F488275

General Info

Members Datasets Scaffolds Average Seq Length
1016 483 986 341

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2721755763|2723876406
Length 404
Sequence RQPGRHLQAAKFASDTVWAGTGEAVGRVREVGCLENIIGYYMARRFHPHIMTALPATATPDPLAQAHAEARQAALEHWLAEVKAPFALDLATVAPASVDASFRRYFRVASASPAHPTLIVMDAPPPQEDCRPFVHVSGLLHEAGLNSPRILAQDLTQGFLLLSDLGRSTYLDVLDEHNATRLYRAAFDALIAWQLASRPGQLPPYDKALLQRELDLFPTWYIERHLNMALSPSQQEVLAQTNTLLIDSALAQPQVYVHRDYMPRNLMVSEPNPGILDFQDAVYGPLTYDVISLLRDAFISWEEDLQLDWLIHYWENAKRAGLPVRQDFGEFYQECEWMGLQRHLKVLGIFARIQYRDGKPRYLADTPRFLQYAHKVAARYRPLHPLARLLDTLDGKSAAVGYTF

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
3 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
4 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
5 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
6 2643221658 Variovorax sp. Root411 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
9 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2842677519 Variovorax sp. R-72495 Isolate Unclassified
14 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
15 2885198086 Variovorax sp. 679 Isolate Unclassified
16 2885211737 Variovorax sp. 553 Isolate Unclassified
17 2885266251 Ralstonia sp. SET104 Isolate Nodule
18 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
19 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
20 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
21 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
22 2904456579 Variovorax sp. 2002 Isolate Unclassified
23 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
24 2928058823 Ralstonia sp. 1138 Isolate Unclassified
25 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
26 2929520902 Variovorax beijingensis 502 Isolate Unclassified
27 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
28 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
29 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
30 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
31 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
38 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
39 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
43 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
44 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
52 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
140 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
149 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
174 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
192 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
269 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
272 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
276 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
277 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
278 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
279 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
280 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
281 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
282 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
283 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
286 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
287 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
288 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
289 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
292 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
293 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
294 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
295 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
296 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
297 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
298 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
300 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
301 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
302 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
305 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
306 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
307 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
308 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
313 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
316 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
317 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
318 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
319 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
320 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
321 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
322 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
323 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
324 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
325 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
326 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
327 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
328 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
329 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
330 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
331 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
332 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
333 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
334 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
335 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
336 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
337 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
338 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
339 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
340 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
341 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
342 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
343 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
344 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
345 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
346 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
347 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
348 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
349 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
350 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
355 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
356 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
357 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
358 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
359 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
365 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
366 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
367 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
368 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
369 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
372 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
373 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
374 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
375 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
376 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
377 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
378 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
379 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
380 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
393 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
394 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
395 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
398 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
399 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
400 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
441 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
442 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
443 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
446 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
447 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
448 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
449 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
450 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
453 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
458 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
459 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
460 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
461 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
462 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
465 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
466 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
467 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
468 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
469 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
470 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
471 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
472 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
473 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
474 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
475 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
476 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
477 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
478 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
479 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 0.3
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 0.3
Rhizoplane 1.77
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000490 3300001915 Bacteria 12087
2 JGI24740J21852_10000170 3300001979 Bacteria 26025
3 JGI24740J21852_10000394 3300001979 Bacteria 18727
4 JGI24740J21852_10005758 3300001979 Bacteria 5208
5 JGI25154J39366_1000650 3300002738 Bacteria 16227
6 JGI25152J39213_1005420 3300002773 Bacteria 3725
7 JGI25159J45721_1011185 3300002987 Bacteria 2221
8 JGI25406J46586_10046803 3300003203 Bacteria 1479
9 Ga0055539_1000230 3300003752 Bacteria 39333
10 Ga0055539_1000294 3300003752 Bacteria 27517
11 Ga0055533_1005484 3300003756 Bacteria 2026
12 Ga0055532_1000006 3300003758 Bacteria 451244
13 Ga0055525_1000414 3300003759 Bacteria 26035
14 Ga0055535_1000004 3300003761 Bacteria 451244
15 Ga0055535_1000759 3300003761 Bacteria 23986
16 Ga0055529_1000022 3300003763 Bacteria 320108
17 Ga0055526_1005405 3300003771 Bacteria 7351
18 Ga0055537_1000341 3300003773 Bacteria 31907
19 Ga0055536_1002361 3300003781 Bacteria 10677
20 Ga0055536_1002834 3300003781 Bacteria 9551
21 Ga0055534_1000320 3300003784 Bacteria 31907
22 Ga0055528_1002843 3300003790 Bacteria 9039
23 Ga0055528_1004744 3300003790 Bacteria 6481
24 Ga0055530_10026300 3300003791 Bacteria 1610
25 Ga0055540_1001647 3300003792 Bacteria 12967
26 Ga0055540_1001867 3300003792 Bacteria 11840
27 Ga0055540_1001942 3300003792 Bacteria 11567
28 Ga0055531_10001635 3300003794 Bacteria 16229
29 Ga0055531_10002896 3300003794 Bacteria 11173
30 Ga0055541_1000379 3300003841 Bacteria 13551
31 Ga0065714_10005802 3300005288 Bacteria 6247
32 Ga0065712_10069020 3300005290 Bacteria 8254
33 Ga0065712_10118833 3300005290 Bacteria 1701
34 Ga0065715_10221518 3300005293 Bacteria 1256
35 Ga0065707_10142323 3300005295 Bacteria 1757
36 Ga0070658_10030313 3300005327 Bacteria 4346
37 Ga0070676_10000313 3300005328 Bacteria 21908
38 Ga0070676_10031851 3300005328 Bacteria 3017
39 Ga0070683_100016822 3300005329 Bacteria 6453
40 Ga0070683_100030891 3300005329 Bacteria 4867
41 Ga0070683_100093865 3300005329 Bacteria 2820
42 Ga0070690_100002693 3300005330 Bacteria 9580
43 Ga0070670_100000420 3300005331 Bacteria 34942
44 Ga0070677_10003289 3300005333 Bacteria 5204
45 Ga0068869_100002298 3300005334 Bacteria 11499
46 Ga0068869_100010273 3300005334 Bacteria 6100
47 Ga0070666_10006030 3300005335 Bacteria 7446
48 Ga0070666_10016271 3300005335 Bacteria 4756
49 Ga0070666_10027648 3300005335 Bacteria 3717
50 Ga0070666_10048999 3300005335 Bacteria 2838
51 Ga0070666_10085437 3300005335 Bacteria 2161
52 Ga0070680_100003537 3300005336 Bacteria 11657
53 Ga0070680_100016773 3300005336 Bacteria 5764
54 Ga0068868_100000341 3300005338 Bacteria 31563
55 Ga0068868_100000481 3300005338 Bacteria 26493
56 Ga0068868_100002154 3300005338 Bacteria 13600
57 Ga0070689_100001002 3300005340 Bacteria 17702
58 Ga0070689_100003497 3300005340 Bacteria 10451
59 Ga0070689_100080902 3300005340 Bacteria 2550
60 Ga0070689_100155589 3300005340 Bacteria 1845
61 Ga0070689_100460941 3300005340 Bacteria 1083
62 Ga0070691_10000934 3300005341 Bacteria 11862
63 Ga0070687_100000369 3300005343 Bacteria 15363
64 Ga0070687_100036020 3300005343 Bacteria 2462
65 Ga0070661_100000012 3300005344 Bacteria 167998
66 Ga0070661_100085006 3300005344 Bacteria 2338
67 Ga0070668_100004065 3300005347 Bacteria 10835
68 Ga0070668_100096792 3300005347 Bacteria 2333
69 Ga0070669_100012049 3300005353 Bacteria 6134
70 Ga0070669_100057844 3300005353 Bacteria 2845
71 Ga0070669_100076499 3300005353 Bacteria 2484
72 Ga0070675_100011753 3300005354 Bacteria 6857
73 Ga0070675_100017523 3300005354 Bacteria 5692
74 Ga0070675_100024700 3300005354 Bacteria 4813
75 Ga0070675_100046180 3300005354 Bacteria 3566
76 Ga0070675_100053903 3300005354 Bacteria 3308
77 Ga0070675_100171539 3300005354 Bacteria 1871
78 Ga0070671_100000233 3300005355 Bacteria 37258
79 Ga0070671_100002054 3300005355 Bacteria 15515
80 Ga0070671_100016418 3300005355 Bacteria 5988
81 Ga0070674_100009927 3300005356 Bacteria 5731
82 Ga0070674_100012986 3300005356 Bacteria 5132
83 Ga0070673_100003250 3300005364 Bacteria 10086
84 Ga0070673_100034846 3300005364 Bacteria 3814
85 Ga0070673_100049244 3300005364 Bacteria 3289
86 Ga0070688_100131707 3300005365 Bacteria 1688
87 Ga0070659_100001485 3300005366 Bacteria 16884
88 Ga0070667_100015489 3300005367 Bacteria 6305
89 Ga0070667_100241496 3300005367 Bacteria 1613
90 Ga0070667_100401430 3300005367 Bacteria 1248
91 Ga0070667_100441502 3300005367 Bacteria 1188
92 Ga0070714_100008789 3300005435 Bacteria 7898
93 Ga0070710_10115182 3300005437 Bacteria 1620
94 Ga0070701_10000173 3300005438 Bacteria 20020
95 Ga0070701_10118961 3300005438 Bacteria 1486
96 Ga0070701_10183545 3300005438 Bacteria 1226
97 Ga0070705_100002026 3300005440 Bacteria 10362
98 Ga0070705_100012429 3300005440 Bacteria 4327
99 Ga0070705_100014900 3300005440 Bacteria 4010
100 Ga0070705_100017908 3300005440 Bacteria 3704
101 Ga0070700_100001867 3300005441 Bacteria 10641
102 Ga0070700_100002899 3300005441 Bacteria 8808
103 Ga0070700_100287623 3300005441 Bacteria 1194
104 Ga0070694_100000045 3300005444 Bacteria 57135
105 Ga0070694_100013774 3300005444 Bacteria 5054
106 Ga0070694_100024371 3300005444 Bacteria 3905
107 Ga0070694_100195755 3300005444 Bacteria 1504
108 Ga0070663_100000020 3300005455 Bacteria 112469
109 Ga0070663_100003404 3300005455 Bacteria 9184
110 Ga0070678_100000650 3300005456 Bacteria 17006
111 Ga0070678_100006098 3300005456 Bacteria 7035
112 Ga0070678_100043183 3300005456 Bacteria 3209
113 Ga0070678_100132226 3300005456 Bacteria 1984
114 Ga0070662_100005005 3300005457 Bacteria 8428
115 Ga0070662_100029819 3300005457 Bacteria 3811
116 Ga0070681_10006268 3300005458 Bacteria 11569
117 Ga0070681_10010845 3300005458 Bacteria 9007
118 Ga0070681_10062663 3300005458 Bacteria 3692
119 Ga0070681_10062814 3300005458 Bacteria 3687
120 Ga0068867_100001882 3300005459 Bacteria 14597
121 Ga0068867_100002025 3300005459 Bacteria 14164
122 Ga0068867_100004883 3300005459 Bacteria 9437
123 Ga0068867_100051793 3300005459 Bacteria 3028
124 Ga0070685_10017491 3300005466 Bacteria 3839
125 Ga0070685_10083134 3300005466 Bacteria 1923
126 Ga0070685_10265362 3300005466 Bacteria 1144
127 Ga0070706_100006783 3300005467 Bacteria 10810
128 Ga0070706_100108259 3300005467 Bacteria 2586
129 Ga0070707_100003388 3300005468 Bacteria 15062
130 Ga0070698_100349640 3300005471 Bacteria 1410
131 Ga0070699_100077562 3300005518 Bacteria 2893
132 Ga0070679_100083541 3300005530 Bacteria 3182
133 Ga0070679_100187058 3300005530 Bacteria 2041
134 Ga0070684_100002834 3300005535 Bacteria 12880
135 Ga0070684_100225702 3300005535 Bacteria 1709
136 Ga0070697_100002360 3300005536 Bacteria 14519
137 Ga0070697_100008436 3300005536 Bacteria 8040
138 Ga0068853_100001685 3300005539 Bacteria 16182
139 Ga0068853_100067128 3300005539 Bacteria 3116
140 Ga0068853_100260860 3300005539 Bacteria 1593
141 Ga0070672_100001511 3300005543 Bacteria 14418
142 Ga0070672_100001587 3300005543 Bacteria 14100
143 Ga0070672_100018915 3300005543 Bacteria 4990
144 Ga0070672_100070674 3300005543 Bacteria 2774
145 Ga0070672_100143267 3300005543 Bacteria 1973
146 Ga0070672_100148264 3300005543 Bacteria 1939
147 Ga0070672_100227048 3300005543 Bacteria 1567
148 Ga0070672_100344566 3300005543 Bacteria 1269
149 Ga0070686_100003713 3300005544 Bacteria 8389
150 Ga0070686_100012327 3300005544 Bacteria 4865
151 Ga0070686_100069845 3300005544 Bacteria 2295
152 Ga0070686_100128493 3300005544 Bacteria 1749
153 Ga0070695_100000126 3300005545 Bacteria 34457
154 Ga0070695_100000692 3300005545 Bacteria 18036
155 Ga0070695_100024403 3300005545 Bacteria 3724
156 Ga0070695_100027130 3300005545 Bacteria 3546
157 Ga0070695_100027161 3300005545 Bacteria 3544
158 Ga0070696_100003057 3300005546 Bacteria 11117
159 Ga0070696_100008744 3300005546 Bacteria 6778
160 Ga0070696_100025013 3300005546 Bacteria 4058
161 Ga0070696_100040502 3300005546 Bacteria 3217
162 Ga0070696_100082402 3300005546 Bacteria 2280
163 Ga0070696_100121266 3300005546 Bacteria 1893
164 Ga0070693_100000731 3300005547 Bacteria 14461
165 Ga0070693_100015741 3300005547 Bacteria 3900
166 Ga0070693_100065905 3300005547 Bacteria 2118
167 Ga0070693_100129648 3300005547 Bacteria 1575
168 Ga0070665_100008796 3300005548 Bacteria 10219
169 Ga0070665_100021204 3300005548 Bacteria 6532
170 Ga0070665_100139708 3300005548 Bacteria 2426
171 Ga0070665_100146290 3300005548 Bacteria 2366
172 Ga0070704_100000195 3300005549 Bacteria 24991
173 Ga0070704_100005519 3300005549 Bacteria 7375
174 Ga0070704_100072836 3300005549 Bacteria 2501
175 Ga0068855_100005836 3300005563 Bacteria 15029
176 Ga0068855_100007080 3300005563 Bacteria 13604
177 Ga0068855_100013040 3300005563 Bacteria 10025
178 Ga0068855_100077941 3300005563 Bacteria 3845
179 Ga0070664_100000003 3300005564 Bacteria 325604
180 Ga0070664_100008955 3300005564 Bacteria 8116
181 Ga0070664_100020888 3300005564 Bacteria 5395
182 Ga0070664_100153629 3300005564 Bacteria 2033
183 Ga0068857_100061974 3300005577 Bacteria 3324
184 Ga0068857_100073964 3300005577 Bacteria 3037
185 Ga0068857_100151436 3300005577 Bacteria 2102
186 Ga0068857_100397699 3300005577 Bacteria 1282
187 Ga0068854_100000063 3300005578 Bacteria 77198
188 Ga0068854_100003263 3300005578 Bacteria 10104
189 Ga0068854_100013526 3300005578 Bacteria 5358
190 Ga0068856_100000011 3300005614 Bacteria 170419
191 Ga0068856_100009039 3300005614 Bacteria 9695
192 Ga0068856_100015746 3300005614 Bacteria 7311
193 Ga0068856_100038071 3300005614 Bacteria 4720
194 Ga0070702_100000019 3300005615 Bacteria 46900
195 Ga0068852_100000484 3300005616 Bacteria 26098
196 Ga0068852_100004168 3300005616 Bacteria 10185
197 Ga0068852_100010590 3300005616 Bacteria 6898
198 Ga0068859_100013818 3300005617 Bacteria 8096
199 Ga0068859_100017464 3300005617 Bacteria 7213
200 Ga0068859_100059459 3300005617 Bacteria 3850
201 Ga0068859_100478011 3300005617 Bacteria 1341
202 Ga0068864_100004221 3300005618 Bacteria 11826
203 Ga0068864_100005062 3300005618 Bacteria 10793
204 Ga0068864_100021353 3300005618 Bacteria 5424
205 Ga0068864_100087152 3300005618 Bacteria 2748
206 Ga0068864_100094011 3300005618 Bacteria 2649
207 Ga0068866_10001065 3300005718 Bacteria 12079
208 Ga0068861_100002221 3300005719 Bacteria 12602
209 Ga0068861_100138222 3300005719 Bacteria 1985
210 Ga0068851_10001115 3300005834 Bacteria 11633
211 Ga0068851_10001624 3300005834 Bacteria 9865
212 Ga0068870_10011148 3300005840 Bacteria 4157
213 Ga0068870_10079472 3300005840 Bacteria 1809
214 Ga0068870_10182918 3300005840 Bacteria 1259
215 Ga0068863_100004084 3300005841 Bacteria 14421
216 Ga0068863_100012296 3300005841 Bacteria 8263
217 Ga0068863_100038818 3300005841 Bacteria 4530
218 Ga0068863_100266231 3300005841 Bacteria 1658
219 Ga0068858_100000751 3300005842 Bacteria 33969
220 Ga0068858_100014709 3300005842 Bacteria 7366
221 Ga0068858_100039861 3300005842 Bacteria 4354
222 Ga0068858_100061889 3300005842 Bacteria 3460
223 Ga0068858_100244528 3300005842 Bacteria 1703
224 Ga0068860_100005413 3300005843 Bacteria 12953
225 Ga0068860_100018660 3300005843 Bacteria 6745
226 Ga0068862_100005525 3300005844 Bacteria 10561
227 Ga0068862_100006778 3300005844 Bacteria 9496
228 Ga0068862_100025277 3300005844 Bacteria 4986
229 Ga0068862_100098802 3300005844 Bacteria 2550
230 Ga0081455_10083505 3300005937 Bacteria 2610
231 Ga0081539_10000226 3300005985 Bacteria 132618
232 Ga0081539_10016258 3300005985 Bacteria 5331
233 Ga0075363_100012669 3300006048 Bacteria 4068
234 Ga0075364_10034245 3300006051 Bacteria 3275
235 Ga0075432_10011661 3300006058 Bacteria 2986
236 Ga0070715_10019721 3300006163 Bacteria 2591
237 Ga0070716_100074657 3300006173 Bacteria 2004
238 Ga0070712_100341238 3300006175 Bacteria 1223
239 Ga0075362_10009361 3300006177 Bacteria 3787
240 Ga0075362_10030280 3300006177 Bacteria 2337
241 Ga0075367_10027731 3300006178 Bacteria 3225
242 Ga0075369_10001702 3300006186 Bacteria 7611
243 Ga0075369_10024886 3300006186 Bacteria 2484
244 Ga0075366_10017190 3300006195 Bacteria 4160
245 Ga0097621_100002059 3300006237 Bacteria 13752
246 Ga0097621_100014223 3300006237 Bacteria 5952
247 Ga0097621_100024797 3300006237 Bacteria 4688
248 Ga0097621_100038035 3300006237 Bacteria 3860
249 Ga0075370_10027737 3300006353 Bacteria 3144
250 Ga0068871_100003308 3300006358 Bacteria 11060
251 Ga0068871_100005061 3300006358 Bacteria 9206
252 Ga0068871_100007338 3300006358 Bacteria 7867
253 Ga0068871_100032101 3300006358 Bacteria 4145
254 Ga0068871_100046749 3300006358 Bacteria 3487
255 Ga0068871_100142157 3300006358 Bacteria 2041
256 Ga0075430_100009206 3300006846 Bacteria 8346
257 Ga0075430_100129639 3300006846 Bacteria 2102
258 Ga0075431_100000324 3300006847 Bacteria 37752
259 Ga0075433_10001856 3300006852 Bacteria 15871
260 Ga0075433_10203240 3300006852 Bacteria 1761
261 Ga0075434_100000306 3300006871 Bacteria 34874
262 Ga0075434_100001295 3300006871 Bacteria 20857
263 Ga0075429_100000143 3300006880 Bacteria 43584
264 Ga0075429_100040723 3300006880 Bacteria 4045
265 Ga0068865_100001242 3300006881 Bacteria 14825
266 Ga0068865_100002021 3300006881 Bacteria 11969
267 Ga0075436_100000087 3300006914 Bacteria 53435
268 Ga0075436_100000475 3300006914 Bacteria 26074
269 Ga0075436_100014968 3300006914 Bacteria 5317
270 Ga0075436_100032054 3300006914 Bacteria 3621
271 Ga0075436_100189790 3300006914 Bacteria 1454
272 Ga0097620_100013819 3300006931 Bacteria 8096
273 Ga0097620_100017464 3300006931 Bacteria 7213
274 Ga0097620_100059456 3300006931 Bacteria 3850
275 Ga0097620_100478010 3300006931 Bacteria 1341
276 Ga0099826_10031839 3300006948 Bacteria 3809
277 Ga0075435_100000811 3300007076 Bacteria 19470
278 Ga0075435_100001385 3300007076 Bacteria 15654
279 Ga0075435_100018574 3300007076 Bacteria 5293
280 Ga0075435_100052938 3300007076 Bacteria 3271
281 Ga0075435_100071689 3300007076 Bacteria 2829
282 Ga0075435_100073655 3300007076 Bacteria 2792
283 Ga0075435_100184894 3300007076 Bacteria 1762
284 Ga0099794_10012591 3300007265 Bacteria 3656
285 Ga0099794_10015970 3300007265 Bacteria 3322
286 Ga0099794_10019763 3300007265 Bacteria 3041
287 Ga0099794_10037077 3300007265 Bacteria 2307
288 Ga0105244_10006962 3300009036 Bacteria 7240
289 Ga0105240_10065089 3300009093 Bacteria 4526
290 Ga0105240_10094231 3300009093 Bacteria 3653
291 Ga0105240_10098276 3300009093 Bacteria 3565
292 Ga0111539_10002898 3300009094 Bacteria 22772
293 Ga0111539_10020073 3300009094 Bacteria 8232
294 Ga0111539_10027344 3300009094 Bacteria 6966
295 Ga0111539_10054800 3300009094 Bacteria 4743
296 Ga0111539_10060748 3300009094 Bacteria 4479
297 Ga0111539_10078279 3300009094 Bacteria 3890
298 Ga0111539_10092441 3300009094 Bacteria 3555
299 Ga0105245_10005835 3300009098 Bacteria 10810
300 Ga0105245_10185882 3300009098 Bacteria 1988
301 Ga0105245_10270801 3300009098 Bacteria 1656
302 Ga0114129_10001740 3300009147 Bacteria 29637
303 Ga0114129_10223463 3300009147 Bacteria 2539
304 Ga0114129_10418881 3300009147 Bacteria 1762
305 Ga0105243_10002206 3300009148 Bacteria 16405
306 Ga0105243_10003125 3300009148 Bacteria 13607
307 Ga0105243_10003372 3300009148 Bacteria 12960
308 Ga0105243_10004530 3300009148 Bacteria 10982
309 Ga0105243_10052189 3300009148 Bacteria 3238
310 Ga0105243_10196189 3300009148 Bacteria 1767
311 Ga0105241_10010806 3300009174 Bacteria 6697
312 Ga0105241_10047970 3300009174 Bacteria 3248
313 Ga0105242_10001658 3300009176 Bacteria 17602
314 Ga0105242_10040427 3300009176 Bacteria 3758
315 Ga0105242_10349857 3300009176 Bacteria 1364
316 Ga0105248_10005187 3300009177 Bacteria 14361
317 Ga0105248_10033298 3300009177 Bacteria 5756
318 Ga0105248_10076691 3300009177 Bacteria 3757
319 Ga0105248_10089123 3300009177 Bacteria 3472
320 Ga0105248_10224528 3300009177 Bacteria 2114
321 Ga0105238_10004061 3300009551 Bacteria 14507
322 Ga0105238_10156571 3300009551 Bacteria 2253
323 Ga0105249_10004022 3300009553 Bacteria 12686
324 Ga0105249_10011197 3300009553 Bacteria 7880
325 Ga0105249_10426249 3300009553 Bacteria 1361
326 Ga0105239_10504717 3300010375 Bacteria 1375
327 Ga0105246_10005048 3300011119 Bacteria 8023
328 Ga0105246_10017932 3300011119 Bacteria 4506
329 Ga0105246_10316737 3300011119 Bacteria 1266
330 Ga0157373_10004380 3300013100 Bacteria 10641
331 Ga0157371_10000083 3300013102 Bacteria 149633
332 Ga0157371_10068354 3300013102 Bacteria 2515
333 Ga0157370_10000141 3300013104 Bacteria 87406
334 Ga0157370_10000800 3300013104 Bacteria 39630
335 Ga0157370_10009801 3300013104 Bacteria 10160
336 Ga0157369_10003851 3300013105 Bacteria 17830
337 Ga0157369_10048969 3300013105 Bacteria 4583
338 Ga0157374_10073243 3300013296 Bacteria 3233
339 Ga0157374_10172545 3300013296 Bacteria 2110
340 Ga0157378_10000579 3300013297 Bacteria 34490
341 Ga0157378_10001901 3300013297 Bacteria 18743
342 Ga0157378_10003615 3300013297 Bacteria 13684
343 Ga0157378_10008040 3300013297 Bacteria 9206
344 Ga0157378_10008082 3300013297 Bacteria 9182
345 Ga0163162_10006590 3300013306 Bacteria 11250
346 Ga0163162_10006818 3300013306 Bacteria 11080
347 Ga0163162_10032414 3300013306 Bacteria 5190
348 Ga0163162_10112236 3300013306 Bacteria 2824
349 Ga0163162_10203073 3300013306 Bacteria 2111
350 Ga0157372_10000775 3300013307 Bacteria 34581
351 Ga0157372_10060911 3300013307 Bacteria 4224
352 Ga0157372_10066547 3300013307 Bacteria 4048
353 Ga0157375_10001103 3300013308 Bacteria 23426
354 Ga0157375_10031375 3300013308 Bacteria 5023
355 Ga0157375_10096305 3300013308 Bacteria 3032
356 Ga0157375_10118307 3300013308 Bacteria 2756
357 Ga0157375_10276889 3300013308 Bacteria 1840
358 Ga0157375_10378031 3300013308 Bacteria 1583
359 Ga0163163_10413114 3300014325 Bacteria 1408
360 Ga0157380_10003849 3300014326 Bacteria 10343
361 Ga0157380_10042159 3300014326 Bacteria 3566
362 Ga0157380_10155386 3300014326 Bacteria 1982
363 Ga0182008_10000260 3300014497 Bacteria 41217
364 Ga0182008_10002165 3300014497 Bacteria 12503
365 Ga0182008_10002687 3300014497 Bacteria 11037
366 Ga0182008_10014557 3300014497 Bacteria 4117
367 Ga0182008_10015230 3300014497 Bacteria 4016
368 Ga0182008_10072392 3300014497 Bacteria 1696
369 Ga0157377_10016731 3300014745 Bacteria 3777
370 Ga0157377_10064112 3300014745 Bacteria 2107
371 Ga0157379_10002873 3300014968 Bacteria 14522
372 Ga0157379_10040024 3300014968 Bacteria 4183
373 Ga0157379_10061246 3300014968 Bacteria 3365
374 Ga0157379_10382298 3300014968 Bacteria 1292
375 Ga0157376_10020591 3300014969 Bacteria 5107
376 Ga0157376_10056115 3300014969 Bacteria 3289
377 Ga0157376_10126047 3300014969 Bacteria 2278
378 Ga0157376_10199412 3300014969 Bacteria 1840
379 Ga0157376_10251591 3300014969 Bacteria 1651
380 Ga0157376_10262271 3300014969 Bacteria 1619
381 Ga0182006_1003724 3300015261 Bacteria 7709
382 Ga0182006_1005768 3300015261 Bacteria 5842
383 Ga0182006_1007705 3300015261 Bacteria 4918
384 Ga0182006_1016938 3300015261 Bacteria 3103
385 Ga0182007_10001176 3300015262 Bacteria 14194
386 Ga0182007_10001351 3300015262 Bacteria 13232
387 Ga0183362_10004 3300015683 Bacteria 569303
388 Ga0163161_10001684 3300017792 Bacteria 16226
389 Ga0163161_10004016 3300017792 Bacteria 10298
390 Ga0163161_10004590 3300017792 Bacteria 9613
391 Ga0163161_10032713 3300017792 Bacteria 3715
392 Ga0163161_10162583 3300017792 Bacteria 1703
393 Ga0206356_10375286 3300020070 Bacteria 2222
394 Ga0206351_10502756 3300020077 Bacteria 20710
395 Ga0154015_1372279 3300020610 Bacteria 19706
396 Ga0209784_100150 3300025224 Bacteria 63516
397 Ga0209784_100554 3300025224 Bacteria 13367
398 Ga0209784_100595 3300025224 Bacteria 11953
399 Ga0209566_100002 3300025225 Bacteria 2614868
400 Ga0209566_100430 3300025225 Bacteria 31511
401 Ga0209566_100569 3300025225 Bacteria 24024
402 Ga0209674_100010 3300025226 Bacteria 1038638
403 Ga0209674_100050 3300025226 Bacteria 341738
404 Ga0209674_100248 3300025226 Bacteria 45380
405 Ga0209672_100218 3300025228 Bacteria 44911
406 Ga0209147_100015 3300025229 Bacteria 565073
407 Ga0209563_100004 3300025230 Bacteria 1814108
408 Ga0209563_100026 3300025230 Bacteria 559453
409 Ga0209563_104187 3300025230 Bacteria 2804
410 Ga0209258_100021 3300025242 Bacteria 565073
411 Ga0209646_1000055 3300025246 Bacteria 271793
412 Ga0209677_100007 3300025253 Bacteria 1021332
413 Ga0209677_102421 3300025253 Bacteria 7051
414 Ga0209148_1000109 3300025254 Bacteria 204266
415 Ga0209565_1000283 3300025263 Bacteria 49870
416 Ga0207666_1001903 3300025271 Bacteria 2483
417 Ga0209455_1000028 3300025272 Bacteria 565073
418 Ga0209673_1000136 3300025273 Bacteria 159975
419 Ga0209673_1016929 3300025273 Bacteria 2705
420 Ga0209675_1000071 3300025291 Bacteria 168382
421 Ga0209676_1000643 3300025292 Bacteria 50106
422 Ga0209676_1000659 3300025292 Bacteria 49458
423 Ga0209050_1000945 3300025298 Bacteria 37767
424 Ga0209051_1000180 3300025303 Bacteria 113724
425 Ga0209051_1000227 3300025303 Bacteria 94321
426 Ga0209051_1000351 3300025303 Bacteria 68445
427 Ga0209051_1000513 3300025303 Bacteria 48907
428 Ga0209257_1000015 3300025304 Bacteria 908141
429 Ga0209257_1001106 3300025304 Bacteria 35067
430 Ga0209257_1004691 3300025304 Bacteria 10269
431 Ga0207697_10014516 3300025315 Bacteria 3266
432 Ga0207656_10000903 3300025321 Bacteria 9650
433 Ga0207656_10001284 3300025321 Bacteria 8249
434 Ga0207656_10012445 3300025321 Bacteria 3235
435 Ga0207655_1002301 3300025728 Bacteria 15701
436 Ga0207653_10043071 3300025885 Bacteria 1486
437 Ga0207682_10000059 3300025893 Bacteria 48172
438 Ga0207682_10009656 3300025893 Bacteria 3801
439 Ga0207642_10001096 3300025899 Bacteria 8394
440 Ga0207642_10004720 3300025899 Bacteria 4402
441 Ga0207688_10006888 3300025901 Bacteria 6184
442 Ga0207688_10018621 3300025901 Bacteria 3777
443 Ga0207688_10156891 3300025901 Bacteria 1347
444 Ga0207680_10007283 3300025903 Bacteria 5383
445 Ga0207680_10029264 3300025903 Bacteria 3092
446 Ga0207699_10129328 3300025906 Bacteria 1645
447 Ga0207645_10002844 3300025907 Bacteria 13423
448 Ga0207645_10016689 3300025907 Bacteria 4856
449 Ga0207643_10002206 3300025908 Bacteria 10607
450 Ga0207643_10030908 3300025908 Bacteria 2984
451 Ga0207643_10040818 3300025908 Bacteria 2613
452 Ga0207643_10051847 3300025908 Bacteria 2329
453 Ga0207705_10023381 3300025909 Bacteria 4409
454 Ga0207705_10161331 3300025909 Bacteria 1684
455 Ga0207684_10041849 3300025910 Bacteria 3883
456 Ga0207654_10034789 3300025911 Bacteria 2801
457 Ga0207707_10009957 3300025912 Bacteria 8243
458 Ga0207707_10042674 3300025912 Bacteria 3958
459 Ga0207707_10252201 3300025912 Bacteria 1533
460 Ga0207695_10004143 3300025913 Bacteria 19908
461 Ga0207695_10086080 3300025913 Bacteria 3170
462 Ga0207663_10232839 3300025916 Bacteria 1347
463 Ga0207660_10004091 3300025917 Bacteria 9500
464 Ga0207660_10083168 3300025917 Bacteria 2357
465 Ga0207662_10000049 3300025918 Bacteria 51921
466 Ga0207662_10003774 3300025918 Bacteria 7862
467 Ga0207662_10097533 3300025918 Bacteria 1817
468 Ga0207662_10113344 3300025918 Bacteria 1693
469 Ga0207649_10000302 3300025920 Bacteria 37899
470 Ga0207649_10279379 3300025920 Bacteria 1213
471 Ga0207652_10057137 3300025921 Bacteria 3360
472 Ga0207652_10101889 3300025921 Bacteria 2537
473 Ga0207646_10224210 3300025922 Bacteria 1698
474 Ga0207681_10000513 3300025923 Bacteria 26911
475 Ga0207681_10072794 3300025923 Bacteria 2401
476 Ga0207694_10082862 3300025924 Bacteria 2521
477 Ga0207650_10080128 3300025925 Bacteria 2475
478 Ga0207650_10137181 3300025925 Bacteria 1920
479 Ga0207659_10008117 3300025926 Bacteria 6497
480 Ga0207659_10041724 3300025926 Bacteria 3215
481 Ga0207659_10110319 3300025926 Bacteria 2090
482 Ga0207687_10004654 3300025927 Bacteria 9127
483 Ga0207687_10059254 3300025927 Bacteria 2697
484 Ga0207644_10018061 3300025931 Bacteria 4768
485 Ga0207644_10020376 3300025931 Bacteria 4509
486 Ga0207644_10043748 3300025931 Bacteria 3179
487 Ga0207644_10114123 3300025931 Bacteria 2046
488 Ga0207644_10274214 3300025931 Bacteria 1353
489 Ga0207690_10001630 3300025932 Bacteria 13945
490 Ga0207706_10027297 3300025933 Bacteria 5106
491 Ga0207706_10036312 3300025933 Bacteria 4377
492 Ga0207706_10039233 3300025933 Bacteria 4198
493 Ga0207706_10275578 3300025933 Bacteria 1468
494 Ga0207686_10004424 3300025934 Bacteria 7537
495 Ga0207686_10005916 3300025934 Bacteria 6567
496 Ga0207686_10008534 3300025934 Bacteria 5535
497 Ga0207686_10037208 3300025934 Bacteria 2935
498 Ga0207709_10000436 3300025935 Bacteria 39392
499 Ga0207709_10000534 3300025935 Bacteria 32767
500 Ga0207709_10003231 3300025935 Bacteria 9783
501 Ga0207709_10004865 3300025935 Bacteria 7686
502 Ga0207709_10110585 3300025935 Bacteria 1836
503 Ga0207709_10181419 3300025935 Bacteria 1487
504 Ga0207670_10001257 3300025936 Bacteria 13387
505 Ga0207669_10022292 3300025937 Bacteria 3361
506 Ga0207704_10003500 3300025938 Bacteria 7143
507 Ga0207704_10013921 3300025938 Bacteria 4046
508 Ga0207704_10113122 3300025938 Bacteria 1840
509 Ga0207691_10000243 3300025940 Bacteria 53649
510 Ga0207691_10000625 3300025940 Bacteria 35040
511 Ga0207691_10008832 3300025940 Bacteria 9669
512 Ga0207691_10081441 3300025940 Bacteria 2910
513 Ga0207691_10082605 3300025940 Bacteria 2885
514 Ga0207691_10141471 3300025940 Bacteria 2120
515 Ga0207691_10142670 3300025940 Bacteria 2109
516 Ga0207711_10029400 3300025941 Bacteria 4635
517 Ga0207711_10118310 3300025941 Bacteria 2364
518 Ga0207711_10146325 3300025941 Bacteria 2129
519 Ga0207711_10230884 3300025941 Bacteria 1695
520 Ga0207689_10005474 3300025942 Bacteria 11362
521 Ga0207689_10012793 3300025942 Bacteria 7168
522 Ga0207689_10037778 3300025942 Bacteria 4003
523 Ga0207689_10201914 3300025942 Bacteria 1641
524 Ga0207689_10296882 3300025942 Bacteria 1339
525 Ga0207661_10002842 3300025944 Bacteria 11965
526 Ga0207679_10000007 3300025945 Bacteria 460140
527 Ga0207679_10006685 3300025945 Bacteria 7301
528 Ga0207679_10032149 3300025945 Bacteria 3680
529 Ga0207679_10107408 3300025945 Bacteria 2196
530 Ga0207679_10230318 3300025945 Bacteria 1564
531 Ga0207667_10002796 3300025949 Bacteria 21611
532 Ga0207667_10016584 3300025949 Bacteria 8316
533 Ga0207651_10005150 3300025960 Bacteria 6676
534 Ga0207651_10012247 3300025960 Bacteria 4844
535 Ga0207651_10164182 3300025960 Bacteria 1744
536 Ga0207712_10009645 3300025961 Bacteria 6117
537 Ga0207712_10011050 3300025961 Bacteria 5747
538 Ga0207668_10004976 3300025972 Bacteria 7818
539 Ga0207668_10042435 3300025972 Bacteria 3080
540 Ga0207668_10151285 3300025972 Bacteria 1797
541 Ga0207640_10000224 3300025981 Bacteria 39760
542 Ga0207640_10011056 3300025981 Bacteria 5099
543 Ga0207640_10147294 3300025981 Bacteria 1725
544 Ga0207658_10010666 3300025986 Bacteria 6246
545 Ga0207658_10051643 3300025986 Bacteria 3031
546 Ga0207677_10004358 3300026023 Bacteria 7582
547 Ga0207677_10005372 3300026023 Bacteria 6951
548 Ga0207677_10011167 3300026023 Bacteria 5108
549 Ga0207703_10003975 3300026035 Bacteria 12250
550 Ga0207703_10019959 3300026035 Bacteria 5237
551 Ga0207703_10054661 3300026035 Bacteria 3248
552 Ga0207703_10213390 3300026035 Bacteria 1722
553 Ga0207639_10013658 3300026041 Bacteria 5692
554 Ga0207678_10000030 3300026067 Bacteria 112455
555 Ga0207678_10002320 3300026067 Bacteria 17245
556 Ga0207678_10073392 3300026067 Bacteria 2932
557 Ga0207708_10007875 3300026075 Bacteria 7892
558 Ga0207708_10125804 3300026075 Bacteria 2000
559 Ga0207708_10140222 3300026075 Bacteria 1896
560 Ga0207708_10244101 3300026075 Bacteria 1445
561 Ga0207702_10000054 3300026078 Bacteria 137192
562 Ga0207702_10018915 3300026078 Bacteria 5699
563 Ga0207702_10036006 3300026078 Bacteria 4139
564 Ga0207641_10021128 3300026088 Bacteria 5350
565 Ga0207641_10085529 3300026088 Bacteria 2748
566 Ga0207648_10000265 3300026089 Bacteria 56755
567 Ga0207648_10003896 3300026089 Bacteria 15568
568 Ga0207648_10026807 3300026089 Bacteria 5118
569 Ga0207648_10031871 3300026089 Bacteria 4657
570 Ga0207648_10063517 3300026089 Bacteria 3218
571 Ga0207648_10067457 3300026089 Bacteria 3118
572 Ga0207676_10011925 3300026095 Bacteria 6220
573 Ga0207676_10012250 3300026095 Bacteria 6137
574 Ga0207676_10058205 3300026095 Bacteria 3047
575 Ga0207676_10133049 3300026095 Bacteria 2117
576 Ga0207676_10162995 3300026095 Bacteria 1934
577 Ga0207676_10364707 3300026095 Bacteria 1340
578 Ga0207674_10026678 3300026116 Bacteria 6129
579 Ga0207674_10048165 3300026116 Bacteria 4364
580 Ga0207674_10056236 3300026116 Bacteria 3996
581 Ga0207674_10095874 3300026116 Bacteria 2952
582 Ga0207674_10097405 3300026116 Bacteria 2925
583 Ga0207674_10123429 3300026116 Bacteria 2556
584 Ga0207675_100000182 3300026118 Bacteria 56879
585 Ga0207675_100033522 3300026118 Bacteria 4785
586 Ga0207675_100077615 3300026118 Bacteria 3112
587 Ga0207675_100223542 3300026118 Bacteria 1814
588 Ga0207683_10000308 3300026121 Bacteria 44216
589 Ga0207683_10000611 3300026121 Bacteria 32981
590 Ga0207683_10053724 3300026121 Bacteria 3532
591 Ga0207683_10056794 3300026121 Bacteria 3435
592 Ga0207683_10183054 3300026121 Bacteria 1900
593 Ga0207698_10001809 3300026142 Bacteria 12492
594 Ga0207698_10130595 3300026142 Bacteria 2146
595 Ga0207698_10237043 3300026142 Bacteria 1660
596 Ga0209969_1010690 3300027360 Bacteria 1315
597 Ga0209967_1000620 3300027364 Bacteria 4593
598 Ga0210000_1002190 3300027462 Bacteria 2770
599 Ga0210000_1003715 3300027462 Bacteria 2204
600 Ga0209995_1005856 3300027471 Bacteria 1979
601 Ga0209999_1005808 3300027543 Bacteria 2219
602 Ga0209999_1008713 3300027543 Bacteria 1832
603 Ga0209970_1003460 3300027614 Bacteria 2653
604 Ga0209282_1000795 3300027666 Bacteria 16072
605 Ga0209588_1014430 3300027671 Bacteria 2418
606 Ga0209974_10005799 3300027876 Bacteria 4331
607 Ga0209974_10021675 3300027876 Bacteria 2129
608 Ga0207428_10001034 3300027907 Bacteria 30690
609 Ga0207428_10103884 3300027907 Bacteria 2193
610 Ga0268266_10012628 3300028379 Bacteria 7298
611 Ga0268266_10038502 3300028379 Bacteria 4070
612 Ga0268266_10213696 3300028379 Bacteria 1770
613 Ga0268266_10255986 3300028379 Bacteria 1621
614 Ga0268265_10000818 3300028380 Bacteria 29529
615 Ga0268265_10001580 3300028380 Bacteria 18852
616 Ga0268265_10004295 3300028380 Bacteria 9943
617 Ga0268265_10054256 3300028380 Bacteria 3040
618 Ga0268265_10149146 3300028380 Bacteria 1970
619 Ga0268264_10000909 3300028381 Bacteria 31074
620 Ga0268264_10006840 3300028381 Bacteria 9575
621 Ga0268264_10026779 3300028381 Bacteria 4710
622 Ga0307515_10000058 3300028794 Bacteria 259680
623 Ga0307515_10000468 3300028794 Bacteria 96483
624 Ga0307515_10001320 3300028794 Bacteria 56334
625 Ga0265338_10000350 3300028800 Bacteria 83778
626 Ga0265338_10136804 3300028800 Bacteria 1925
627 Ga0265324_10077431 3300029957 Bacteria 1131
628 Ga0314311_1019906 3300030733 Bacteria 5718
629 Ga0316182_1006065 3300030745 Bacteria 3181
630 Ga0265332_10000006 3300031238 Bacteria 327963
631 Ga0265332_10015105 3300031238 Bacteria 3412
632 Ga0265327_10002065 3300031251 Bacteria 22495
633 Ga0265327_10013789 3300031251 Bacteria 5341
634 Ga0265316_10158752 3300031344 Bacteria 1691
635 Ga0307408_100090527 3300031548 Bacteria 2309
636 Ga0265314_10000481 3300031711 Bacteria 52341
637 Ga0316578_10023142 3300031728 Bacteria 3475
638 Ga0307405_10032286 3300031731 Bacteria 3093
639 Ga0307405_10186056 3300031731 Bacteria 1495
640 Ga0307406_10001349 3300031901 Bacteria 13761
641 Ga0307406_10002313 3300031901 Bacteria 10347
642 Ga0307406_10299273 3300031901 Bacteria 1235
643 Ga0307412_10026388 3300031911 Bacteria 3610
644 Ga0307412_10196884 3300031911 Bacteria 1527
645 Ga0307416_100042082 3300032002 Bacteria 3563
646 Ga0307416_100126191 3300032002 Bacteria 2292
647 Ga0307416_100201197 3300032002 Bacteria 1890
648 Ga0307416_100403130 3300032002 Bacteria 1406
649 Ga0307411_10002662 3300032005 Bacteria 7997
650 Ga0307411_10209786 3300032005 Bacteria 1503
651 Ga0316583_10012150 3300032133 Bacteria 3106
652 Ga0373930_0008188 3300034816 Bacteria 1825
653 Ga0373928_0003570 3300035084 Bacteria 2965
654 Ga0373929_0003033 3300035085 Bacteria 3056
655 Ga0373940_0016602 3300035088 Bacteria 1825
656 Ga0373944_0005926 3300035089 Bacteria 3233
657 Ga0373949_0002756 3300035090 Bacteria 4385
658 Ga0373923_0009299 3300035111 Bacteria 3543
659 Ga0373932_0003784 3300035112 Bacteria 3608
660 Ga0373939_0002155 3300035114 Bacteria 4673
661 Ga0373941_0004319 3300035115 Bacteria 3275
662 Ga0373941_0022138 3300035115 Bacteria 1800
663 Ga0373941_0030441 3300035115 Bacteria 1600
664 Ga0373954_0000210 3300035118 Bacteria 21283
665 Ga0373960_0004454 3300035121 Bacteria 3211
666 Ga0373946_0005537 3300035171 Bacteria 4557
667 Ga0373942_0001690 3300035207 Bacteria 5589
668 Ga0373961_0011514 3300035241 Bacteria 2196
669 Ga0373962_0009214 3300035242 Bacteria 2441
670 Ga0373924_0001388 3300035410 Bacteria 7838
671 Ga0373931_0000062 3300035691 Bacteria 54491
672 Ga0373931_0022673 3300035691 Bacteria 3162
673 Ga0373931_0053492 3300035691 Bacteria 2154
674 Ga0373931_0069565 3300035691 Bacteria 1918
675 Ga0373931_0135374 3300035691 Bacteria 1422
676 Ga0373933_0001438 3300035724 Bacteria 13917
677 Ga0373933_0007663 3300035724 Bacteria 5894
678 Ga0373937_0003410 3300036401 Bacteria 13337
679 Ga0373937_0009139 3300036401 Bacteria 8599
680 Ga0373937_0026857 3300036401 Bacteria 5205
681 Ga0373937_0040869 3300036401 Bacteria 4228
682 Ga0316582_0013270 3300036647 Bacteria 4632
683 Ga0395899_0169538 3300037312 Bacteria 1538
684 Ga0395900_0169363 3300037418 Bacteria 2224
685 Ga0316581_0008234 3300037588 Bacteria 2829
686 Ga0439439_0006043 3300041406 Bacteria 2787
687 Ga0439461_0018591 3300041410 Bacteria 1362
688 Ga0439466_0008421 3300041411 Bacteria 3887
689 Ga0439466_0016927 3300041411 Bacteria 2630
690 Ga0439466_0018100 3300041411 Bacteria 2530
691 Ga0439465_0005112 3300041413 Bacteria 4210
692 Ga0451841_0312808 3300041498 Bacteria 1150
693 Ga0439431_0001324 3300041997 Bacteria 5449
694 Ga0439431_0008028 3300041997 Bacteria 2365
695 Ga0439431_0009507 3300041997 Bacteria 2197
696 Ga0439433_0000088 3300041999 Bacteria 12634
697 Ga0439433_0001045 3300041999 Bacteria 5617
698 Ga0439441_000286 3300042001 Bacteria 5029
699 Ga0439441_000342 3300042001 Bacteria 4771
700 Ga0439442_000991 3300042002 Bacteria 5733
701 Ga0439442_002915 3300042002 Bacteria 3372
702 Ga0439442_005941 3300042002 Bacteria 2447
703 Ga0439443_000254 3300042003 Bacteria 4228
704 Ga0439445_0000038 3300042004 Bacteria 17912
705 Ga0439432_004611 3300042006 Bacteria 5021
706 Ga0439449_0000654 3300042007 Bacteria 13073
707 Ga0439449_0001890 3300042007 Bacteria 8253
708 Ga0439449_0001985 3300042007 Bacteria 8047
709 Ga0439452_003838 3300042010 Bacteria 5161
710 Ga0439452_005074 3300042010 Bacteria 4297
711 Ga0439457_002262 3300042014 Bacteria 5560
712 Ga0439462_0001430 3300042015 Bacteria 5313
713 Ga0450919_002040 3300042121 Bacteria 2627
714 Ga0450920_005881 3300042122 Bacteria 2192
715 Ga0450923_000082 3300042125 Bacteria 7965
716 Ga0450906_004114 3300042145 Bacteria 3077
717 Ga0450906_005854 3300042145 Bacteria 2507
718 Ga0439446_0006771 3300042156 Bacteria 3000
719 Ga0439446_0018238 3300042156 Bacteria 1964
720 Ga0439446_0030557 3300042156 Bacteria 1557
721 Ga0450908_000361 3300042184 Bacteria 8786
722 Ga0450909_004127 3300042185 Bacteria 2070
723 Ga0439434_0000113 3300042435 Bacteria 21172
724 Ga0439434_0003215 3300042435 Bacteria 4799
725 Ga0439435_0000473 3300042436 Bacteria 6371
726 Ga0439460_0000631 3300042461 Bacteria 7721
727 Ga0450918_001007 3300042531 Bacteria 5849
728 Ga0451577_0008793 3300042876 Bacteria 9785
729 Ga0451577_0018812 3300042876 Bacteria 6356
730 Ga0451577_0037209 3300042876 Bacteria 4380
731 Ga0451577_0095475 3300042876 Bacteria 2655
732 Ga0451577_0101090 3300042876 Bacteria 2576
733 Ga0451577_0136974 3300042876 Bacteria 2198
734 Ga0451577_0220298 3300042876 Bacteria 1715
735 Ga0451577_0368695 3300042876 Bacteria 1303
736 Ga0466972_0006017 3300044658 Bacteria 6095
737 Ga0466977_0004540 3300044666 Bacteria 7047
738 Ga0466965_0005919 3300044683 Bacteria 5522
739 Ga0466965_0008451 3300044683 Bacteria 4765
740 Ga0466961_0000499 3300044693 Bacteria 25055
741 Ga0466964_0005193 3300044706 Bacteria 4826
742 Ga0453684_0000005 3300044712 Bacteria 1431632
743 Ga0453684_0023470 3300044712 Bacteria 9078
744 Ga0453684_0083116 3300044712 Bacteria 3986
745 Ga0453684_0205026 3300044712 Bacteria 2296
746 Ga0453684_0243395 3300044712 Bacteria 2070
747 Ga0466968_0011804 3300044735 Bacteria 3407
748 Ga0466957_0032413 3300044842 Bacteria 3128
749 Ga0466960_0031324 3300044901 Bacteria 2453
750 Ga0451576_0001787 3300045051 Bacteria 35253
751 Ga0451576_0002877 3300045051 Bacteria 24625
752 Ga0451576_0003213 3300045051 Bacteria 22785
753 Ga0451576_0008064 3300045051 Bacteria 12423
754 Ga0451576_0010170 3300045051 Bacteria 10823
755 Ga0451576_0012002 3300045051 Bacteria 9784
756 Ga0451576_0016403 3300045051 Bacteria 8176
757 Ga0451576_0160305 3300045051 Bacteria 2347
758 Ga0451576_0253546 3300045051 Bacteria 1839
759 Ga0451576_0318573 3300045051 Bacteria 1627
760 Ga0466967_0003717 3300045976 Bacteria 10054
761 Ga0495627_007760 3300046453 Bacteria 4088
762 Ga0495592_0009024 3300046454 Bacteria 7493
763 Ga0495603_0036970 3300046455 Bacteria 2930
764 Ga0495629_0085607 3300046459 Bacteria 2199
765 Ga0495638_0023942 3300046460 Bacteria 3987
766 Ga0495580_0006729 3300046472 Bacteria 9331
767 Ga0495605_0097449 3300046474 Bacteria 1355
768 Ga0495639_0005541 3300046475 Bacteria 5435
769 Ga0495662_0074644 3300046476 Bacteria 1645
770 Ga0495608_0004731 3300046511 Bacteria 9740
771 Ga0495608_0175474 3300046511 Bacteria 1358
772 Ga0495616_0002565 3300046513 Bacteria 11973
773 Ga0495620_0033715 3300046515 Bacteria 2322
774 Ga0495620_0053275 3300046515 Bacteria 1714
775 Ga0495628_0007988 3300046516 Bacteria 9116
776 Ga0495628_0012002 3300046516 Bacteria 7307
777 Ga0495630_0001001 3300046517 Bacteria 19663
778 Ga0495630_0062383 3300046517 Bacteria 2800
779 Ga0495631_0001040 3300046518 Bacteria 17215
780 Ga0495637_0036259 3300046520 Bacteria 2149
781 Ga0495666_0006235 3300046526 Bacteria 6007
782 Ga0495666_0017771 3300046526 Bacteria 3541
783 Ga0495642_0012814 3300046528 Bacteria 3236
784 Ga0495652_0225071 3300046529 Bacteria 1407
785 Ga0495654_0005652 3300046530 Bacteria 7223
786 Ga0495654_0113350 3300046530 Bacteria 1235
787 Ga0495665_0016870 3300046531 Bacteria 3932
788 Ga0495640_0004549 3300046533 Bacteria 11056
789 Ga0495586_0001499 3300046535 Bacteria 12886
790 Ga0495598_0001069 3300046537 Bacteria 5256
791 Ga0495621_0002227 3300046539 Bacteria 5183
792 Ga0495621_0035190 3300046539 Bacteria 1733
793 Ga0495621_0036395 3300046539 Bacteria 1708
794 Ga0495645_0001930 3300046543 Bacteria 14080
795 Ga0495645_0099123 3300046543 Bacteria 2073
796 Ga0495645_0138284 3300046543 Bacteria 1702
797 Ga0495622_0023983 3300046557 Bacteria 2847
798 Ga0495667_0014114 3300046559 Bacteria 5392
799 Ga0495667_0022383 3300046559 Bacteria 4257
800 Ga0495656_0001092 3300046615 Bacteria 8793
801 Ga0495668_0006944 3300046616 Bacteria 7327
802 Ga0495634_0011090 3300046642 Bacteria 6573
803 Ga0495625_0000114 3300046660 Bacteria 123268
804 Ga0495635_0145736 3300046663 Bacteria 1612
805 Ga0495588_0019099 3300046674 Bacteria 3354
806 Ga0495588_0041360 3300046674 Bacteria 2353
807 Ga0495657_0080708 3300046675 Bacteria 2105
808 Ga0495657_0163068 3300046675 Bacteria 1378
809 Ga0495599_0012523 3300046678 Bacteria 5232
810 Ga0495599_0015568 3300046678 Bacteria 4721
811 Ga0495623_0013457 3300046679 Bacteria 5305
812 Ga0495623_0108500 3300046679 Bacteria 1685
813 Ga0495658_0011040 3300046683 Bacteria 4531
814 Ga0495658_0185580 3300046683 Bacteria 1291
815 Ga0495613_0006610 3300046689 Bacteria 8666
816 Ga0495613_0226815 3300046689 Bacteria 1310
817 Ga0495624_0043767 3300046690 Bacteria 2855
818 Ga0495670_0056757 3300046691 Bacteria 1965
819 Ga0495600_0004232 3300046809 Bacteria 8571
820 Ga0495636_0004863 3300047318 Bacteria 5261
821 Ga0495674_0039300 3300047319 Bacteria 4243
822 Ga0495674_0039453 3300047319 Bacteria 4232
823 Ga0495672_0005040 3300047320 Bacteria 10563
824 Ga0495680_0190935 3300047322 Bacteria 1474
825 Ga0495686_0000014 3300047472 Bacteria 474014
826 Ga0495593_0008132 3300047673 Bacteria 6104
827 Ga0495602_0185750 3300048088 Bacteria 1599
828 Ga0495614_0003394 3300048089 Bacteria 7128
829 Ga0496100_0102754 3300048903 Bacteria 1972
830 Ga0496101_0001900 3300048904 Bacteria 12620
831 Ga0496102_0004231 3300048905 Bacteria 12132
832 Ga0496102_0274038 3300048905 Bacteria 1591
833 Ga0496104_0002663 3300048907 Bacteria 15369
834 Ga0496105_0001549 3300048908 Bacteria 16271
835 Ga0496106_0034566 3300048909 Bacteria 3776
836 Ga0496107_0043853 3300048910 Bacteria 3214
837 Ga0496108_0007533 3300048911 Bacteria 8823
838 Ga0496108_0178322 3300048911 Bacteria 1839
839 Ga0496109_0054988 3300048912 Bacteria 3631
840 Ga0496109_0152637 3300048912 Bacteria 2163
841 Ga0496110_0000706 3300048913 Bacteria 23078
842 Ga0496110_0097087 3300048913 Bacteria 2640
843 Ga0496111_0063090 3300048914 Bacteria 2687
844 Ga0496112_0270186 3300048915 Bacteria 1649
845 Ga0496116_0021075 3300048919 Bacteria 4926
846 Ga0496117_0008098 3300048920 Bacteria 10059
847 Ga0496118_0029901 3300048921 Bacteria 4558
848 Ga0496121_0089624 3300048924 Bacteria 2407
849 Ga0496123_0073392 3300048926 Bacteria 2123
850 Ga0496125_0034504 3300048928 Bacteria 4458
851 Ga0496125_0058511 3300048928 Bacteria 3113
852 Ga0501033_0000938 3300049570 Bacteria 26508
853 Ga0501034_0007094 3300049571 Bacteria 11954
854 Ga0501034_0047636 3300049571 Bacteria 4328
855 Ga0501036_0020678 3300049572 Bacteria 5529
856 Ga0501038_0004435 3300049574 Bacteria 13050
857 Ga0501039_0001678 3300049575 Bacteria 16322
858 Ga0501039_0324672 3300049575 Bacteria 1210
859 Ga0501040_0003651 3300049576 Bacteria 9963
860 Ga0501041_0000379 3300049577 Bacteria 22302
861 Ga0501041_0020745 3300049577 Bacteria 3931
862 Ga0501041_0071212 3300049577 Bacteria 2135
863 Ga0501041_0169831 3300049577 Bacteria 1365
864 Ga0501042_0000723 3300049578 Bacteria 17920
865 Ga0501043_0048433 3300049579 Bacteria 3341
866 Ga0501046_0001335 3300049580 Bacteria 23896
867 Ga0501046_0006321 3300049580 Bacteria 10504
868 Ga0501046_0113765 3300049580 Bacteria 2065
869 Ga0501046_0167941 3300049580 Bacteria 1648
870 Ga0501047_0025433 3300049581 Bacteria 5691
871 Ga0501047_0281385 3300049581 Bacteria 1508
872 Ga0501048_0001543 3300049582 Bacteria 17478
873 Ga0501068_0033697 3300049584 Bacteria 3051
874 Ga0501068_0122055 3300049584 Bacteria 1625
875 Ga0501069_0000942 3300049585 Bacteria 13871
876 Ga0501069_0123807 3300049585 Bacteria 1478
877 Ga0501070_0003078 3300049586 Bacteria 14519
878 Ga0501070_0014380 3300049586 Bacteria 6658
879 Ga0501070_0238908 3300049586 Bacteria 1487
880 Ga0501071_0001886 3300049587 Bacteria 12453
881 Ga0501071_0018176 3300049587 Bacteria 4862
882 Ga0501071_0070335 3300049587 Bacteria 2549
883 Ga0501071_0207138 3300049587 Bacteria 1474
884 Ga0501072_0000730 3300049588 Bacteria 23956
885 Ga0501072_0008283 3300049588 Bacteria 7900
886 Ga0501073_0003022 3300049589 Bacteria 12609
887 Ga0501073_0005339 3300049589 Bacteria 9636
888 Ga0501074_0005252 3300049590 Bacteria 9317
889 Ga0501074_0005970 3300049590 Bacteria 8786
890 Ga0501074_0019604 3300049590 Bacteria 4909
891 Ga0501074_0046248 3300049590 Bacteria 3147
892 Ga0501074_0125069 3300049590 Bacteria 1839
893 Ga0501074_0169899 3300049590 Bacteria 1557
894 Ga0501075_0000411 3300049591 Bacteria 24982
895 Ga0501075_0007281 3300049591 Bacteria 7672
896 Ga0501075_0031212 3300049591 Bacteria 3953
897 Ga0501076_0000861 3300049592 Bacteria 19709
898 Ga0501076_0017164 3300049592 Bacteria 5498
899 Ga0501077_0061697 3300049593 Bacteria 2379
900 Ga0501249_004119 3300049679 Bacteria 2942
901 Ga0501079_0001087 3300049741 Bacteria 18873
902 Ga0501079_0002789 3300049741 Bacteria 12734
903 Ga0501079_0006549 3300049741 Bacteria 8754
904 Ga0501080_0004879 3300049742 Bacteria 11950
905 Ga0501080_0012613 3300049742 Bacteria 7749
906 Ga0501080_0028657 3300049742 Bacteria 5183
907 Ga0501080_0298218 3300049742 Bacteria 1462
908 Ga0501080_0338571 3300049742 Bacteria 1360
909 Ga0501080_0420112 3300049742 Bacteria 1201
910 Ga0501081_0003501 3300049743 Bacteria 10037
911 Ga0501081_0161244 3300049743 Bacteria 1616
912 Ga0501083_0012662 3300049744 Bacteria 5902
913 Ga0501083_0038854 3300049744 Bacteria 3234
914 Ga0501035_0030221 3300049822 Bacteria 4939
915 Ga0501035_0097495 3300049822 Bacteria 2582
916 Ga0501035_0212421 3300049822 Bacteria 1655
917 Ga0501044_0102442 3300049823 Bacteria 2879
918 Ga0501044_0175921 3300049823 Bacteria 2109
919 Ga0501045_0001439 3300049824 Bacteria 15853
920 Ga0501045_0242669 3300049824 Bacteria 1341
921 nmdc:mga03n38_2559_c1 3300050490 Bacteria 5651
922 nmdc:mga00v17_73454_c1 3300050491 Bacteria 2124
923 nmdc:mga0yw44_66932_c1 3300050492 Bacteria 2219
924 nmdc:mga0k408_27742_c1 3300050493 Bacteria 3217
925 nmdc:mga0k408_38601_c1 3300050493 Bacteria 2741
926 nmdc:mga0k408_51893_c1 3300050493 Bacteria 1854
927 nmdc:mga07m45_162435_c1 3300050496 Bacteria 1297
928 nmdc:mga05p37_239873_c1 3300050507 Bacteria 2180
929 nmdc:mga05p37_3424_c1 3300050507 Bacteria 18509
930 nmdc:mga09592_1698_c1 3300050508 Bacteria 17757
931 nmdc:mga09592_196881_c1 3300050508 Bacteria 1745
932 nmdc:mga09592_30226_c1 3300050508 Bacteria 4507
933 nmdc:mga09592_340285_c1 3300050508 Bacteria 1299
934 nmdc:mga0qj67_10467_c1 3300050509 Bacteria 6928
935 nmdc:mga0qj67_107710_c2 3300050509 Bacteria 1836
936 nmdc:mga06r32_172405_c1 3300050510 Bacteria 2147
937 nmdc:mga06r32_812_c1 3300050510 Bacteria 27757
938 nmdc:mga08y16_108428_c1 3300050511 Bacteria 2891
939 nmdc:mga08y16_1548_c1 3300050511 Bacteria 23173
940 nmdc:mga08y16_15859_c1 3300050511 Bacteria 7920
941 nmdc:mga08y16_16812_c1 3300050511 Bacteria 7701
942 nmdc:mga08y16_305883_c1 3300050511 Bacteria 1638
943 nmdc:mga08y16_80864_c1 3300050511 Bacteria 3388
944 nmdc:mga08y16_88346_c1 3300050511 Bacteria 3230
945 nmdc:mga0n895_121741_c1 3300050512 Bacteria 2630
946 nmdc:mga0n895_201551_c1 3300050512 Bacteria 2021
947 nmdc:mga0n895_28767_c1 3300050512 Bacteria 5291
948 nmdc:mga0n895_33504_c1 3300050512 Bacteria 4938
949 nmdc:mga0rr50_13378_c1 3300050513 Bacteria 5341
950 nmdc:mga0rr50_203655_c1 3300050513 Bacteria 1627
951 nmdc:mga0rr50_2572_c1 3300050513 Bacteria 10277
952 nmdc:mga0rr50_348037_c1 3300050513 Bacteria 1246
953 nmdc:mga0rr50_436_c1 3300050513 Bacteria 22427
954 nmdc:mga0rr50_60030_c1 3300050513 Bacteria 2859
955 nmdc:mga08x19_1428_c1 3300050514 Bacteria 14774
956 nmdc:mga08x19_180935_c1 3300050514 Bacteria 1439
957 nmdc:mga08x19_3510_c1 3300050514 Bacteria 9333
958 nmdc:mga08x19_38557_c1 3300050514 Bacteria 3035
959 nmdc:mga08x19_487_c1 3300050514 Bacteria 26435
960 nmdc:mga0a205_100380_c1 3300050515 Bacteria 2793
961 nmdc:mga0a205_1353_c1 3300050515 Bacteria 20648
962 nmdc:mga0a205_386498_c1 3300050515 Bacteria 1264
963 Ga0500651_0000967 3300053093 Bacteria 14133
964 Ga0500566_0005275 3300053094 Bacteria 7691
965 Ga0500571_000098 3300053110 Bacteria 28557
966 Ga0500594_0000650 3300053118 Bacteria 7417
967 Ga0500607_023878 3300053121 Bacteria 3421
968 Ga0500618_016401 3300053125 Bacteria 1854
969 Ga0500658_0001601 3300053134 Bacteria 9050
970 Ga0500559_0002136 3300053136 Bacteria 10521
971 Ga0500559_0028570 3300053136 Bacteria 2383
972 Ga0500568_0007761 3300053139 Bacteria 5231
973 Ga0500574_009406 3300053141 Bacteria 2121
974 Ga0500604_0053702 3300053151 Bacteria 1250
975 Ga0500616_0014630 3300053153 Bacteria 4503
976 Ga0500627_0037841 3300053158 Bacteria 2061
977 Ga0501084_0012332 3300054114 Bacteria 7078
978 Ga0501084_0013879 3300054114 Bacteria 6667
979 Ga0501082_0002225 3300060353 Bacteria 16966
980 Ga0501082_0026242 3300060353 Bacteria 5020
981 Ga0501082_0065813 3300060353 Bacteria 3121
982 Ga0501082_0117772 3300060353 Bacteria 2301
983 Ga0466962_0002885 3300061719 Bacteria 8200
984 Ga0530510_0000870 3300061734 Bacteria 19874
985 Ga0530510_0001009 3300061734 Bacteria 18700
986 Ga0530510_0271887 3300061734 Bacteria 1265

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10279379 Ga0207649_102793792 288
2 3300042876 Ga0451577_0368695 Ga0451577_0368695_384_1280 288
3 3300034816 Ga0373930_0008188 Ga0373930_0008188_19_906 291
4 3300046474 Ga0495605_0097449 Ga0495605_0097449_28_1161 292
5 3300046530 Ga0495654_0113350 Ga0495654_0113350_329_1216 292
6 3300046515 Ga0495620_0053275 Ga0495620_0053275_24_977 303
7 3300049575 Ga0501039_0324672 Ga0501039_0324672_213_1163 311
8 3300025938 Ga0207704_10113122 Ga0207704_101131223 313
9 3300035118 Ga0373954_0000210 Ga0373954_0000210_19308_20297 313
10 3300035724 Ga0373933_0001438 Ga0373933_0001438_4111_5100 313
11 3300036401 Ga0373937_0003410 Ga0373937_0003410_2969_3958 313
12 3300005440 Ga0070705_100017908 Ga0070705_1000179082 317
13 3300005444 Ga0070694_100024371 Ga0070694_1000243714 317
14 3300005467 Ga0070706_100108259 Ga0070706_1001082592 317
15 3300005518 Ga0070699_100077562 Ga0070699_1000775623 317
16 3300005536 Ga0070697_100008436 Ga0070697_1000084366 317
17 3300005545 Ga0070695_100000692 Ga0070695_10000069212 317
18 3300005546 Ga0070696_100008744 Ga0070696_1000087442 317
19 3300006914 Ga0075436_100032054 Ga0075436_1000320543 317
20 3300005328 Ga0070676_10000313 Ga0070676_100003139 318
21 3300005333 Ga0070677_10003289 Ga0070677_100032893 318
22 3300005334 Ga0068869_100010273 Ga0068869_1000102733 318
23 3300005335 Ga0070666_10006030 Ga0070666_100060303 318
24 3300005338 Ga0068868_100002154 Ga0068868_1000021549 318
25 3300005340 Ga0070689_100080902 Ga0070689_1000809022 318
26 3300005347 Ga0070668_100004065 Ga0070668_1000040652 318
27 3300005354 Ga0070675_100024700 Ga0070675_1000247002 318
28 3300005355 Ga0070671_100016418 Ga0070671_1000164183 318
29 3300005356 Ga0070674_100012986 Ga0070674_1000129862 318
30 3300005364 Ga0070673_100003250 Ga0070673_1000032508 318
31 3300005367 Ga0070667_100015489 Ga0070667_1000154892 318
32 3300005455 Ga0070663_100003404 Ga0070663_1000034046 318
33 3300005456 Ga0070678_100000650 Ga0070678_1000006503 318
34 3300005457 Ga0070662_100029819 Ga0070662_1000298192 318
35 3300005459 Ga0068867_100001882 Ga0068867_1000018823 318
36 3300005466 Ga0070685_10017491 Ga0070685_100174912 318
37 3300005539 Ga0068853_100001685 Ga0068853_1000016858 318
38 3300005444 Ga0070694_100195755 Ga0070694_1001957552 319
39 3300005545 Ga0070695_100024403 Ga0070695_1000244032 319
40 3300005545 Ga0070695_100027130 Ga0070695_1000271302 319
41 3300005546 Ga0070696_100121266 Ga0070696_1001212662 319
42 3300005618 Ga0068864_100094011 Ga0068864_1000940112 319
43 3300005841 Ga0068863_100266231 Ga0068863_1002662312 319
44 3300007265 Ga0099794_10012591 Ga0099794_100125912 319
45 3300009094 Ga0111539_10020073 Ga0111539_100200733 319
46 3300025271 Ga0207666_1001903 Ga0207666_10019032 319
47 3300026095 Ga0207676_10364707 Ga0207676_103647072 319
48 3300031901 Ga0307406_10001349 Ga0307406_1000134910 319
49 3300050508 nmdc:mga09592_340285_c1 nmdc:mga09592_340285_c1_210_1187 319
50 3300050511 nmdc:mga08y16_80864_c1 nmdc:mga08y16_80864_c1_855_1832 319
51 3300005293 Ga0065715_10221518 Ga0065715_102215182 320
52 3300005335 Ga0070666_10016271 Ga0070666_100162713 320
53 3300005340 Ga0070689_100155589 Ga0070689_1001555892 320
54 3300005353 Ga0070669_100076499 Ga0070669_1000764993 320
55 3300005438 Ga0070701_10118961 Ga0070701_101189611 320
56 3300005456 Ga0070678_100132226 Ga0070678_1001322261 320
57 3300005466 Ga0070685_10265362 Ga0070685_102653621 320
58 3300005544 Ga0070686_100128493 Ga0070686_1001284932 320
59 3300005548 Ga0070665_100139708 Ga0070665_1001397082 320
60 3300005577 Ga0068857_100397699 Ga0068857_1003976991 320
61 3300005617 Ga0068859_100478011 Ga0068859_1004780111 320
62 3300005618 Ga0068864_100021353 Ga0068864_1000213535 320
63 3300005840 Ga0068870_10079472 Ga0068870_100794722 320
64 3300005841 Ga0068863_100038818 Ga0068863_1000388182 320
65 3300006931 Ga0097620_100478010 Ga0097620_1004780101 320
66 3300009177 Ga0105248_10224528 Ga0105248_102245282 320
67 3300013297 Ga0157378_10008082 Ga0157378_100080823 320
68 3300013308 Ga0157375_10378031 Ga0157375_103780311 320
69 3300014325 Ga0163163_10413114 Ga0163163_104131141 320
70 3300014968 Ga0157379_10040024 Ga0157379_100400242 320
71 3300014969 Ga0157376_10126047 Ga0157376_101260472 320
72 3300014969 Ga0157376_10262271 Ga0157376_102622711 320
73 3300025315 Ga0207697_10014516 Ga0207697_100145162 320
74 3300025893 Ga0207682_10009656 Ga0207682_100096562 320
75 3300025901 Ga0207688_10006888 Ga0207688_100068881 320
76 3300025918 Ga0207662_10003774 Ga0207662_100037746 320
77 3300025923 Ga0207681_10072794 Ga0207681_100727942 320
78 3300025925 Ga0207650_10137181 Ga0207650_101371812 320
79 3300025926 Ga0207659_10110319 Ga0207659_101103192 320
80 3300025931 Ga0207644_10020376 Ga0207644_100203762 320
81 3300025933 Ga0207706_10039233 Ga0207706_100392334 320
82 3300025934 Ga0207686_10037208 Ga0207686_100372083 320
83 3300025940 Ga0207691_10082605 Ga0207691_100826053 320
84 3300025941 Ga0207711_10029400 Ga0207711_100294002 320
85 3300025942 Ga0207689_10201914 Ga0207689_102019142 320
86 3300025942 Ga0207689_10296882 Ga0207689_102968822 320
87 3300025960 Ga0207651_10164182 Ga0207651_101641822 320
88 3300025972 Ga0207668_10151285 Ga0207668_101512852 320
89 3300025981 Ga0207640_10147294 Ga0207640_101472942 320
90 3300026095 Ga0207676_10012250 Ga0207676_100122505 320
91 3300026095 Ga0207676_10133049 Ga0207676_101330492 320
92 3300026116 Ga0207674_10123429 Ga0207674_101234291 320
93 3300026118 Ga0207675_100033522 Ga0207675_1000335223 320
94 3300026121 Ga0207683_10183054 Ga0207683_101830542 320
95 3300027907 Ga0207428_10103884 Ga0207428_101038842 320
96 3300028379 Ga0268266_10213696 Ga0268266_102136962 320
97 3300046528 Ga0495642_0012814 Ga0495642_0012814_2075_3079 320
98 3300046537 Ga0495598_0001069 Ga0495598_0001069_1504_2508 320
99 3300046539 Ga0495621_0035190 Ga0495621_0035190_515_1519 320
100 3300048912 Ga0496109_0152637 Ga0496109_0152637_1107_2111 320
101 3300050511 nmdc:mga08y16_305883_c1 nmdc:mga08y16_305883_c1_107_1111 320
102 3300005440 Ga0070705_100012429 Ga0070705_1000124292 321
103 3300005444 Ga0070694_100013774 Ga0070694_1000137743 321
104 3300005545 Ga0070695_100027161 Ga0070695_1000271613 321
105 3300005546 Ga0070696_100025013 Ga0070696_1000250133 321
106 3300005549 Ga0070704_100005519 Ga0070704_1000055194 321
107 3300013307 Ga0157372_10060911 Ga0157372_100609112 321
108 3300035242 Ga0373962_0009214 Ga0373962_0009214_713_1699 321
109 3300042003 Ga0439443_000254 Ga0439443_000254_1998_2972 321
110 3300042461 Ga0439460_0000631 Ga0439460_0000631_412_1386 321
111 3300046511 Ga0495608_0175474 Ga0495608_0175474_291_1292 321
112 3300049577 Ga0501041_0071212 Ga0501041_0071212_671_1645 321
113 3300049580 Ga0501046_0006321 Ga0501046_0006321_7517_8491 321
114 3300049584 Ga0501068_0122055 Ga0501068_0122055_287_1261 321
115 3300049587 Ga0501071_0018176 Ga0501071_0018176_21_995 321
116 3300049587 Ga0501071_0207138 Ga0501071_0207138_452_1426 321
117 3300049588 Ga0501072_0008283 Ga0501072_0008283_2763_3737 321
118 3300049590 Ga0501074_0125069 Ga0501074_0125069_724_1698 321
119 3300049591 Ga0501075_0031212 Ga0501075_0031212_25_999 321
120 3300049592 Ga0501076_0017164 Ga0501076_0017164_3593_4567 321
121 3300049593 Ga0501077_0061697 Ga0501077_0061697_698_1672 321
122 3300049742 Ga0501080_0028657 Ga0501080_0028657_826_1800 321
123 3300049743 Ga0501081_0161244 Ga0501081_0161244_567_1541 321
124 3300054114 Ga0501084_0012332 Ga0501084_0012332_2131_3105 321
125 3300060353 Ga0501082_0117772 Ga0501082_0117772_897_1871 321
126 3300061734 Ga0530510_0001009 Ga0530510_0001009_12803_13777 321
127 3300005347 Ga0070668_100096792 Ga0070668_1000967922 322
128 3300005353 Ga0070669_100012049 Ga0070669_1000120491 322
129 3300005354 Ga0070675_100017523 Ga0070675_1000175232 322
130 3300005354 Ga0070675_100171539 Ga0070675_1001715392 322
131 3300005441 Ga0070700_100001867 Ga0070700_10000186711 322
132 3300005441 Ga0070700_100287623 Ga0070700_1002876232 322
133 3300005459 Ga0068867_100002025 Ga0068867_1000020255 322
134 3300005536 Ga0070697_100002360 Ga0070697_1000023605 322
135 3300005543 Ga0070672_100227048 Ga0070672_1002270481 322
136 3300005543 Ga0070672_100344566 Ga0070672_1003445662 322
137 3300005544 Ga0070686_100069845 Ga0070686_1000698452 322
138 3300005549 Ga0070704_100072836 Ga0070704_1000728362 322
139 3300005840 Ga0068870_10182918 Ga0068870_101829182 322
140 3300005844 Ga0068862_100006778 Ga0068862_1000067785 322
141 3300006852 Ga0075433_10203240 Ga0075433_102032402 322
142 3300007076 Ga0075435_100000811 Ga0075435_1000008117 322
143 3300007076 Ga0075435_100071689 Ga0075435_1000716892 322
144 3300007265 Ga0099794_10015970 Ga0099794_100159702 322
145 3300007265 Ga0099794_10019763 Ga0099794_100197632 322
146 3300009094 Ga0111539_10078279 Ga0111539_100782792 322
147 3300009148 Ga0105243_10003125 Ga0105243_100031255 322
148 3300009553 Ga0105249_10004022 Ga0105249_100040223 322
149 3300013306 Ga0163162_10112236 Ga0163162_101122362 322
150 3300013308 Ga0157375_10118307 Ga0157375_101183073 322
151 3300014326 Ga0157380_10003849 Ga0157380_100038496 322
152 3300025899 Ga0207642_10004720 Ga0207642_100047202 322
153 3300025901 Ga0207688_10018621 Ga0207688_100186213 322
154 3300025908 Ga0207643_10040818 Ga0207643_100408182 322
155 3300025918 Ga0207662_10113344 Ga0207662_101133442 322
156 3300025923 Ga0207681_10000513 Ga0207681_100005134 322
157 3300025926 Ga0207659_10041724 Ga0207659_100417242 322
158 3300025935 Ga0207709_10003231 Ga0207709_100032316 322
159 3300025961 Ga0207712_10011050 Ga0207712_100110503 322
160 3300025972 Ga0207668_10042435 Ga0207668_100424352 322
161 3300026116 Ga0207674_10095874 Ga0207674_100958742 322
162 3300027360 Ga0209969_1010690 Ga0209969_10106902 322
163 3300027364 Ga0209967_1000620 Ga0209967_10006202 322
164 3300027462 Ga0210000_1002190 Ga0210000_10021902 322
165 3300027471 Ga0209995_1005856 Ga0209995_10058562 322
166 3300027543 Ga0209999_1005808 Ga0209999_10058082 322
167 3300027671 Ga0209588_1014430 Ga0209588_10144301 322
168 3300028380 Ga0268265_10000818 Ga0268265_1000081826 322
169 3300031251 Ga0265327_10002065 Ga0265327_1000206510 322
170 3300035115 Ga0373941_0030441 Ga0373941_0030441_120_1109 322
171 3300035207 Ga0373942_0001690 Ga0373942_0001690_4361_5338 322
172 3300036401 Ga0373937_0009139 Ga0373937_0009139_5285_6277 322
173 3300042156 Ga0439446_0018238 Ga0439446_0018238_99_1088 322
174 3300042435 Ga0439434_0000113 Ga0439434_0000113_13819_14808 322
175 3300042436 Ga0439435_0000473 Ga0439435_0000473_2858_3847 322
176 3300046454 Ga0495592_0009024 Ga0495592_0009024_1816_2808 322
177 3300046476 Ga0495662_0074644 Ga0495662_0074644_28_1020 322
178 3300046511 Ga0495608_0004731 Ga0495608_0004731_2933_3925 322
179 3300046516 Ga0495628_0007988 Ga0495628_0007988_2767_3759 322
180 3300046517 Ga0495630_0001001 Ga0495630_0001001_13102_14094 322
181 3300046526 Ga0495666_0006235 Ga0495666_0006235_77_1069 322
182 3300046533 Ga0495640_0004549 Ga0495640_0004549_4462_5454 322
183 3300046535 Ga0495586_0001499 Ga0495586_0001499_6941_7933 322
184 3300046543 Ga0495645_0099123 Ga0495645_0099123_307_1299 322
185 3300046559 Ga0495667_0022383 Ga0495667_0022383_2845_3837 322
186 3300046642 Ga0495634_0011090 Ga0495634_0011090_4725_5717 322
187 3300046663 Ga0495635_0145736 Ga0495635_0145736_123_1115 322
188 3300046678 Ga0495599_0015568 Ga0495599_0015568_2086_3078 322
189 3300046683 Ga0495658_0011040 Ga0495658_0011040_2375_3367 322
190 3300046689 Ga0495613_0006610 Ga0495613_0006610_3052_4044 322
191 3300046690 Ga0495624_0043767 Ga0495624_0043767_271_1263 322
192 3300046809 Ga0495600_0004232 Ga0495600_0004232_5280_6272 322
193 3300047318 Ga0495636_0004863 Ga0495636_0004863_2112_3104 322
194 3300047319 Ga0495674_0039300 Ga0495674_0039300_1778_2770 322
195 3300049577 Ga0501041_0020745 Ga0501041_0020745_2078_3055 322
196 3300049580 Ga0501046_0167941 Ga0501046_0167941_229_1206 322
197 3300049742 Ga0501080_0338571 Ga0501080_0338571_197_1207 322
198 3300050507 nmdc:mga05p37_239873_c1 nmdc:mga05p37_239873_c1_498_1487 322
199 3300050510 nmdc:mga06r32_172405_c1 nmdc:mga06r32_172405_c1_13_990 322
200 3300050511 nmdc:mga08y16_108428_c1 nmdc:mga08y16_108428_c1_1076_2065 322
201 3300050511 nmdc:mga08y16_15859_c1 nmdc:mga08y16_15859_c1_1986_2975 322
202 3300050512 nmdc:mga0n895_201551_c1 nmdc:mga0n895_201551_c1_750_1727 322
203 3300050513 nmdc:mga0rr50_2572_c1 nmdc:mga0rr50_2572_c1_619_1596 322
204 3300050514 nmdc:mga08x19_38557_c1 nmdc:mga08x19_38557_c1_1749_2726 322
205 3300050515 nmdc:mga0a205_100380_c1 nmdc:mga0a205_100380_c1_306_1283 322
206 3300061734 Ga0530510_0271887 Ga0530510_0271887_77_1054 322
207 iso_pu_bacteria 2554235132 2554812981 322
208 iso_pu_bacteria 2606217733 2608383436 322
209 3300003203 JGI25406J46586_10046803 JGI25406J46586_100468032 323
210 3300005329 Ga0070683_100030891 Ga0070683_1000308912 323
211 3300005336 Ga0070680_100016773 Ga0070680_1000167732 323
212 3300005343 Ga0070687_100036020 Ga0070687_1000360203 323
213 3300005365 Ga0070688_100131707 Ga0070688_1001317072 323
214 3300005458 Ga0070681_10062814 Ga0070681_100628142 323
215 3300005535 Ga0070684_100002834 Ga0070684_1000028349 323
216 3300005544 Ga0070686_100012327 Ga0070686_1000123272 323
217 3300005546 Ga0070696_100082402 Ga0070696_1000824022 323
218 3300005618 Ga0068864_100087152 Ga0068864_1000871523 323
219 3300005842 Ga0068858_100014709 Ga0068858_1000147094 323
220 3300005985 Ga0081539_10000226 Ga0081539_10000226138 323
221 3300006358 Ga0068871_100007338 Ga0068871_1000073382 323
222 3300006852 Ga0075433_10001856 Ga0075433_1000185616 323
223 3300006871 Ga0075434_100000306 Ga0075434_10000030637 323
224 3300006871 Ga0075434_100001295 Ga0075434_1000012955 323
225 3300006914 Ga0075436_100000087 Ga0075436_10000008728 323
226 3300006914 Ga0075436_100189790 Ga0075436_1001897902 323
227 3300007076 Ga0075435_100001385 Ga0075435_1000013855 323
228 3300007076 Ga0075435_100018574 Ga0075435_1000185742 323
229 3300007076 Ga0075435_100052938 Ga0075435_1000529383 323
230 3300007076 Ga0075435_100184894 Ga0075435_1001848942 323
231 3300009094 Ga0111539_10054800 Ga0111539_100548003 323
232 3300009147 Ga0114129_10223463 Ga0114129_102234631 323
233 3300009176 Ga0105242_10001658 Ga0105242_1000165810 323
234 3300009177 Ga0105248_10033298 Ga0105248_100332984 323
235 3300014968 Ga0157379_10002873 Ga0157379_1000287312 323
236 3300025901 Ga0207688_10156891 Ga0207688_101568912 323
237 3300025912 Ga0207707_10042674 Ga0207707_100426743 323
238 3300025917 Ga0207660_10083168 Ga0207660_100831682 323
239 3300025918 Ga0207662_10097533 Ga0207662_100975332 323
240 3300025934 Ga0207686_10005916 Ga0207686_100059162 323
241 3300025941 Ga0207711_10118310 Ga0207711_101183102 323
242 3300025944 Ga0207661_10002842 Ga0207661_1000284210 323
243 3300026035 Ga0207703_10054661 Ga0207703_100546612 323
244 3300026089 Ga0207648_10031871 Ga0207648_100318713 323
245 3300026095 Ga0207676_10058205 Ga0207676_100582052 323
246 3300027462 Ga0210000_1003715 Ga0210000_10037153 323
247 3300027543 Ga0209999_1008713 Ga0209999_10087132 323
248 3300027876 Ga0209974_10021675 Ga0209974_100216752 323
249 3300035115 Ga0373941_0004319 Ga0373941_0004319_837_1817 323
250 3300035241 Ga0373961_0011514 Ga0373961_0011514_513_1493 323
251 3300035691 Ga0373931_0069565 Ga0373931_0069565_663_1661 323
252 3300035691 Ga0373931_0135374 Ga0373931_0135374_169_1170 323
253 3300042001 Ga0439441_000286 Ga0439441_000286_1648_2628 323
254 3300050508 nmdc:mga09592_196881_c1 nmdc:mga09592_196881_c1_44_1024 323
255 3300050512 nmdc:mga0n895_28767_c1 nmdc:mga0n895_28767_c1_2337_3317 323
256 3300050512 nmdc:mga0n895_33504_c1 nmdc:mga0n895_33504_c1_1620_2612 323
257 3300050513 nmdc:mga0rr50_13378_c1 nmdc:mga0rr50_13378_c1_3209_4189 323
258 3300050513 nmdc:mga0rr50_203655_c1 nmdc:mga0rr50_203655_c1_268_1263 323
259 3300050513 nmdc:mga0rr50_348037_c1 nmdc:mga0rr50_348037_c1_194_1174 323
260 3300050513 nmdc:mga0rr50_436_c1 nmdc:mga0rr50_436_c1_2799_3791 323
261 3300050513 nmdc:mga0rr50_60030_c1 nmdc:mga0rr50_60030_c1_1272_2279 323
262 3300050514 nmdc:mga08x19_1428_c1 nmdc:mga08x19_1428_c1_2576_3568 323
263 3300050514 nmdc:mga08x19_180935_c1 nmdc:mga08x19_180935_c1_35_1030 323
264 3300050514 nmdc:mga08x19_487_c1 nmdc:mga08x19_487_c1_15440_16420 323
265 3300050515 nmdc:mga0a205_1353_c1 nmdc:mga0a205_1353_c1_7129_8121 323
266 3300005330 Ga0070690_100002693 Ga0070690_1000026934 324
267 3300005334 Ga0068869_100002298 Ga0068869_1000022986 324
268 3300005336 Ga0070680_100003537 Ga0070680_1000035377 324
269 3300005338 Ga0068868_100000341 Ga0068868_10000034131 324
270 3300005340 Ga0070689_100003497 Ga0070689_1000034974 324
271 3300005341 Ga0070691_10000934 Ga0070691_100009347 324
272 3300005343 Ga0070687_100000369 Ga0070687_1000003699 324
273 3300005367 Ga0070667_100241496 Ga0070667_1002414961 324
274 3300005438 Ga0070701_10000173 Ga0070701_1000017315 324
275 3300005440 Ga0070705_100002026 Ga0070705_1000020264 324
276 3300005441 Ga0070700_100002899 Ga0070700_1000028993 324
277 3300005444 Ga0070694_100000045 Ga0070694_10000004552 324
278 3300005458 Ga0070681_10062663 Ga0070681_100626632 324
279 3300005459 Ga0068867_100004883 Ga0068867_1000048834 324
280 3300005530 Ga0070679_100083541 Ga0070679_1000835412 324
281 3300005539 Ga0068853_100260860 Ga0068853_1002608602 324
282 3300005543 Ga0070672_100001587 Ga0070672_1000015873 324
283 3300005544 Ga0070686_100003713 Ga0070686_1000037133 324
284 3300005545 Ga0070695_100000126 Ga0070695_10000012629 324
285 3300005546 Ga0070696_100003057 Ga0070696_1000030577 324
286 3300005547 Ga0070693_100000731 Ga0070693_1000007318 324
287 3300005548 Ga0070665_100008796 Ga0070665_1000087963 324
288 3300005549 Ga0070704_100000195 Ga0070704_10000019519 324
289 3300005563 Ga0068855_100007080 Ga0068855_1000070807 324
290 3300005578 Ga0068854_100003263 Ga0068854_1000032635 324
291 3300005614 Ga0068856_100015746 Ga0068856_1000157462 324
292 3300005615 Ga0070702_100000019 Ga0070702_1000000195 324
293 3300005616 Ga0068852_100010590 Ga0068852_1000105904 324
294 3300005617 Ga0068859_100013818 Ga0068859_1000138183 324
295 3300005618 Ga0068864_100004221 Ga0068864_1000042217 324
296 3300005718 Ga0068866_10001065 Ga0068866_100010656 324
297 3300005719 Ga0068861_100002221 Ga0068861_1000022215 324
298 3300005834 Ga0068851_10001624 Ga0068851_100016246 324
299 3300005840 Ga0068870_10011148 Ga0068870_100111482 324
300 3300005841 Ga0068863_100004084 Ga0068863_1000040849 324
301 3300005842 Ga0068858_100000751 Ga0068858_1000007514 324
302 3300005843 Ga0068860_100005413 Ga0068860_1000054139 324
303 3300005843 Ga0068860_100018660 Ga0068860_1000186603 324
304 3300005844 Ga0068862_100005525 Ga0068862_1000055256 324
305 3300006237 Ga0097621_100014223 Ga0097621_1000142234 324
306 3300006237 Ga0097621_100024797 Ga0097621_1000247972 324
307 3300006358 Ga0068871_100003308 Ga0068871_1000033085 324
308 3300006358 Ga0068871_100046749 Ga0068871_1000467493 324
309 3300006881 Ga0068865_100001242 Ga0068865_1000012429 324
310 3300006914 Ga0075436_100000475 Ga0075436_1000004751 324
311 3300006931 Ga0097620_100013819 Ga0097620_1000138193 324
312 3300009098 Ga0105245_10005835 Ga0105245_100058356 324
313 3300009148 Ga0105243_10004530 Ga0105243_100045306 324
314 3300009174 Ga0105241_10047970 Ga0105241_100479703 324
315 3300009553 Ga0105249_10011197 Ga0105249_100111973 324
316 3300013297 Ga0157378_10000579 Ga0157378_100005795 324
317 3300013306 Ga0163162_10006590 Ga0163162_100065907 324
318 3300013308 Ga0157375_10031375 Ga0157375_100313752 324
319 3300013308 Ga0157375_10096305 Ga0157375_100963053 324
320 3300014326 Ga0157380_10042159 Ga0157380_100421592 324
321 3300014969 Ga0157376_10056115 Ga0157376_100561153 324
322 3300025321 Ga0207656_10000903 Ga0207656_100009033 324
323 3300025885 Ga0207653_10043071 Ga0207653_100430712 324
324 3300025893 Ga0207682_10000059 Ga0207682_1000005940 324
325 3300025899 Ga0207642_10001096 Ga0207642_100010965 324
326 3300025903 Ga0207680_10007283 Ga0207680_100072833 324
327 3300025907 Ga0207645_10002844 Ga0207645_100028448 324
328 3300025908 Ga0207643_10002206 Ga0207643_100022064 324
329 3300025908 Ga0207643_10051847 Ga0207643_100518473 324
330 3300025911 Ga0207654_10034789 Ga0207654_100347893 324
331 3300025916 Ga0207663_10232839 Ga0207663_102328392 324
332 3300025917 Ga0207660_10004091 Ga0207660_100040914 324
333 3300025918 Ga0207662_10000049 Ga0207662_100000496 324
334 3300025921 Ga0207652_10057137 Ga0207652_100571373 324
335 3300025925 Ga0207650_10080128 Ga0207650_100801282 324
336 3300025926 Ga0207659_10008117 Ga0207659_100081176 324
337 3300025927 Ga0207687_10004654 Ga0207687_100046544 324
338 3300025931 Ga0207644_10114123 Ga0207644_101141232 324
339 3300025933 Ga0207706_10027297 Ga0207706_100272973 324
340 3300025934 Ga0207686_10004424 Ga0207686_100044243 324
341 3300025935 Ga0207709_10004865 Ga0207709_100048655 324
342 3300025936 Ga0207670_10001257 Ga0207670_100012575 324
343 3300025937 Ga0207669_10022292 Ga0207669_100222922 324
344 3300025938 Ga0207704_10003500 Ga0207704_100035005 324
345 3300025940 Ga0207691_10000243 Ga0207691_1000024332 324
346 3300025942 Ga0207689_10005474 Ga0207689_100054746 324
347 3300025942 Ga0207689_10012793 Ga0207689_100127932 324
348 3300025960 Ga0207651_10012247 Ga0207651_100122472 324
349 3300025961 Ga0207712_10009645 Ga0207712_100096454 324
350 3300025972 Ga0207668_10004976 Ga0207668_100049764 324
351 3300025981 Ga0207640_10011056 Ga0207640_100110563 324
352 3300025986 Ga0207658_10010666 Ga0207658_100106662 324
353 3300026023 Ga0207677_10004358 Ga0207677_100043585 324
354 3300026023 Ga0207677_10011167 Ga0207677_100111673 324
355 3300026035 Ga0207703_10019959 Ga0207703_100199594 324
356 3300026041 Ga0207639_10013658 Ga0207639_100136583 324
357 3300026067 Ga0207678_10002320 Ga0207678_1000232010 324
358 3300026075 Ga0207708_10007875 Ga0207708_100078756 324
359 3300026078 Ga0207702_10036006 Ga0207702_100360062 324
360 3300026088 Ga0207641_10021128 Ga0207641_100211285 324
361 3300026089 Ga0207648_10000265 Ga0207648_100002655 324
362 3300026089 Ga0207648_10003896 Ga0207648_100038969 324
363 3300026095 Ga0207676_10011925 Ga0207676_100119256 324
364 3300026118 Ga0207675_100000182 Ga0207675_1000001826 324
365 3300026118 Ga0207675_100077615 Ga0207675_1000776153 324
366 3300026121 Ga0207683_10000308 Ga0207683_1000030832 324
367 3300026142 Ga0207698_10130595 Ga0207698_101305952 324
368 3300028379 Ga0268266_10012628 Ga0268266_100126283 324
369 3300028380 Ga0268265_10004295 Ga0268265_100042954 324
370 3300028381 Ga0268264_10006840 Ga0268264_100068405 324
371 3300028381 Ga0268264_10026779 Ga0268264_100267793 324
372 3300035084 Ga0373928_0003570 Ga0373928_0003570_243_1226 324
373 3300035085 Ga0373929_0003033 Ga0373929_0003033_119_1102 324
374 3300035088 Ga0373940_0016602 Ga0373940_0016602_640_1623 324
375 3300035089 Ga0373944_0005926 Ga0373944_0005926_1619_2614 324
376 3300035111 Ga0373923_0009299 Ga0373923_0009299_2025_3020 324
377 3300035112 Ga0373932_0003784 Ga0373932_0003784_2450_3433 324
378 3300035114 Ga0373939_0002155 Ga0373939_0002155_1027_2010 324
379 3300035115 Ga0373941_0022138 Ga0373941_0022138_506_1489 324
380 3300035121 Ga0373960_0004454 Ga0373960_0004454_1235_2218 324
381 3300035171 Ga0373946_0005537 Ga0373946_0005537_1139_2134 324
382 3300035691 Ga0373931_0000062 Ga0373931_0000062_22656_23639 324
383 3300035691 Ga0373931_0022673 Ga0373931_0022673_1873_2856 324
384 3300035724 Ga0373933_0007663 Ga0373933_0007663_2467_3450 324
385 3300045051 Ga0451576_0008064 Ga0451576_0008064_5497_6480 324
386 3300045051 Ga0451576_0012002 Ga0451576_0012002_4325_5308 324
387 3300046455 Ga0495603_0036970 Ga0495603_0036970_154_1149 324
388 3300046472 Ga0495580_0006729 Ga0495580_0006729_2610_3605 324
389 3300046517 Ga0495630_0062383 Ga0495630_0062383_300_1295 324
390 3300046526 Ga0495666_0017771 Ga0495666_0017771_662_1657 324
391 3300046531 Ga0495665_0016870 Ga0495665_0016870_360_1355 324
392 3300046674 Ga0495588_0019099 Ga0495588_0019099_1450_2445 324
393 3300046679 Ga0495623_0108500 Ga0495623_0108500_268_1251 324
394 3300049577 Ga0501041_0169831 Ga0501041_0169831_241_1224 324
395 3300006846 Ga0075430_100129639 Ga0075430_1001296392 325
396 3300006880 Ga0075429_100000143 Ga0075429_10000014310 325
397 3300009094 Ga0111539_10092441 Ga0111539_100924412 325
398 3300009147 Ga0114129_10001740 Ga0114129_1000174025 325
399 3300027907 Ga0207428_10001034 Ga0207428_100010345 325
400 3300035691 Ga0373931_0053492 Ga0373931_0053492_358_1344 325
401 3300042876 Ga0451577_0018812 Ga0451577_0018812_4776_5762 325
402 3300045051 Ga0451576_0001787 Ga0451576_0001787_26762_27748 325
403 3300049570 Ga0501033_0000938 Ga0501033_0000938_4194_5180 325
404 3300049572 Ga0501036_0020678 Ga0501036_0020678_2861_3859 325
405 3300049574 Ga0501038_0004435 Ga0501038_0004435_5475_6461 325
406 3300049575 Ga0501039_0001678 Ga0501039_0001678_506_1492 325
407 3300049576 Ga0501040_0003651 Ga0501040_0003651_4409_5395 325
408 3300049577 Ga0501041_0000379 Ga0501041_0000379_5878_6864 325
409 3300049578 Ga0501042_0000723 Ga0501042_0000723_12761_13747 325
410 3300049579 Ga0501043_0048433 Ga0501043_0048433_685_1671 325
411 3300049580 Ga0501046_0001335 Ga0501046_0001335_15731_16717 325
412 3300049580 Ga0501046_0113765 Ga0501046_0113765_405_1403 325
413 3300049581 Ga0501047_0281385 Ga0501047_0281385_427_1413 325
414 3300049582 Ga0501048_0001543 Ga0501048_0001543_3933_4919 325
415 3300049584 Ga0501068_0033697 Ga0501068_0033697_1209_2195 325
416 3300049587 Ga0501071_0001886 Ga0501071_0001886_4468_5454 325
417 3300049588 Ga0501072_0000730 Ga0501072_0000730_14958_15944 325
418 3300049590 Ga0501074_0005252 Ga0501074_0005252_4143_5129 325
419 3300049590 Ga0501074_0169899 Ga0501074_0169899_286_1284 325
420 3300049591 Ga0501075_0007281 Ga0501075_0007281_6620_7606 325
421 3300049592 Ga0501076_0000861 Ga0501076_0000861_4853_5839 325
422 3300049741 Ga0501079_0001087 Ga0501079_0001087_13144_14130 325
423 3300049742 Ga0501080_0420112 Ga0501080_0420112_95_1081 325
424 3300049743 Ga0501081_0003501 Ga0501081_0003501_6893_7879 325
425 3300049822 Ga0501035_0030221 Ga0501035_0030221_3018_4004 325
426 3300049823 Ga0501044_0102442 Ga0501044_0102442_1140_2126 325
427 3300049824 Ga0501045_0001439 Ga0501045_0001439_8084_9070 325
428 3300050507 nmdc:mga05p37_3424_c1 nmdc:mga05p37_3424_c1_6562_7548 325
429 3300050508 nmdc:mga09592_1698_c1 nmdc:mga09592_1698_c1_12217_13203 325
430 3300050509 nmdc:mga0qj67_107710_c2 nmdc:mga0qj67_107710_c2_710_1696 325
431 3300050511 nmdc:mga08y16_1548_c1 nmdc:mga08y16_1548_c1_7892_8878 325
432 3300050515 nmdc:mga0a205_386498_c1 nmdc:mga0a205_386498_c1_66_1052 325
433 3300054114 Ga0501084_0013879 Ga0501084_0013879_818_1804 325
434 3300060353 Ga0501082_0002225 Ga0501082_0002225_4443_5429 325
435 3300061734 Ga0530510_0000870 Ga0530510_0000870_8263_9249 325
436 iso_pu_bacteria 2891633521 2891634260 325
437 3300005290 Ga0065712_10118833 Ga0065712_101188332 326
438 3300005354 Ga0070675_100053903 Ga0070675_1000539032 326
439 3300005617 Ga0068859_100059459 Ga0068859_1000594593 326
440 3300005719 Ga0068861_100138222 Ga0068861_1001382223 326
441 3300005842 Ga0068858_100061889 Ga0068858_1000618892 326
442 3300006931 Ga0097620_100059456 Ga0097620_1000594563 326
443 3300009094 Ga0111539_10002898 Ga0111539_100028988 326
444 3300009094 Ga0111539_10027344 Ga0111539_100273442 326
445 3300009551 Ga0105238_10156571 Ga0105238_101565712 326
446 3300026035 Ga0207703_10213390 Ga0207703_102133902 326
447 3300026075 Ga0207708_10125804 Ga0207708_101258042 326
448 3300026118 Ga0207675_100223542 Ga0207675_1002235421 326
449 3300028800 Ga0265338_10136804 Ga0265338_101368042 326
450 3300046539 Ga0495621_0002227 Ga0495621_0002227_1888_2883 326
451 3300005564 Ga0070664_100020888 Ga0070664_1000208883 327
452 3300005614 Ga0068856_100009039 Ga0068856_1000090393 327
453 3300011119 Ga0105246_10017932 Ga0105246_100179322 327
454 3300025945 Ga0207679_10032149 Ga0207679_100321492 327
455 3300026078 Ga0207702_10018915 Ga0207702_100189153 327
456 3300032005 Ga0307411_10209786 Ga0307411_102097862 327
457 3300046515 Ga0495620_0033715 Ga0495620_0033715_193_1209 327
458 3300046520 Ga0495637_0036259 Ga0495637_0036259_215_1231 327
459 3300046530 Ga0495654_0005652 Ga0495654_0005652_5155_6171 327
460 3300046683 Ga0495658_0185580 Ga0495658_0185580_121_1137 327
461 3300049585 Ga0501069_0123807 Ga0501069_0123807_47_1039 327
462 3300053093 Ga0500651_0000967 Ga0500651_0000967_7001_8017 327
463 3300053094 Ga0500566_0005275 Ga0500566_0005275_4589_5605 327
464 3300053134 Ga0500658_0001601 Ga0500658_0001601_200_1216 327
465 3300053139 Ga0500568_0007761 Ga0500568_0007761_1343_2359 327
466 3300053141 Ga0500574_009406 Ga0500574_009406_13_1029 327
467 3300053158 Ga0500627_0037841 Ga0500627_0037841_972_1988 327
468 3300005329 Ga0070683_100093865 Ga0070683_1000938652 328
469 3300005335 Ga0070666_10048999 Ga0070666_100489992 328
470 3300005340 Ga0070689_100460941 Ga0070689_1004609411 328
471 3300005355 Ga0070671_100002054 Ga0070671_10000205412 328
472 3300005435 Ga0070714_100008789 Ga0070714_1000087896 328
473 3300005437 Ga0070710_10115182 Ga0070710_101151821 328
474 3300005438 Ga0070701_10183545 Ga0070701_101835451 328
475 3300005440 Ga0070705_100014900 Ga0070705_1000149003 328
476 3300005458 Ga0070681_10006268 Ga0070681_100062686 328
477 3300005458 Ga0070681_10010845 Ga0070681_100108458 328
478 3300005467 Ga0070706_100006783 Ga0070706_10000678310 328
479 3300005468 Ga0070707_100003388 Ga0070707_1000033888 328
480 3300005530 Ga0070679_100187058 Ga0070679_1001870581 328
481 3300005535 Ga0070684_100225702 Ga0070684_1002257022 328
482 3300005539 Ga0068853_100067128 Ga0068853_1000671282 328
483 3300005543 Ga0070672_100143267 Ga0070672_1001432672 328
484 3300005547 Ga0070693_100015741 Ga0070693_1000157414 328
485 3300005547 Ga0070693_100129648 Ga0070693_1001296481 328
486 3300005563 Ga0068855_100005836 Ga0068855_1000058363 328
487 3300005563 Ga0068855_100013040 Ga0068855_1000130406 328
488 3300005563 Ga0068855_100077941 Ga0068855_1000779412 328
489 3300005617 Ga0068859_100017464 Ga0068859_1000174647 328
490 3300005842 Ga0068858_100039861 Ga0068858_1000398613 328
491 3300006163 Ga0070715_10019721 Ga0070715_100197213 328
492 3300006173 Ga0070716_100074657 Ga0070716_1000746572 328
493 3300006237 Ga0097621_100038035 Ga0097621_1000380352 328
494 3300006358 Ga0068871_100142157 Ga0068871_1001421572 328
495 3300006931 Ga0097620_100017464 Ga0097620_1000174647 328
496 3300007265 Ga0099794_10037077 Ga0099794_100370772 328
497 3300009093 Ga0105240_10094231 Ga0105240_100942312 328
498 3300009098 Ga0105245_10270801 Ga0105245_102708012 328
499 3300009147 Ga0114129_10418881 Ga0114129_104188812 328
500 3300009176 Ga0105242_10040427 Ga0105242_100404272 328
501 3300013104 Ga0157370_10000800 Ga0157370_1000080019 328
502 3300013297 Ga0157378_10003615 Ga0157378_100036159 328
503 3300014968 Ga0157379_10382298 Ga0157379_103822982 328
504 3300025910 Ga0207684_10041849 Ga0207684_100418492 328
505 3300025912 Ga0207707_10009957 Ga0207707_100099572 328
506 3300025921 Ga0207652_10101889 Ga0207652_101018892 328
507 3300025927 Ga0207687_10059254 Ga0207687_100592542 328
508 3300025931 Ga0207644_10043748 Ga0207644_100437482 328
509 3300025934 Ga0207686_10008534 Ga0207686_100085343 328
510 3300025935 Ga0207709_10110585 Ga0207709_101105852 328
511 3300025940 Ga0207691_10141471 Ga0207691_101414712 328
512 3300025940 Ga0207691_10142670 Ga0207691_101426702 328
513 3300025949 Ga0207667_10002796 Ga0207667_1000279620 328
514 3300025949 Ga0207667_10016584 Ga0207667_100165847 328
515 3300026075 Ga0207708_10244101 Ga0207708_102441012 328
516 3300026089 Ga0207648_10067457 Ga0207648_100674572 328
517 3300026121 Ga0207683_10053724 Ga0207683_100537244 328
518 3300029957 Ga0265324_10077431 Ga0265324_100774311 328
519 3300031344 Ga0265316_10158752 Ga0265316_101587522 328
520 3300031728 Ga0316578_10023142 Ga0316578_100231422 328
521 3300032002 Ga0307416_100403130 Ga0307416_1004031302 328
522 3300032133 Ga0316583_10012150 Ga0316583_100121502 328
523 3300035410 Ga0373924_0001388 Ga0373924_0001388_3741_4757 328
524 3300036647 Ga0316582_0013270 Ga0316582_0013270_2569_3591 328
525 3300037588 Ga0316581_0008234 Ga0316581_0008234_1109_2131 328
526 3300042876 Ga0451577_0101090 Ga0451577_0101090_1494_2495 328
527 3300044712 Ga0453684_0083116 Ga0453684_0083116_2285_3280 328
528 3300049571 Ga0501034_0007094 Ga0501034_0007094_3196_4215 328
529 3300049586 Ga0501070_0003078 Ga0501070_0003078_9030_10022 328
530 3300049586 Ga0501070_0238908 Ga0501070_0238908_251_1249 328
531 3300049589 Ga0501073_0003022 Ga0501073_0003022_6390_7382 328
532 3300049590 Ga0501074_0019604 Ga0501074_0019604_649_1641 328
533 3300049742 Ga0501080_0012613 Ga0501080_0012613_3373_4365 328
534 3300049744 Ga0501083_0038854 Ga0501083_0038854_1623_2615 328
535 3300050511 nmdc:mga08y16_16812_c1 nmdc:mga08y16_16812_c1_3106_4170 328
536 3300005327 Ga0070658_10030313 Ga0070658_100303135 329
537 3300005335 Ga0070666_10085437 Ga0070666_100854372 329
538 3300005340 Ga0070689_100001002 Ga0070689_10000100210 329
539 3300005353 Ga0070669_100057844 Ga0070669_1000578442 329
540 3300005354 Ga0070675_100046180 Ga0070675_1000461802 329
541 3300005364 Ga0070673_100049244 Ga0070673_1000492442 329
542 3300005466 Ga0070685_10083134 Ga0070685_100831342 329
543 3300005471 Ga0070698_100349640 Ga0070698_1003496401 329
544 3300005543 Ga0070672_100148264 Ga0070672_1001482642 329
545 3300005546 Ga0070696_100040502 Ga0070696_1000405024 329
546 3300005616 Ga0068852_100000484 Ga0068852_10000048422 329
547 3300005834 Ga0068851_10001115 Ga0068851_100011155 329
548 3300006175 Ga0070712_100341238 Ga0070712_1003412381 329
549 3300006358 Ga0068871_100032101 Ga0068871_1000321012 329
550 3300009093 Ga0105240_10065089 Ga0105240_100650892 329
551 3300009098 Ga0105245_10185882 Ga0105245_101858822 329
552 3300013296 Ga0157374_10073243 Ga0157374_100732432 329
553 3300014326 Ga0157380_10155386 Ga0157380_101553862 329
554 3300014968 Ga0157379_10061246 Ga0157379_100612462 329
555 3300025321 Ga0207656_10001284 Ga0207656_100012842 329
556 3300025906 Ga0207699_10129328 Ga0207699_101293282 329
557 3300025908 Ga0207643_10030908 Ga0207643_100309082 329
558 3300025909 Ga0207705_10023381 Ga0207705_100233813 329
559 3300025913 Ga0207695_10086080 Ga0207695_100860802 329
560 3300025922 Ga0207646_10224210 Ga0207646_102242102 329
561 3300025931 Ga0207644_10274214 Ga0207644_102742142 329
562 3300025940 Ga0207691_10008832 Ga0207691_100088323 329
563 3300025942 Ga0207689_10037778 Ga0207689_100377782 329
564 3300025945 Ga0207679_10230318 Ga0207679_102303181 329
565 3300026035 Ga0207703_10003975 Ga0207703_100039751 329
566 3300026075 Ga0207708_10140222 Ga0207708_101402222 329
567 3300026095 Ga0207676_10162995 Ga0207676_101629952 329
568 3300026116 Ga0207674_10056236 Ga0207674_100562364 329
569 3300031548 Ga0307408_100090527 Ga0307408_1000905272 329
570 3300032002 Ga0307416_100042082 Ga0307416_1000420822 329
571 3300036401 Ga0373937_0026857 Ga0373937_0026857_1544_2551 329
572 3300042001 Ga0439441_000342 Ga0439441_000342_1583_2587 329
573 3300044712 Ga0453684_0205026 Ga0453684_0205026_401_1408 329
574 3300045051 Ga0451576_0253546 Ga0451576_0253546_434_1435 329
575 3300046539 Ga0495621_0036395 Ga0495621_0036395_537_1571 329
576 3300046675 Ga0495657_0080708 Ga0495657_0080708_624_1631 329
577 3300048911 Ga0496108_0178322 Ga0496108_0178322_351_1349 329
578 3300050493 nmdc:mga0k408_38601_c1 nmdc:mga0k408_38601_c1_244_1245 329
579 iso_pu_bacteria 2734482258 2735817323 329
580 3300006846 Ga0075430_100009206 Ga0075430_1000092065 330
581 3300006847 Ga0075431_100000324 Ga0075431_10000032419 330
582 3300006880 Ga0075429_100040723 Ga0075429_1000407234 330
583 3300046516 Ga0495628_0012002 Ga0495628_0012002_3310_4335 330
584 3300047319 Ga0495674_0039453 Ga0495674_0039453_2240_3265 330
585 3300047320 Ga0495672_0005040 Ga0495672_0005040_2356_3381 330
586 3300047472 Ga0495686_0000014 Ga0495686_0000014_399465_400490 330
587 3300050508 nmdc:mga09592_30226_c1 nmdc:mga09592_30226_c1_2343_3347 330
588 3300050509 nmdc:mga0qj67_10467_c1 nmdc:mga0qj67_10467_c1_5269_6273 330
589 3300050510 nmdc:mga06r32_812_c1 nmdc:mga06r32_812_c1_23516_24520 330
590 3300005290 Ga0065712_10069020 Ga0065712_100690209 331
591 3300005328 Ga0070676_10031851 Ga0070676_100318512 331
592 3300005329 Ga0070683_100016822 Ga0070683_1000168223 331
593 3300005331 Ga0070670_100000420 Ga0070670_10000042025 331
594 3300005335 Ga0070666_10027648 Ga0070666_100276482 331
595 3300005338 Ga0068868_100000481 Ga0068868_10000048122 331
596 3300005344 Ga0070661_100085006 Ga0070661_1000850062 331
597 3300005354 Ga0070675_100011753 Ga0070675_1000117533 331
598 3300005355 Ga0070671_100000233 Ga0070671_10000023327 331
599 3300005356 Ga0070674_100009927 Ga0070674_1000099274 331
600 3300005364 Ga0070673_100034846 Ga0070673_1000348464 331
601 3300005367 Ga0070667_100441502 Ga0070667_1004415021 331
602 3300005456 Ga0070678_100006098 Ga0070678_1000060985 331
603 3300005543 Ga0070672_100001511 Ga0070672_1000015113 331
604 3300005564 Ga0070664_100008955 Ga0070664_1000089555 331
605 3300005578 Ga0068854_100013526 Ga0068854_1000135264 331
606 3300005616 Ga0068852_100004168 Ga0068852_1000041685 331
607 3300005618 Ga0068864_100005062 Ga0068864_1000050622 331
608 3300005841 Ga0068863_100012296 Ga0068863_1000122963 331
609 3300006237 Ga0097621_100002059 Ga0097621_10000205910 331
610 3300006358 Ga0068871_100005061 Ga0068871_1000050613 331
611 3300009148 Ga0105243_10196189 Ga0105243_101961892 331
612 3300009176 Ga0105242_10349857 Ga0105242_103498572 331
613 3300009177 Ga0105248_10005187 Ga0105248_1000518712 331
614 3300009177 Ga0105248_10076691 Ga0105248_100766912 331
615 3300009177 Ga0105248_10089123 Ga0105248_100891232 331
616 3300013296 Ga0157374_10172545 Ga0157374_101725452 331
617 3300013297 Ga0157378_10001901 Ga0157378_100019013 331
618 3300013306 Ga0163162_10203073 Ga0163162_102030732 331
619 3300013308 Ga0157375_10001103 Ga0157375_1000110320 331
620 3300014745 Ga0157377_10064112 Ga0157377_100641122 331
621 3300014969 Ga0157376_10020591 Ga0157376_100205913 331
622 3300025321 Ga0207656_10012445 Ga0207656_100124452 331
623 3300025903 Ga0207680_10029264 Ga0207680_100292642 331
624 3300025907 Ga0207645_10016689 Ga0207645_100166893 331
625 3300025931 Ga0207644_10018061 Ga0207644_100180612 331
626 3300025938 Ga0207704_10013921 Ga0207704_100139212 331
627 3300025940 Ga0207691_10000625 Ga0207691_100006252 331
628 3300025941 Ga0207711_10230884 Ga0207711_102308842 331
629 3300025945 Ga0207679_10006685 Ga0207679_100066853 331
630 3300025960 Ga0207651_10005150 Ga0207651_100051503 331
631 3300026023 Ga0207677_10005372 Ga0207677_100053723 331
632 3300026088 Ga0207641_10085529 Ga0207641_100855293 331
633 3300026121 Ga0207683_10000611 Ga0207683_100006113 331
634 3300026142 Ga0207698_10001809 Ga0207698_1000180910 331
635 3300027876 Ga0209974_10005799 Ga0209974_100057993 331
636 3300028800 Ga0265338_10000350 Ga0265338_1000035013 331
637 3300036401 Ga0373937_0040869 Ga0373937_0040869_977_1993 331
638 3300044712 Ga0453684_0243395 Ga0453684_0243395_380_1390 331
639 3300046529 Ga0495652_0225071 Ga0495652_0225071_162_1178 331
640 3300046543 Ga0495645_0001930 Ga0495645_0001930_8867_9883 331
641 3300046559 Ga0495667_0014114 Ga0495667_0014114_349_1365 331
642 3300046675 Ga0495657_0163068 Ga0495657_0163068_133_1149 331
643 3300046678 Ga0495599_0012523 Ga0495599_0012523_189_1205 331
644 3300046679 Ga0495623_0013457 Ga0495623_0013457_299_1315 331
645 3300047322 Ga0495680_0190935 Ga0495680_0190935_189_1205 331
646 3300048905 Ga0496102_0274038 Ga0496102_0274038_501_1505 331
647 3300048911 Ga0496108_0007533 Ga0496108_0007533_4101_5105 331
648 3300048913 Ga0496110_0000706 Ga0496110_0000706_17083_18087 331
649 3300003794 Ga0055531_10001635 Ga0055531_100016352 332
650 3300013308 Ga0157375_10276889 Ga0157375_102768892 332
651 3300014745 Ga0157377_10016731 Ga0157377_100167313 332
652 3300025303 Ga0209051_1000351 Ga0209051_10003512 332
653 3300025304 Ga0209257_1000015 Ga0209257_1000015244 332
654 3300035090 Ga0373949_0002756 Ga0373949_0002756_245_1252 332
655 3300044712 Ga0453684_0000005 Ga0453684_0000005_1332000_1333007 332
656 3300030745 Ga0316182_1006065 Ga0316182_10060652 333
657 3300045051 Ga0451576_0160305 Ga0451576_0160305_66_1094 333
658 3300049742 Ga0501080_0004879 Ga0501080_0004879_5593_6639 333
659 3300049824 Ga0501045_0242669 Ga0501045_0242669_280_1287 333
660 3300005985 Ga0081539_10016258 Ga0081539_100162585 334
661 3300009094 Ga0111539_10060748 Ga0111539_100607482 334
662 3300045051 Ga0451576_0318573 Ga0451576_0318573_507_1547 334
663 3300050511 nmdc:mga08y16_88346_c1 nmdc:mga08y16_88346_c1_862_1875 334
664 3300053125 Ga0500618_016401 Ga0500618_016401_330_1469 334
665 3300005295 Ga0065707_10142323 Ga0065707_101423232 335
666 3300005367 Ga0070667_100401430 Ga0070667_1004014301 335
667 3300005543 Ga0070672_100018915 Ga0070672_1000189152 335
668 3300005844 Ga0068862_100025277 Ga0068862_1000252773 335
669 3300005844 Ga0068862_100098802 Ga0068862_1000988022 335
670 3300005937 Ga0081455_10083505 Ga0081455_100835052 335
671 3300006881 Ga0068865_100002021 Ga0068865_1000020217 335
672 3300009148 Ga0105243_10052189 Ga0105243_100521891 335
673 3300009553 Ga0105249_10426249 Ga0105249_104262491 335
674 3300011119 Ga0105246_10316737 Ga0105246_103167371 335
675 3300025909 Ga0207705_10161331 Ga0207705_101613311 335
676 3300025935 Ga0207709_10181419 Ga0207709_101814191 335
677 3300025940 Ga0207691_10081441 Ga0207691_100814412 335
678 3300025986 Ga0207658_10051643 Ga0207658_100516433 335
679 3300026067 Ga0207678_10073392 Ga0207678_100733922 335
680 3300026089 Ga0207648_10026807 Ga0207648_100268071 335
681 3300028380 Ga0268265_10001580 Ga0268265_100015807 335
682 3300028380 Ga0268265_10054256 Ga0268265_100542561 335
683 3300028380 Ga0268265_10149146 Ga0268265_101491462 335
684 3300028381 Ga0268264_10000909 Ga0268264_1000090914 335
685 3300028794 Ga0307515_10000058 Ga0307515_10000058163 335
686 3300028794 Ga0307515_10001320 Ga0307515_1000132036 335
687 3300042876 Ga0451577_0095475 Ga0451577_0095475_1316_2368 335
688 3300042876 Ga0451577_0220298 Ga0451577_0220298_14_1087 335
689 3300045051 Ga0451576_0016403 Ga0451576_0016403_1595_2668 335
690 3300049587 Ga0501071_0070335 Ga0501071_0070335_1332_2387 335
691 3300049590 Ga0501074_0046248 Ga0501074_0046248_1213_2268 335
692 3300049591 Ga0501075_0000411 Ga0501075_0000411_8571_9626 335
693 3300049741 Ga0501079_0002789 Ga0501079_0002789_4079_5134 335
694 3300049822 Ga0501035_0097495 Ga0501035_0097495_837_1892 335
695 3300060353 Ga0501082_0026242 Ga0501082_0026242_2714_3769 335
696 iso_pu_bacteria 2904434214 2904435295 335
697 3300009036 Ga0105244_10006962 Ga0105244_100069626 336
698 3300009148 Ga0105243_10003372 Ga0105243_100033722 336
699 3300011119 Ga0105246_10005048 Ga0105246_100050485 336
700 3300013104 Ga0157370_10009801 Ga0157370_100098015 336
701 3300014497 Ga0182008_10002687 Ga0182008_100026878 336
702 3300014497 Ga0182008_10015230 Ga0182008_100152303 336
703 3300015261 Ga0182006_1007705 Ga0182006_10077053 336
704 3300015262 Ga0182007_10001351 Ga0182007_100013518 336
705 3300046453 Ga0495627_007760 Ga0495627_007760_436_1566 336
706 3300046674 Ga0495588_0041360 Ga0495588_0041360_962_2032 336
707 3300048919 Ga0496116_0021075 Ga0496116_0021075_3302_4372 336
708 3300048920 Ga0496117_0008098 Ga0496117_0008098_2640_3710 336
709 3300048921 Ga0496118_0029901 Ga0496118_0029901_2512_3582 336
710 3300048924 Ga0496121_0089624 Ga0496121_0089624_1093_2163 336
711 3300048928 Ga0496125_0034504 Ga0496125_0034504_1272_2342 336
712 3300048928 Ga0496125_0058511 Ga0496125_0058511_643_1773 336
713 3300005547 Ga0070693_100065905 Ga0070693_1000659052 337
714 3300005614 Ga0068856_100038071 Ga0068856_1000380712 337
715 3300009174 Ga0105241_10010806 Ga0105241_100108064 337
716 3300009551 Ga0105238_10004061 Ga0105238_100040615 337
717 3300010375 Ga0105239_10504717 Ga0105239_105047171 337
718 3300013102 Ga0157371_10068354 Ga0157371_100683541 337
719 3300013105 Ga0157369_10048969 Ga0157369_100489694 337
720 3300013307 Ga0157372_10066547 Ga0157372_100665473 337
721 3300025912 Ga0207707_10252201 Ga0207707_102522012 337
722 3300025924 Ga0207694_10082862 Ga0207694_100828622 337
723 3300026142 Ga0207698_10237043 Ga0207698_102370432 337
724 3300041997 Ga0439431_0001324 Ga0439431_0001324_2100_3182 337
725 3300042156 Ga0439446_0030557 Ga0439446_0030557_294_1376 337
726 3300049742 Ga0501080_0298218 Ga0501080_0298218_29_1069 337
727 3300053121 Ga0500607_023878 Ga0500607_023878_607_1704 337
728 3300006186 Ga0075369_10001702 Ga0075369_100017028 338
729 3300006195 Ga0075366_10017190 Ga0075366_100171903 338
730 3300013306 Ga0163162_10032414 Ga0163162_100324142 338
731 3300014969 Ga0157376_10199412 Ga0157376_101994122 338
732 3300017792 Ga0163161_10162583 Ga0163161_101625832 338
733 3300025941 Ga0207711_10146325 Ga0207711_101463252 338
734 3300027614 Ga0209970_1003460 Ga0209970_10034603 338
735 3300042876 Ga0451577_0008793 Ga0451577_0008793_6891_7934 338
736 3300042876 Ga0451577_0037209 Ga0451577_0037209_2120_3163 338
737 3300042876 Ga0451577_0136974 Ga0451577_0136974_815_1900 338
738 3300044712 Ga0453684_0023470 Ga0453684_0023470_5040_6125 338
739 3300045051 Ga0451576_0002877 Ga0451576_0002877_8575_9618 338
740 3300045051 Ga0451576_0010170 Ga0451576_0010170_6573_7658 338
741 3300049571 Ga0501034_0047636 Ga0501034_0047636_956_2047 338
742 3300049581 Ga0501047_0025433 Ga0501047_0025433_737_1780 338
743 3300049585 Ga0501069_0000942 Ga0501069_0000942_6773_7816 338
744 3300049586 Ga0501070_0014380 Ga0501070_0014380_3813_4856 338
745 3300049589 Ga0501073_0005339 Ga0501073_0005339_3412_4455 338
746 3300049590 Ga0501074_0005970 Ga0501074_0005970_6075_7118 338
747 3300049741 Ga0501079_0006549 Ga0501079_0006549_1638_2681 338
748 3300049744 Ga0501083_0012662 Ga0501083_0012662_1210_2253 338
749 3300049822 Ga0501035_0212421 Ga0501035_0212421_33_1076 338
750 3300049823 Ga0501044_0175921 Ga0501044_0175921_228_1271 338
751 3300060353 Ga0501082_0065813 Ga0501082_0065813_1242_2285 338
752 iso_pu_bacteria 2842677519 2842678124 338
753 iso_pu_bacteria 2885192300 2885193608 338
754 iso_pu_bacteria 2904449895 2904451306 338
755 iso_pu_bacteria 2904456579 2904458168 338
756 iso_pu_bacteria 2919462493 2919466707 338
757 iso_pu_bacteria 2929520902 2929526217 338
758 iso_pu_bacteria 2945972063 2945974600 338
759 3300005459 Ga0068867_100051793 Ga0068867_1000517932 339
760 3300026089 Ga0207648_10063517 Ga0207648_100635172 339
761 3300028379 Ga0268266_10255986 Ga0268266_102559862 339
762 3300041498 Ga0451841_0312808 Ga0451841_0312808_54_1133 339
763 iso_pu_bacteria 2513020051 2513229902 339
764 iso_pu_bacteria 2643221658 2644327228 339
765 iso_pu_bacteria 2643221672 2644399586 339
766 iso_pu_bacteria 2738541277 2738721671 339
767 iso_pu_bacteria 2738541307 2738883525 339
768 iso_pu_bacteria 2738543019 2739282035 339
769 iso_pu_bacteria 2885198086 2885204102 339
770 iso_pu_bacteria 2885211737 2885217564 339
771 iso_pu_bacteria 2928084124 2928085424 339
772 iso_pu_bacteria 2945909444 2945915203 339
773 iso_pu_bacteria 2954767861 2954769808 339
774 3300005548 Ga0070665_100021204 Ga0070665_1000212042 340
775 3300006914 Ga0075436_100014968 Ga0075436_1000149682 340
776 3300007076 Ga0075435_100073655 Ga0075435_1000736552 340
777 3300028379 Ga0268266_10038502 Ga0268266_100385022 340
778 3300050512 nmdc:mga0n895_121741_c1 nmdc:mga0n895_121741_c1_854_1930 340
779 3300050514 nmdc:mga08x19_3510_c1 nmdc:mga08x19_3510_c1_1823_2902 340
780 3300005842 Ga0068858_100244528 Ga0068858_1002445282 341
781 3300006178 Ga0075367_10027731 Ga0075367_100277312 341
782 3300014969 Ga0157376_10251591 Ga0157376_102515911 341
783 3300017792 Ga0163161_10004590 Ga0163161_100045902 341
784 3300031731 Ga0307405_10186056 Ga0307405_101860561 341
785 3300031901 Ga0307406_10299273 Ga0307406_102992731 341
786 3300031911 Ga0307412_10026388 Ga0307412_100263882 341
787 3300045051 Ga0451576_0003213 Ga0451576_0003213_6830_7927 341
788 3300046459 Ga0495629_0085607 Ga0495629_0085607_341_1435 341
789 3300046475 Ga0495639_0005541 Ga0495639_0005541_1509_2603 341
790 3300048903 Ga0496100_0102754 Ga0496100_0102754_686_1780 341
791 3300048904 Ga0496101_0001900 Ga0496101_0001900_4647_5741 341
792 3300048905 Ga0496102_0004231 Ga0496102_0004231_6215_7309 341
793 3300048907 Ga0496104_0002663 Ga0496104_0002663_7849_8943 341
794 3300048908 Ga0496105_0001549 Ga0496105_0001549_12992_14086 341
795 3300048909 Ga0496106_0034566 Ga0496106_0034566_2602_3696 341
796 3300048910 Ga0496107_0043853 Ga0496107_0043853_1568_2662 341
797 3300048912 Ga0496109_0054988 Ga0496109_0054988_2413_3507 341
798 3300048914 Ga0496111_0063090 Ga0496111_0063090_1222_2316 341
799 3300048915 Ga0496112_0270186 Ga0496112_0270186_291_1385 341
800 3300001979 JGI24740J21852_10005758 JGI24740J21852_100057585 342
801 3300003792 Ga0055540_1001942 Ga0055540_10019427 342
802 3300005456 Ga0070678_100043183 Ga0070678_1000431833 342
803 3300005543 Ga0070672_100070674 Ga0070672_1000706742 342
804 3300005577 Ga0068857_100073964 Ga0068857_1000739642 342
805 3300006048 Ga0075363_100012669 Ga0075363_1000126692 342
806 3300006051 Ga0075364_10034245 Ga0075364_100342452 342
807 3300006058 Ga0075432_10011661 Ga0075432_100116612 342
808 3300006177 Ga0075362_10009361 Ga0075362_100093613 342
809 3300006177 Ga0075362_10030280 Ga0075362_100302802 342
810 3300006186 Ga0075369_10024886 Ga0075369_100248862 342
811 3300006353 Ga0075370_10027737 Ga0075370_100277371 342
812 3300013306 Ga0163162_10006818 Ga0163162_100068187 342
813 3300014497 Ga0182008_10002165 Ga0182008_100021652 342
814 3300014497 Ga0182008_10014557 Ga0182008_100145572 342
815 3300015261 Ga0182006_1016938 Ga0182006_10169382 342
816 3300015262 Ga0182007_10001176 Ga0182007_1000117610 342
817 3300015683 Ga0183362_10004 Ga0183362_10004226 342
818 3300017792 Ga0163161_10001684 Ga0163161_1000168411 342
819 3300017792 Ga0163161_10032713 Ga0163161_100327132 342
820 3300025303 Ga0209051_1000227 Ga0209051_100022729 342
821 3300025933 Ga0207706_10275578 Ga0207706_102755782 342
822 3300026116 Ga0207674_10097405 Ga0207674_100974052 342
823 3300026121 Ga0207683_10056794 Ga0207683_100567943 342
824 3300028794 Ga0307515_10000468 Ga0307515_1000046816 342
825 3300030733 Ga0314311_1019906 Ga0314311_10199062 342
826 3300031238 Ga0265332_10000006 Ga0265332_100000068 342
827 3300031251 Ga0265327_10013789 Ga0265327_100137893 342
828 3300031901 Ga0307406_10002313 Ga0307406_100023133 342
829 3300031911 Ga0307412_10196884 Ga0307412_101968841 342
830 3300032002 Ga0307416_100126191 Ga0307416_1001261913 342
831 3300032002 Ga0307416_100201197 Ga0307416_1002011972 342
832 3300041406 Ga0439439_0006043 Ga0439439_0006043_1390_2484 342
833 3300041410 Ga0439461_0018591 Ga0439461_0018591_177_1271 342
834 3300041411 Ga0439466_0008421 Ga0439466_0008421_1202_2296 342
835 3300041411 Ga0439466_0016927 Ga0439466_0016927_1116_2210 342
836 3300041411 Ga0439466_0018100 Ga0439466_0018100_783_1877 342
837 3300041413 Ga0439465_0005112 Ga0439465_0005112_2247_3341 342
838 3300041997 Ga0439431_0008028 Ga0439431_0008028_1086_2180 342
839 3300041997 Ga0439431_0009507 Ga0439431_0009507_245_1339 342
840 3300041999 Ga0439433_0000088 Ga0439433_0000088_8897_9991 342
841 3300041999 Ga0439433_0001045 Ga0439433_0001045_4446_5540 342
842 3300042002 Ga0439442_000991 Ga0439442_000991_4110_5204 342
843 3300042002 Ga0439442_002915 Ga0439442_002915_1286_2380 342
844 3300042002 Ga0439442_005941 Ga0439442_005941_311_1405 342
845 3300042004 Ga0439445_0000038 Ga0439445_0000038_7180_8274 342
846 3300042006 Ga0439432_004611 Ga0439432_004611_35_1129 342
847 3300042007 Ga0439449_0000654 Ga0439449_0000654_5900_6994 342
848 3300042007 Ga0439449_0001890 Ga0439449_0001890_1399_2493 342
849 3300042007 Ga0439449_0001985 Ga0439449_0001985_3225_4319 342
850 3300042010 Ga0439452_003838 Ga0439452_003838_729_1823 342
851 3300042010 Ga0439452_005074 Ga0439452_005074_31_1125 342
852 3300042014 Ga0439457_002262 Ga0439457_002262_269_1363 342
853 3300042015 Ga0439462_0001430 Ga0439462_0001430_2868_3962 342
854 3300042121 Ga0450919_002040 Ga0450919_002040_622_1716 342
855 3300042122 Ga0450920_005881 Ga0450920_005881_1044_2138 342
856 3300042125 Ga0450923_000082 Ga0450923_000082_5733_6827 342
857 3300042145 Ga0450906_004114 Ga0450906_004114_612_1706 342
858 3300042145 Ga0450906_005854 Ga0450906_005854_311_1405 342
859 3300042156 Ga0439446_0006771 Ga0439446_0006771_576_1670 342
860 3300042184 Ga0450908_000361 Ga0450908_000361_364_1458 342
861 3300042185 Ga0450909_004127 Ga0450909_004127_35_1129 342
862 3300042435 Ga0439434_0003215 Ga0439434_0003215_965_2059 342
863 3300042531 Ga0450918_001007 Ga0450918_001007_3617_4711 342
864 3300044683 Ga0466965_0008451 Ga0466965_0008451_2576_3670 342
865 3300044901 Ga0466960_0031324 Ga0466960_0031324_1177_2271 342
866 3300046543 Ga0495645_0138284 Ga0495645_0138284_394_1491 342
867 3300046615 Ga0495656_0001092 Ga0495656_0001092_4620_5714 342
868 3300046660 Ga0495625_0000114 Ga0495625_0000114_112042_113136 342
869 3300046689 Ga0495613_0226815 Ga0495613_0226815_168_1265 342
870 3300048913 Ga0496110_0097087 Ga0496110_0097087_876_1973 342
871 3300049679 Ga0501249_004119 Ga0501249_004119_1278_2372 342
872 3300050490 nmdc:mga03n38_2559_c1 nmdc:mga03n38_2559_c1_4476_5570 342
873 3300050491 nmdc:mga00v17_73454_c1 nmdc:mga00v17_73454_c1_354_1448 342
874 3300050492 nmdc:mga0yw44_66932_c1 nmdc:mga0yw44_66932_c1_256_1350 342
875 3300050493 nmdc:mga0k408_27742_c1 nmdc:mga0k408_27742_c1_1272_2366 342
876 3300050493 nmdc:mga0k408_51893_c1 nmdc:mga0k408_51893_c1_198_1292 342
877 3300050496 nmdc:mga07m45_162435_c1 nmdc:mga07m45_162435_c1_116_1252 342
878 3300053136 Ga0500559_0002136 Ga0500559_0002136_2829_3917 342
879 iso_pu_bacteria 2721755763 2723876406 342
880 iso_pu_bacteria 2939631187 2939634704 342
881 3300002773 JGI25152J39213_1005420 JGI25152J39213_10054203 343
882 3300002987 JGI25159J45721_1011185 JGI25159J45721_10111852 343
883 3300003771 Ga0055526_1005405 Ga0055526_10054055 343
884 3300003773 Ga0055537_1000341 Ga0055537_10003413 343
885 3300003781 Ga0055536_1002361 Ga0055536_10023611 343
886 3300003781 Ga0055536_1002834 Ga0055536_10028342 343
887 3300003784 Ga0055534_1000320 Ga0055534_10003203 343
888 3300003790 Ga0055528_1002843 Ga0055528_10028433 343
889 3300003790 Ga0055528_1004744 Ga0055528_10047444 343
890 3300003791 Ga0055530_10026300 Ga0055530_100263001 343
891 3300003792 Ga0055540_1001647 Ga0055540_10016476 343
892 3300003792 Ga0055540_1001867 Ga0055540_10018678 343
893 3300003794 Ga0055531_10002896 Ga0055531_100028962 343
894 3300005288 Ga0065714_10005802 Ga0065714_100058022 343
895 3300005457 Ga0070662_100005005 Ga0070662_1000050058 343
896 3300005548 Ga0070665_100146290 Ga0070665_1001462903 343
897 3300005564 Ga0070664_100153629 Ga0070664_1001536292 343
898 3300005577 Ga0068857_100151436 Ga0068857_1001514362 343
899 3300006948 Ga0099826_10031839 Ga0099826_100318393 343
900 3300009148 Ga0105243_10002206 Ga0105243_100022068 343
901 3300013297 Ga0157378_10008040 Ga0157378_100080405 343
902 3300014497 Ga0182008_10000260 Ga0182008_1000026029 343
903 3300017792 Ga0163161_10004016 Ga0163161_100040165 343
904 3300025263 Ga0209565_1000283 Ga0209565_10002833 343
905 3300025273 Ga0209673_1000136 Ga0209673_1000136122 343
906 3300025273 Ga0209673_1016929 Ga0209673_10169292 343
907 3300025291 Ga0209675_1000071 Ga0209675_1000071122 343
908 3300025292 Ga0209676_1000643 Ga0209676_100064315 343
909 3300025292 Ga0209676_1000659 Ga0209676_100065916 343
910 3300025298 Ga0209050_1000945 Ga0209050_100094514 343
911 3300025303 Ga0209051_1000180 Ga0209051_100018028 343
912 3300025303 Ga0209051_1000513 Ga0209051_100051323 343
913 3300025304 Ga0209257_1001106 Ga0209257_100110625 343
914 3300025304 Ga0209257_1004691 Ga0209257_10046913 343
915 3300025728 Ga0207655_1002301 Ga0207655_100230113 343
916 3300025933 Ga0207706_10036312 Ga0207706_100363122 343
917 3300025935 Ga0207709_10000436 Ga0207709_1000043631 343
918 3300025935 Ga0207709_10000534 Ga0207709_1000053418 343
919 3300025945 Ga0207679_10107408 Ga0207679_101074082 343
920 3300026116 Ga0207674_10048165 Ga0207674_100481654 343
921 3300027666 Ga0209282_1000795 Ga0209282_10007954 343
922 3300031238 Ga0265332_10015105 Ga0265332_100151053 343
923 3300031711 Ga0265314_10000481 Ga0265314_1000048130 343
924 3300031731 Ga0307405_10032286 Ga0307405_100322863 343
925 3300032005 Ga0307411_10002662 Ga0307411_100026622 343
926 3300046460 Ga0495638_0023942 Ga0495638_0023942_1421_2518 343
927 3300046513 Ga0495616_0002565 Ga0495616_0002565_6703_7800 343
928 3300046518 Ga0495631_0001040 Ga0495631_0001040_11639_12736 343
929 3300046557 Ga0495622_0023983 Ga0495622_0023983_1229_2326 343
930 3300046616 Ga0495668_0006944 Ga0495668_0006944_875_1972 343
931 3300046691 Ga0495670_0056757 Ga0495670_0056757_546_1643 343
932 3300047673 Ga0495593_0008132 Ga0495593_0008132_1037_2134 343
933 3300048088 Ga0495602_0185750 Ga0495602_0185750_484_1581 343
934 3300048089 Ga0495614_0003394 Ga0495614_0003394_1458_2555 343
935 3300048926 Ga0496123_0073392 Ga0496123_0073392_186_1283 343
936 3300053110 Ga0500571_000098 Ga0500571_000098_20493_21590 343
937 3300053118 Ga0500594_0000650 Ga0500594_0000650_1937_3034 343
938 3300053136 Ga0500559_0028570 Ga0500559_0028570_326_1423 343
939 3300053151 Ga0500604_0053702 Ga0500604_0053702_116_1213 343
940 3300053153 Ga0500616_0014630 Ga0500616_0014630_2026_3123 343
941 3300003761 Ga0055535_1000759 Ga0055535_100075916 344
942 3300044666 Ga0466977_0004540 Ga0466977_0004540_2148_3233 344
943 iso_pu_bacteria 2596583598 2597030777 349
944 iso_pu_bacteria 2599185178 2599447007 349
945 iso_pu_bacteria 2885266251 2885268945 349
946 iso_pu_bacteria 2900577576 2900582293 349
947 iso_pu_bacteria 2928058823 2928061291 349
948 3300001979 JGI24740J21852_10000394 JGI24740J21852_100003945 352
949 3300002738 JGI25154J39366_1000650 JGI25154J39366_10006505 352
950 3300003841 Ga0055541_1000379 Ga0055541_100037911 352
951 3300025224 Ga0209784_100595 Ga0209784_1005959 352
952 3300025225 Ga0209566_100430 Ga0209566_10043012 352
953 3300025225 Ga0209566_100569 Ga0209566_10056912 352
954 3300025226 Ga0209674_100248 Ga0209674_10024821 352
955 3300025230 Ga0209563_104187 Ga0209563_1041872 352
956 3300025246 Ga0209646_1000055 Ga0209646_1000055258 352
957 3300025253 Ga0209677_102421 Ga0209677_1024213 352
958 3300025254 Ga0209148_1000109 Ga0209148_100010946 352
959 3300001915 JGI24741J21665_1000490 JGI24741J21665_100049010 353
960 3300001979 JGI24740J21852_10000170 JGI24740J21852_1000017014 353
961 3300003752 Ga0055539_1000230 Ga0055539_100023016 353
962 3300003752 Ga0055539_1000294 Ga0055539_100029416 353
963 3300003756 Ga0055533_1005484 Ga0055533_10054843 353
964 3300003758 Ga0055532_1000006 Ga0055532_1000006118 353
965 3300003759 Ga0055525_1000414 Ga0055525_10004148 353
966 3300003761 Ga0055535_1000004 Ga0055535_1000004118 353
967 3300003763 Ga0055529_1000022 Ga0055529_1000022203 353
968 3300005344 Ga0070661_100000012 Ga0070661_100000012151 353
969 3300005366 Ga0070659_100001485 Ga0070659_10000148510 353
970 3300005455 Ga0070663_100000020 Ga0070663_1000000209 353
971 3300005564 Ga0070664_100000003 Ga0070664_100000003203 353
972 3300005577 Ga0068857_100061974 Ga0068857_1000619742 353
973 3300005578 Ga0068854_100000063 Ga0068854_1000000634 353
974 3300005614 Ga0068856_100000011 Ga0068856_100000011120 353
975 3300009093 Ga0105240_10098276 Ga0105240_100982761 353
976 3300013100 Ga0157373_10004380 Ga0157373_100043804 353
977 3300013102 Ga0157371_10000083 Ga0157371_10000083119 353
978 3300013104 Ga0157370_10000141 Ga0157370_1000014159 353
979 3300013105 Ga0157369_10003851 Ga0157369_1000385111 353
980 3300013307 Ga0157372_10000775 Ga0157372_1000077516 353
981 3300014497 Ga0182008_10072392 Ga0182008_100723922 353
982 3300015261 Ga0182006_1003724 Ga0182006_10037245 353
983 3300015261 Ga0182006_1005768 Ga0182006_10057682 353
984 3300020070 Ga0206356_10375286 Ga0206356_103752862 353
985 3300020077 Ga0206351_10502756 Ga0206351_105027565 353
986 3300020610 Ga0154015_1372279 Ga0154015_137227914 353
987 3300025224 Ga0209784_100150 Ga0209784_10015032 353
988 3300025224 Ga0209784_100554 Ga0209784_1005548 353
989 3300025225 Ga0209566_100002 Ga0209566_100002952 353
990 3300025226 Ga0209674_100010 Ga0209674_100010186 353
991 3300025226 Ga0209674_100050 Ga0209674_100050121 353
992 3300025228 Ga0209672_100218 Ga0209672_10021821 353
993 3300025229 Ga0209147_100015 Ga0209147_100015425 353
994 3300025230 Ga0209563_100004 Ga0209563_100004363 353
995 3300025230 Ga0209563_100026 Ga0209563_100026386 353
996 3300025242 Ga0209258_100021 Ga0209258_100021425 353
997 3300025253 Ga0209677_100007 Ga0209677_100007951 353
998 3300025272 Ga0209455_1000028 Ga0209455_1000028425 353
999 3300025913 Ga0207695_10004143 Ga0207695_1000414319 353
1000 3300025920 Ga0207649_10000302 Ga0207649_1000030225 353
1001 3300025932 Ga0207690_10001630 Ga0207690_100016304 353
1002 3300025945 Ga0207679_10000007 Ga0207679_1000000716 353
1003 3300025981 Ga0207640_10000224 Ga0207640_1000022436 353
1004 3300026067 Ga0207678_10000030 Ga0207678_100000309 353
1005 3300026078 Ga0207702_10000054 Ga0207702_1000005443 353
1006 3300026116 Ga0207674_10026678 Ga0207674_100266785 353
1007 3300037312 Ga0395899_0169538 Ga0395899_0169538_109_1170 353
1008 3300037418 Ga0395900_0169363 Ga0395900_0169363_355_1416 353
1009 3300044658 Ga0466972_0006017 Ga0466972_0006017_193_1254 353
1010 3300044683 Ga0466965_0005919 Ga0466965_0005919_823_1884 353
1011 3300044693 Ga0466961_0000499 Ga0466961_0000499_15740_16801 353
1012 3300044706 Ga0466964_0005193 Ga0466964_0005193_3632_4693 353
1013 3300044735 Ga0466968_0011804 Ga0466968_0011804_1880_2941 353
1014 3300044842 Ga0466957_0032413 Ga0466957_0032413_193_1254 353
1015 3300045976 Ga0466967_0003717 Ga0466967_0003717_1020_2081 353
1016 3300061719 Ga0466962_0002885 Ga0466962_0002885_3501_4562 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

92

328

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3csv-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (yp_614837.1) from silicibacter sp. tm1040 at 2.15 a resolution 0.8818 15 342
3csv-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (yp_614837.1) from silicibacter sp. tm1040 at 2.15 a resolution 0.8409 15 342
8agy-assembly1.cif.gz_A the corramycin phosphotransferase in complex with corramycin 0.7325 19 348
8ahd-assembly1.cif.gz_A the apo structure of the corramycin phosphotransferase 0.7024 19 348
8agy-assembly1.cif.gz_A the corramycin phosphotransferase in complex with corramycin 0.6968 19 348
ID Description Score Start End Superfamily
3csvA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8635 106 342 3.90.1200.10
3csvA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8131 106 342 3.90.1200.10
3csvA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8041 15 105 3.30.200.20
1j7lA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8009 37 104 3.30.200.20
3csvA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7859 15 105 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A349LNE9-F1-model_v4 Aminoglycoside phosphotransferase 0.9877 105 341 GO:0005524
GO:0016740
AF-A0A522KAK5-F1-model_v4 deleted 0.9845 128 343
AF-A0A847DSW8-F1-model_v4 Phosphotransferase 0.9799 13 344 GO:0005524
GO:0016740
AF-W9T8M1-F1-model_v4 Aminoglycoside phosphotransferase 0.9759 86 341 GO:0005524
GO:0016740
AF-A0A7Y8M745-F1-model_v4 Phosphotransferase 0.9751 14 318 GO:0005524
GO:0016740

Feature Viewer

pLDDT pTM Quality
92.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map