 Ga0439456_075124 3300042013 Bacteria 751
825 Ga0439462_0078786 3300042015 Bacteria 899
826 Ga0450917_027856 3300042120 Unclassified 530
827 Ga0450923_000962 3300042125 Bacteria 3571
828 Ga0450923_112777 3300042125 Bacteria 636
829 Ga0439446_0001964 3300042156 Bacteria 4852
830 Ga0450908_037959 3300042184 Bacteria 835
831 Ga0439434_0273614 3300042435 Bacteria 580
832 Ga0439435_0001188 3300042436 Bacteria 4693
833 Ga0439444_0000441 3300042437 Bacteria 4632
834 Ga0439444_0028990 3300042437 Bacteria 1029
835 Ga0439459_0071438 3300042438 Bacteria 804
836 Ga0439464_0085150 3300042439 Bacteria 948
837 Ga0439460_0060340 3300042461 Bacteria 1157
838 Ga0451577_0113739 3300042876 Bacteria 2422
839 Ga0453683_0675118 3300044673 Bacteria 676
840 Ga0466961_0380136 3300044693 Bacteria 858
841 Ga0466963_0571023 3300044694 Unclassified 799
842 Ga0453684_0000939 3300044712 Bacteria 96146
843 Ga0466957_0369214 3300044842 Bacteria 977
844 Ga0466957_1371645 3300044842 Bacteria 514
845 Ga0466960_0712625 3300044901 Bacteria 603
846 Ga0451576_0439473 3300045051 Bacteria 1369
847 Ga0451576_1078838 3300045051 Bacteria 841
848 Ga0495629_0097002 3300046459 Bacteria 2057
849 Ga0495638_0361285 3300046460 Bacteria 764
850 Ga0495641_0014204 3300046461 Bacteria 4320
851 Ga0495650_0000027 3300046471 Bacteria 475071
852 Ga0495639_0124882 3300046475 Bacteria 1229
853 Ga0495639_0347010 3300046475 Bacteria 745
854 Ga0495594_0007137 3300046499 Bacteria 5750
855 Ga0495594_0115875 3300046499 Bacteria 1513
856 Ga0495596_0312922 3300046500 Bacteria 610
857 Ga0495628_0905706 3300046516 Bacteria 612
858 Ga0495632_0317082 3300046519 Unclassified 689
859 Ga0495644_0106856 3300046523 Bacteria 1061
860 Ga0495663_0124817 3300046525 Bacteria 864
861 Ga0495621_0115680 3300046539 Bacteria 1032
862 Ga0495625_0202858 3300046660 Bacteria 1308
863 Ga0495661_0415862 3300046665 Bacteria 652
864 Ga0495599_0360437 3300046678 Bacteria 871
865 Ga0495613_0055044 3300046689 Bacteria 2924
866 Ga0495600_0111263 3300046809 Bacteria 1783
867 Ga0495581_0066351 3300047315 Bacteria 2087
868 Ga0495636_0075448 3300047318 Bacteria 1445
869 Ga0495672_0002532 3300047320 Bacteria 16670
870 Ga0495677_0026657 3300047445 Bacteria 2096
871 Ga0495685_041165 3300047447 Bacteria 1579
872 Ga0495684_0858240 3300047471 Bacteria 588
873 Ga0495615_0228489 3300048090 Bacteria 583
874 Ga0496100_0722153 3300048903 Bacteria 778
875 Ga0496102_1730079 3300048905 Bacteria 543
876 Ga0496104_0204205 3300048907 Bacteria 1888
877 Ga0496104_0637565 3300048907 Bacteria 975
878 Ga0496104_0648612 3300048907 Bacteria 965
879 Ga0496105_0189172 3300048908 Bacteria 1684
880 Ga0496105_1004879 3300048908 Bacteria 624
881 Ga0496106_0082749 3300048909 Bacteria 2468
882 Ga0496106_0087337 3300048909 Bacteria 2403
883 Ga0496107_0219086 3300048910 Bacteria 1416
884 Ga0496107_1183726 3300048910 Bacteria 550
885 Ga0496108_0062246 3300048911 Bacteria 3142
886 Ga0496108_0141866 3300048911 Bacteria 2070
887 Ga0496108_0290330 3300048911 Bacteria 1424
888 Ga0496108_0660724 3300048911 Bacteria 908
889 Ga0496109_0030074 3300048912 Bacteria 4867
890 Ga0496109_0269154 3300048912 Bacteria 1605
891 Ga0496109_0375171 3300048912 Bacteria 1344
892 Ga0496109_1537762 3300048912 Bacteria 600
893 Ga0496109_1897623 3300048912 Bacteria 528
894 Ga0496110_0044322 3300048913 Bacteria 3885
895 Ga0496112_0033600 3300048915 Bacteria 4987
896 Ga0496112_0618920 3300048915 Bacteria 1014
897 Ga0496112_1770096 3300048915 Bacteria 530
898 Ga0496113_0122120 3300048916 Bacteria 2037
899 Ga0496113_0216289 3300048916 Bacteria 1526
900 Ga0496115_0108203 3300048918 Bacteria 2283
901 Ga0501291_014518 3300049514 Bacteria 1180
902 Ga0501291_027040 3300049514 Bacteria 948
903 Ga0501296_020584 3300049519 Bacteria 841
904 Ga0501298_038603 3300049521 Bacteria 962
905 Ga0501298_115275 3300049521 Bacteria 627
906 Ga0501031_0740531 3300049568 Bacteria 631
907 Ga0501033_0025163 3300049570 Unclassified 4484
908 Ga0501036_0047981 3300049572 Unclassified 3616
909 Ga0501043_0704935 3300049579 Bacteria 737
910 Ga0501046_0842413 3300049580 Bacteria 641
911 Ga0501047_0151210 3300049581 Bacteria 2197
912 Ga0501047_0787812 3300049581 Bacteria 766
913 Ga0501048_0334005 3300049582 Bacteria 1080
914 Ga0501067_0099968 3300049583 Bacteria 1611
915 Ga0501067_0711961 3300049583 Bacteria 564
916 Ga0501068_0135929 3300049584 Bacteria 1539
917 Ga0501068_0780134 3300049584 Unclassified 626
918 Ga0501070_0017289 3300049586 Bacteria 6056
919 Ga0501070_0310953 3300049586 Bacteria 1283
920 Ga0501071_0132060 3300049587 Bacteria 1856
921 Ga0501072_0273858 3300049588 Bacteria 1343
922 Ga0501072_0391494 3300049588 Bacteria 1103
923 Ga0501075_0335650 3300049591 Bacteria 1152
924 Ga0501076_0184903 3300049592 Bacteria 1699
925 Ga0501077_0219660 3300049593 Bacteria 1208
926 Ga0501077_0618620 3300049593 Bacteria 696
927 Ga0501198_024717 3300049649 Bacteria 973
928 Ga0501202_053375 3300049652 Bacteria 900
929 Ga0501207_033814 3300049654 Bacteria 869
930 Ga0501216_053647 3300049660 Bacteria 798
931 Ga0501217_084532 3300049661 Bacteria 883
932 Ga0501224_031055 3300049664 Bacteria 800
933 Ga0501233_129944 3300049668 Bacteria 687
934 Ga0501233_178262 3300049668 Bacteria 607
935 Ga0501233_259214 3300049668 Bacteria 525
936 Ga0501238_057025 3300049671 Bacteria 592
937 Ga0501246_018320 3300049676 Bacteria 705
938 Ga0501247_015519 3300049677 Bacteria 952
939 Ga0501247_049607 3300049677 Bacteria 620
940 Ga0501249_024916 3300049679 Bacteria 1319
941 Ga0501249_039494 3300049679 Bacteria 1067
942 Ga0501249_067965 3300049679 Bacteria 830
943 Ga0501249_160061 3300049679 Bacteria 571
944 Ga0501250_093189 3300049680 Bacteria 527
945 Ga0501253_066061 3300049683 Bacteria 790
946 Ga0501253_089612 3300049683 Bacteria 706
947 Ga0501257_058817 3300049686 Bacteria 969
948 Ga0501259_030012 3300049688 Bacteria 1021
949 Ga0501259_135490 3300049688 Bacteria 598
950 Ga0501225_0035821 3300049705 Bacteria 1367
951 Ga0501229_074495 3300049706 Bacteria 536
952 Ga0501245_156005 3300049708 Bacteria 508
953 Ga0501080_0270777 3300049742 Bacteria 1546
954 Ga0501080_0747330 3300049742 Bacteria 860
955 Ga0501241_067917 3300049758 Bacteria 724
956 Ga0501263_089368 3300049760 Bacteria 518
957 Ga0501265_077458 3300049762 Bacteria 572
958 Ga0501266_057431 3300049763 Unclassified 615
959 Ga0501266_083037 3300049763 Bacteria 546
960 Ga0501268_005903 3300049765 Bacteria 1776
961 Ga0501269_063891 3300049766 Bacteria 525
962 Ga0501272_034014 3300049769 Bacteria 658
963 Ga0501272_050608 3300049769 Bacteria 576
964 Ga0501272_068084 3300049769 Bacteria 517
965 Ga0501279_049312 3300049775 Bacteria 664
966 Ga0501283_041000 3300049779 Bacteria 801
967 Ga0501283_100161 3300049779 Bacteria 563
968 Ga0501035_0164990 3300049822 Bacteria 1916
969 Ga0501044_0016350 3300049823 Bacteria 7966
970 Ga0501044_0220011 3300049823 Bacteria 1850
971 nmdc:mga03n38_271498_c1 3300050490 Bacteria 902
972 nmdc:mga05p37_1049884_c1 3300050507 Bacteria 859
973 nmdc:mga05p37_112785_c1 3300050507 Bacteria 3343
974 nmdc:mga05p37_1715128_c1 3300050507 Bacteria 611
975 nmdc:mga09592_129339_c1 3300050508 Bacteria 2172
976 nmdc:mga09592_195702_c1 3300050508 Bacteria 1750
977 nmdc:mga0qj67_482812_c1 3300050509 Bacteria 997
978 nmdc:mga06r32_125035_c1 3300050510 Bacteria 2539
979 nmdc:mga06r32_1380961_c1 3300050510 Bacteria 647
980 nmdc:mga06r32_575707_c1 3300050510 Bacteria 1098
981 nmdc:mga06r32_604928_c1 3300050510 Bacteria 1067
982 nmdc:mga08y16_1008304_c1 3300050511 Bacteria 812
983 nmdc:mga08y16_1128336_c1 3300050511 Bacteria 758
984 nmdc:mga08y16_1219967_c1 3300050511 Unclassified 722
985 nmdc:mga08y16_1601200_c1 3300050511 Bacteria 609
986 nmdc:mga08y16_22712_c2 3300050511 Bacteria 6419
987 nmdc:mga08y16_38177_c1 3300050511 Bacteria 5044
988 nmdc:mga08y16_492206_c1 3300050511 Bacteria 1247
989 nmdc:mga08y16_721655_c1 3300050511 Bacteria 995
990 nmdc:mga08y16_9515_c1 3300050511 Bacteria 10197
991 nmdc:mga0n895_14555_c1 3300050512 Bacteria 7149
992 nmdc:mga0n895_25288_c1 3300050512 Bacteria 5608
993 nmdc:mga0n895_74179_c1 3300050512 Bacteria 3379
994 nmdc:mga0rr50_1061802_c1 3300050513 Bacteria 689
995 nmdc:mga0rr50_145246_c1 3300050513 Bacteria 1912
996 nmdc:mga08x19_22079_c1 3300050514 Bacteria 3937
997 nmdc:mga08x19_6811_c1 3300050514 Bacteria 6787
998 nmdc:mga0a205_171250_c1 3300050515 Bacteria 2067
999 nmdc:mga0a205_26159_c1 3300050515 Bacteria 5560
1000 nmdc:mga0a205_428254_c1 3300050515 Bacteria 1185
1001 nmdc:mga0a205_723661_c1 3300050515 Bacteria 844
1002 Ga0500646_0004679 3300053090 Bacteria 3458
1003 Ga0500646_0101629 3300053090 Bacteria 903
1004 Ga0500554_042253 3300053102 Bacteria 1404
1005 Ga0500628_000202 3300053129 Bacteria 11575
1006 Ga0500652_302633 3300053131 Bacteria 618
1007 Ga0500658_0074588 3300053134 Bacteria 1439
1008 Ga0500568_0033398 3300053139 Bacteria 2111
1009 Ga0500616_0000575 3300053153 Bacteria 44655
1010 Ga0500616_0096194 3300053153 Bacteria 1456
1011 Ga0500622_0006275 3300053156 Bacteria 6947
1012 Ga0500622_0007430 3300053156 Bacteria 6223
1013 Ga0500633_0323998 3300053160 Bacteria 564
1014 Ga0501084_1086663 3300054114 Bacteria 672
1015 Ga0590071_037169 3300059421 Bacteria 1168
1016 Ga0590074_009280 3300059423 Bacteria 1639
1017 Ga0530510_1128322 3300061734 Unclassified 601
1018 nmdc:mga0rr50_171652_c1
1019 JGI24737J22298_10236793
1020 JGI24035J26624_1011242
1021 JGI25159J45721_1024851
1022 JGI25151J46595_10086933
1023 Ga0055526_1012111
1024 Ga0055524_1000951
1025 Ga0055524_1001641
1026 Ga0055536_1014134
1027 Ga0055534_1008563
1028 Ga0055528_1036653
1029 Ga0055530_10005594
1030 Ga0055531_10001261
1031 Ga0055531_10002230
1032 Ga0055531_10003072
1033 Ga0055531_10010188
1034 Ga0055531_10030703
1035 Ga0065704_10294183
1036 Ga0065712_10008022
1037 Ga0065712_10024919
1038 Ga0065712_10078049
1039 Ga0065712_10173609
1040 Ga0065712_10316965
1041 Ga0065715_10348131
1042 Ga0065715_10393698
1043 Ga0065715_11103161
1044 Ga0065707_10110278
1045 Ga0065707_10115019
1046 Ga0065707_10122585
1047 Ga0065707_10140491
1048 Ga0065707_10531151
1049 Ga0070658_10033753
1050 Ga0070658_10219627
1051 Ga0070658_10708727
1052 Ga0070658_10794943
1053 Ga0070658_10917744
1054 Ga0070676_10047197
1055 Ga0070676_10552157
1056 Ga0070676_11102439
1057 Ga0070683_100002327
1058 Ga0070683_100022612
1059 Ga0070683_100049118
1060 Ga0070683_100087981
1061 Ga0070683_100106856
1062 Ga0070683_100148129
1063 Ga0070683_100164656
1064 Ga0070683_100190785
1065 Ga0070683_100204496
1066 Ga0070683_100890703
1067 Ga0070683_101207398
1068 Ga0070690_100074756
1069 Ga0070690_100552771
1070 Ga0070670_100091108
1071 Ga0070670_100555444
1072 Ga0070670_100559526
1073 Ga0070670_100618898
1074 Ga0070670_100664503
1075 Ga0070670_101099977
1076 Ga0070677_10371602
1077 Ga0070677_10737192
1078 Ga0068869_100046521
1079 Ga0068869_100107791
1080 Ga0068869_100839218
1081 Ga0068869_100848578
1082 Ga0070666_10269224
1083 Ga0070666_10335169
1084 Ga0070680_100008898
1085 Ga0070680_100060199
1086 Ga0070680_100485896
1087 Ga0070680_100630449
1088 Ga0070682_100101276
1089 Ga0070682_100353796
1090 Ga0070682_101752956
1091 Ga0068868_100022080
1092 Ga0070660_100046383
1093 Ga0070660_100085134
1094 Ga0070689_100016259
1095 Ga0070689_100071117
1096 Ga0070689_101144659
1097 Ga0070687_100010285
1098 Ga0070687_100095140
1099 Ga0070687_100391455
1100 Ga0070687_101106785
1101 Ga0070661_100002072
1102 Ga0070661_100021059
1103 Ga0070661_100022798
1104 Ga0070661_100804232
1105 Ga0070661_100823882
1106 Ga0070661_101005954
1107 Ga0070692_10064111
1108 Ga0070668_100034983
1109 Ga0070668_100054067
1110 Ga0070668_100785826
1111 Ga0070669_100001824
1112 Ga0070669_100089004
1113 Ga0070675_100001147
1114 Ga0070675_100033024
1115 Ga0070675_100143974
1116 Ga0070675_100221505
1117 Ga0070675_101260582
1118 Ga0070671_100179082
1119 Ga0070671_100312256
1120 Ga0070671_100564838
1121 Ga0070673_100062378
1122 Ga0070673_100419539
1123 Ga0070688_100038678
1124 Ga0070688_100343518
1125 Ga0070688_100485119
1126 Ga0070688_100550927
1127 Ga0070688_100571762
1128 Ga0070659_100037782
1129 Ga0070659_100087344
1130 Ga0070659_100117239
1131 Ga0070659_100264869
1132 Ga0070659_100448035
1133 Ga0070659_100483195
1134 Ga0070659_100771709
1135 Ga0070659_101284901
1136 Ga0070667_100064211
1137 Ga0070667_100314189
1138 Ga0070667_100575319
1139 Ga0070667_100836368
1140 Ga0070667_101047847
1141 Ga0070667_101710805
1142 Ga0070703_10257965
1143 Ga0070703_10575581
1144 Ga0070701_10023737
1145 Ga0070701_10333854
1146 Ga0070705_100005429
1147 Ga0070705_101201364
1148 Ga0070705_101390433
1149 Ga0070700_100028866
1150 Ga0070700_100125557
1151 Ga0070700_100262775
1152 Ga0070694_100046697
1153 Ga0070694_100467427
1154 Ga0070694_100667087
1155 Ga0070663_100624087
1156 Ga0070663_101055043
1157 Ga0070678_100185328
1158 Ga0070678_101792386
1159 Ga0070662_100013116
1160 Ga0070662_100064872
1161 Ga0070662_100066832
1162 Ga0070662_100225888
1163 Ga0070662_100422641
1164 Ga0070662_101260712
1165 Ga0070662_101713121
1166 Ga0070681_10008511
1167 Ga0070681_10008667
1168 Ga0070681_10014161
1169 Ga0070681_10017926
1170 Ga0070681_10127822
1171 Ga0070681_10350335
1172 Ga0070681_10503191
1173 Ga0070681_10558475
1174 Ga0070681_10916527
1175 Ga0070681_11340398
1176 Ga0070681_11384466
1177 Ga0068867_101095795
1178 Ga0068867_102136684
1179 Ga0070685_10014935
1180 Ga0070685_10061086
1181 Ga0070685_10291930
1182 Ga0070699_100551056
1183 Ga0070679_100001702
1184 Ga0070679_100117134
1185 Ga0070679_100196255
1186 Ga0070679_100281350
1187 Ga0070679_100465364
1188 Ga0070679_100821206
1189 Ga0070684_100013783
1190 Ga0070684_100082361
1191 Ga0070684_100087732
1192 Ga0070684_100113100
1193 Ga0070684_100128544
1194 Ga0070684_100137105
1195 Ga0070684_100400221
1196 Ga0070684_100595088
1197 Ga0070684_101559255
1198 Ga0068853_100005407
1199 Ga0068853_100015819
1200 Ga0068853_101136693
1201 Ga0070672_100080600
1202 Ga0070672_100153463
1203 Ga0070672_100293531
1204 Ga0070672_100295777
1205 Ga0070672_100621980
1206 Ga0070686_100143250
1207 Ga0070686_100304681
1208 Ga0070686_100520786
1209 Ga0070693_100069750
1210 Ga0070693_100598019
1211 Ga0070693_100934846
1212 Ga0070693_101113568
1213 Ga0070665_100092233
1214 Ga0070665_100124658
1215 Ga0070665_100946435
1216 Ga0070704_100822956
1217 Ga0070704_101079369
1218 Ga0068855_100034057
1219 Ga0068855_101620525
1220 Ga0070664_100020581
1221 Ga0070664_100088840
1222 Ga0070664_100094612
1223 Ga0070664_100141951
1224 Ga0070664_100149326
1225 Ga0070664_100171061
1226 Ga0070664_100175576
1227 Ga0070664_100375557
1228 Ga0070664_100419906
1229 Ga0070664_100617040
1230 Ga0070664_100675394
1231 Ga0070664_101070841
1232 Ga0068857_100043819
1233 Ga0068857_100051176
1234 Ga0068857_100068506
1235 Ga0068857_100112028
1236 Ga0068857_100459159
1237 Ga0068854_100540134
1238 Ga0068854_101611583
1239 Ga0068856_100102001
1240 Ga0068856_100180514
1241 Ga0068856_100843215
1242 Ga0070702_100052170
1243 Ga0070702_100976558
1244 Ga0068852_100009459
1245 Ga0068852_100092675
1246 Ga0068852_100150106
1247 Ga0068852_100678330
1248 Ga0068852_100920858
1249 Ga0068852_101209822
1250 Ga0068852_101352754
1251 Ga0068859_100020078
1252 Ga0068859_100184489
1253 Ga0068859_100264811
1254 Ga0068864_100068876
1255 Ga0068864_100218966
1256 Ga0068864_100306502
1257 Ga0068864_100559129
1258 Ga0068864_100893879
1259 Ga0068864_101261451
1260 Ga0068864_101417493
1261 Ga0068861_100004625
1262 Ga0068861_100066574
1263 Ga0068861_100143628
1264 Ga0068861_100624850
1265 Ga0068861_102551930
1266 Ga0068851_10016073
1267 Ga0068851_10220794
1268 Ga0068870_10029793
1269 Ga0068870_10060121
1270 Ga0068870_10395524
1271 Ga0068863_100003611
1272 Ga0068863_100075877
1273 Ga0068863_100317582
1274 Ga0068863_100452830
1275 Ga0068863_100605585
1276 Ga0068863_100812642
1277 Ga0068858_100021630
1278 Ga0068858_100491077
1279 Ga0068858_101245288
1280 Ga0068858_101377475
1281 Ga0068860_100028624
1282 Ga0068860_100510746
1283 Ga0068860_101010530
1284 Ga0068862_100009967
1285 Ga0068862_100021217
1286 Ga0068862_100158957
1287 Ga0068862_100185733
1288 Ga0068862_100521507
1289 Ga0081455_10434191
1290 Ga0075363_100311093
1291 Ga0075432_10066695
1292 Ga0075432_10297490
1293 Ga0070712_100650094
1294 Ga0070712_101247602
1295 Ga0075427_10021685
1296 Ga0097621_100066116
1297 Ga0097621_101162523
1298 Ga0075428_100017080
1299 Ga0075428_100093041
1300 Ga0075428_101203021
1301 Ga0075428_101391601
1302 Ga0075430_100428689
1303 Ga0075430_100772785
1304 Ga0075430_101084695
1305 Ga0075430_101155436
1306 Ga0075431_100148241
1307 Ga0075431_100615164
1308 Ga0075433_10025380
1309 Ga0075433_10074113
1310 Ga0075433_10144868
1311 Ga0075434_100006240
1312 Ga0075434_100105101
1313 Ga0075434_100353241
1314 Ga0075429_100074976
1315 Ga0075429_100198819
1316 Ga0068865_100004671
1317 Ga0068865_100004928
1318 Ga0068865_101050681
1319 Ga0075436_100014918
1320 Ga0097620_100020078
1321 Ga0097620_100184490
1322 Ga0097620_100264810
1323 Ga0075435_100084960
1324 Ga0075435_100580976
1325 Ga0075435_101385799
1326 Ga0105240_10032792
1327 Ga0105240_11165800
1328 Ga0111539_10017919
1329 Ga0111539_10049836
1330 Ga0111539_10080853
1331 Ga0111539_10094070
1332 Ga0111539_10108588
1333 Ga0111539_10167917
1334 Ga0111539_10255592
1335 Ga0111539_10656679
1336 Ga0111539_10726126
1337 Ga0105245_10279297
1338 Ga0105247_10155745
1339 Ga0105247_10425335
1340 Ga0114129_10088126
1341 Ga0114129_10121071
1342 Ga0114129_10817026
1343 Ga0114129_12070114
1344 Ga0114129_13222569
1345 Ga0105243_10552403
1346 Ga0105243_10751262
1347 Ga0105243_11693957
1348 Ga0105241_10048790
1349 Ga0105241_11216060
1350 Ga0105242_10059694
1351 Ga0105242_10717467
1352 Ga0105242_10745422
1353 Ga0105242_11209334
1354 Ga0105242_12129757
1355 Ga0105248_10056165
1356 Ga0105248_10070473
1357 Ga0105248_10253628
1358 Ga0105248_10511315
1359 Ga0105248_11199304
1360 Ga0105248_11439451
1361 Ga0105248_11492275
1362 Ga0105237_10721189
1363 Ga0105237_10888068
1364 Ga0105238_10096002
1365 Ga0105238_10247955
1366 Ga0105238_10695910
1367 Ga0105238_10716294
1368 Ga0105238_10730448
1369 Ga0105249_10029865
1370 Ga0105249_10041058
1371 Ga0105249_10151644
1372 Ga0105249_10158694
1373 Ga0105249_10524989
1374 Ga0105249_11917200
1375 Ga0105239_10004359
1376 Ga0105239_12667774
1377 Ga0157315_1013431
1378 Ga0157327_1003733
1379 Ga0157373_10053842
1380 Ga0157373_10067088
1381 Ga0157373_10253994
1382 Ga0157373_10294390
1383 Ga0157373_10438985
1384 Ga0157373_10458019
1385 Ga0157373_10556809
1386 Ga0157373_10591866
1387 Ga0157373_10739503
1388 Ga0157371_10036763
1389 Ga0157371_10198700
1390 Ga0157371_10697026
1391 Ga0157371_11437521
1392 Ga0157370_10016751
1393 Ga0157370_10084953
1394 Ga0157370_10648767
1395 Ga0157370_10733419
1396 Ga0157370_10843135
1397 Ga0157370_11141415
1398 Ga0157369_10027504
1399 Ga0157369_10040652
1400 Ga0157369_11322528
1401 Ga0157374_10110905
1402 Ga0157374_10159090
1403 Ga0157374_10786660
1404 Ga0157378_10221099
1405 Ga0157378_11371948
1406 Ga0157378_11834058
1407 Ga0163162_10012258
1408 Ga0163162_11625390
1409 Ga0163162_12315488
1410 Ga0163162_12761386
1411 Ga0157372_10018905
1412 Ga0157372_10030499
1413 Ga0157372_10094890
1414 Ga0157372_10099327
1415 Ga0157372_10157722
1416 Ga0157372_10196009
1417 Ga0157372_10281497
1418 Ga0157372_10292597
1419 Ga0157372_10383648
1420 Ga0157372_10691515
1421 Ga0157372_11648719
1422 Ga0157372_11673898
1423 Ga0157372_12141682
1424 Ga0157375_10014319
1425 Ga0157375_10045132
1426 Ga0157375_10047652
1427 Ga0157375_10069477
1428 Ga0157375_10167683
1429 Ga0157375_10822861
1430 Ga0157375_12375921
1431 Ga0163163_10131822
1432 Ga0163163_10215355
1433 Ga0157380_10125160
1434 Ga0157380_10162324
1435 Ga0157377_10008532
1436 Ga0157377_10028605
1437 Ga0157377_10100295
1438 Ga0157377_10451901
1439 Ga0157379_10012695
1440 Ga0157379_10288858
1441 Ga0157379_10560193
1442 Ga0157376_10189927
1443 Ga0157376_11630474
1444 Ga0157376_12371917
1445 Ga0157376_12758708
1446 Ga0182007_10301113
1447 Ga0163161_10018510
1448 Ga0163161_10602091
1449 Ga0163161_11175931
1450 Ga0206353_10233494
1451 Ga0213876_10003094
1452 Ga0213876_10011231
1453 Ga0209673_1004145
1454 Ga0209130_1007131
1455 Ga0209675_1006161
1456 Ga0209675_1012769
1457 Ga0209676_1000764
1458 Ga0209676_1001068
1459 Ga0209025_1001810
1460 Ga0209025_1024030
1461 Ga0209025_1075421
1462 Ga0209564_1005861
1463 Ga0209564_1016181
1464 Ga0209758_1040504
1465 Ga0209050_1005038
1466 Ga0209050_1017947
1467 Ga0209256_1000575
1468 Ga0209256_1002249
1469 Ga0209051_1006260
1470 Ga0209257_1000065
1471 Ga0209257_1000498
1472 Ga0209257_1000593
1473 Ga0209257_1001112
1474 Ga0209257_1003126
1475 Ga0209257_1004270
1476 Ga0207697_10009866
1477 Ga0207697_10183676
1478 Ga0207697_10295155
1479 Ga0207656_10016846
1480 Ga0207656_10046472
1481 Ga0207656_10060426
1482 Ga0207682_10139122
1483 Ga0207682_10431936
1484 Ga0207642_10625636
1485 Ga0207688_10054461
1486 Ga0207688_10059278
1487 Ga0207688_10462002
1488 Ga0207680_10094716
1489 Ga0207680_10278909
1490 Ga0207647_10050141
1491 Ga0207647_10257058
1492 Ga0207645_10011297
1493 Ga0207643_10042901
1494 Ga0207643_10201022
1495 Ga0207705_10024486
1496 Ga0207705_10049896
1497 Ga0207705_10200069
1498 Ga0207705_10656421
1499 Ga0207705_10887568
1500 Ga0207705_10955775
1501 Ga0207705_11400917
1502 Ga0207684_10065996
1503 Ga0207654_10017730
1504 Ga0207654_10585418
1505 Ga0207707_10001539
1506 Ga0207707_10009253
1507 Ga0207707_10041123
1508 Ga0207707_10072921
1509 Ga0207707_10096763
1510 Ga0207707_10097980
1511 Ga0207707_10768404
1512 Ga0207695_10064899
1513 Ga0207671_10567938
1514 Ga0207663_10286707
1515 Ga0207660_10007070
1516 Ga0207660_10012283
1517 Ga0207660_10372285
1518 Ga0207660_10663877
1519 Ga0207662_10014013
1520 Ga0207662_10054696
1521 Ga0207657_10024845
1522 Ga0207657_10086708
1523 Ga0207657_10191899
1524 Ga0207649_10019705
1525 Ga0207649_10033784
1526 Ga0207649_10066165
1527 Ga0207649_10518634
1528 Ga0207652_10067634
1529 Ga0207652_10104068
1530 Ga0207652_10618453
1531 Ga0207652_11362043
1532 Ga0207652_11747936
1533 Ga0207681_10013719
1534 Ga0207681_10511789
1535 Ga0207694_10249068
1536 Ga0207694_10742799
1537 Ga0207694_10922372
1538 Ga0207650_10050200
1539 Ga0207650_10067932
1540 Ga0207650_10333562
1541 Ga0207650_11131566
1542 Ga0207650_11271985
1543 Ga0207659_10079982
1544 Ga0207659_10252219
1545 Ga0207659_10275502
1546 Ga0207659_10297605
1547 Ga0207659_10418239
1548 Ga0207659_10634140
1549 Ga0207659_10733871
1550 Ga0207664_10364119
1551 Ga0207644_10262683
1552 Ga0207644_10308870
1553 Ga0207644_10385769
1554 Ga0207644_10641008
1555 Ga0207690_10016598
1556 Ga0207690_10026685
1557 Ga0207690_10128824
1558 Ga0207690_10330085
1559 Ga0207690_10795058
1560 Ga0207690_10872051
1561 Ga0207706_10002237
1562 Ga0207706_10081778
1563 Ga0207686_10037265
1564 Ga0207686_11306938
1565 Ga0207709_10647032
1566 Ga0207670_10066576
1567 Ga0207670_10337339
1568 Ga0207670_10959984
1569 Ga0207670_11932016
1570 Ga0207669_10727829
1571 Ga0207704_10027971
1572 Ga0207704_10124939
1573 Ga0207704_11716438
1574 Ga0207691_10046847
1575 Ga0207691_10097144
1576 Ga0207691_10099416
1577 Ga0207691_10125146
1578 Ga0207691_10222306
1579 Ga0207711_10041786
1580 Ga0207711_10473336
1581 Ga0207689_10037078
1582 Ga0207689_10201212
1583 Ga0207689_10546033
1584 Ga0207689_11091049
1585 Ga0207661_10002394
1586 Ga0207661_10028189
1587 Ga0207661_10085411
1588 Ga0207661_10106480
1589 Ga0207661_10168154
1590 Ga0207661_10189880
1591 Ga0207661_10362443
1592 Ga0207661_10868878
1593 Ga0207661_10876897
1594 Ga0207661_10879246
1595 Ga0207679_10002284
1596 Ga0207679_10041988
1597 Ga0207679_10077744
1598 Ga0207679_10163265
1599 Ga0207679_10185497
1600 Ga0207679_10208189
1601 Ga0207679_10288698
1602 Ga0207679_10380007
1603 Ga0207679_10424722
1604 Ga0207679_10453408
1605 Ga0207679_10613656
1606 Ga0207679_10977952
1607 Ga0207679_11207135
1608 Ga0207679_11826462
1609 Ga0207667_10231860
1610 Ga0207667_10605382
1611 Ga0207667_11039029
1612 Ga0207667_11899658
1613 Ga0207667_12032403
1614 Ga0207651_10025055
1615 Ga0207651_10045633
1616 Ga0207712_10013793
1617 Ga0207712_10015567
1618 Ga0207712_10032907
1619 Ga0207712_10288438
1620 Ga0207668_10009889
1621 Ga0207668_10021866
1622 Ga0207640_10308730
1623 Ga0207640_10483521
1624 Ga0207640_10726259
1625 Ga0207640_11431750
1626 Ga0207640_11514858
1627 Ga0207658_10052857
1628 Ga0207658_10147742
1629 Ga0207658_11305173
1630 Ga0207677_10160633
1631 Ga0207677_10256424
1632 Ga0207677_11541778
1633 Ga0207703_10023800
1634 Ga0207703_10425013
1635 Ga0207703_11019406
1636 Ga0207703_11743076
1637 Ga0207703_11773075
1638 Ga0207639_10016177
1639 Ga0207639_10063961
1640 Ga0207639_10336450
1641 Ga0207639_10592155
1642 Ga0207639_10915047
1643 Ga0207639_12046953
1644 Ga0207639_12197742
1645 Ga0207678_10044834
1646 Ga0207678_10411538
1647 Ga0207708_10032553
1648 Ga0207708_10528025
1649 Ga0207702_10184662
1650 Ga0207702_10694463
1651 Ga0207702_10893626
1652 Ga0207702_11818375
1653 Ga0207641_10103975
1654 Ga0207641_10325662
1655 Ga0207641_10693479
1656 Ga0207641_10913838
1657 Ga0207641_10926881
1658 Ga0207641_11060259
1659 Ga0207648_10040177
1660 Ga0207648_10146559
1661 Ga0207648_11191749
1662 Ga0207676_10247055
1663 Ga0207676_10568584
1664 Ga0207676_10689996
1665 Ga0207676_10798897
1666 Ga0207676_11063303
1667 Ga0207676_11442351
1668 Ga0207676_12065615
1669 Ga0207674_10008894
1670 Ga0207674_10047433
1671 Ga0207674_10056432
1672 Ga0207674_10122083
1673 Ga0207674_10488628
1674 Ga0207675_100000209
1675 Ga0207675_100002910
1676 Ga0207675_100594660
1677 Ga0207675_100668168
1678 Ga0207675_100805885
1679 Ga0207675_102189842
1680 Ga0207698_10039806
1681 Ga0207698_10051296
1682 Ga0207698_10132867
1683 Ga0207698_11163174
1684 Ga0207698_11330778
1685 Ga0209995_1062771
1686 Ga0209970_1041146
1687 Ga0209974_10093259
1688 Ga0207428_10009104
1689 Ga0207428_10054860
1690 Ga0207428_10067609
1691 Ga0207428_10155986
1692 Ga0207428_10221820
1693 Ga0268266_10237080
1694 Ga0268266_10246397
1695 Ga0268266_10383095
1696 Ga0268266_10691353
1697 Ga0268266_12008685
1698 Ga0268265_10012226
1699 Ga0268265_10013128
1700 Ga0268265_10304984
1701 Ga0268265_11966241
1702 Ga0268264_10087668
1703 Ga0307517_10549211
1704 Ga0307515_10707329
1705 Ga0307408_100005765
1706 Ga0307408_100022310
1707 Ga0307408_100069266
1708 Ga0307408_100071711
1709 Ga0307408_100190589
1710 Ga0307405_10000431
1711 Ga0307405_10000467
1712 Ga0307405_10004308
1713 Ga0307405_10025988
1714 Ga0307405_10397022
1715 Ga0307405_10410594
1716 Ga0307405_11061527
1717 Ga0307405_11490986
1718 Ga0307413_10000553
1719 Ga0307413_10000611
1720 Ga0307413_10046328
1721 Ga0307413_10065562
1722 Ga0307413_10086659
1723 Ga0307413_10256133
1724 Ga0307413_10348001
1725 Ga0307413_10431682
1726 Ga0307413_10645769
1727 Ga0307410_10014163
1728 Ga0307410_10047568
1729 Ga0307410_10061960
1730 Ga0307410_10178373
1731 Ga0307410_10197290
1732 Ga0307410_10239074
1733 Ga0307410_10396720
1734 Ga0307410_10422915
1735 Ga0307410_11171109
1736 Ga0307406_10002382
1737 Ga0307406_10005037
1738 Ga0307406_10014924
1739 Ga0307406_10035208
1740 Ga0307406_10053531
1741 Ga0307406_10063388
1742 Ga0307406_10143337
1743 Ga0307406_10200322
1744 Ga0307406_10229065
1745 Ga0307407_10000511
1746 Ga0307407_10004075
1747 Ga0307407_10041261
1748 Ga0307407_10161929
1749 Ga0307407_10250093
1750 Ga0307407_10275083
1751 Ga0307407_10329993
1752 Ga0307407_10883291
1753 Ga0307407_11094928
1754 Ga0307412_10001715
1755 Ga0307412_10010522
1756 Ga0307412_10029005
1757 Ga0307412_10059476
1758 Ga0307412_10372344
1759 Ga0307412_10454780
1760 Ga0307412_12315555
1761 Ga0307409_100000474
1762 Ga0307409_100004192
1763 Ga0307409_100066532
1764 Ga0307409_100072959
1765 Ga0307409_100462768
1766 Ga0307409_100913706
1767 Ga0307409_101398726
1768 Ga0307409_101635213
1769 Ga0307416_100000163
1770 Ga0307416_100000912
1771 Ga0307416_100001181
1772 Ga0307416_100018472
1773 Ga0307416_100040050
1774 Ga0307416_100092765
1775 Ga0307416_100252872
1776 Ga0307416_100310937
1777 Ga0307416_100716573
1778 Ga0307416_100854641
1779 Ga0307416_101074897
1780 Ga0307416_101810145
1781 Ga0307416_102070073
1782 Ga0307414_10001031
1783 Ga0307414_10002523
1784 Ga0307414_10129588
1785 Ga0307414_10143624
1786 Ga0307414_10314665
1787 Ga0307414_10326140
1788 Ga0307414_10460805
1789 Ga0307411_10000120
1790 Ga0307411_10003303
1791 Ga0307411_10010089
1792 Ga0307411_10058094
1793 Ga0307411_10122995
1794 Ga0307411_10163960
1795 Ga0307411_10262565
1796 Ga0307411_10276649
1797 Ga0307411_10798627
1798 Ga0307411_11181599
1799 Ga0307415_100001591
1800 Ga0307415_100022540
1801 Ga0307415_100113318
1802 Ga0307415_100173143
1803 Ga0307415_100534568
1804 Ga0307415_100651072
1805 Ga0307415_101396334
1806 Ga0307510_10000276
1807 Ga0373952_0058003
1808 Ga0373960_0178499
1809 Ga0373946_0419620
1810 Ga0373961_0129810
1811 Ga0373962_0086014
1812 Ga0395899_0122473
1813 Ga0395900_0001278
1814 Ga0395900_0261130
1815 Ga0395898_0002604
1816 Ga0395898_0023538
1817 Ga0395898_0170279
1818 Ga0395905_0086560
1819 Ga0395905_0247916
1820 Ga0395905_1815990
1821 Ga0436364_1168503
1822 Ga0395901_0000327
1823 Ga0395901_0020475
1824 Ga0395901_0028345
1825 Ga0436365_0137719
1826 Ga0436365_0173963
1827 Ga0436365_0223687
1828 Ga0436362_1069022
1829 Ga0439439_0059749
1830 Ga0439439_0131204
1831 Ga0439453_0017774
1832 Ga0439461_0012170
1833 Ga0451800_0683371
1834 Ga0451847_0370653
1835 Ga0451853_1340511
1836 Ga0439433_0031208
1837 Ga0439441_023866
1838 Ga0439443_016136
1839 Ga0439448_0017521
1840 Ga0439454_048451
1841 Ga0439456_075124
1842 Ga0439462_0078786
1843 Ga0450917_027856
1844 Ga0450923_000962
1845 Ga0450923_112777
1846 Ga0439446_0001964
1847 Ga0450908_037959
1848 Ga0439434_0273614
1849 Ga0439435_0001188
1850 Ga0439444_0000441
1851 Ga0439444_0028990
1852 Ga0439459_0071438
1853 Ga0439464_0085150
1854 Ga0439460_0060340
1855 Ga0451577_0113739
1856 Ga0453683_0675118
1857 Ga0466961_0380136
1858 Ga0466963_0571023
1859 Ga0453684_0000939
1860 Ga0466957_0369214
1861 Ga0466957_1371645
1862 Ga0466960_0712625
1863 Ga0451576_0439473
1864 Ga0451576_1078838
1865 Ga0495629_0097002
1866 Ga0495638_0361285
1867 Ga0495641_0014204
1868 Ga0495650_0000027
1869 Ga0495639_0124882
1870 Ga0495639_0347010
1871 Ga0495594_0007137
1872 Ga0495594_0115875
1873 Ga0495596_0312922
1874 Ga0495628_0905706
1875 Ga0495632_0317082
1876 Ga0495644_0106856
1877 Ga0495663_0124817
1878 Ga0495621_0115680
1879 Ga0495625_0202858
1880 Ga0495661_0415862
1881 Ga0495599_0360437
1882 Ga0495613_0055044
1883 Ga0495600_0111263
1884 Ga0495581_0066351
1885 Ga0495636_0075448
1886 Ga0495672_0002532
1887 Ga0495677_0026657
1888 Ga0495685_041165
1889 Ga0495684_0858240
1890 Ga0495615_0228489
1891 Ga0496100_0722153
1892 Ga0496102_1730079
1893 Ga0496104_0204205
1894 Ga0496104_0637565
1895 Ga0496104_0648612
1896 Ga0496105_0189172
1897 Ga0496105_1004879
1898 Ga0496106_0082749
1899 Ga0496106_0087337
1900 Ga0496107_0219086
1901 Ga0496107_1183726
1902 Ga0496108_0062246
1903 Ga0496108_0141866
1904 Ga0496108_0290330
1905 Ga0496108_0660724
1906 Ga0496109_0030074
1907 Ga0496109_0269154
1908 Ga0496109_0375171
1909 Ga0496109_1537762
1910 Ga0496109_1897623
1911 Ga0496110_0044322
1912 Ga0496112_0033600
1913 Ga0496112_0618920
1914 Ga0496112_1770096
1915 Ga0496113_0122120
1916 Ga0496113_0216289
1917 Ga0496115_0108203
1918 Ga0501291_014518
1919 Ga0501291_027040
1920 Ga0501296_020584
1921 Ga0501298_038603
1922 Ga0501298_115275
1923 Ga0501031_0740531
1924 Ga0501033_0025163
1925 Ga0501036_0047981
1926 Ga0501043_0704935
1927 Ga0501046_0842413
1928 Ga0501047_0151210
1929 Ga0501047_0787812
1930 Ga0501048_0334005
1931 Ga0501067_0099968
1932 Ga0501067_0711961
1933 Ga0501068_0135929
1934 Ga0501068_0780134
1935 Ga0501070_0017289
1936 Ga0501070_0310953
1937 Ga0501071_0132060
1938 Ga0501072_0273858
1939 Ga0501072_0391494
1940 Ga0501075_0335650
1941 Ga0501076_0184903
1942 Ga0501077_0219660
1943 Ga0501077_0618620
1944 Ga0501198_024717
1945 Ga0501202_053375
1946 Ga0501207_033814
1947 Ga0501216_053647
1948 Ga0501217_084532
1949 Ga0501224_031055
1950 Ga0501233_129944
1951 Ga0501233_178262
1952 Ga0501233_259214
1953 Ga0501238_057025
1954 Ga0501246_018320
1955 Ga0501247_015519
1956 Ga0501247_049607
1957 Ga0501249_024916
1958 Ga0501249_039494
1959 Ga0501249_067965
1960 Ga0501249_160061
1961 Ga0501250_093189
1962 Ga0501253_066061
1963 Ga0501253_089612
1964 Ga0501257_058817
1965 Ga0501259_030012
1966 Ga0501259_135490
1967 Ga0501225_0035821
1968 Ga0501229_074495
1969 Ga0501245_156005
1970 Ga0501080_0270777
1971 Ga0501080_0747330
1972 Ga0501241_067917
1973 Ga0501263_089368
1974 Ga0501265_077458
1975 Ga0501266_057431
1976 Ga0501266_083037
1977 Ga0501268_005903
1978 Ga0501269_063891
1979 Ga0501272_034014
1980 Ga0501272_050608
1981 Ga0501272_068084
1982 Ga0501279_049312
1983 Ga0501283_041000
1984 Ga0501283_100161
1985 Ga0501035_0164990
1986 Ga0501044_0016350
1987 Ga0501044_0220011
1988 nmdc:mga03n38_271498_c1
1989 nmdc:mga05p37_1049884_c1
1990 nmdc:mga05p37_112785_c1
1991 nmdc:mga05p37_1715128_c1
1992 nmdc:mga09592_129339_c1
1993 nmdc:mga09592_195702_c1
1994 nmdc:mga0qj67_482812_c1
1995 nmdc:mga06r32_125035_c1
1996 nmdc:mga06r32_1380961_c1
1997 nmdc:mga06r32_575707_c1
1998 nmdc:mga06r32_604928_c1
1999 nmdc:mga08y16_1008304_c1
2000 nmdc:mga08y16_1128336_c1
2001 nmdc:mga08y16_1219967_c1
2002 nmdc:mga08y16_1601200_c1
2003 nmdc:mga08y16_22712_c2
2004 nmdc:mga08y16_38177_c1
2005 nmdc:mga08y16_492206_c1
2006 nmdc:mga08y16_721655_c1
2007 nmdc:mga08y16_9515_c1
2008 nmdc:mga0n895_14555_c1
2009 nmdc:mga0n895_25288_c1
2010 nmdc:mga0n895_74179_c1
2011 nmdc:mga0rr50_1061802_c1
2012 nmdc:mga0rr50_145246_c1
2013 nmdc:mga08x19_22079_c1
2014 nmdc:mga08x19_6811_c1
2015 nmdc:mga0a205_171250_c1
2016 nmdc:mga0a205_26159_c1
2017 nmdc:mga0a205_428254_c1
2018 nmdc:mga0a205_723661_c1
2019 Ga0500646_0004679
2020 Ga0500646_0101629
2021 Ga0500554_042253
2022 Ga0500628_000202
2023 Ga0500652_302633
2024 Ga0500658_0074588
2025 Ga0500568_0033398
2026 Ga0500616_0000575
2027 Ga0500616_0096194
2028 Ga0500622_0006275
2029 Ga0500622_0007430
2030 Ga0500633_0323998
2031 Ga0501084_1086663
2032 Ga0590071_037169
2033 Ga0590074_009280
2034 Ga0530510_1128322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

37

83

0.97

PF12840

HTH_20

Helix-turn-helix domain

35

84

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9119 9 87
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9101 4 87
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9082 4 87
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.908 16 75
3lmm-assembly4.cif.gz_D crystal structure of the dip2311 protein from corynebacterium diphtheriae, northeast structural genomics consortium target cdr35 0.8972 18 74
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9334 18 73 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9169 3 83 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9129 6 86 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9119 9 87 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.908 16 75 1.10.10.10
ID Description Score Start End GO Terms
AF-W7CAE8-F1-model_v4 deleted 0.9704 6 79
AF-A0A3M0T2P4-F1-model_v4 ArsR family transcriptional regulator 0.9675 3 73 GO:0003700
AF-A0A7V5WPP1-F1-model_v4 ArsR family transcriptional regulator 0.9541 6 79 GO:0003700
AF-A0A2S9G3J3-F1-model_v4 Transcriptional regulator 0.947 1 84 GO:0003700
AF-A0A432EPW3-F1-model_v4 Transcriptional regulator 0.9393 6 85 GO:0003700

Map