F488275
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1016 | 483 | 986 | 341 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2721755763|2723876406 |
| Length | 404 |
| Sequence | RQPGRHLQAAKFASDTVWAGTGEAVGRVREVGCLENIIGYYMARRFHPHIMTALPATATPDPLAQAHAEARQAALEHWLAEVKAPFALDLATVAPASVDASFRRYFRVASASPAHPTLIVMDAPPPQEDCRPFVHVSGLLHEAGLNSPRILAQDLTQGFLLLSDLGRSTYLDVLDEHNATRLYRAAFDALIAWQLASRPGQLPPYDKALLQRELDLFPTWYIERHLNMALSPSQQEVLAQTNTLLIDSALAQPQVYVHRDYMPRNLMVSEPNPGILDFQDAVYGPLTYDVISLLRDAFISWEEDLQLDWLIHYWENAKRAGLPVRQDFGEFYQECEWMGLQRHLKVLGIFARIQYRDGKPRYLADTPRFLQYAHKVAARYRPLHPLARLLDTLDGKSAAVGYTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 3 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 4 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 5 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 6 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 7 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 8 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 9 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 10 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 11 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 14 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 15 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 16 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 17 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 18 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 19 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 20 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 21 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 22 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 23 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 24 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 25 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 26 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 27 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 28 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 29 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 30 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 31 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 34 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 35 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 54 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 90 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 109 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 110 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 111 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 113 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 114 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 115 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 118 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 119 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 120 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 121 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 122 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 123 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 124 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 126 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 127 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 128 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 132 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 133 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 134 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 135 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 137 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 138 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 139 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 140 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 141 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 142 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 143 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 144 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 147 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 148 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 149 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 174 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 269 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 272 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 276 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 278 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 279 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 280 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 281 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 282 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 283 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 284 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 286 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 287 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 288 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 289 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 292 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 295 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 301 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 308 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 309 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 310 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 311 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 313 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 316 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 317 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 318 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 319 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 320 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 321 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 322 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 323 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 324 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 325 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 326 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 327 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 328 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 329 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 330 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 331 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 332 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 333 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 334 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 335 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 336 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 337 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 338 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 339 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 340 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 341 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 342 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 343 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 344 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 345 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 346 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 347 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 348 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 349 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 350 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 351 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 352 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 353 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 354 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 355 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 423 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 446 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 468 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 471 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 472 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 475 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 476 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 480 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 483 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.75 |
| Metatranscriptomes | 0.3 |
| Isolates | 2.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.56 |
| Nodule | 0.3 |
| Rhizoplane | 1.77 |
| Rhizosphere | 86.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000490 | 3300001915 | Bacteria | 12087 |
| 2 | JGI24740J21852_10000170 | 3300001979 | Bacteria | 26025 |
| 3 | JGI24740J21852_10000394 | 3300001979 | Bacteria | 18727 |
| 4 | JGI24740J21852_10005758 | 3300001979 | Bacteria | 5208 |
| 5 | JGI25154J39366_1000650 | 3300002738 | Bacteria | 16227 |
| 6 | JGI25152J39213_1005420 | 3300002773 | Bacteria | 3725 |
| 7 | JGI25159J45721_1011185 | 3300002987 | Bacteria | 2221 |
| 8 | JGI25406J46586_10046803 | 3300003203 | Bacteria | 1479 |
| 9 | Ga0055539_1000230 | 3300003752 | Bacteria | 39333 |
| 10 | Ga0055539_1000294 | 3300003752 | Bacteria | 27517 |
| 11 | Ga0055533_1005484 | 3300003756 | Bacteria | 2026 |
| 12 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 13 | Ga0055525_1000414 | 3300003759 | Bacteria | 26035 |
| 14 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 15 | Ga0055535_1000759 | 3300003761 | Bacteria | 23986 |
| 16 | Ga0055529_1000022 | 3300003763 | Bacteria | 320108 |
| 17 | Ga0055526_1005405 | 3300003771 | Bacteria | 7351 |
| 18 | Ga0055537_1000341 | 3300003773 | Bacteria | 31907 |
| 19 | Ga0055536_1002361 | 3300003781 | Bacteria | 10677 |
| 20 | Ga0055536_1002834 | 3300003781 | Bacteria | 9551 |
| 21 | Ga0055534_1000320 | 3300003784 | Bacteria | 31907 |
| 22 | Ga0055528_1002843 | 3300003790 | Bacteria | 9039 |
| 23 | Ga0055528_1004744 | 3300003790 | Bacteria | 6481 |
| 24 | Ga0055530_10026300 | 3300003791 | Bacteria | 1610 |
| 25 | Ga0055540_1001647 | 3300003792 | Bacteria | 12967 |
| 26 | Ga0055540_1001867 | 3300003792 | Bacteria | 11840 |
| 27 | Ga0055540_1001942 | 3300003792 | Bacteria | 11567 |
| 28 | Ga0055531_10001635 | 3300003794 | Bacteria | 16229 |
| 29 | Ga0055531_10002896 | 3300003794 | Bacteria | 11173 |
| 30 | Ga0055541_1000379 | 3300003841 | Bacteria | 13551 |
| 31 | Ga0065714_10005802 | 3300005288 | Bacteria | 6247 |
| 32 | Ga0065712_10069020 | 3300005290 | Bacteria | 8254 |
| 33 | Ga0065712_10118833 | 3300005290 | Bacteria | 1701 |
| 34 | Ga0065715_10221518 | 3300005293 | Bacteria | 1256 |
| 35 | Ga0065707_10142323 | 3300005295 | Bacteria | 1757 |
| 36 | Ga0070658_10030313 | 3300005327 | Bacteria | 4346 |
| 37 | Ga0070676_10000313 | 3300005328 | Bacteria | 21908 |
| 38 | Ga0070676_10031851 | 3300005328 | Bacteria | 3017 |
| 39 | Ga0070683_100016822 | 3300005329 | Bacteria | 6453 |
| 40 | Ga0070683_100030891 | 3300005329 | Bacteria | 4867 |
| 41 | Ga0070683_100093865 | 3300005329 | Bacteria | 2820 |
| 42 | Ga0070690_100002693 | 3300005330 | Bacteria | 9580 |
| 43 | Ga0070670_100000420 | 3300005331 | Bacteria | 34942 |
| 44 | Ga0070677_10003289 | 3300005333 | Bacteria | 5204 |
| 45 | Ga0068869_100002298 | 3300005334 | Bacteria | 11499 |
| 46 | Ga0068869_100010273 | 3300005334 | Bacteria | 6100 |
| 47 | Ga0070666_10006030 | 3300005335 | Bacteria | 7446 |
| 48 | Ga0070666_10016271 | 3300005335 | Bacteria | 4756 |
| 49 | Ga0070666_10027648 | 3300005335 | Bacteria | 3717 |
| 50 | Ga0070666_10048999 | 3300005335 | Bacteria | 2838 |
| 51 | Ga0070666_10085437 | 3300005335 | Bacteria | 2161 |
| 52 | Ga0070680_100003537 | 3300005336 | Bacteria | 11657 |
| 53 | Ga0070680_100016773 | 3300005336 | Bacteria | 5764 |
| 54 | Ga0068868_100000341 | 3300005338 | Bacteria | 31563 |
| 55 | Ga0068868_100000481 | 3300005338 | Bacteria | 26493 |
| 56 | Ga0068868_100002154 | 3300005338 | Bacteria | 13600 |
| 57 | Ga0070689_100001002 | 3300005340 | Bacteria | 17702 |
| 58 | Ga0070689_100003497 | 3300005340 | Bacteria | 10451 |
| 59 | Ga0070689_100080902 | 3300005340 | Bacteria | 2550 |
| 60 | Ga0070689_100155589 | 3300005340 | Bacteria | 1845 |
| 61 | Ga0070689_100460941 | 3300005340 | Bacteria | 1083 |
| 62 | Ga0070691_10000934 | 3300005341 | Bacteria | 11862 |
| 63 | Ga0070687_100000369 | 3300005343 | Bacteria | 15363 |
| 64 | Ga0070687_100036020 | 3300005343 | Bacteria | 2462 |
| 65 | Ga0070661_100000012 | 3300005344 | Bacteria | 167998 |
| 66 | Ga0070661_100085006 | 3300005344 | Bacteria | 2338 |
| 67 | Ga0070668_100004065 | 3300005347 | Bacteria | 10835 |
| 68 | Ga0070668_100096792 | 3300005347 | Bacteria | 2333 |
| 69 | Ga0070669_100012049 | 3300005353 | Bacteria | 6134 |
| 70 | Ga0070669_100057844 | 3300005353 | Bacteria | 2845 |
| 71 | Ga0070669_100076499 | 3300005353 | Bacteria | 2484 |
| 72 | Ga0070675_100011753 | 3300005354 | Bacteria | 6857 |
| 73 | Ga0070675_100017523 | 3300005354 | Bacteria | 5692 |
| 74 | Ga0070675_100024700 | 3300005354 | Bacteria | 4813 |
| 75 | Ga0070675_100046180 | 3300005354 | Bacteria | 3566 |
| 76 | Ga0070675_100053903 | 3300005354 | Bacteria | 3308 |
| 77 | Ga0070675_100171539 | 3300005354 | Bacteria | 1871 |
| 78 | Ga0070671_100000233 | 3300005355 | Bacteria | 37258 |
| 79 | Ga0070671_100002054 | 3300005355 | Bacteria | 15515 |
| 80 | Ga0070671_100016418 | 3300005355 | Bacteria | 5988 |
| 81 | Ga0070674_100009927 | 3300005356 | Bacteria | 5731 |
| 82 | Ga0070674_100012986 | 3300005356 | Bacteria | 5132 |
| 83 | Ga0070673_100003250 | 3300005364 | Bacteria | 10086 |
| 84 | Ga0070673_100034846 | 3300005364 | Bacteria | 3814 |
| 85 | Ga0070673_100049244 | 3300005364 | Bacteria | 3289 |
| 86 | Ga0070688_100131707 | 3300005365 | Bacteria | 1688 |
| 87 | Ga0070659_100001485 | 3300005366 | Bacteria | 16884 |
| 88 | Ga0070667_100015489 | 3300005367 | Bacteria | 6305 |
| 89 | Ga0070667_100241496 | 3300005367 | Bacteria | 1613 |
| 90 | Ga0070667_100401430 | 3300005367 | Bacteria | 1248 |
| 91 | Ga0070667_100441502 | 3300005367 | Bacteria | 1188 |
| 92 | Ga0070714_100008789 | 3300005435 | Bacteria | 7898 |
| 93 | Ga0070710_10115182 | 3300005437 | Bacteria | 1620 |
| 94 | Ga0070701_10000173 | 3300005438 | Bacteria | 20020 |
| 95 | Ga0070701_10118961 | 3300005438 | Bacteria | 1486 |
| 96 | Ga0070701_10183545 | 3300005438 | Bacteria | 1226 |
| 97 | Ga0070705_100002026 | 3300005440 | Bacteria | 10362 |
| 98 | Ga0070705_100012429 | 3300005440 | Bacteria | 4327 |
| 99 | Ga0070705_100014900 | 3300005440 | Bacteria | 4010 |
| 100 | Ga0070705_100017908 | 3300005440 | Bacteria | 3704 |
| 101 | Ga0070700_100001867 | 3300005441 | Bacteria | 10641 |
| 102 | Ga0070700_100002899 | 3300005441 | Bacteria | 8808 |
| 103 | Ga0070700_100287623 | 3300005441 | Bacteria | 1194 |
| 104 | Ga0070694_100000045 | 3300005444 | Bacteria | 57135 |
| 105 | Ga0070694_100013774 | 3300005444 | Bacteria | 5054 |
| 106 | Ga0070694_100024371 | 3300005444 | Bacteria | 3905 |
| 107 | Ga0070694_100195755 | 3300005444 | Bacteria | 1504 |
| 108 | Ga0070663_100000020 | 3300005455 | Bacteria | 112469 |
| 109 | Ga0070663_100003404 | 3300005455 | Bacteria | 9184 |
| 110 | Ga0070678_100000650 | 3300005456 | Bacteria | 17006 |
| 111 | Ga0070678_100006098 | 3300005456 | Bacteria | 7035 |
| 112 | Ga0070678_100043183 | 3300005456 | Bacteria | 3209 |
| 113 | Ga0070678_100132226 | 3300005456 | Bacteria | 1984 |
| 114 | Ga0070662_100005005 | 3300005457 | Bacteria | 8428 |
| 115 | Ga0070662_100029819 | 3300005457 | Bacteria | 3811 |
| 116 | Ga0070681_10006268 | 3300005458 | Bacteria | 11569 |
| 117 | Ga0070681_10010845 | 3300005458 | Bacteria | 9007 |
| 118 | Ga0070681_10062663 | 3300005458 | Bacteria | 3692 |
| 119 | Ga0070681_10062814 | 3300005458 | Bacteria | 3687 |
| 120 | Ga0068867_100001882 | 3300005459 | Bacteria | 14597 |
| 121 | Ga0068867_100002025 | 3300005459 | Bacteria | 14164 |
| 122 | Ga0068867_100004883 | 3300005459 | Bacteria | 9437 |
| 123 | Ga0068867_100051793 | 3300005459 | Bacteria | 3028 |
| 124 | Ga0070685_10017491 | 3300005466 | Bacteria | 3839 |
| 125 | Ga0070685_10083134 | 3300005466 | Bacteria | 1923 |
| 126 | Ga0070685_10265362 | 3300005466 | Bacteria | 1144 |
| 127 | Ga0070706_100006783 | 3300005467 | Bacteria | 10810 |
| 128 | Ga0070706_100108259 | 3300005467 | Bacteria | 2586 |
| 129 | Ga0070707_100003388 | 3300005468 | Bacteria | 15062 |
| 130 | Ga0070698_100349640 | 3300005471 | Bacteria | 1410 |
| 131 | Ga0070699_100077562 | 3300005518 | Bacteria | 2893 |
| 132 | Ga0070679_100083541 | 3300005530 | Bacteria | 3182 |
| 133 | Ga0070679_100187058 | 3300005530 | Bacteria | 2041 |
| 134 | Ga0070684_100002834 | 3300005535 | Bacteria | 12880 |
| 135 | Ga0070684_100225702 | 3300005535 | Bacteria | 1709 |
| 136 | Ga0070697_100002360 | 3300005536 | Bacteria | 14519 |
| 137 | Ga0070697_100008436 | 3300005536 | Bacteria | 8040 |
| 138 | Ga0068853_100001685 | 3300005539 | Bacteria | 16182 |
| 139 | Ga0068853_100067128 | 3300005539 | Bacteria | 3116 |
| 140 | Ga0068853_100260860 | 3300005539 | Bacteria | 1593 |
| 141 | Ga0070672_100001511 | 3300005543 | Bacteria | 14418 |
| 142 | Ga0070672_100001587 | 3300005543 | Bacteria | 14100 |
| 143 | Ga0070672_100018915 | 3300005543 | Bacteria | 4990 |
| 144 | Ga0070672_100070674 | 3300005543 | Bacteria | 2774 |
| 145 | Ga0070672_100143267 | 3300005543 | Bacteria | 1973 |
| 146 | Ga0070672_100148264 | 3300005543 | Bacteria | 1939 |
| 147 | Ga0070672_100227048 | 3300005543 | Bacteria | 1567 |
| 148 | Ga0070672_100344566 | 3300005543 | Bacteria | 1269 |
| 149 | Ga0070686_100003713 | 3300005544 | Bacteria | 8389 |
| 150 | Ga0070686_100012327 | 3300005544 | Bacteria | 4865 |
| 151 | Ga0070686_100069845 | 3300005544 | Bacteria | 2295 |
| 152 | Ga0070686_100128493 | 3300005544 | Bacteria | 1749 |
| 153 | Ga0070695_100000126 | 3300005545 | Bacteria | 34457 |
| 154 | Ga0070695_100000692 | 3300005545 | Bacteria | 18036 |
| 155 | Ga0070695_100024403 | 3300005545 | Bacteria | 3724 |
| 156 | Ga0070695_100027130 | 3300005545 | Bacteria | 3546 |
| 157 | Ga0070695_100027161 | 3300005545 | Bacteria | 3544 |
| 158 | Ga0070696_100003057 | 3300005546 | Bacteria | 11117 |
| 159 | Ga0070696_100008744 | 3300005546 | Bacteria | 6778 |
| 160 | Ga0070696_100025013 | 3300005546 | Bacteria | 4058 |
| 161 | Ga0070696_100040502 | 3300005546 | Bacteria | 3217 |
| 162 | Ga0070696_100082402 | 3300005546 | Bacteria | 2280 |
| 163 | Ga0070696_100121266 | 3300005546 | Bacteria | 1893 |
| 164 | Ga0070693_100000731 | 3300005547 | Bacteria | 14461 |
| 165 | Ga0070693_100015741 | 3300005547 | Bacteria | 3900 |
| 166 | Ga0070693_100065905 | 3300005547 | Bacteria | 2118 |
| 167 | Ga0070693_100129648 | 3300005547 | Bacteria | 1575 |
| 168 | Ga0070665_100008796 | 3300005548 | Bacteria | 10219 |
| 169 | Ga0070665_100021204 | 3300005548 | Bacteria | 6532 |
| 170 | Ga0070665_100139708 | 3300005548 | Bacteria | 2426 |
| 171 | Ga0070665_100146290 | 3300005548 | Bacteria | 2366 |
| 172 | Ga0070704_100000195 | 3300005549 | Bacteria | 24991 |
| 173 | Ga0070704_100005519 | 3300005549 | Bacteria | 7375 |
| 174 | Ga0070704_100072836 | 3300005549 | Bacteria | 2501 |
| 175 | Ga0068855_100005836 | 3300005563 | Bacteria | 15029 |
| 176 | Ga0068855_100007080 | 3300005563 | Bacteria | 13604 |
| 177 | Ga0068855_100013040 | 3300005563 | Bacteria | 10025 |
| 178 | Ga0068855_100077941 | 3300005563 | Bacteria | 3845 |
| 179 | Ga0070664_100000003 | 3300005564 | Bacteria | 325604 |
| 180 | Ga0070664_100008955 | 3300005564 | Bacteria | 8116 |
| 181 | Ga0070664_100020888 | 3300005564 | Bacteria | 5395 |
| 182 | Ga0070664_100153629 | 3300005564 | Bacteria | 2033 |
| 183 | Ga0068857_100061974 | 3300005577 | Bacteria | 3324 |
| 184 | Ga0068857_100073964 | 3300005577 | Bacteria | 3037 |
| 185 | Ga0068857_100151436 | 3300005577 | Bacteria | 2102 |
| 186 | Ga0068857_100397699 | 3300005577 | Bacteria | 1282 |
| 187 | Ga0068854_100000063 | 3300005578 | Bacteria | 77198 |
| 188 | Ga0068854_100003263 | 3300005578 | Bacteria | 10104 |
| 189 | Ga0068854_100013526 | 3300005578 | Bacteria | 5358 |
| 190 | Ga0068856_100000011 | 3300005614 | Bacteria | 170419 |
| 191 | Ga0068856_100009039 | 3300005614 | Bacteria | 9695 |
| 192 | Ga0068856_100015746 | 3300005614 | Bacteria | 7311 |
| 193 | Ga0068856_100038071 | 3300005614 | Bacteria | 4720 |
| 194 | Ga0070702_100000019 | 3300005615 | Bacteria | 46900 |
| 195 | Ga0068852_100000484 | 3300005616 | Bacteria | 26098 |
| 196 | Ga0068852_100004168 | 3300005616 | Bacteria | 10185 |
| 197 | Ga0068852_100010590 | 3300005616 | Bacteria | 6898 |
| 198 | Ga0068859_100013818 | 3300005617 | Bacteria | 8096 |
| 199 | Ga0068859_100017464 | 3300005617 | Bacteria | 7213 |
| 200 | Ga0068859_100059459 | 3300005617 | Bacteria | 3850 |
| 201 | Ga0068859_100478011 | 3300005617 | Bacteria | 1341 |
| 202 | Ga0068864_100004221 | 3300005618 | Bacteria | 11826 |
| 203 | Ga0068864_100005062 | 3300005618 | Bacteria | 10793 |
| 204 | Ga0068864_100021353 | 3300005618 | Bacteria | 5424 |
| 205 | Ga0068864_100087152 | 3300005618 | Bacteria | 2748 |
| 206 | Ga0068864_100094011 | 3300005618 | Bacteria | 2649 |
| 207 | Ga0068866_10001065 | 3300005718 | Bacteria | 12079 |
| 208 | Ga0068861_100002221 | 3300005719 | Bacteria | 12602 |
| 209 | Ga0068861_100138222 | 3300005719 | Bacteria | 1985 |
| 210 | Ga0068851_10001115 | 3300005834 | Bacteria | 11633 |
| 211 | Ga0068851_10001624 | 3300005834 | Bacteria | 9865 |
| 212 | Ga0068870_10011148 | 3300005840 | Bacteria | 4157 |
| 213 | Ga0068870_10079472 | 3300005840 | Bacteria | 1809 |
| 214 | Ga0068870_10182918 | 3300005840 | Bacteria | 1259 |
| 215 | Ga0068863_100004084 | 3300005841 | Bacteria | 14421 |
| 216 | Ga0068863_100012296 | 3300005841 | Bacteria | 8263 |
| 217 | Ga0068863_100038818 | 3300005841 | Bacteria | 4530 |
| 218 | Ga0068863_100266231 | 3300005841 | Bacteria | 1658 |
| 219 | Ga0068858_100000751 | 3300005842 | Bacteria | 33969 |
| 220 | Ga0068858_100014709 | 3300005842 | Bacteria | 7366 |
| 221 | Ga0068858_100039861 | 3300005842 | Bacteria | 4354 |
| 222 | Ga0068858_100061889 | 3300005842 | Bacteria | 3460 |
| 223 | Ga0068858_100244528 | 3300005842 | Bacteria | 1703 |
| 224 | Ga0068860_100005413 | 3300005843 | Bacteria | 12953 |
| 225 | Ga0068860_100018660 | 3300005843 | Bacteria | 6745 |
| 226 | Ga0068862_100005525 | 3300005844 | Bacteria | 10561 |
| 227 | Ga0068862_100006778 | 3300005844 | Bacteria | 9496 |
| 228 | Ga0068862_100025277 | 3300005844 | Bacteria | 4986 |
| 229 | Ga0068862_100098802 | 3300005844 | Bacteria | 2550 |
| 230 | Ga0081455_10083505 | 3300005937 | Bacteria | 2610 |
| 231 | Ga0081539_10000226 | 3300005985 | Bacteria | 132618 |
| 232 | Ga0081539_10016258 | 3300005985 | Bacteria | 5331 |
| 233 | Ga0075363_100012669 | 3300006048 | Bacteria | 4068 |
| 234 | Ga0075364_10034245 | 3300006051 | Bacteria | 3275 |
| 235 | Ga0075432_10011661 | 3300006058 | Bacteria | 2986 |
| 236 | Ga0070715_10019721 | 3300006163 | Bacteria | 2591 |
| 237 | Ga0070716_100074657 | 3300006173 | Bacteria | 2004 |
| 238 | Ga0070712_100341238 | 3300006175 | Bacteria | 1223 |
| 239 | Ga0075362_10009361 | 3300006177 | Bacteria | 3787 |
| 240 | Ga0075362_10030280 | 3300006177 | Bacteria | 2337 |
| 241 | Ga0075367_10027731 | 3300006178 | Bacteria | 3225 |
| 242 | Ga0075369_10001702 | 3300006186 | Bacteria | 7611 |
| 243 | Ga0075369_10024886 | 3300006186 | Bacteria | 2484 |
| 244 | Ga0075366_10017190 | 3300006195 | Bacteria | 4160 |
| 245 | Ga0097621_100002059 | 3300006237 | Bacteria | 13752 |
| 246 | Ga0097621_100014223 | 3300006237 | Bacteria | 5952 |
| 247 | Ga0097621_100024797 | 3300006237 | Bacteria | 4688 |
| 248 | Ga0097621_100038035 | 3300006237 | Bacteria | 3860 |
| 249 | Ga0075370_10027737 | 3300006353 | Bacteria | 3144 |
| 250 | Ga0068871_100003308 | 3300006358 | Bacteria | 11060 |
| 251 | Ga0068871_100005061 | 3300006358 | Bacteria | 9206 |
| 252 | Ga0068871_100007338 | 3300006358 | Bacteria | 7867 |
| 253 | Ga0068871_100032101 | 3300006358 | Bacteria | 4145 |
| 254 | Ga0068871_100046749 | 3300006358 | Bacteria | 3487 |
| 255 | Ga0068871_100142157 | 3300006358 | Bacteria | 2041 |
| 256 | Ga0075430_100009206 | 3300006846 | Bacteria | 8346 |
| 257 | Ga0075430_100129639 | 3300006846 | Bacteria | 2102 |
| 258 | Ga0075431_100000324 | 3300006847 | Bacteria | 37752 |
| 259 | Ga0075433_10001856 | 3300006852 | Bacteria | 15871 |
| 260 | Ga0075433_10203240 | 3300006852 | Bacteria | 1761 |
| 261 | Ga0075434_100000306 | 3300006871 | Bacteria | 34874 |
| 262 | Ga0075434_100001295 | 3300006871 | Bacteria | 20857 |
| 263 | Ga0075429_100000143 | 3300006880 | Bacteria | 43584 |
| 264 | Ga0075429_100040723 | 3300006880 | Bacteria | 4045 |
| 265 | Ga0068865_100001242 | 3300006881 | Bacteria | 14825 |
| 266 | Ga0068865_100002021 | 3300006881 | Bacteria | 11969 |
| 267 | Ga0075436_100000087 | 3300006914 | Bacteria | 53435 |
| 268 | Ga0075436_100000475 | 3300006914 | Bacteria | 26074 |
| 269 | Ga0075436_100014968 | 3300006914 | Bacteria | 5317 |
| 270 | Ga0075436_100032054 | 3300006914 | Bacteria | 3621 |
| 271 | Ga0075436_100189790 | 3300006914 | Bacteria | 1454 |
| 272 | Ga0097620_100013819 | 3300006931 | Bacteria | 8096 |
| 273 | Ga0097620_100017464 | 3300006931 | Bacteria | 7213 |
| 274 | Ga0097620_100059456 | 3300006931 | Bacteria | 3850 |
| 275 | Ga0097620_100478010 | 3300006931 | Bacteria | 1341 |
| 276 | Ga0099826_10031839 | 3300006948 | Bacteria | 3809 |
| 277 | Ga0075435_100000811 | 3300007076 | Bacteria | 19470 |
| 278 | Ga0075435_100001385 | 3300007076 | Bacteria | 15654 |
| 279 | Ga0075435_100018574 | 3300007076 | Bacteria | 5293 |
| 280 | Ga0075435_100052938 | 3300007076 | Bacteria | 3271 |
| 281 | Ga0075435_100071689 | 3300007076 | Bacteria | 2829 |
| 282 | Ga0075435_100073655 | 3300007076 | Bacteria | 2792 |
| 283 | Ga0075435_100184894 | 3300007076 | Bacteria | 1762 |
| 284 | Ga0099794_10012591 | 3300007265 | Bacteria | 3656 |
| 285 | Ga0099794_10015970 | 3300007265 | Bacteria | 3322 |
| 286 | Ga0099794_10019763 | 3300007265 | Bacteria | 3041 |
| 287 | Ga0099794_10037077 | 3300007265 | Bacteria | 2307 |
| 288 | Ga0105244_10006962 | 3300009036 | Bacteria | 7240 |
| 289 | Ga0105240_10065089 | 3300009093 | Bacteria | 4526 |
| 290 | Ga0105240_10094231 | 3300009093 | Bacteria | 3653 |
| 291 | Ga0105240_10098276 | 3300009093 | Bacteria | 3565 |
| 292 | Ga0111539_10002898 | 3300009094 | Bacteria | 22772 |
| 293 | Ga0111539_10020073 | 3300009094 | Bacteria | 8232 |
| 294 | Ga0111539_10027344 | 3300009094 | Bacteria | 6966 |
| 295 | Ga0111539_10054800 | 3300009094 | Bacteria | 4743 |
| 296 | Ga0111539_10060748 | 3300009094 | Bacteria | 4479 |
| 297 | Ga0111539_10078279 | 3300009094 | Bacteria | 3890 |
| 298 | Ga0111539_10092441 | 3300009094 | Bacteria | 3555 |
| 299 | Ga0105245_10005835 | 3300009098 | Bacteria | 10810 |
| 300 | Ga0105245_10185882 | 3300009098 | Bacteria | 1988 |
| 301 | Ga0105245_10270801 | 3300009098 | Bacteria | 1656 |
| 302 | Ga0114129_10001740 | 3300009147 | Bacteria | 29637 |
| 303 | Ga0114129_10223463 | 3300009147 | Bacteria | 2539 |
| 304 | Ga0114129_10418881 | 3300009147 | Bacteria | 1762 |
| 305 | Ga0105243_10002206 | 3300009148 | Bacteria | 16405 |
| 306 | Ga0105243_10003125 | 3300009148 | Bacteria | 13607 |
| 307 | Ga0105243_10003372 | 3300009148 | Bacteria | 12960 |
| 308 | Ga0105243_10004530 | 3300009148 | Bacteria | 10982 |
| 309 | Ga0105243_10052189 | 3300009148 | Bacteria | 3238 |
| 310 | Ga0105243_10196189 | 3300009148 | Bacteria | 1767 |
| 311 | Ga0105241_10010806 | 3300009174 | Bacteria | 6697 |
| 312 | Ga0105241_10047970 | 3300009174 | Bacteria | 3248 |
| 313 | Ga0105242_10001658 | 3300009176 | Bacteria | 17602 |
| 314 | Ga0105242_10040427 | 3300009176 | Bacteria | 3758 |
| 315 | Ga0105242_10349857 | 3300009176 | Bacteria | 1364 |
| 316 | Ga0105248_10005187 | 3300009177 | Bacteria | 14361 |
| 317 | Ga0105248_10033298 | 3300009177 | Bacteria | 5756 |
| 318 | Ga0105248_10076691 | 3300009177 | Bacteria | 3757 |
| 319 | Ga0105248_10089123 | 3300009177 | Bacteria | 3472 |
| 320 | Ga0105248_10224528 | 3300009177 | Bacteria | 2114 |
| 321 | Ga0105238_10004061 | 3300009551 | Bacteria | 14507 |
| 322 | Ga0105238_10156571 | 3300009551 | Bacteria | 2253 |
| 323 | Ga0105249_10004022 | 3300009553 | Bacteria | 12686 |
| 324 | Ga0105249_10011197 | 3300009553 | Bacteria | 7880 |
| 325 | Ga0105249_10426249 | 3300009553 | Bacteria | 1361 |
| 326 | Ga0105239_10504717 | 3300010375 | Bacteria | 1375 |
| 327 | Ga0105246_10005048 | 3300011119 | Bacteria | 8023 |
| 328 | Ga0105246_10017932 | 3300011119 | Bacteria | 4506 |
| 329 | Ga0105246_10316737 | 3300011119 | Bacteria | 1266 |
| 330 | Ga0157373_10004380 | 3300013100 | Bacteria | 10641 |
| 331 | Ga0157371_10000083 | 3300013102 | Bacteria | 149633 |
| 332 | Ga0157371_10068354 | 3300013102 | Bacteria | 2515 |
| 333 | Ga0157370_10000141 | 3300013104 | Bacteria | 87406 |
| 334 | Ga0157370_10000800 | 3300013104 | Bacteria | 39630 |
| 335 | Ga0157370_10009801 | 3300013104 | Bacteria | 10160 |
| 336 | Ga0157369_10003851 | 3300013105 | Bacteria | 17830 |
| 337 | Ga0157369_10048969 | 3300013105 | Bacteria | 4583 |
| 338 | Ga0157374_10073243 | 3300013296 | Bacteria | 3233 |
| 339 | Ga0157374_10172545 | 3300013296 | Bacteria | 2110 |
| 340 | Ga0157378_10000579 | 3300013297 | Bacteria | 34490 |
| 341 | Ga0157378_10001901 | 3300013297 | Bacteria | 18743 |
| 342 | Ga0157378_10003615 | 3300013297 | Bacteria | 13684 |
| 343 | Ga0157378_10008040 | 3300013297 | Bacteria | 9206 |
| 344 | Ga0157378_10008082 | 3300013297 | Bacteria | 9182 |
| 345 | Ga0163162_10006590 | 3300013306 | Bacteria | 11250 |
| 346 | Ga0163162_10006818 | 3300013306 | Bacteria | 11080 |
| 347 | Ga0163162_10032414 | 3300013306 | Bacteria | 5190 |
| 348 | Ga0163162_10112236 | 3300013306 | Bacteria | 2824 |
| 349 | Ga0163162_10203073 | 3300013306 | Bacteria | 2111 |
| 350 | Ga0157372_10000775 | 3300013307 | Bacteria | 34581 |
| 351 | Ga0157372_10060911 | 3300013307 | Bacteria | 4224 |
| 352 | Ga0157372_10066547 | 3300013307 | Bacteria | 4048 |
| 353 | Ga0157375_10001103 | 3300013308 | Bacteria | 23426 |
| 354 | Ga0157375_10031375 | 3300013308 | Bacteria | 5023 |
| 355 | Ga0157375_10096305 | 3300013308 | Bacteria | 3032 |
| 356 | Ga0157375_10118307 | 3300013308 | Bacteria | 2756 |
| 357 | Ga0157375_10276889 | 3300013308 | Bacteria | 1840 |
| 358 | Ga0157375_10378031 | 3300013308 | Bacteria | 1583 |
| 359 | Ga0163163_10413114 | 3300014325 | Bacteria | 1408 |
| 360 | Ga0157380_10003849 | 3300014326 | Bacteria | 10343 |
| 361 | Ga0157380_10042159 | 3300014326 | Bacteria | 3566 |
| 362 | Ga0157380_10155386 | 3300014326 | Bacteria | 1982 |
| 363 | Ga0182008_10000260 | 3300014497 | Bacteria | 41217 |
| 364 | Ga0182008_10002165 | 3300014497 | Bacteria | 12503 |
| 365 | Ga0182008_10002687 | 3300014497 | Bacteria | 11037 |
| 366 | Ga0182008_10014557 | 3300014497 | Bacteria | 4117 |
| 367 | Ga0182008_10015230 | 3300014497 | Bacteria | 4016 |
| 368 | Ga0182008_10072392 | 3300014497 | Bacteria | 1696 |
| 369 | Ga0157377_10016731 | 3300014745 | Bacteria | 3777 |
| 370 | Ga0157377_10064112 | 3300014745 | Bacteria | 2107 |
| 371 | Ga0157379_10002873 | 3300014968 | Bacteria | 14522 |
| 372 | Ga0157379_10040024 | 3300014968 | Bacteria | 4183 |
| 373 | Ga0157379_10061246 | 3300014968 | Bacteria | 3365 |
| 374 | Ga0157379_10382298 | 3300014968 | Bacteria | 1292 |
| 375 | Ga0157376_10020591 | 3300014969 | Bacteria | 5107 |
| 376 | Ga0157376_10056115 | 3300014969 | Bacteria | 3289 |
| 377 | Ga0157376_10126047 | 3300014969 | Bacteria | 2278 |
| 378 | Ga0157376_10199412 | 3300014969 | Bacteria | 1840 |
| 379 | Ga0157376_10251591 | 3300014969 | Bacteria | 1651 |
| 380 | Ga0157376_10262271 | 3300014969 | Bacteria | 1619 |
| 381 | Ga0182006_1003724 | 3300015261 | Bacteria | 7709 |
| 382 | Ga0182006_1005768 | 3300015261 | Bacteria | 5842 |
| 383 | Ga0182006_1007705 | 3300015261 | Bacteria | 4918 |
| 384 | Ga0182006_1016938 | 3300015261 | Bacteria | 3103 |
| 385 | Ga0182007_10001176 | 3300015262 | Bacteria | 14194 |
| 386 | Ga0182007_10001351 | 3300015262 | Bacteria | 13232 |
| 387 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 388 | Ga0163161_10001684 | 3300017792 | Bacteria | 16226 |
| 389 | Ga0163161_10004016 | 3300017792 | Bacteria | 10298 |
| 390 | Ga0163161_10004590 | 3300017792 | Bacteria | 9613 |
| 391 | Ga0163161_10032713 | 3300017792 | Bacteria | 3715 |
| 392 | Ga0163161_10162583 | 3300017792 | Bacteria | 1703 |
| 393 | Ga0206356_10375286 | 3300020070 | Bacteria | 2222 |
| 394 | Ga0206351_10502756 | 3300020077 | Bacteria | 20710 |
| 395 | Ga0154015_1372279 | 3300020610 | Bacteria | 19706 |
| 396 | Ga0209784_100150 | 3300025224 | Bacteria | 63516 |
| 397 | Ga0209784_100554 | 3300025224 | Bacteria | 13367 |
| 398 | Ga0209784_100595 | 3300025224 | Bacteria | 11953 |
| 399 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 400 | Ga0209566_100430 | 3300025225 | Bacteria | 31511 |
| 401 | Ga0209566_100569 | 3300025225 | Bacteria | 24024 |
| 402 | Ga0209674_100010 | 3300025226 | Bacteria | 1038638 |
| 403 | Ga0209674_100050 | 3300025226 | Bacteria | 341738 |
| 404 | Ga0209674_100248 | 3300025226 | Bacteria | 45380 |
| 405 | Ga0209672_100218 | 3300025228 | Bacteria | 44911 |
| 406 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 407 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 408 | Ga0209563_100026 | 3300025230 | Bacteria | 559453 |
| 409 | Ga0209563_104187 | 3300025230 | Bacteria | 2804 |
| 410 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 411 | Ga0209646_1000055 | 3300025246 | Bacteria | 271793 |
| 412 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 413 | Ga0209677_102421 | 3300025253 | Bacteria | 7051 |
| 414 | Ga0209148_1000109 | 3300025254 | Bacteria | 204266 |
| 415 | Ga0209565_1000283 | 3300025263 | Bacteria | 49870 |
| 416 | Ga0207666_1001903 | 3300025271 | Bacteria | 2483 |
| 417 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 418 | Ga0209673_1000136 | 3300025273 | Bacteria | 159975 |
| 419 | Ga0209673_1016929 | 3300025273 | Bacteria | 2705 |
| 420 | Ga0209675_1000071 | 3300025291 | Bacteria | 168382 |
| 421 | Ga0209676_1000643 | 3300025292 | Bacteria | 50106 |
| 422 | Ga0209676_1000659 | 3300025292 | Bacteria | 49458 |
| 423 | Ga0209050_1000945 | 3300025298 | Bacteria | 37767 |
| 424 | Ga0209051_1000180 | 3300025303 | Bacteria | 113724 |
| 425 | Ga0209051_1000227 | 3300025303 | Bacteria | 94321 |
| 426 | Ga0209051_1000351 | 3300025303 | Bacteria | 68445 |
| 427 | Ga0209051_1000513 | 3300025303 | Bacteria | 48907 |
| 428 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 429 | Ga0209257_1001106 | 3300025304 | Bacteria | 35067 |
| 430 | Ga0209257_1004691 | 3300025304 | Bacteria | 10269 |
| 431 | Ga0207697_10014516 | 3300025315 | Bacteria | 3266 |
| 432 | Ga0207656_10000903 | 3300025321 | Bacteria | 9650 |
| 433 | Ga0207656_10001284 | 3300025321 | Bacteria | 8249 |
| 434 | Ga0207656_10012445 | 3300025321 | Bacteria | 3235 |
| 435 | Ga0207655_1002301 | 3300025728 | Bacteria | 15701 |
| 436 | Ga0207653_10043071 | 3300025885 | Bacteria | 1486 |
| 437 | Ga0207682_10000059 | 3300025893 | Bacteria | 48172 |
| 438 | Ga0207682_10009656 | 3300025893 | Bacteria | 3801 |
| 439 | Ga0207642_10001096 | 3300025899 | Bacteria | 8394 |
| 440 | Ga0207642_10004720 | 3300025899 | Bacteria | 4402 |
| 441 | Ga0207688_10006888 | 3300025901 | Bacteria | 6184 |
| 442 | Ga0207688_10018621 | 3300025901 | Bacteria | 3777 |
| 443 | Ga0207688_10156891 | 3300025901 | Bacteria | 1347 |
| 444 | Ga0207680_10007283 | 3300025903 | Bacteria | 5383 |
| 445 | Ga0207680_10029264 | 3300025903 | Bacteria | 3092 |
| 446 | Ga0207699_10129328 | 3300025906 | Bacteria | 1645 |
| 447 | Ga0207645_10002844 | 3300025907 | Bacteria | 13423 |
| 448 | Ga0207645_10016689 | 3300025907 | Bacteria | 4856 |
| 449 | Ga0207643_10002206 | 3300025908 | Bacteria | 10607 |
| 450 | Ga0207643_10030908 | 3300025908 | Bacteria | 2984 |
| 451 | Ga0207643_10040818 | 3300025908 | Bacteria | 2613 |
| 452 | Ga0207643_10051847 | 3300025908 | Bacteria | 2329 |
| 453 | Ga0207705_10023381 | 3300025909 | Bacteria | 4409 |
| 454 | Ga0207705_10161331 | 3300025909 | Bacteria | 1684 |
| 455 | Ga0207684_10041849 | 3300025910 | Bacteria | 3883 |
| 456 | Ga0207654_10034789 | 3300025911 | Bacteria | 2801 |
| 457 | Ga0207707_10009957 | 3300025912 | Bacteria | 8243 |
| 458 | Ga0207707_10042674 | 3300025912 | Bacteria | 3958 |
| 459 | Ga0207707_10252201 | 3300025912 | Bacteria | 1533 |
| 460 | Ga0207695_10004143 | 3300025913 | Bacteria | 19908 |
| 461 | Ga0207695_10086080 | 3300025913 | Bacteria | 3170 |
| 462 | Ga0207663_10232839 | 3300025916 | Bacteria | 1347 |
| 463 | Ga0207660_10004091 | 3300025917 | Bacteria | 9500 |
| 464 | Ga0207660_10083168 | 3300025917 | Bacteria | 2357 |
| 465 | Ga0207662_10000049 | 3300025918 | Bacteria | 51921 |
| 466 | Ga0207662_10003774 | 3300025918 | Bacteria | 7862 |
| 467 | Ga0207662_10097533 | 3300025918 | Bacteria | 1817 |
| 468 | Ga0207662_10113344 | 3300025918 | Bacteria | 1693 |
| 469 | Ga0207649_10000302 | 3300025920 | Bacteria | 37899 |
| 470 | Ga0207649_10279379 | 3300025920 | Bacteria | 1213 |
| 471 | Ga0207652_10057137 | 3300025921 | Bacteria | 3360 |
| 472 | Ga0207652_10101889 | 3300025921 | Bacteria | 2537 |
| 473 | Ga0207646_10224210 | 3300025922 | Bacteria | 1698 |
| 474 | Ga0207681_10000513 | 3300025923 | Bacteria | 26911 |
| 475 | Ga0207681_10072794 | 3300025923 | Bacteria | 2401 |
| 476 | Ga0207694_10082862 | 3300025924 | Bacteria | 2521 |
| 477 | Ga0207650_10080128 | 3300025925 | Bacteria | 2475 |
| 478 | Ga0207650_10137181 | 3300025925 | Bacteria | 1920 |
| 479 | Ga0207659_10008117 | 3300025926 | Bacteria | 6497 |
| 480 | Ga0207659_10041724 | 3300025926 | Bacteria | 3215 |
| 481 | Ga0207659_10110319 | 3300025926 | Bacteria | 2090 |
| 482 | Ga0207687_10004654 | 3300025927 | Bacteria | 9127 |
| 483 | Ga0207687_10059254 | 3300025927 | Bacteria | 2697 |
| 484 | Ga0207644_10018061 | 3300025931 | Bacteria | 4768 |
| 485 | Ga0207644_10020376 | 3300025931 | Bacteria | 4509 |
| 486 | Ga0207644_10043748 | 3300025931 | Bacteria | 3179 |
| 487 | Ga0207644_10114123 | 3300025931 | Bacteria | 2046 |
| 488 | Ga0207644_10274214 | 3300025931 | Bacteria | 1353 |
| 489 | Ga0207690_10001630 | 3300025932 | Bacteria | 13945 |
| 490 | Ga0207706_10027297 | 3300025933 | Bacteria | 5106 |
| 491 | Ga0207706_10036312 | 3300025933 | Bacteria | 4377 |
| 492 | Ga0207706_10039233 | 3300025933 | Bacteria | 4198 |
| 493 | Ga0207706_10275578 | 3300025933 | Bacteria | 1468 |
| 494 | Ga0207686_10004424 | 3300025934 | Bacteria | 7537 |
| 495 | Ga0207686_10005916 | 3300025934 | Bacteria | 6567 |
| 496 | Ga0207686_10008534 | 3300025934 | Bacteria | 5535 |
| 497 | Ga0207686_10037208 | 3300025934 | Bacteria | 2935 |
| 498 | Ga0207709_10000436 | 3300025935 | Bacteria | 39392 |
| 499 | Ga0207709_10000534 | 3300025935 | Bacteria | 32767 |
| 500 | Ga0207709_10003231 | 3300025935 | Bacteria | 9783 |
| 501 | Ga0207709_10004865 | 3300025935 | Bacteria | 7686 |
| 502 | Ga0207709_10110585 | 3300025935 | Bacteria | 1836 |
| 503 | Ga0207709_10181419 | 3300025935 | Bacteria | 1487 |
| 504 | Ga0207670_10001257 | 3300025936 | Bacteria | 13387 |
| 505 | Ga0207669_10022292 | 3300025937 | Bacteria | 3361 |
| 506 | Ga0207704_10003500 | 3300025938 | Bacteria | 7143 |
| 507 | Ga0207704_10013921 | 3300025938 | Bacteria | 4046 |
| 508 | Ga0207704_10113122 | 3300025938 | Bacteria | 1840 |
| 509 | Ga0207691_10000243 | 3300025940 | Bacteria | 53649 |
| 510 | Ga0207691_10000625 | 3300025940 | Bacteria | 35040 |
| 511 | Ga0207691_10008832 | 3300025940 | Bacteria | 9669 |
| 512 | Ga0207691_10081441 | 3300025940 | Bacteria | 2910 |
| 513 | Ga0207691_10082605 | 3300025940 | Bacteria | 2885 |
| 514 | Ga0207691_10141471 | 3300025940 | Bacteria | 2120 |
| 515 | Ga0207691_10142670 | 3300025940 | Bacteria | 2109 |
| 516 | Ga0207711_10029400 | 3300025941 | Bacteria | 4635 |
| 517 | Ga0207711_10118310 | 3300025941 | Bacteria | 2364 |
| 518 | Ga0207711_10146325 | 3300025941 | Bacteria | 2129 |
| 519 | Ga0207711_10230884 | 3300025941 | Bacteria | 1695 |
| 520 | Ga0207689_10005474 | 3300025942 | Bacteria | 11362 |
| 521 | Ga0207689_10012793 | 3300025942 | Bacteria | 7168 |
| 522 | Ga0207689_10037778 | 3300025942 | Bacteria | 4003 |
| 523 | Ga0207689_10201914 | 3300025942 | Bacteria | 1641 |
| 524 | Ga0207689_10296882 | 3300025942 | Bacteria | 1339 |
| 525 | Ga0207661_10002842 | 3300025944 | Bacteria | 11965 |
| 526 | Ga0207679_10000007 | 3300025945 | Bacteria | 460140 |
| 527 | Ga0207679_10006685 | 3300025945 | Bacteria | 7301 |
| 528 | Ga0207679_10032149 | 3300025945 | Bacteria | 3680 |
| 529 | Ga0207679_10107408 | 3300025945 | Bacteria | 2196 |
| 530 | Ga0207679_10230318 | 3300025945 | Bacteria | 1564 |
| 531 | Ga0207667_10002796 | 3300025949 | Bacteria | 21611 |
| 532 | Ga0207667_10016584 | 3300025949 | Bacteria | 8316 |
| 533 | Ga0207651_10005150 | 3300025960 | Bacteria | 6676 |
| 534 | Ga0207651_10012247 | 3300025960 | Bacteria | 4844 |
| 535 | Ga0207651_10164182 | 3300025960 | Bacteria | 1744 |
| 536 | Ga0207712_10009645 | 3300025961 | Bacteria | 6117 |
| 537 | Ga0207712_10011050 | 3300025961 | Bacteria | 5747 |
| 538 | Ga0207668_10004976 | 3300025972 | Bacteria | 7818 |
| 539 | Ga0207668_10042435 | 3300025972 | Bacteria | 3080 |
| 540 | Ga0207668_10151285 | 3300025972 | Bacteria | 1797 |
| 541 | Ga0207640_10000224 | 3300025981 | Bacteria | 39760 |
| 542 | Ga0207640_10011056 | 3300025981 | Bacteria | 5099 |
| 543 | Ga0207640_10147294 | 3300025981 | Bacteria | 1725 |
| 544 | Ga0207658_10010666 | 3300025986 | Bacteria | 6246 |
| 545 | Ga0207658_10051643 | 3300025986 | Bacteria | 3031 |
| 546 | Ga0207677_10004358 | 3300026023 | Bacteria | 7582 |
| 547 | Ga0207677_10005372 | 3300026023 | Bacteria | 6951 |
| 548 | Ga0207677_10011167 | 3300026023 | Bacteria | 5108 |
| 549 | Ga0207703_10003975 | 3300026035 | Bacteria | 12250 |
| 550 | Ga0207703_10019959 | 3300026035 | Bacteria | 5237 |
| 551 | Ga0207703_10054661 | 3300026035 | Bacteria | 3248 |
| 552 | Ga0207703_10213390 | 3300026035 | Bacteria | 1722 |
| 553 | Ga0207639_10013658 | 3300026041 | Bacteria | 5692 |
| 554 | Ga0207678_10000030 | 3300026067 | Bacteria | 112455 |
| 555 | Ga0207678_10002320 | 3300026067 | Bacteria | 17245 |
| 556 | Ga0207678_10073392 | 3300026067 | Bacteria | 2932 |
| 557 | Ga0207708_10007875 | 3300026075 | Bacteria | 7892 |
| 558 | Ga0207708_10125804 | 3300026075 | Bacteria | 2000 |
| 559 | Ga0207708_10140222 | 3300026075 | Bacteria | 1896 |
| 560 | Ga0207708_10244101 | 3300026075 | Bacteria | 1445 |
| 561 | Ga0207702_10000054 | 3300026078 | Bacteria | 137192 |
| 562 | Ga0207702_10018915 | 3300026078 | Bacteria | 5699 |
| 563 | Ga0207702_10036006 | 3300026078 | Bacteria | 4139 |
| 564 | Ga0207641_10021128 | 3300026088 | Bacteria | 5350 |
| 565 | Ga0207641_10085529 | 3300026088 | Bacteria | 2748 |
| 566 | Ga0207648_10000265 | 3300026089 | Bacteria | 56755 |
| 567 | Ga0207648_10003896 | 3300026089 | Bacteria | 15568 |
| 568 | Ga0207648_10026807 | 3300026089 | Bacteria | 5118 |
| 569 | Ga0207648_10031871 | 3300026089 | Bacteria | 4657 |
| 570 | Ga0207648_10063517 | 3300026089 | Bacteria | 3218 |
| 571 | Ga0207648_10067457 | 3300026089 | Bacteria | 3118 |
| 572 | Ga0207676_10011925 | 3300026095 | Bacteria | 6220 |
| 573 | Ga0207676_10012250 | 3300026095 | Bacteria | 6137 |
| 574 | Ga0207676_10058205 | 3300026095 | Bacteria | 3047 |
| 575 | Ga0207676_10133049 | 3300026095 | Bacteria | 2117 |
| 576 | Ga0207676_10162995 | 3300026095 | Bacteria | 1934 |
| 577 | Ga0207676_10364707 | 3300026095 | Bacteria | 1340 |
| 578 | Ga0207674_10026678 | 3300026116 | Bacteria | 6129 |
| 579 | Ga0207674_10048165 | 3300026116 | Bacteria | 4364 |
| 580 | Ga0207674_10056236 | 3300026116 | Bacteria | 3996 |
| 581 | Ga0207674_10095874 | 3300026116 | Bacteria | 2952 |
| 582 | Ga0207674_10097405 | 3300026116 | Bacteria | 2925 |
| 583 | Ga0207674_10123429 | 3300026116 | Bacteria | 2556 |
| 584 | Ga0207675_100000182 | 3300026118 | Bacteria | 56879 |
| 585 | Ga0207675_100033522 | 3300026118 | Bacteria | 4785 |
| 586 | Ga0207675_100077615 | 3300026118 | Bacteria | 3112 |
| 587 | Ga0207675_100223542 | 3300026118 | Bacteria | 1814 |
| 588 | Ga0207683_10000308 | 3300026121 | Bacteria | 44216 |
| 589 | Ga0207683_10000611 | 3300026121 | Bacteria | 32981 |
| 590 | Ga0207683_10053724 | 3300026121 | Bacteria | 3532 |
| 591 | Ga0207683_10056794 | 3300026121 | Bacteria | 3435 |
| 592 | Ga0207683_10183054 | 3300026121 | Bacteria | 1900 |
| 593 | Ga0207698_10001809 | 3300026142 | Bacteria | 12492 |
| 594 | Ga0207698_10130595 | 3300026142 | Bacteria | 2146 |
| 595 | Ga0207698_10237043 | 3300026142 | Bacteria | 1660 |
| 596 | Ga0209969_1010690 | 3300027360 | Bacteria | 1315 |
| 597 | Ga0209967_1000620 | 3300027364 | Bacteria | 4593 |
| 598 | Ga0210000_1002190 | 3300027462 | Bacteria | 2770 |
| 599 | Ga0210000_1003715 | 3300027462 | Bacteria | 2204 |
| 600 | Ga0209995_1005856 | 3300027471 | Bacteria | 1979 |
| 601 | Ga0209999_1005808 | 3300027543 | Bacteria | 2219 |
| 602 | Ga0209999_1008713 | 3300027543 | Bacteria | 1832 |
| 603 | Ga0209970_1003460 | 3300027614 | Bacteria | 2653 |
| 604 | Ga0209282_1000795 | 3300027666 | Bacteria | 16072 |
| 605 | Ga0209588_1014430 | 3300027671 | Bacteria | 2418 |
| 606 | Ga0209974_10005799 | 3300027876 | Bacteria | 4331 |
| 607 | Ga0209974_10021675 | 3300027876 | Bacteria | 2129 |
| 608 | Ga0207428_10001034 | 3300027907 | Bacteria | 30690 |
| 609 | Ga0207428_10103884 | 3300027907 | Bacteria | 2193 |
| 610 | Ga0268266_10012628 | 3300028379 | Bacteria | 7298 |
| 611 | Ga0268266_10038502 | 3300028379 | Bacteria | 4070 |
| 612 | Ga0268266_10213696 | 3300028379 | Bacteria | 1770 |
| 613 | Ga0268266_10255986 | 3300028379 | Bacteria | 1621 |
| 614 | Ga0268265_10000818 | 3300028380 | Bacteria | 29529 |
| 615 | Ga0268265_10001580 | 3300028380 | Bacteria | 18852 |
| 616 | Ga0268265_10004295 | 3300028380 | Bacteria | 9943 |
| 617 | Ga0268265_10054256 | 3300028380 | Bacteria | 3040 |
| 618 | Ga0268265_10149146 | 3300028380 | Bacteria | 1970 |
| 619 | Ga0268264_10000909 | 3300028381 | Bacteria | 31074 |
| 620 | Ga0268264_10006840 | 3300028381 | Bacteria | 9575 |
| 621 | Ga0268264_10026779 | 3300028381 | Bacteria | 4710 |
| 622 | Ga0307515_10000058 | 3300028794 | Bacteria | 259680 |
| 623 | Ga0307515_10000468 | 3300028794 | Bacteria | 96483 |
| 624 | Ga0307515_10001320 | 3300028794 | Bacteria | 56334 |
| 625 | Ga0265338_10000350 | 3300028800 | Bacteria | 83778 |
| 626 | Ga0265338_10136804 | 3300028800 | Bacteria | 1925 |
| 627 | Ga0265324_10077431 | 3300029957 | Bacteria | 1131 |
| 628 | Ga0314311_1019906 | 3300030733 | Bacteria | 5718 |
| 629 | Ga0316182_1006065 | 3300030745 | Bacteria | 3181 |
| 630 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 631 | Ga0265332_10015105 | 3300031238 | Bacteria | 3412 |
| 632 | Ga0265327_10002065 | 3300031251 | Bacteria | 22495 |
| 633 | Ga0265327_10013789 | 3300031251 | Bacteria | 5341 |
| 634 | Ga0265316_10158752 | 3300031344 | Bacteria | 1691 |
| 635 | Ga0307408_100090527 | 3300031548 | Bacteria | 2309 |
| 636 | Ga0265314_10000481 | 3300031711 | Bacteria | 52341 |
| 637 | Ga0316578_10023142 | 3300031728 | Bacteria | 3475 |
| 638 | Ga0307405_10032286 | 3300031731 | Bacteria | 3093 |
| 639 | Ga0307405_10186056 | 3300031731 | Bacteria | 1495 |
| 640 | Ga0307406_10001349 | 3300031901 | Bacteria | 13761 |
| 641 | Ga0307406_10002313 | 3300031901 | Bacteria | 10347 |
| 642 | Ga0307406_10299273 | 3300031901 | Bacteria | 1235 |
| 643 | Ga0307412_10026388 | 3300031911 | Bacteria | 3610 |
| 644 | Ga0307412_10196884 | 3300031911 | Bacteria | 1527 |
| 645 | Ga0307416_100042082 | 3300032002 | Bacteria | 3563 |
| 646 | Ga0307416_100126191 | 3300032002 | Bacteria | 2292 |
| 647 | Ga0307416_100201197 | 3300032002 | Bacteria | 1890 |
| 648 | Ga0307416_100403130 | 3300032002 | Bacteria | 1406 |
| 649 | Ga0307411_10002662 | 3300032005 | Bacteria | 7997 |
| 650 | Ga0307411_10209786 | 3300032005 | Bacteria | 1503 |
| 651 | Ga0316583_10012150 | 3300032133 | Bacteria | 3106 |
| 652 | Ga0373930_0008188 | 3300034816 | Bacteria | 1825 |
| 653 | Ga0373928_0003570 | 3300035084 | Bacteria | 2965 |
| 654 | Ga0373929_0003033 | 3300035085 | Bacteria | 3056 |
| 655 | Ga0373940_0016602 | 3300035088 | Bacteria | 1825 |
| 656 | Ga0373944_0005926 | 3300035089 | Bacteria | 3233 |
| 657 | Ga0373949_0002756 | 3300035090 | Bacteria | 4385 |
| 658 | Ga0373923_0009299 | 3300035111 | Bacteria | 3543 |
| 659 | Ga0373932_0003784 | 3300035112 | Bacteria | 3608 |
| 660 | Ga0373939_0002155 | 3300035114 | Bacteria | 4673 |
| 661 | Ga0373941_0004319 | 3300035115 | Bacteria | 3275 |
| 662 | Ga0373941_0022138 | 3300035115 | Bacteria | 1800 |
| 663 | Ga0373941_0030441 | 3300035115 | Bacteria | 1600 |
| 664 | Ga0373954_0000210 | 3300035118 | Bacteria | 21283 |
| 665 | Ga0373960_0004454 | 3300035121 | Bacteria | 3211 |
| 666 | Ga0373946_0005537 | 3300035171 | Bacteria | 4557 |
| 667 | Ga0373942_0001690 | 3300035207 | Bacteria | 5589 |
| 668 | Ga0373961_0011514 | 3300035241 | Bacteria | 2196 |
| 669 | Ga0373962_0009214 | 3300035242 | Bacteria | 2441 |
| 670 | Ga0373924_0001388 | 3300035410 | Bacteria | 7838 |
| 671 | Ga0373931_0000062 | 3300035691 | Bacteria | 54491 |
| 672 | Ga0373931_0022673 | 3300035691 | Bacteria | 3162 |
| 673 | Ga0373931_0053492 | 3300035691 | Bacteria | 2154 |
| 674 | Ga0373931_0069565 | 3300035691 | Bacteria | 1918 |
| 675 | Ga0373931_0135374 | 3300035691 | Bacteria | 1422 |
| 676 | Ga0373933_0001438 | 3300035724 | Bacteria | 13917 |
| 677 | Ga0373933_0007663 | 3300035724 | Bacteria | 5894 |
| 678 | Ga0373937_0003410 | 3300036401 | Bacteria | 13337 |
| 679 | Ga0373937_0009139 | 3300036401 | Bacteria | 8599 |
| 680 | Ga0373937_0026857 | 3300036401 | Bacteria | 5205 |
| 681 | Ga0373937_0040869 | 3300036401 | Bacteria | 4228 |
| 682 | Ga0316582_0013270 | 3300036647 | Bacteria | 4632 |
| 683 | Ga0395899_0169538 | 3300037312 | Bacteria | 1538 |
| 684 | Ga0395900_0169363 | 3300037418 | Bacteria | 2224 |
| 685 | Ga0316581_0008234 | 3300037588 | Bacteria | 2829 |
| 686 | Ga0439439_0006043 | 3300041406 | Bacteria | 2787 |
| 687 | Ga0439461_0018591 | 3300041410 | Bacteria | 1362 |
| 688 | Ga0439466_0008421 | 3300041411 | Bacteria | 3887 |
| 689 | Ga0439466_0016927 | 3300041411 | Bacteria | 2630 |
| 690 | Ga0439466_0018100 | 3300041411 | Bacteria | 2530 |
| 691 | Ga0439465_0005112 | 3300041413 | Bacteria | 4210 |
| 692 | Ga0451841_0312808 | 3300041498 | Bacteria | 1150 |
| 693 | Ga0439431_0001324 | 3300041997 | Bacteria | 5449 |
| 694 | Ga0439431_0008028 | 3300041997 | Bacteria | 2365 |
| 695 | Ga0439431_0009507 | 3300041997 | Bacteria | 2197 |
| 696 | Ga0439433_0000088 | 3300041999 | Bacteria | 12634 |
| 697 | Ga0439433_0001045 | 3300041999 | Bacteria | 5617 |
| 698 | Ga0439441_000286 | 3300042001 | Bacteria | 5029 |
| 699 | Ga0439441_000342 | 3300042001 | Bacteria | 4771 |
| 700 | Ga0439442_000991 | 3300042002 | Bacteria | 5733 |
| 701 | Ga0439442_002915 | 3300042002 | Bacteria | 3372 |
| 702 | Ga0439442_005941 | 3300042002 | Bacteria | 2447 |
| 703 | Ga0439443_000254 | 3300042003 | Bacteria | 4228 |
| 704 | Ga0439445_0000038 | 3300042004 | Bacteria | 17912 |
| 705 | Ga0439432_004611 | 3300042006 | Bacteria | 5021 |
| 706 | Ga0439449_0000654 | 3300042007 | Bacteria | 13073 |
| 707 | Ga0439449_0001890 | 3300042007 | Bacteria | 8253 |
| 708 | Ga0439449_0001985 | 3300042007 | Bacteria | 8047 |
| 709 | Ga0439452_003838 | 3300042010 | Bacteria | 5161 |
| 710 | Ga0439452_005074 | 3300042010 | Bacteria | 4297 |
| 711 | Ga0439457_002262 | 3300042014 | Bacteria | 5560 |
| 712 | Ga0439462_0001430 | 3300042015 | Bacteria | 5313 |
| 713 | Ga0450919_002040 | 3300042121 | Bacteria | 2627 |
| 714 | Ga0450920_005881 | 3300042122 | Bacteria | 2192 |
| 715 | Ga0450923_000082 | 3300042125 | Bacteria | 7965 |
| 716 | Ga0450906_004114 | 3300042145 | Bacteria | 3077 |
| 717 | Ga0450906_005854 | 3300042145 | Bacteria | 2507 |
| 718 | Ga0439446_0006771 | 3300042156 | Bacteria | 3000 |
| 719 | Ga0439446_0018238 | 3300042156 | Bacteria | 1964 |
| 720 | Ga0439446_0030557 | 3300042156 | Bacteria | 1557 |
| 721 | Ga0450908_000361 | 3300042184 | Bacteria | 8786 |
| 722 | Ga0450909_004127 | 3300042185 | Bacteria | 2070 |
| 723 | Ga0439434_0000113 | 3300042435 | Bacteria | 21172 |
| 724 | Ga0439434_0003215 | 3300042435 | Bacteria | 4799 |
| 725 | Ga0439435_0000473 | 3300042436 | Bacteria | 6371 |
| 726 | Ga0439460_0000631 | 3300042461 | Bacteria | 7721 |
| 727 | Ga0450918_001007 | 3300042531 | Bacteria | 5849 |
| 728 | Ga0451577_0008793 | 3300042876 | Bacteria | 9785 |
| 729 | Ga0451577_0018812 | 3300042876 | Bacteria | 6356 |
| 730 | Ga0451577_0037209 | 3300042876 | Bacteria | 4380 |
| 731 | Ga0451577_0095475 | 3300042876 | Bacteria | 2655 |
| 732 | Ga0451577_0101090 | 3300042876 | Bacteria | 2576 |
| 733 | Ga0451577_0136974 | 3300042876 | Bacteria | 2198 |
| 734 | Ga0451577_0220298 | 3300042876 | Bacteria | 1715 |
| 735 | Ga0451577_0368695 | 3300042876 | Bacteria | 1303 |
| 736 | Ga0466972_0006017 | 3300044658 | Bacteria | 6095 |
| 737 | Ga0466977_0004540 | 3300044666 | Bacteria | 7047 |
| 738 | Ga0466965_0005919 | 3300044683 | Bacteria | 5522 |
| 739 | Ga0466965_0008451 | 3300044683 | Bacteria | 4765 |
| 740 | Ga0466961_0000499 | 3300044693 | Bacteria | 25055 |
| 741 | Ga0466964_0005193 | 3300044706 | Bacteria | 4826 |
| 742 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 743 | Ga0453684_0023470 | 3300044712 | Bacteria | 9078 |
| 744 | Ga0453684_0083116 | 3300044712 | Bacteria | 3986 |
| 745 | Ga0453684_0205026 | 3300044712 | Bacteria | 2296 |
| 746 | Ga0453684_0243395 | 3300044712 | Bacteria | 2070 |
| 747 | Ga0466968_0011804 | 3300044735 | Bacteria | 3407 |
| 748 | Ga0466957_0032413 | 3300044842 | Bacteria | 3128 |
| 749 | Ga0466960_0031324 | 3300044901 | Bacteria | 2453 |
| 750 | Ga0451576_0001787 | 3300045051 | Bacteria | 35253 |
| 751 | Ga0451576_0002877 | 3300045051 | Bacteria | 24625 |
| 752 | Ga0451576_0003213 | 3300045051 | Bacteria | 22785 |
| 753 | Ga0451576_0008064 | 3300045051 | Bacteria | 12423 |
| 754 | Ga0451576_0010170 | 3300045051 | Bacteria | 10823 |
| 755 | Ga0451576_0012002 | 3300045051 | Bacteria | 9784 |
| 756 | Ga0451576_0016403 | 3300045051 | Bacteria | 8176 |
| 757 | Ga0451576_0160305 | 3300045051 | Bacteria | 2347 |
| 758 | Ga0451576_0253546 | 3300045051 | Bacteria | 1839 |
| 759 | Ga0451576_0318573 | 3300045051 | Bacteria | 1627 |
| 760 | Ga0466967_0003717 | 3300045976 | Bacteria | 10054 |
| 761 | Ga0495627_007760 | 3300046453 | Bacteria | 4088 |
| 762 | Ga0495592_0009024 | 3300046454 | Bacteria | 7493 |
| 763 | Ga0495603_0036970 | 3300046455 | Bacteria | 2930 |
| 764 | Ga0495629_0085607 | 3300046459 | Bacteria | 2199 |
| 765 | Ga0495638_0023942 | 3300046460 | Bacteria | 3987 |
| 766 | Ga0495580_0006729 | 3300046472 | Bacteria | 9331 |
| 767 | Ga0495605_0097449 | 3300046474 | Bacteria | 1355 |
| 768 | Ga0495639_0005541 | 3300046475 | Bacteria | 5435 |
| 769 | Ga0495662_0074644 | 3300046476 | Bacteria | 1645 |
| 770 | Ga0495608_0004731 | 3300046511 | Bacteria | 9740 |
| 771 | Ga0495608_0175474 | 3300046511 | Bacteria | 1358 |
| 772 | Ga0495616_0002565 | 3300046513 | Bacteria | 11973 |
| 773 | Ga0495620_0033715 | 3300046515 | Bacteria | 2322 |
| 774 | Ga0495620_0053275 | 3300046515 | Bacteria | 1714 |
| 775 | Ga0495628_0007988 | 3300046516 | Bacteria | 9116 |
| 776 | Ga0495628_0012002 | 3300046516 | Bacteria | 7307 |
| 777 | Ga0495630_0001001 | 3300046517 | Bacteria | 19663 |
| 778 | Ga0495630_0062383 | 3300046517 | Bacteria | 2800 |
| 779 | Ga0495631_0001040 | 3300046518 | Bacteria | 17215 |
| 780 | Ga0495637_0036259 | 3300046520 | Bacteria | 2149 |
| 781 | Ga0495666_0006235 | 3300046526 | Bacteria | 6007 |
| 782 | Ga0495666_0017771 | 3300046526 | Bacteria | 3541 |
| 783 | Ga0495642_0012814 | 3300046528 | Bacteria | 3236 |
| 784 | Ga0495652_0225071 | 3300046529 | Bacteria | 1407 |
| 785 | Ga0495654_0005652 | 3300046530 | Bacteria | 7223 |
| 786 | Ga0495654_0113350 | 3300046530 | Bacteria | 1235 |
| 787 | Ga0495665_0016870 | 3300046531 | Bacteria | 3932 |
| 788 | Ga0495640_0004549 | 3300046533 | Bacteria | 11056 |
| 789 | Ga0495586_0001499 | 3300046535 | Bacteria | 12886 |
| 790 | Ga0495598_0001069 | 3300046537 | Bacteria | 5256 |
| 791 | Ga0495621_0002227 | 3300046539 | Bacteria | 5183 |
| 792 | Ga0495621_0035190 | 3300046539 | Bacteria | 1733 |
| 793 | Ga0495621_0036395 | 3300046539 | Bacteria | 1708 |
| 794 | Ga0495645_0001930 | 3300046543 | Bacteria | 14080 |
| 795 | Ga0495645_0099123 | 3300046543 | Bacteria | 2073 |
| 796 | Ga0495645_0138284 | 3300046543 | Bacteria | 1702 |
| 797 | Ga0495622_0023983 | 3300046557 | Bacteria | 2847 |
| 798 | Ga0495667_0014114 | 3300046559 | Bacteria | 5392 |
| 799 | Ga0495667_0022383 | 3300046559 | Bacteria | 4257 |
| 800 | Ga0495656_0001092 | 3300046615 | Bacteria | 8793 |
| 801 | Ga0495668_0006944 | 3300046616 | Bacteria | 7327 |
| 802 | Ga0495634_0011090 | 3300046642 | Bacteria | 6573 |
| 803 | Ga0495625_0000114 | 3300046660 | Bacteria | 123268 |
| 804 | Ga0495635_0145736 | 3300046663 | Bacteria | 1612 |
| 805 | Ga0495588_0019099 | 3300046674 | Bacteria | 3354 |
| 806 | Ga0495588_0041360 | 3300046674 | Bacteria | 2353 |
| 807 | Ga0495657_0080708 | 3300046675 | Bacteria | 2105 |
| 808 | Ga0495657_0163068 | 3300046675 | Bacteria | 1378 |
| 809 | Ga0495599_0012523 | 3300046678 | Bacteria | 5232 |
| 810 | Ga0495599_0015568 | 3300046678 | Bacteria | 4721 |
| 811 | Ga0495623_0013457 | 3300046679 | Bacteria | 5305 |
| 812 | Ga0495623_0108500 | 3300046679 | Bacteria | 1685 |
| 813 | Ga0495658_0011040 | 3300046683 | Bacteria | 4531 |
| 814 | Ga0495658_0185580 | 3300046683 | Bacteria | 1291 |
| 815 | Ga0495613_0006610 | 3300046689 | Bacteria | 8666 |
| 816 | Ga0495613_0226815 | 3300046689 | Bacteria | 1310 |
| 817 | Ga0495624_0043767 | 3300046690 | Bacteria | 2855 |
| 818 | Ga0495670_0056757 | 3300046691 | Bacteria | 1965 |
| 819 | Ga0495600_0004232 | 3300046809 | Bacteria | 8571 |
| 820 | Ga0495636_0004863 | 3300047318 | Bacteria | 5261 |
| 821 | Ga0495674_0039300 | 3300047319 | Bacteria | 4243 |
| 822 | Ga0495674_0039453 | 3300047319 | Bacteria | 4232 |
| 823 | Ga0495672_0005040 | 3300047320 | Bacteria | 10563 |
| 824 | Ga0495680_0190935 | 3300047322 | Bacteria | 1474 |
| 825 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 826 | Ga0495593_0008132 | 3300047673 | Bacteria | 6104 |
| 827 | Ga0495602_0185750 | 3300048088 | Bacteria | 1599 |
| 828 | Ga0495614_0003394 | 3300048089 | Bacteria | 7128 |
| 829 | Ga0496100_0102754 | 3300048903 | Bacteria | 1972 |
| 830 | Ga0496101_0001900 | 3300048904 | Bacteria | 12620 |
| 831 | Ga0496102_0004231 | 3300048905 | Bacteria | 12132 |
| 832 | Ga0496102_0274038 | 3300048905 | Bacteria | 1591 |
| 833 | Ga0496104_0002663 | 3300048907 | Bacteria | 15369 |
| 834 | Ga0496105_0001549 | 3300048908 | Bacteria | 16271 |
| 835 | Ga0496106_0034566 | 3300048909 | Bacteria | 3776 |
| 836 | Ga0496107_0043853 | 3300048910 | Bacteria | 3214 |
| 837 | Ga0496108_0007533 | 3300048911 | Bacteria | 8823 |
| 838 | Ga0496108_0178322 | 3300048911 | Bacteria | 1839 |
| 839 | Ga0496109_0054988 | 3300048912 | Bacteria | 3631 |
| 840 | Ga0496109_0152637 | 3300048912 | Bacteria | 2163 |
| 841 | Ga0496110_0000706 | 3300048913 | Bacteria | 23078 |
| 842 | Ga0496110_0097087 | 3300048913 | Bacteria | 2640 |
| 843 | Ga0496111_0063090 | 3300048914 | Bacteria | 2687 |
| 844 | Ga0496112_0270186 | 3300048915 | Bacteria | 1649 |
| 845 | Ga0496116_0021075 | 3300048919 | Bacteria | 4926 |
| 846 | Ga0496117_0008098 | 3300048920 | Bacteria | 10059 |
| 847 | Ga0496118_0029901 | 3300048921 | Bacteria | 4558 |
| 848 | Ga0496121_0089624 | 3300048924 | Bacteria | 2407 |
| 849 | Ga0496123_0073392 | 3300048926 | Bacteria | 2123 |
| 850 | Ga0496125_0034504 | 3300048928 | Bacteria | 4458 |
| 851 | Ga0496125_0058511 | 3300048928 | Bacteria | 3113 |
| 852 | Ga0501033_0000938 | 3300049570 | Bacteria | 26508 |
| 853 | Ga0501034_0007094 | 3300049571 | Bacteria | 11954 |
| 854 | Ga0501034_0047636 | 3300049571 | Bacteria | 4328 |
| 855 | Ga0501036_0020678 | 3300049572 | Bacteria | 5529 |
| 856 | Ga0501038_0004435 | 3300049574 | Bacteria | 13050 |
| 857 | Ga0501039_0001678 | 3300049575 | Bacteria | 16322 |
| 858 | Ga0501039_0324672 | 3300049575 | Bacteria | 1210 |
| 859 | Ga0501040_0003651 | 3300049576 | Bacteria | 9963 |
| 860 | Ga0501041_0000379 | 3300049577 | Bacteria | 22302 |
| 861 | Ga0501041_0020745 | 3300049577 | Bacteria | 3931 |
| 862 | Ga0501041_0071212 | 3300049577 | Bacteria | 2135 |
| 863 | Ga0501041_0169831 | 3300049577 | Bacteria | 1365 |
| 864 | Ga0501042_0000723 | 3300049578 | Bacteria | 17920 |
| 865 | Ga0501043_0048433 | 3300049579 | Bacteria | 3341 |
| 866 | Ga0501046_0001335 | 3300049580 | Bacteria | 23896 |
| 867 | Ga0501046_0006321 | 3300049580 | Bacteria | 10504 |
| 868 | Ga0501046_0113765 | 3300049580 | Bacteria | 2065 |
| 869 | Ga0501046_0167941 | 3300049580 | Bacteria | 1648 |
| 870 | Ga0501047_0025433 | 3300049581 | Bacteria | 5691 |
| 871 | Ga0501047_0281385 | 3300049581 | Bacteria | 1508 |
| 872 | Ga0501048_0001543 | 3300049582 | Bacteria | 17478 |
| 873 | Ga0501068_0033697 | 3300049584 | Bacteria | 3051 |
| 874 | Ga0501068_0122055 | 3300049584 | Bacteria | 1625 |
| 875 | Ga0501069_0000942 | 3300049585 | Bacteria | 13871 |
| 876 | Ga0501069_0123807 | 3300049585 | Bacteria | 1478 |
| 877 | Ga0501070_0003078 | 3300049586 | Bacteria | 14519 |
| 878 | Ga0501070_0014380 | 3300049586 | Bacteria | 6658 |
| 879 | Ga0501070_0238908 | 3300049586 | Bacteria | 1487 |
| 880 | Ga0501071_0001886 | 3300049587 | Bacteria | 12453 |
| 881 | Ga0501071_0018176 | 3300049587 | Bacteria | 4862 |
| 882 | Ga0501071_0070335 | 3300049587 | Bacteria | 2549 |
| 883 | Ga0501071_0207138 | 3300049587 | Bacteria | 1474 |
| 884 | Ga0501072_0000730 | 3300049588 | Bacteria | 23956 |
| 885 | Ga0501072_0008283 | 3300049588 | Bacteria | 7900 |
| 886 | Ga0501073_0003022 | 3300049589 | Bacteria | 12609 |
| 887 | Ga0501073_0005339 | 3300049589 | Bacteria | 9636 |
| 888 | Ga0501074_0005252 | 3300049590 | Bacteria | 9317 |
| 889 | Ga0501074_0005970 | 3300049590 | Bacteria | 8786 |
| 890 | Ga0501074_0019604 | 3300049590 | Bacteria | 4909 |
| 891 | Ga0501074_0046248 | 3300049590 | Bacteria | 3147 |
| 892 | Ga0501074_0125069 | 3300049590 | Bacteria | 1839 |
| 893 | Ga0501074_0169899 | 3300049590 | Bacteria | 1557 |
| 894 | Ga0501075_0000411 | 3300049591 | Bacteria | 24982 |
| 895 | Ga0501075_0007281 | 3300049591 | Bacteria | 7672 |
| 896 | Ga0501075_0031212 | 3300049591 | Bacteria | 3953 |
| 897 | Ga0501076_0000861 | 3300049592 | Bacteria | 19709 |
| 898 | Ga0501076_0017164 | 3300049592 | Bacteria | 5498 |
| 899 | Ga0501077_0061697 | 3300049593 | Bacteria | 2379 |
| 900 | Ga0501249_004119 | 3300049679 | Bacteria | 2942 |
| 901 | Ga0501079_0001087 | 3300049741 | Bacteria | 18873 |
| 902 | Ga0501079_0002789 | 3300049741 | Bacteria | 12734 |
| 903 | Ga0501079_0006549 | 3300049741 | Bacteria | 8754 |
| 904 | Ga0501080_0004879 | 3300049742 | Bacteria | 11950 |
| 905 | Ga0501080_0012613 | 3300049742 | Bacteria | 7749 |
| 906 | Ga0501080_0028657 | 3300049742 | Bacteria | 5183 |
| 907 | Ga0501080_0298218 | 3300049742 | Bacteria | 1462 |
| 908 | Ga0501080_0338571 | 3300049742 | Bacteria | 1360 |
| 909 | Ga0501080_0420112 | 3300049742 | Bacteria | 1201 |
| 910 | Ga0501081_0003501 | 3300049743 | Bacteria | 10037 |
| 911 | Ga0501081_0161244 | 3300049743 | Bacteria | 1616 |
| 912 | Ga0501083_0012662 | 3300049744 | Bacteria | 5902 |
| 913 | Ga0501083_0038854 | 3300049744 | Bacteria | 3234 |
| 914 | Ga0501035_0030221 | 3300049822 | Bacteria | 4939 |
| 915 | Ga0501035_0097495 | 3300049822 | Bacteria | 2582 |
| 916 | Ga0501035_0212421 | 3300049822 | Bacteria | 1655 |
| 917 | Ga0501044_0102442 | 3300049823 | Bacteria | 2879 |
| 918 | Ga0501044_0175921 | 3300049823 | Bacteria | 2109 |
| 919 | Ga0501045_0001439 | 3300049824 | Bacteria | 15853 |
| 920 | Ga0501045_0242669 | 3300049824 | Bacteria | 1341 |
| 921 | nmdc:mga03n38_2559_c1 | 3300050490 | Bacteria | 5651 |
| 922 | nmdc:mga00v17_73454_c1 | 3300050491 | Bacteria | 2124 |
| 923 | nmdc:mga0yw44_66932_c1 | 3300050492 | Bacteria | 2219 |
| 924 | nmdc:mga0k408_27742_c1 | 3300050493 | Bacteria | 3217 |
| 925 | nmdc:mga0k408_38601_c1 | 3300050493 | Bacteria | 2741 |
| 926 | nmdc:mga0k408_51893_c1 | 3300050493 | Bacteria | 1854 |
| 927 | nmdc:mga07m45_162435_c1 | 3300050496 | Bacteria | 1297 |
| 928 | nmdc:mga05p37_239873_c1 | 3300050507 | Bacteria | 2180 |
| 929 | nmdc:mga05p37_3424_c1 | 3300050507 | Bacteria | 18509 |
| 930 | nmdc:mga09592_1698_c1 | 3300050508 | Bacteria | 17757 |
| 931 | nmdc:mga09592_196881_c1 | 3300050508 | Bacteria | 1745 |
| 932 | nmdc:mga09592_30226_c1 | 3300050508 | Bacteria | 4507 |
| 933 | nmdc:mga09592_340285_c1 | 3300050508 | Bacteria | 1299 |
| 934 | nmdc:mga0qj67_10467_c1 | 3300050509 | Bacteria | 6928 |
| 935 | nmdc:mga0qj67_107710_c2 | 3300050509 | Bacteria | 1836 |
| 936 | nmdc:mga06r32_172405_c1 | 3300050510 | Bacteria | 2147 |
| 937 | nmdc:mga06r32_812_c1 | 3300050510 | Bacteria | 27757 |
| 938 | nmdc:mga08y16_108428_c1 | 3300050511 | Bacteria | 2891 |
| 939 | nmdc:mga08y16_1548_c1 | 3300050511 | Bacteria | 23173 |
| 940 | nmdc:mga08y16_15859_c1 | 3300050511 | Bacteria | 7920 |
| 941 | nmdc:mga08y16_16812_c1 | 3300050511 | Bacteria | 7701 |
| 942 | nmdc:mga08y16_305883_c1 | 3300050511 | Bacteria | 1638 |
| 943 | nmdc:mga08y16_80864_c1 | 3300050511 | Bacteria | 3388 |
| 944 | nmdc:mga08y16_88346_c1 | 3300050511 | Bacteria | 3230 |
| 945 | nmdc:mga0n895_121741_c1 | 3300050512 | Bacteria | 2630 |
| 946 | nmdc:mga0n895_201551_c1 | 3300050512 | Bacteria | 2021 |
| 947 | nmdc:mga0n895_28767_c1 | 3300050512 | Bacteria | 5291 |
| 948 | nmdc:mga0n895_33504_c1 | 3300050512 | Bacteria | 4938 |
| 949 | nmdc:mga0rr50_13378_c1 | 3300050513 | Bacteria | 5341 |
| 950 | nmdc:mga0rr50_203655_c1 | 3300050513 | Bacteria | 1627 |
| 951 | nmdc:mga0rr50_2572_c1 | 3300050513 | Bacteria | 10277 |
| 952 | nmdc:mga0rr50_348037_c1 | 3300050513 | Bacteria | 1246 |
| 953 | nmdc:mga0rr50_436_c1 | 3300050513 | Bacteria | 22427 |
| 954 | nmdc:mga0rr50_60030_c1 | 3300050513 | Bacteria | 2859 |
| 955 | nmdc:mga08x19_1428_c1 | 3300050514 | Bacteria | 14774 |
| 956 | nmdc:mga08x19_180935_c1 | 3300050514 | Bacteria | 1439 |
| 957 | nmdc:mga08x19_3510_c1 | 3300050514 | Bacteria | 9333 |
| 958 | nmdc:mga08x19_38557_c1 | 3300050514 | Bacteria | 3035 |
| 959 | nmdc:mga08x19_487_c1 | 3300050514 | Bacteria | 26435 |
| 960 | nmdc:mga0a205_100380_c1 | 3300050515 | Bacteria | 2793 |
| 961 | nmdc:mga0a205_1353_c1 | 3300050515 | Bacteria | 20648 |
| 962 | nmdc:mga0a205_386498_c1 | 3300050515 | Bacteria | 1264 |
| 963 | Ga0500651_0000967 | 3300053093 | Bacteria | 14133 |
| 964 | Ga0500566_0005275 | 3300053094 | Bacteria | 7691 |
| 965 | Ga0500571_000098 | 3300053110 | Bacteria | 28557 |
| 966 | Ga0500594_0000650 | 3300053118 | Bacteria | 7417 |
| 967 | Ga0500607_023878 | 3300053121 | Bacteria | 3421 |
| 968 | Ga0500618_016401 | 3300053125 | Bacteria | 1854 |
| 969 | Ga0500658_0001601 | 3300053134 | Bacteria | 9050 |
| 970 | Ga0500559_0002136 | 3300053136 | Bacteria | 10521 |
| 971 | Ga0500559_0028570 | 3300053136 | Bacteria | 2383 |
| 972 | Ga0500568_0007761 | 3300053139 | Bacteria | 5231 |
| 973 | Ga0500574_009406 | 3300053141 | Bacteria | 2121 |
| 974 | Ga0500604_0053702 | 3300053151 | Bacteria | 1250 |
| 975 | Ga0500616_0014630 | 3300053153 | Bacteria | 4503 |
| 976 | Ga0500627_0037841 | 3300053158 | Bacteria | 2061 |
| 977 | Ga0501084_0012332 | 3300054114 | Bacteria | 7078 |
| 978 | Ga0501084_0013879 | 3300054114 | Bacteria | 6667 |
| 979 | Ga0501082_0002225 | 3300060353 | Bacteria | 16966 |
| 980 | Ga0501082_0026242 | 3300060353 | Bacteria | 5020 |
| 981 | Ga0501082_0065813 | 3300060353 | Bacteria | 3121 |
| 982 | Ga0501082_0117772 | 3300060353 | Bacteria | 2301 |
| 983 | Ga0466962_0002885 | 3300061719 | Bacteria | 8200 |
| 984 | Ga0530510_0000870 | 3300061734 | Bacteria | 19874 |
| 985 | Ga0530510_0001009 | 3300061734 | Bacteria | 18700 |
| 986 | Ga0530510_0271887 | 3300061734 | Bacteria | 1265 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025920 | Ga0207649_10279379 | Ga0207649_102793792 | 288 |
| 2 | 3300042876 | Ga0451577_0368695 | Ga0451577_0368695_384_1280 | 288 |
| 3 | 3300034816 | Ga0373930_0008188 | Ga0373930_0008188_19_906 | 291 |
| 4 | 3300046474 | Ga0495605_0097449 | Ga0495605_0097449_28_1161 | 292 |
| 5 | 3300046530 | Ga0495654_0113350 | Ga0495654_0113350_329_1216 | 292 |
| 6 | 3300046515 | Ga0495620_0053275 | Ga0495620_0053275_24_977 | 303 |
| 7 | 3300049575 | Ga0501039_0324672 | Ga0501039_0324672_213_1163 | 311 |
| 8 | 3300025938 | Ga0207704_10113122 | Ga0207704_101131223 | 313 |
| 9 | 3300035118 | Ga0373954_0000210 | Ga0373954_0000210_19308_20297 | 313 |
| 10 | 3300035724 | Ga0373933_0001438 | Ga0373933_0001438_4111_5100 | 313 |
| 11 | 3300036401 | Ga0373937_0003410 | Ga0373937_0003410_2969_3958 | 313 |
| 12 | 3300005440 | Ga0070705_100017908 | Ga0070705_1000179082 | 317 |
| 13 | 3300005444 | Ga0070694_100024371 | Ga0070694_1000243714 | 317 |
| 14 | 3300005467 | Ga0070706_100108259 | Ga0070706_1001082592 | 317 |
| 15 | 3300005518 | Ga0070699_100077562 | Ga0070699_1000775623 | 317 |
| 16 | 3300005536 | Ga0070697_100008436 | Ga0070697_1000084366 | 317 |
| 17 | 3300005545 | Ga0070695_100000692 | Ga0070695_10000069212 | 317 |
| 18 | 3300005546 | Ga0070696_100008744 | Ga0070696_1000087442 | 317 |
| 19 | 3300006914 | Ga0075436_100032054 | Ga0075436_1000320543 | 317 |
| 20 | 3300005328 | Ga0070676_10000313 | Ga0070676_100003139 | 318 |
| 21 | 3300005333 | Ga0070677_10003289 | Ga0070677_100032893 | 318 |
| 22 | 3300005334 | Ga0068869_100010273 | Ga0068869_1000102733 | 318 |
| 23 | 3300005335 | Ga0070666_10006030 | Ga0070666_100060303 | 318 |
| 24 | 3300005338 | Ga0068868_100002154 | Ga0068868_1000021549 | 318 |
| 25 | 3300005340 | Ga0070689_100080902 | Ga0070689_1000809022 | 318 |
| 26 | 3300005347 | Ga0070668_100004065 | Ga0070668_1000040652 | 318 |
| 27 | 3300005354 | Ga0070675_100024700 | Ga0070675_1000247002 | 318 |
| 28 | 3300005355 | Ga0070671_100016418 | Ga0070671_1000164183 | 318 |
| 29 | 3300005356 | Ga0070674_100012986 | Ga0070674_1000129862 | 318 |
| 30 | 3300005364 | Ga0070673_100003250 | Ga0070673_1000032508 | 318 |
| 31 | 3300005367 | Ga0070667_100015489 | Ga0070667_1000154892 | 318 |
| 32 | 3300005455 | Ga0070663_100003404 | Ga0070663_1000034046 | 318 |
| 33 | 3300005456 | Ga0070678_100000650 | Ga0070678_1000006503 | 318 |
| 34 | 3300005457 | Ga0070662_100029819 | Ga0070662_1000298192 | 318 |
| 35 | 3300005459 | Ga0068867_100001882 | Ga0068867_1000018823 | 318 |
| 36 | 3300005466 | Ga0070685_10017491 | Ga0070685_100174912 | 318 |
| 37 | 3300005539 | Ga0068853_100001685 | Ga0068853_1000016858 | 318 |
| 38 | 3300005444 | Ga0070694_100195755 | Ga0070694_1001957552 | 319 |
| 39 | 3300005545 | Ga0070695_100024403 | Ga0070695_1000244032 | 319 |
| 40 | 3300005545 | Ga0070695_100027130 | Ga0070695_1000271302 | 319 |
| 41 | 3300005546 | Ga0070696_100121266 | Ga0070696_1001212662 | 319 |
| 42 | 3300005618 | Ga0068864_100094011 | Ga0068864_1000940112 | 319 |
| 43 | 3300005841 | Ga0068863_100266231 | Ga0068863_1002662312 | 319 |
| 44 | 3300007265 | Ga0099794_10012591 | Ga0099794_100125912 | 319 |
| 45 | 3300009094 | Ga0111539_10020073 | Ga0111539_100200733 | 319 |
| 46 | 3300025271 | Ga0207666_1001903 | Ga0207666_10019032 | 319 |
| 47 | 3300026095 | Ga0207676_10364707 | Ga0207676_103647072 | 319 |
| 48 | 3300031901 | Ga0307406_10001349 | Ga0307406_1000134910 | 319 |
| 49 | 3300050508 | nmdc:mga09592_340285_c1 | nmdc:mga09592_340285_c1_210_1187 | 319 |
| 50 | 3300050511 | nmdc:mga08y16_80864_c1 | nmdc:mga08y16_80864_c1_855_1832 | 319 |
| 51 | 3300005293 | Ga0065715_10221518 | Ga0065715_102215182 | 320 |
| 52 | 3300005335 | Ga0070666_10016271 | Ga0070666_100162713 | 320 |
| 53 | 3300005340 | Ga0070689_100155589 | Ga0070689_1001555892 | 320 |
| 54 | 3300005353 | Ga0070669_100076499 | Ga0070669_1000764993 | 320 |
| 55 | 3300005438 | Ga0070701_10118961 | Ga0070701_101189611 | 320 |
| 56 | 3300005456 | Ga0070678_100132226 | Ga0070678_1001322261 | 320 |
| 57 | 3300005466 | Ga0070685_10265362 | Ga0070685_102653621 | 320 |
| 58 | 3300005544 | Ga0070686_100128493 | Ga0070686_1001284932 | 320 |
| 59 | 3300005548 | Ga0070665_100139708 | Ga0070665_1001397082 | 320 |
| 60 | 3300005577 | Ga0068857_100397699 | Ga0068857_1003976991 | 320 |
| 61 | 3300005617 | Ga0068859_100478011 | Ga0068859_1004780111 | 320 |
| 62 | 3300005618 | Ga0068864_100021353 | Ga0068864_1000213535 | 320 |
| 63 | 3300005840 | Ga0068870_10079472 | Ga0068870_100794722 | 320 |
| 64 | 3300005841 | Ga0068863_100038818 | Ga0068863_1000388182 | 320 |
| 65 | 3300006931 | Ga0097620_100478010 | Ga0097620_1004780101 | 320 |
| 66 | 3300009177 | Ga0105248_10224528 | Ga0105248_102245282 | 320 |
| 67 | 3300013297 | Ga0157378_10008082 | Ga0157378_100080823 | 320 |
| 68 | 3300013308 | Ga0157375_10378031 | Ga0157375_103780311 | 320 |
| 69 | 3300014325 | Ga0163163_10413114 | Ga0163163_104131141 | 320 |
| 70 | 3300014968 | Ga0157379_10040024 | Ga0157379_100400242 | 320 |
| 71 | 3300014969 | Ga0157376_10126047 | Ga0157376_101260472 | 320 |
| 72 | 3300014969 | Ga0157376_10262271 | Ga0157376_102622711 | 320 |
| 73 | 3300025315 | Ga0207697_10014516 | Ga0207697_100145162 | 320 |
| 74 | 3300025893 | Ga0207682_10009656 | Ga0207682_100096562 | 320 |
| 75 | 3300025901 | Ga0207688_10006888 | Ga0207688_100068881 | 320 |
| 76 | 3300025918 | Ga0207662_10003774 | Ga0207662_100037746 | 320 |
| 77 | 3300025923 | Ga0207681_10072794 | Ga0207681_100727942 | 320 |
| 78 | 3300025925 | Ga0207650_10137181 | Ga0207650_101371812 | 320 |
| 79 | 3300025926 | Ga0207659_10110319 | Ga0207659_101103192 | 320 |
| 80 | 3300025931 | Ga0207644_10020376 | Ga0207644_100203762 | 320 |
| 81 | 3300025933 | Ga0207706_10039233 | Ga0207706_100392334 | 320 |
| 82 | 3300025934 | Ga0207686_10037208 | Ga0207686_100372083 | 320 |
| 83 | 3300025940 | Ga0207691_10082605 | Ga0207691_100826053 | 320 |
| 84 | 3300025941 | Ga0207711_10029400 | Ga0207711_100294002 | 320 |
| 85 | 3300025942 | Ga0207689_10201914 | Ga0207689_102019142 | 320 |
| 86 | 3300025942 | Ga0207689_10296882 | Ga0207689_102968822 | 320 |
| 87 | 3300025960 | Ga0207651_10164182 | Ga0207651_101641822 | 320 |
| 88 | 3300025972 | Ga0207668_10151285 | Ga0207668_101512852 | 320 |
| 89 | 3300025981 | Ga0207640_10147294 | Ga0207640_101472942 | 320 |
| 90 | 3300026095 | Ga0207676_10012250 | Ga0207676_100122505 | 320 |
| 91 | 3300026095 | Ga0207676_10133049 | Ga0207676_101330492 | 320 |
| 92 | 3300026116 | Ga0207674_10123429 | Ga0207674_101234291 | 320 |
| 93 | 3300026118 | Ga0207675_100033522 | Ga0207675_1000335223 | 320 |
| 94 | 3300026121 | Ga0207683_10183054 | Ga0207683_101830542 | 320 |
| 95 | 3300027907 | Ga0207428_10103884 | Ga0207428_101038842 | 320 |
| 96 | 3300028379 | Ga0268266_10213696 | Ga0268266_102136962 | 320 |
| 97 | 3300046528 | Ga0495642_0012814 | Ga0495642_0012814_2075_3079 | 320 |
| 98 | 3300046537 | Ga0495598_0001069 | Ga0495598_0001069_1504_2508 | 320 |
| 99 | 3300046539 | Ga0495621_0035190 | Ga0495621_0035190_515_1519 | 320 |
| 100 | 3300048912 | Ga0496109_0152637 | Ga0496109_0152637_1107_2111 | 320 |
| 101 | 3300050511 | nmdc:mga08y16_305883_c1 | nmdc:mga08y16_305883_c1_107_1111 | 320 |
| 102 | 3300005440 | Ga0070705_100012429 | Ga0070705_1000124292 | 321 |
| 103 | 3300005444 | Ga0070694_100013774 | Ga0070694_1000137743 | 321 |
| 104 | 3300005545 | Ga0070695_100027161 | Ga0070695_1000271613 | 321 |
| 105 | 3300005546 | Ga0070696_100025013 | Ga0070696_1000250133 | 321 |
| 106 | 3300005549 | Ga0070704_100005519 | Ga0070704_1000055194 | 321 |
| 107 | 3300013307 | Ga0157372_10060911 | Ga0157372_100609112 | 321 |
| 108 | 3300035242 | Ga0373962_0009214 | Ga0373962_0009214_713_1699 | 321 |
| 109 | 3300042003 | Ga0439443_000254 | Ga0439443_000254_1998_2972 | 321 |
| 110 | 3300042461 | Ga0439460_0000631 | Ga0439460_0000631_412_1386 | 321 |
| 111 | 3300046511 | Ga0495608_0175474 | Ga0495608_0175474_291_1292 | 321 |
| 112 | 3300049577 | Ga0501041_0071212 | Ga0501041_0071212_671_1645 | 321 |
| 113 | 3300049580 | Ga0501046_0006321 | Ga0501046_0006321_7517_8491 | 321 |
| 114 | 3300049584 | Ga0501068_0122055 | Ga0501068_0122055_287_1261 | 321 |
| 115 | 3300049587 | Ga0501071_0018176 | Ga0501071_0018176_21_995 | 321 |
| 116 | 3300049587 | Ga0501071_0207138 | Ga0501071_0207138_452_1426 | 321 |
| 117 | 3300049588 | Ga0501072_0008283 | Ga0501072_0008283_2763_3737 | 321 |
| 118 | 3300049590 | Ga0501074_0125069 | Ga0501074_0125069_724_1698 | 321 |
| 119 | 3300049591 | Ga0501075_0031212 | Ga0501075_0031212_25_999 | 321 |
| 120 | 3300049592 | Ga0501076_0017164 | Ga0501076_0017164_3593_4567 | 321 |
| 121 | 3300049593 | Ga0501077_0061697 | Ga0501077_0061697_698_1672 | 321 |
| 122 | 3300049742 | Ga0501080_0028657 | Ga0501080_0028657_826_1800 | 321 |
| 123 | 3300049743 | Ga0501081_0161244 | Ga0501081_0161244_567_1541 | 321 |
| 124 | 3300054114 | Ga0501084_0012332 | Ga0501084_0012332_2131_3105 | 321 |
| 125 | 3300060353 | Ga0501082_0117772 | Ga0501082_0117772_897_1871 | 321 |
| 126 | 3300061734 | Ga0530510_0001009 | Ga0530510_0001009_12803_13777 | 321 |
| 127 | 3300005347 | Ga0070668_100096792 | Ga0070668_1000967922 | 322 |
| 128 | 3300005353 | Ga0070669_100012049 | Ga0070669_1000120491 | 322 |
| 129 | 3300005354 | Ga0070675_100017523 | Ga0070675_1000175232 | 322 |
| 130 | 3300005354 | Ga0070675_100171539 | Ga0070675_1001715392 | 322 |
| 131 | 3300005441 | Ga0070700_100001867 | Ga0070700_10000186711 | 322 |
| 132 | 3300005441 | Ga0070700_100287623 | Ga0070700_1002876232 | 322 |
| 133 | 3300005459 | Ga0068867_100002025 | Ga0068867_1000020255 | 322 |
| 134 | 3300005536 | Ga0070697_100002360 | Ga0070697_1000023605 | 322 |
| 135 | 3300005543 | Ga0070672_100227048 | Ga0070672_1002270481 | 322 |
| 136 | 3300005543 | Ga0070672_100344566 | Ga0070672_1003445662 | 322 |
| 137 | 3300005544 | Ga0070686_100069845 | Ga0070686_1000698452 | 322 |
| 138 | 3300005549 | Ga0070704_100072836 | Ga0070704_1000728362 | 322 |
| 139 | 3300005840 | Ga0068870_10182918 | Ga0068870_101829182 | 322 |
| 140 | 3300005844 | Ga0068862_100006778 | Ga0068862_1000067785 | 322 |
| 141 | 3300006852 | Ga0075433_10203240 | Ga0075433_102032402 | 322 |
| 142 | 3300007076 | Ga0075435_100000811 | Ga0075435_1000008117 | 322 |
| 143 | 3300007076 | Ga0075435_100071689 | Ga0075435_1000716892 | 322 |
| 144 | 3300007265 | Ga0099794_10015970 | Ga0099794_100159702 | 322 |
| 145 | 3300007265 | Ga0099794_10019763 | Ga0099794_100197632 | 322 |
| 146 | 3300009094 | Ga0111539_10078279 | Ga0111539_100782792 | 322 |
| 147 | 3300009148 | Ga0105243_10003125 | Ga0105243_100031255 | 322 |
| 148 | 3300009553 | Ga0105249_10004022 | Ga0105249_100040223 | 322 |
| 149 | 3300013306 | Ga0163162_10112236 | Ga0163162_101122362 | 322 |
| 150 | 3300013308 | Ga0157375_10118307 | Ga0157375_101183073 | 322 |
| 151 | 3300014326 | Ga0157380_10003849 | Ga0157380_100038496 | 322 |
| 152 | 3300025899 | Ga0207642_10004720 | Ga0207642_100047202 | 322 |
| 153 | 3300025901 | Ga0207688_10018621 | Ga0207688_100186213 | 322 |
| 154 | 3300025908 | Ga0207643_10040818 | Ga0207643_100408182 | 322 |
| 155 | 3300025918 | Ga0207662_10113344 | Ga0207662_101133442 | 322 |
| 156 | 3300025923 | Ga0207681_10000513 | Ga0207681_100005134 | 322 |
| 157 | 3300025926 | Ga0207659_10041724 | Ga0207659_100417242 | 322 |
| 158 | 3300025935 | Ga0207709_10003231 | Ga0207709_100032316 | 322 |
| 159 | 3300025961 | Ga0207712_10011050 | Ga0207712_100110503 | 322 |
| 160 | 3300025972 | Ga0207668_10042435 | Ga0207668_100424352 | 322 |
| 161 | 3300026116 | Ga0207674_10095874 | Ga0207674_100958742 | 322 |
| 162 | 3300027360 | Ga0209969_1010690 | Ga0209969_10106902 | 322 |
| 163 | 3300027364 | Ga0209967_1000620 | Ga0209967_10006202 | 322 |
| 164 | 3300027462 | Ga0210000_1002190 | Ga0210000_10021902 | 322 |
| 165 | 3300027471 | Ga0209995_1005856 | Ga0209995_10058562 | 322 |
| 166 | 3300027543 | Ga0209999_1005808 | Ga0209999_10058082 | 322 |
| 167 | 3300027671 | Ga0209588_1014430 | Ga0209588_10144301 | 322 |
| 168 | 3300028380 | Ga0268265_10000818 | Ga0268265_1000081826 | 322 |
| 169 | 3300031251 | Ga0265327_10002065 | Ga0265327_1000206510 | 322 |
| 170 | 3300035115 | Ga0373941_0030441 | Ga0373941_0030441_120_1109 | 322 |
| 171 | 3300035207 | Ga0373942_0001690 | Ga0373942_0001690_4361_5338 | 322 |
| 172 | 3300036401 | Ga0373937_0009139 | Ga0373937_0009139_5285_6277 | 322 |
| 173 | 3300042156 | Ga0439446_0018238 | Ga0439446_0018238_99_1088 | 322 |
| 174 | 3300042435 | Ga0439434_0000113 | Ga0439434_0000113_13819_14808 | 322 |
| 175 | 3300042436 | Ga0439435_0000473 | Ga0439435_0000473_2858_3847 | 322 |
| 176 | 3300046454 | Ga0495592_0009024 | Ga0495592_0009024_1816_2808 | 322 |
| 177 | 3300046476 | Ga0495662_0074644 | Ga0495662_0074644_28_1020 | 322 |
| 178 | 3300046511 | Ga0495608_0004731 | Ga0495608_0004731_2933_3925 | 322 |
| 179 | 3300046516 | Ga0495628_0007988 | Ga0495628_0007988_2767_3759 | 322 |
| 180 | 3300046517 | Ga0495630_0001001 | Ga0495630_0001001_13102_14094 | 322 |
| 181 | 3300046526 | Ga0495666_0006235 | Ga0495666_0006235_77_1069 | 322 |
| 182 | 3300046533 | Ga0495640_0004549 | Ga0495640_0004549_4462_5454 | 322 |
| 183 | 3300046535 | Ga0495586_0001499 | Ga0495586_0001499_6941_7933 | 322 |
| 184 | 3300046543 | Ga0495645_0099123 | Ga0495645_0099123_307_1299 | 322 |
| 185 | 3300046559 | Ga0495667_0022383 | Ga0495667_0022383_2845_3837 | 322 |
| 186 | 3300046642 | Ga0495634_0011090 | Ga0495634_0011090_4725_5717 | 322 |
| 187 | 3300046663 | Ga0495635_0145736 | Ga0495635_0145736_123_1115 | 322 |
| 188 | 3300046678 | Ga0495599_0015568 | Ga0495599_0015568_2086_3078 | 322 |
| 189 | 3300046683 | Ga0495658_0011040 | Ga0495658_0011040_2375_3367 | 322 |
| 190 | 3300046689 | Ga0495613_0006610 | Ga0495613_0006610_3052_4044 | 322 |
| 191 | 3300046690 | Ga0495624_0043767 | Ga0495624_0043767_271_1263 | 322 |
| 192 | 3300046809 | Ga0495600_0004232 | Ga0495600_0004232_5280_6272 | 322 |
| 193 | 3300047318 | Ga0495636_0004863 | Ga0495636_0004863_2112_3104 | 322 |
| 194 | 3300047319 | Ga0495674_0039300 | Ga0495674_0039300_1778_2770 | 322 |
| 195 | 3300049577 | Ga0501041_0020745 | Ga0501041_0020745_2078_3055 | 322 |
| 196 | 3300049580 | Ga0501046_0167941 | Ga0501046_0167941_229_1206 | 322 |
| 197 | 3300049742 | Ga0501080_0338571 | Ga0501080_0338571_197_1207 | 322 |
| 198 | 3300050507 | nmdc:mga05p37_239873_c1 | nmdc:mga05p37_239873_c1_498_1487 | 322 |
| 199 | 3300050510 | nmdc:mga06r32_172405_c1 | nmdc:mga06r32_172405_c1_13_990 | 322 |
| 200 | 3300050511 | nmdc:mga08y16_108428_c1 | nmdc:mga08y16_108428_c1_1076_2065 | 322 |
| 201 | 3300050511 | nmdc:mga08y16_15859_c1 | nmdc:mga08y16_15859_c1_1986_2975 | 322 |
| 202 | 3300050512 | nmdc:mga0n895_201551_c1 | nmdc:mga0n895_201551_c1_750_1727 | 322 |
| 203 | 3300050513 | nmdc:mga0rr50_2572_c1 | nmdc:mga0rr50_2572_c1_619_1596 | 322 |
| 204 | 3300050514 | nmdc:mga08x19_38557_c1 | nmdc:mga08x19_38557_c1_1749_2726 | 322 |
| 205 | 3300050515 | nmdc:mga0a205_100380_c1 | nmdc:mga0a205_100380_c1_306_1283 | 322 |
| 206 | 3300061734 | Ga0530510_0271887 | Ga0530510_0271887_77_1054 | 322 |
| 207 | iso_pu_bacteria | 2554235132 | 2554812981 | 322 |
| 208 | iso_pu_bacteria | 2606217733 | 2608383436 | 322 |
| 209 | 3300003203 | JGI25406J46586_10046803 | JGI25406J46586_100468032 | 323 |
| 210 | 3300005329 | Ga0070683_100030891 | Ga0070683_1000308912 | 323 |
| 211 | 3300005336 | Ga0070680_100016773 | Ga0070680_1000167732 | 323 |
| 212 | 3300005343 | Ga0070687_100036020 | Ga0070687_1000360203 | 323 |
| 213 | 3300005365 | Ga0070688_100131707 | Ga0070688_1001317072 | 323 |
| 214 | 3300005458 | Ga0070681_10062814 | Ga0070681_100628142 | 323 |
| 215 | 3300005535 | Ga0070684_100002834 | Ga0070684_1000028349 | 323 |
| 216 | 3300005544 | Ga0070686_100012327 | Ga0070686_1000123272 | 323 |
| 217 | 3300005546 | Ga0070696_100082402 | Ga0070696_1000824022 | 323 |
| 218 | 3300005618 | Ga0068864_100087152 | Ga0068864_1000871523 | 323 |
| 219 | 3300005842 | Ga0068858_100014709 | Ga0068858_1000147094 | 323 |
| 220 | 3300005985 | Ga0081539_10000226 | Ga0081539_10000226138 | 323 |
| 221 | 3300006358 | Ga0068871_100007338 | Ga0068871_1000073382 | 323 |
| 222 | 3300006852 | Ga0075433_10001856 | Ga0075433_1000185616 | 323 |
| 223 | 3300006871 | Ga0075434_100000306 | Ga0075434_10000030637 | 323 |
| 224 | 3300006871 | Ga0075434_100001295 | Ga0075434_1000012955 | 323 |
| 225 | 3300006914 | Ga0075436_100000087 | Ga0075436_10000008728 | 323 |
| 226 | 3300006914 | Ga0075436_100189790 | Ga0075436_1001897902 | 323 |
| 227 | 3300007076 | Ga0075435_100001385 | Ga0075435_1000013855 | 323 |
| 228 | 3300007076 | Ga0075435_100018574 | Ga0075435_1000185742 | 323 |
| 229 | 3300007076 | Ga0075435_100052938 | Ga0075435_1000529383 | 323 |
| 230 | 3300007076 | Ga0075435_100184894 | Ga0075435_1001848942 | 323 |
| 231 | 3300009094 | Ga0111539_10054800 | Ga0111539_100548003 | 323 |
| 232 | 3300009147 | Ga0114129_10223463 | Ga0114129_102234631 | 323 |
| 233 | 3300009176 | Ga0105242_10001658 | Ga0105242_1000165810 | 323 |
| 234 | 3300009177 | Ga0105248_10033298 | Ga0105248_100332984 | 323 |
| 235 | 3300014968 | Ga0157379_10002873 | Ga0157379_1000287312 | 323 |
| 236 | 3300025901 | Ga0207688_10156891 | Ga0207688_101568912 | 323 |
| 237 | 3300025912 | Ga0207707_10042674 | Ga0207707_100426743 | 323 |
| 238 | 3300025917 | Ga0207660_10083168 | Ga0207660_100831682 | 323 |
| 239 | 3300025918 | Ga0207662_10097533 | Ga0207662_100975332 | 323 |
| 240 | 3300025934 | Ga0207686_10005916 | Ga0207686_100059162 | 323 |
| 241 | 3300025941 | Ga0207711_10118310 | Ga0207711_101183102 | 323 |
| 242 | 3300025944 | Ga0207661_10002842 | Ga0207661_1000284210 | 323 |
| 243 | 3300026035 | Ga0207703_10054661 | Ga0207703_100546612 | 323 |
| 244 | 3300026089 | Ga0207648_10031871 | Ga0207648_100318713 | 323 |
| 245 | 3300026095 | Ga0207676_10058205 | Ga0207676_100582052 | 323 |
| 246 | 3300027462 | Ga0210000_1003715 | Ga0210000_10037153 | 323 |
| 247 | 3300027543 | Ga0209999_1008713 | Ga0209999_10087132 | 323 |
| 248 | 3300027876 | Ga0209974_10021675 | Ga0209974_100216752 | 323 |
| 249 | 3300035115 | Ga0373941_0004319 | Ga0373941_0004319_837_1817 | 323 |
| 250 | 3300035241 | Ga0373961_0011514 | Ga0373961_0011514_513_1493 | 323 |
| 251 | 3300035691 | Ga0373931_0069565 | Ga0373931_0069565_663_1661 | 323 |
| 252 | 3300035691 | Ga0373931_0135374 | Ga0373931_0135374_169_1170 | 323 |
| 253 | 3300042001 | Ga0439441_000286 | Ga0439441_000286_1648_2628 | 323 |
| 254 | 3300050508 | nmdc:mga09592_196881_c1 | nmdc:mga09592_196881_c1_44_1024 | 323 |
| 255 | 3300050512 | nmdc:mga0n895_28767_c1 | nmdc:mga0n895_28767_c1_2337_3317 | 323 |
| 256 | 3300050512 | nmdc:mga0n895_33504_c1 | nmdc:mga0n895_33504_c1_1620_2612 | 323 |
| 257 | 3300050513 | nmdc:mga0rr50_13378_c1 | nmdc:mga0rr50_13378_c1_3209_4189 | 323 |
| 258 | 3300050513 | nmdc:mga0rr50_203655_c1 | nmdc:mga0rr50_203655_c1_268_1263 | 323 |
| 259 | 3300050513 | nmdc:mga0rr50_348037_c1 | nmdc:mga0rr50_348037_c1_194_1174 | 323 |
| 260 | 3300050513 | nmdc:mga0rr50_436_c1 | nmdc:mga0rr50_436_c1_2799_3791 | 323 |
| 261 | 3300050513 | nmdc:mga0rr50_60030_c1 | nmdc:mga0rr50_60030_c1_1272_2279 | 323 |
| 262 | 3300050514 | nmdc:mga08x19_1428_c1 | nmdc:mga08x19_1428_c1_2576_3568 | 323 |
| 263 | 3300050514 | nmdc:mga08x19_180935_c1 | nmdc:mga08x19_180935_c1_35_1030 | 323 |
| 264 | 3300050514 | nmdc:mga08x19_487_c1 | nmdc:mga08x19_487_c1_15440_16420 | 323 |
| 265 | 3300050515 | nmdc:mga0a205_1353_c1 | nmdc:mga0a205_1353_c1_7129_8121 | 323 |
| 266 | 3300005330 | Ga0070690_100002693 | Ga0070690_1000026934 | 324 |
| 267 | 3300005334 | Ga0068869_100002298 | Ga0068869_1000022986 | 324 |
| 268 | 3300005336 | Ga0070680_100003537 | Ga0070680_1000035377 | 324 |
| 269 | 3300005338 | Ga0068868_100000341 | Ga0068868_10000034131 | 324 |
| 270 | 3300005340 | Ga0070689_100003497 | Ga0070689_1000034974 | 324 |
| 271 | 3300005341 | Ga0070691_10000934 | Ga0070691_100009347 | 324 |
| 272 | 3300005343 | Ga0070687_100000369 | Ga0070687_1000003699 | 324 |
| 273 | 3300005367 | Ga0070667_100241496 | Ga0070667_1002414961 | 324 |
| 274 | 3300005438 | Ga0070701_10000173 | Ga0070701_1000017315 | 324 |
| 275 | 3300005440 | Ga0070705_100002026 | Ga0070705_1000020264 | 324 |
| 276 | 3300005441 | Ga0070700_100002899 | Ga0070700_1000028993 | 324 |
| 277 | 3300005444 | Ga0070694_100000045 | Ga0070694_10000004552 | 324 |
| 278 | 3300005458 | Ga0070681_10062663 | Ga0070681_100626632 | 324 |
| 279 | 3300005459 | Ga0068867_100004883 | Ga0068867_1000048834 | 324 |
| 280 | 3300005530 | Ga0070679_100083541 | Ga0070679_1000835412 | 324 |
| 281 | 3300005539 | Ga0068853_100260860 | Ga0068853_1002608602 | 324 |
| 282 | 3300005543 | Ga0070672_100001587 | Ga0070672_1000015873 | 324 |
| 283 | 3300005544 | Ga0070686_100003713 | Ga0070686_1000037133 | 324 |
| 284 | 3300005545 | Ga0070695_100000126 | Ga0070695_10000012629 | 324 |
| 285 | 3300005546 | Ga0070696_100003057 | Ga0070696_1000030577 | 324 |
| 286 | 3300005547 | Ga0070693_100000731 | Ga0070693_1000007318 | 324 |
| 287 | 3300005548 | Ga0070665_100008796 | Ga0070665_1000087963 | 324 |
| 288 | 3300005549 | Ga0070704_100000195 | Ga0070704_10000019519 | 324 |
| 289 | 3300005563 | Ga0068855_100007080 | Ga0068855_1000070807 | 324 |
| 290 | 3300005578 | Ga0068854_100003263 | Ga0068854_1000032635 | 324 |
| 291 | 3300005614 | Ga0068856_100015746 | Ga0068856_1000157462 | 324 |
| 292 | 3300005615 | Ga0070702_100000019 | Ga0070702_1000000195 | 324 |
| 293 | 3300005616 | Ga0068852_100010590 | Ga0068852_1000105904 | 324 |
| 294 | 3300005617 | Ga0068859_100013818 | Ga0068859_1000138183 | 324 |
| 295 | 3300005618 | Ga0068864_100004221 | Ga0068864_1000042217 | 324 |
| 296 | 3300005718 | Ga0068866_10001065 | Ga0068866_100010656 | 324 |
| 297 | 3300005719 | Ga0068861_100002221 | Ga0068861_1000022215 | 324 |
| 298 | 3300005834 | Ga0068851_10001624 | Ga0068851_100016246 | 324 |
| 299 | 3300005840 | Ga0068870_10011148 | Ga0068870_100111482 | 324 |
| 300 | 3300005841 | Ga0068863_100004084 | Ga0068863_1000040849 | 324 |
| 301 | 3300005842 | Ga0068858_100000751 | Ga0068858_1000007514 | 324 |
| 302 | 3300005843 | Ga0068860_100005413 | Ga0068860_1000054139 | 324 |
| 303 | 3300005843 | Ga0068860_100018660 | Ga0068860_1000186603 | 324 |
| 304 | 3300005844 | Ga0068862_100005525 | Ga0068862_1000055256 | 324 |
| 305 | 3300006237 | Ga0097621_100014223 | Ga0097621_1000142234 | 324 |
| 306 | 3300006237 | Ga0097621_100024797 | Ga0097621_1000247972 | 324 |
| 307 | 3300006358 | Ga0068871_100003308 | Ga0068871_1000033085 | 324 |
| 308 | 3300006358 | Ga0068871_100046749 | Ga0068871_1000467493 | 324 |
| 309 | 3300006881 | Ga0068865_100001242 | Ga0068865_1000012429 | 324 |
| 310 | 3300006914 | Ga0075436_100000475 | Ga0075436_1000004751 | 324 |
| 311 | 3300006931 | Ga0097620_100013819 | Ga0097620_1000138193 | 324 |
| 312 | 3300009098 | Ga0105245_10005835 | Ga0105245_100058356 | 324 |
| 313 | 3300009148 | Ga0105243_10004530 | Ga0105243_100045306 | 324 |
| 314 | 3300009174 | Ga0105241_10047970 | Ga0105241_100479703 | 324 |
| 315 | 3300009553 | Ga0105249_10011197 | Ga0105249_100111973 | 324 |
| 316 | 3300013297 | Ga0157378_10000579 | Ga0157378_100005795 | 324 |
| 317 | 3300013306 | Ga0163162_10006590 | Ga0163162_100065907 | 324 |
| 318 | 3300013308 | Ga0157375_10031375 | Ga0157375_100313752 | 324 |
| 319 | 3300013308 | Ga0157375_10096305 | Ga0157375_100963053 | 324 |
| 320 | 3300014326 | Ga0157380_10042159 | Ga0157380_100421592 | 324 |
| 321 | 3300014969 | Ga0157376_10056115 | Ga0157376_100561153 | 324 |
| 322 | 3300025321 | Ga0207656_10000903 | Ga0207656_100009033 | 324 |
| 323 | 3300025885 | Ga0207653_10043071 | Ga0207653_100430712 | 324 |
| 324 | 3300025893 | Ga0207682_10000059 | Ga0207682_1000005940 | 324 |
| 325 | 3300025899 | Ga0207642_10001096 | Ga0207642_100010965 | 324 |
| 326 | 3300025903 | Ga0207680_10007283 | Ga0207680_100072833 | 324 |
| 327 | 3300025907 | Ga0207645_10002844 | Ga0207645_100028448 | 324 |
| 328 | 3300025908 | Ga0207643_10002206 | Ga0207643_100022064 | 324 |
| 329 | 3300025908 | Ga0207643_10051847 | Ga0207643_100518473 | 324 |
| 330 | 3300025911 | Ga0207654_10034789 | Ga0207654_100347893 | 324 |
| 331 | 3300025916 | Ga0207663_10232839 | Ga0207663_102328392 | 324 |
| 332 | 3300025917 | Ga0207660_10004091 | Ga0207660_100040914 | 324 |
| 333 | 3300025918 | Ga0207662_10000049 | Ga0207662_100000496 | 324 |
| 334 | 3300025921 | Ga0207652_10057137 | Ga0207652_100571373 | 324 |
| 335 | 3300025925 | Ga0207650_10080128 | Ga0207650_100801282 | 324 |
| 336 | 3300025926 | Ga0207659_10008117 | Ga0207659_100081176 | 324 |
| 337 | 3300025927 | Ga0207687_10004654 | Ga0207687_100046544 | 324 |
| 338 | 3300025931 | Ga0207644_10114123 | Ga0207644_101141232 | 324 |
| 339 | 3300025933 | Ga0207706_10027297 | Ga0207706_100272973 | 324 |
| 340 | 3300025934 | Ga0207686_10004424 | Ga0207686_100044243 | 324 |
| 341 | 3300025935 | Ga0207709_10004865 | Ga0207709_100048655 | 324 |
| 342 | 3300025936 | Ga0207670_10001257 | Ga0207670_100012575 | 324 |
| 343 | 3300025937 | Ga0207669_10022292 | Ga0207669_100222922 | 324 |
| 344 | 3300025938 | Ga0207704_10003500 | Ga0207704_100035005 | 324 |
| 345 | 3300025940 | Ga0207691_10000243 | Ga0207691_1000024332 | 324 |
| 346 | 3300025942 | Ga0207689_10005474 | Ga0207689_100054746 | 324 |
| 347 | 3300025942 | Ga0207689_10012793 | Ga0207689_100127932 | 324 |
| 348 | 3300025960 | Ga0207651_10012247 | Ga0207651_100122472 | 324 |
| 349 | 3300025961 | Ga0207712_10009645 | Ga0207712_100096454 | 324 |
| 350 | 3300025972 | Ga0207668_10004976 | Ga0207668_100049764 | 324 |
| 351 | 3300025981 | Ga0207640_10011056 | Ga0207640_100110563 | 324 |
| 352 | 3300025986 | Ga0207658_10010666 | Ga0207658_100106662 | 324 |
| 353 | 3300026023 | Ga0207677_10004358 | Ga0207677_100043585 | 324 |
| 354 | 3300026023 | Ga0207677_10011167 | Ga0207677_100111673 | 324 |
| 355 | 3300026035 | Ga0207703_10019959 | Ga0207703_100199594 | 324 |
| 356 | 3300026041 | Ga0207639_10013658 | Ga0207639_100136583 | 324 |
| 357 | 3300026067 | Ga0207678_10002320 | Ga0207678_1000232010 | 324 |
| 358 | 3300026075 | Ga0207708_10007875 | Ga0207708_100078756 | 324 |
| 359 | 3300026078 | Ga0207702_10036006 | Ga0207702_100360062 | 324 |
| 360 | 3300026088 | Ga0207641_10021128 | Ga0207641_100211285 | 324 |
| 361 | 3300026089 | Ga0207648_10000265 | Ga0207648_100002655 | 324 |
| 362 | 3300026089 | Ga0207648_10003896 | Ga0207648_100038969 | 324 |
| 363 | 3300026095 | Ga0207676_10011925 | Ga0207676_100119256 | 324 |
| 364 | 3300026118 | Ga0207675_100000182 | Ga0207675_1000001826 | 324 |
| 365 | 3300026118 | Ga0207675_100077615 | Ga0207675_1000776153 | 324 |
| 366 | 3300026121 | Ga0207683_10000308 | Ga0207683_1000030832 | 324 |
| 367 | 3300026142 | Ga0207698_10130595 | Ga0207698_101305952 | 324 |
| 368 | 3300028379 | Ga0268266_10012628 | Ga0268266_100126283 | 324 |
| 369 | 3300028380 | Ga0268265_10004295 | Ga0268265_100042954 | 324 |
| 370 | 3300028381 | Ga0268264_10006840 | Ga0268264_100068405 | 324 |
| 371 | 3300028381 | Ga0268264_10026779 | Ga0268264_100267793 | 324 |
| 372 | 3300035084 | Ga0373928_0003570 | Ga0373928_0003570_243_1226 | 324 |
| 373 | 3300035085 | Ga0373929_0003033 | Ga0373929_0003033_119_1102 | 324 |
| 374 | 3300035088 | Ga0373940_0016602 | Ga0373940_0016602_640_1623 | 324 |
| 375 | 3300035089 | Ga0373944_0005926 | Ga0373944_0005926_1619_2614 | 324 |
| 376 | 3300035111 | Ga0373923_0009299 | Ga0373923_0009299_2025_3020 | 324 |
| 377 | 3300035112 | Ga0373932_0003784 | Ga0373932_0003784_2450_3433 | 324 |
| 378 | 3300035114 | Ga0373939_0002155 | Ga0373939_0002155_1027_2010 | 324 |
| 379 | 3300035115 | Ga0373941_0022138 | Ga0373941_0022138_506_1489 | 324 |
| 380 | 3300035121 | Ga0373960_0004454 | Ga0373960_0004454_1235_2218 | 324 |
| 381 | 3300035171 | Ga0373946_0005537 | Ga0373946_0005537_1139_2134 | 324 |
| 382 | 3300035691 | Ga0373931_0000062 | Ga0373931_0000062_22656_23639 | 324 |
| 383 | 3300035691 | Ga0373931_0022673 | Ga0373931_0022673_1873_2856 | 324 |
| 384 | 3300035724 | Ga0373933_0007663 | Ga0373933_0007663_2467_3450 | 324 |
| 385 | 3300045051 | Ga0451576_0008064 | Ga0451576_0008064_5497_6480 | 324 |
| 386 | 3300045051 | Ga0451576_0012002 | Ga0451576_0012002_4325_5308 | 324 |
| 387 | 3300046455 | Ga0495603_0036970 | Ga0495603_0036970_154_1149 | 324 |
| 388 | 3300046472 | Ga0495580_0006729 | Ga0495580_0006729_2610_3605 | 324 |
| 389 | 3300046517 | Ga0495630_0062383 | Ga0495630_0062383_300_1295 | 324 |
| 390 | 3300046526 | Ga0495666_0017771 | Ga0495666_0017771_662_1657 | 324 |
| 391 | 3300046531 | Ga0495665_0016870 | Ga0495665_0016870_360_1355 | 324 |
| 392 | 3300046674 | Ga0495588_0019099 | Ga0495588_0019099_1450_2445 | 324 |
| 393 | 3300046679 | Ga0495623_0108500 | Ga0495623_0108500_268_1251 | 324 |
| 394 | 3300049577 | Ga0501041_0169831 | Ga0501041_0169831_241_1224 | 324 |
| 395 | 3300006846 | Ga0075430_100129639 | Ga0075430_1001296392 | 325 |
| 396 | 3300006880 | Ga0075429_100000143 | Ga0075429_10000014310 | 325 |
| 397 | 3300009094 | Ga0111539_10092441 | Ga0111539_100924412 | 325 |
| 398 | 3300009147 | Ga0114129_10001740 | Ga0114129_1000174025 | 325 |
| 399 | 3300027907 | Ga0207428_10001034 | Ga0207428_100010345 | 325 |
| 400 | 3300035691 | Ga0373931_0053492 | Ga0373931_0053492_358_1344 | 325 |
| 401 | 3300042876 | Ga0451577_0018812 | Ga0451577_0018812_4776_5762 | 325 |
| 402 | 3300045051 | Ga0451576_0001787 | Ga0451576_0001787_26762_27748 | 325 |
| 403 | 3300049570 | Ga0501033_0000938 | Ga0501033_0000938_4194_5180 | 325 |
| 404 | 3300049572 | Ga0501036_0020678 | Ga0501036_0020678_2861_3859 | 325 |
| 405 | 3300049574 | Ga0501038_0004435 | Ga0501038_0004435_5475_6461 | 325 |
| 406 | 3300049575 | Ga0501039_0001678 | Ga0501039_0001678_506_1492 | 325 |
| 407 | 3300049576 | Ga0501040_0003651 | Ga0501040_0003651_4409_5395 | 325 |
| 408 | 3300049577 | Ga0501041_0000379 | Ga0501041_0000379_5878_6864 | 325 |
| 409 | 3300049578 | Ga0501042_0000723 | Ga0501042_0000723_12761_13747 | 325 |
| 410 | 3300049579 | Ga0501043_0048433 | Ga0501043_0048433_685_1671 | 325 |
| 411 | 3300049580 | Ga0501046_0001335 | Ga0501046_0001335_15731_16717 | 325 |
| 412 | 3300049580 | Ga0501046_0113765 | Ga0501046_0113765_405_1403 | 325 |
| 413 | 3300049581 | Ga0501047_0281385 | Ga0501047_0281385_427_1413 | 325 |
| 414 | 3300049582 | Ga0501048_0001543 | Ga0501048_0001543_3933_4919 | 325 |
| 415 | 3300049584 | Ga0501068_0033697 | Ga0501068_0033697_1209_2195 | 325 |
| 416 | 3300049587 | Ga0501071_0001886 | Ga0501071_0001886_4468_5454 | 325 |
| 417 | 3300049588 | Ga0501072_0000730 | Ga0501072_0000730_14958_15944 | 325 |
| 418 | 3300049590 | Ga0501074_0005252 | Ga0501074_0005252_4143_5129 | 325 |
| 419 | 3300049590 | Ga0501074_0169899 | Ga0501074_0169899_286_1284 | 325 |
| 420 | 3300049591 | Ga0501075_0007281 | Ga0501075_0007281_6620_7606 | 325 |
| 421 | 3300049592 | Ga0501076_0000861 | Ga0501076_0000861_4853_5839 | 325 |
| 422 | 3300049741 | Ga0501079_0001087 | Ga0501079_0001087_13144_14130 | 325 |
| 423 | 3300049742 | Ga0501080_0420112 | Ga0501080_0420112_95_1081 | 325 |
| 424 | 3300049743 | Ga0501081_0003501 | Ga0501081_0003501_6893_7879 | 325 |
| 425 | 3300049822 | Ga0501035_0030221 | Ga0501035_0030221_3018_4004 | 325 |
| 426 | 3300049823 | Ga0501044_0102442 | Ga0501044_0102442_1140_2126 | 325 |
| 427 | 3300049824 | Ga0501045_0001439 | Ga0501045_0001439_8084_9070 | 325 |
| 428 | 3300050507 | nmdc:mga05p37_3424_c1 | nmdc:mga05p37_3424_c1_6562_7548 | 325 |
| 429 | 3300050508 | nmdc:mga09592_1698_c1 | nmdc:mga09592_1698_c1_12217_13203 | 325 |
| 430 | 3300050509 | nmdc:mga0qj67_107710_c2 | nmdc:mga0qj67_107710_c2_710_1696 | 325 |
| 431 | 3300050511 | nmdc:mga08y16_1548_c1 | nmdc:mga08y16_1548_c1_7892_8878 | 325 |
| 432 | 3300050515 | nmdc:mga0a205_386498_c1 | nmdc:mga0a205_386498_c1_66_1052 | 325 |
| 433 | 3300054114 | Ga0501084_0013879 | Ga0501084_0013879_818_1804 | 325 |
| 434 | 3300060353 | Ga0501082_0002225 | Ga0501082_0002225_4443_5429 | 325 |
| 435 | 3300061734 | Ga0530510_0000870 | Ga0530510_0000870_8263_9249 | 325 |
| 436 | iso_pu_bacteria | 2891633521 | 2891634260 | 325 |
| 437 | 3300005290 | Ga0065712_10118833 | Ga0065712_101188332 | 326 |
| 438 | 3300005354 | Ga0070675_100053903 | Ga0070675_1000539032 | 326 |
| 439 | 3300005617 | Ga0068859_100059459 | Ga0068859_1000594593 | 326 |
| 440 | 3300005719 | Ga0068861_100138222 | Ga0068861_1001382223 | 326 |
| 441 | 3300005842 | Ga0068858_100061889 | Ga0068858_1000618892 | 326 |
| 442 | 3300006931 | Ga0097620_100059456 | Ga0097620_1000594563 | 326 |
| 443 | 3300009094 | Ga0111539_10002898 | Ga0111539_100028988 | 326 |
| 444 | 3300009094 | Ga0111539_10027344 | Ga0111539_100273442 | 326 |
| 445 | 3300009551 | Ga0105238_10156571 | Ga0105238_101565712 | 326 |
| 446 | 3300026035 | Ga0207703_10213390 | Ga0207703_102133902 | 326 |
| 447 | 3300026075 | Ga0207708_10125804 | Ga0207708_101258042 | 326 |
| 448 | 3300026118 | Ga0207675_100223542 | Ga0207675_1002235421 | 326 |
| 449 | 3300028800 | Ga0265338_10136804 | Ga0265338_101368042 | 326 |
| 450 | 3300046539 | Ga0495621_0002227 | Ga0495621_0002227_1888_2883 | 326 |
| 451 | 3300005564 | Ga0070664_100020888 | Ga0070664_1000208883 | 327 |
| 452 | 3300005614 | Ga0068856_100009039 | Ga0068856_1000090393 | 327 |
| 453 | 3300011119 | Ga0105246_10017932 | Ga0105246_100179322 | 327 |
| 454 | 3300025945 | Ga0207679_10032149 | Ga0207679_100321492 | 327 |
| 455 | 3300026078 | Ga0207702_10018915 | Ga0207702_100189153 | 327 |
| 456 | 3300032005 | Ga0307411_10209786 | Ga0307411_102097862 | 327 |
| 457 | 3300046515 | Ga0495620_0033715 | Ga0495620_0033715_193_1209 | 327 |
| 458 | 3300046520 | Ga0495637_0036259 | Ga0495637_0036259_215_1231 | 327 |
| 459 | 3300046530 | Ga0495654_0005652 | Ga0495654_0005652_5155_6171 | 327 |
| 460 | 3300046683 | Ga0495658_0185580 | Ga0495658_0185580_121_1137 | 327 |
| 461 | 3300049585 | Ga0501069_0123807 | Ga0501069_0123807_47_1039 | 327 |
| 462 | 3300053093 | Ga0500651_0000967 | Ga0500651_0000967_7001_8017 | 327 |
| 463 | 3300053094 | Ga0500566_0005275 | Ga0500566_0005275_4589_5605 | 327 |
| 464 | 3300053134 | Ga0500658_0001601 | Ga0500658_0001601_200_1216 | 327 |
| 465 | 3300053139 | Ga0500568_0007761 | Ga0500568_0007761_1343_2359 | 327 |
| 466 | 3300053141 | Ga0500574_009406 | Ga0500574_009406_13_1029 | 327 |
| 467 | 3300053158 | Ga0500627_0037841 | Ga0500627_0037841_972_1988 | 327 |
| 468 | 3300005329 | Ga0070683_100093865 | Ga0070683_1000938652 | 328 |
| 469 | 3300005335 | Ga0070666_10048999 | Ga0070666_100489992 | 328 |
| 470 | 3300005340 | Ga0070689_100460941 | Ga0070689_1004609411 | 328 |
| 471 | 3300005355 | Ga0070671_100002054 | Ga0070671_10000205412 | 328 |
| 472 | 3300005435 | Ga0070714_100008789 | Ga0070714_1000087896 | 328 |
| 473 | 3300005437 | Ga0070710_10115182 | Ga0070710_101151821 | 328 |
| 474 | 3300005438 | Ga0070701_10183545 | Ga0070701_101835451 | 328 |
| 475 | 3300005440 | Ga0070705_100014900 | Ga0070705_1000149003 | 328 |
| 476 | 3300005458 | Ga0070681_10006268 | Ga0070681_100062686 | 328 |
| 477 | 3300005458 | Ga0070681_10010845 | Ga0070681_100108458 | 328 |
| 478 | 3300005467 | Ga0070706_100006783 | Ga0070706_10000678310 | 328 |
| 479 | 3300005468 | Ga0070707_100003388 | Ga0070707_1000033888 | 328 |
| 480 | 3300005530 | Ga0070679_100187058 | Ga0070679_1001870581 | 328 |
| 481 | 3300005535 | Ga0070684_100225702 | Ga0070684_1002257022 | 328 |
| 482 | 3300005539 | Ga0068853_100067128 | Ga0068853_1000671282 | 328 |
| 483 | 3300005543 | Ga0070672_100143267 | Ga0070672_1001432672 | 328 |
| 484 | 3300005547 | Ga0070693_100015741 | Ga0070693_1000157414 | 328 |
| 485 | 3300005547 | Ga0070693_100129648 | Ga0070693_1001296481 | 328 |
| 486 | 3300005563 | Ga0068855_100005836 | Ga0068855_1000058363 | 328 |
| 487 | 3300005563 | Ga0068855_100013040 | Ga0068855_1000130406 | 328 |
| 488 | 3300005563 | Ga0068855_100077941 | Ga0068855_1000779412 | 328 |
| 489 | 3300005617 | Ga0068859_100017464 | Ga0068859_1000174647 | 328 |
| 490 | 3300005842 | Ga0068858_100039861 | Ga0068858_1000398613 | 328 |
| 491 | 3300006163 | Ga0070715_10019721 | Ga0070715_100197213 | 328 |
| 492 | 3300006173 | Ga0070716_100074657 | Ga0070716_1000746572 | 328 |
| 493 | 3300006237 | Ga0097621_100038035 | Ga0097621_1000380352 | 328 |
| 494 | 3300006358 | Ga0068871_100142157 | Ga0068871_1001421572 | 328 |
| 495 | 3300006931 | Ga0097620_100017464 | Ga0097620_1000174647 | 328 |
| 496 | 3300007265 | Ga0099794_10037077 | Ga0099794_100370772 | 328 |
| 497 | 3300009093 | Ga0105240_10094231 | Ga0105240_100942312 | 328 |
| 498 | 3300009098 | Ga0105245_10270801 | Ga0105245_102708012 | 328 |
| 499 | 3300009147 | Ga0114129_10418881 | Ga0114129_104188812 | 328 |
| 500 | 3300009176 | Ga0105242_10040427 | Ga0105242_100404272 | 328 |
| 501 | 3300013104 | Ga0157370_10000800 | Ga0157370_1000080019 | 328 |
| 502 | 3300013297 | Ga0157378_10003615 | Ga0157378_100036159 | 328 |
| 503 | 3300014968 | Ga0157379_10382298 | Ga0157379_103822982 | 328 |
| 504 | 3300025910 | Ga0207684_10041849 | Ga0207684_100418492 | 328 |
| 505 | 3300025912 | Ga0207707_10009957 | Ga0207707_100099572 | 328 |
| 506 | 3300025921 | Ga0207652_10101889 | Ga0207652_101018892 | 328 |
| 507 | 3300025927 | Ga0207687_10059254 | Ga0207687_100592542 | 328 |
| 508 | 3300025931 | Ga0207644_10043748 | Ga0207644_100437482 | 328 |
| 509 | 3300025934 | Ga0207686_10008534 | Ga0207686_100085343 | 328 |
| 510 | 3300025935 | Ga0207709_10110585 | Ga0207709_101105852 | 328 |
| 511 | 3300025940 | Ga0207691_10141471 | Ga0207691_101414712 | 328 |
| 512 | 3300025940 | Ga0207691_10142670 | Ga0207691_101426702 | 328 |
| 513 | 3300025949 | Ga0207667_10002796 | Ga0207667_1000279620 | 328 |
| 514 | 3300025949 | Ga0207667_10016584 | Ga0207667_100165847 | 328 |
| 515 | 3300026075 | Ga0207708_10244101 | Ga0207708_102441012 | 328 |
| 516 | 3300026089 | Ga0207648_10067457 | Ga0207648_100674572 | 328 |
| 517 | 3300026121 | Ga0207683_10053724 | Ga0207683_100537244 | 328 |
| 518 | 3300029957 | Ga0265324_10077431 | Ga0265324_100774311 | 328 |
| 519 | 3300031344 | Ga0265316_10158752 | Ga0265316_101587522 | 328 |
| 520 | 3300031728 | Ga0316578_10023142 | Ga0316578_100231422 | 328 |
| 521 | 3300032002 | Ga0307416_100403130 | Ga0307416_1004031302 | 328 |
| 522 | 3300032133 | Ga0316583_10012150 | Ga0316583_100121502 | 328 |
| 523 | 3300035410 | Ga0373924_0001388 | Ga0373924_0001388_3741_4757 | 328 |
| 524 | 3300036647 | Ga0316582_0013270 | Ga0316582_0013270_2569_3591 | 328 |
| 525 | 3300037588 | Ga0316581_0008234 | Ga0316581_0008234_1109_2131 | 328 |
| 526 | 3300042876 | Ga0451577_0101090 | Ga0451577_0101090_1494_2495 | 328 |
| 527 | 3300044712 | Ga0453684_0083116 | Ga0453684_0083116_2285_3280 | 328 |
| 528 | 3300049571 | Ga0501034_0007094 | Ga0501034_0007094_3196_4215 | 328 |
| 529 | 3300049586 | Ga0501070_0003078 | Ga0501070_0003078_9030_10022 | 328 |
| 530 | 3300049586 | Ga0501070_0238908 | Ga0501070_0238908_251_1249 | 328 |
| 531 | 3300049589 | Ga0501073_0003022 | Ga0501073_0003022_6390_7382 | 328 |
| 532 | 3300049590 | Ga0501074_0019604 | Ga0501074_0019604_649_1641 | 328 |
| 533 | 3300049742 | Ga0501080_0012613 | Ga0501080_0012613_3373_4365 | 328 |
| 534 | 3300049744 | Ga0501083_0038854 | Ga0501083_0038854_1623_2615 | 328 |
| 535 | 3300050511 | nmdc:mga08y16_16812_c1 | nmdc:mga08y16_16812_c1_3106_4170 | 328 |
| 536 | 3300005327 | Ga0070658_10030313 | Ga0070658_100303135 | 329 |
| 537 | 3300005335 | Ga0070666_10085437 | Ga0070666_100854372 | 329 |
| 538 | 3300005340 | Ga0070689_100001002 | Ga0070689_10000100210 | 329 |
| 539 | 3300005353 | Ga0070669_100057844 | Ga0070669_1000578442 | 329 |
| 540 | 3300005354 | Ga0070675_100046180 | Ga0070675_1000461802 | 329 |
| 541 | 3300005364 | Ga0070673_100049244 | Ga0070673_1000492442 | 329 |
| 542 | 3300005466 | Ga0070685_10083134 | Ga0070685_100831342 | 329 |
| 543 | 3300005471 | Ga0070698_100349640 | Ga0070698_1003496401 | 329 |
| 544 | 3300005543 | Ga0070672_100148264 | Ga0070672_1001482642 | 329 |
| 545 | 3300005546 | Ga0070696_100040502 | Ga0070696_1000405024 | 329 |
| 546 | 3300005616 | Ga0068852_100000484 | Ga0068852_10000048422 | 329 |
| 547 | 3300005834 | Ga0068851_10001115 | Ga0068851_100011155 | 329 |
| 548 | 3300006175 | Ga0070712_100341238 | Ga0070712_1003412381 | 329 |
| 549 | 3300006358 | Ga0068871_100032101 | Ga0068871_1000321012 | 329 |
| 550 | 3300009093 | Ga0105240_10065089 | Ga0105240_100650892 | 329 |
| 551 | 3300009098 | Ga0105245_10185882 | Ga0105245_101858822 | 329 |
| 552 | 3300013296 | Ga0157374_10073243 | Ga0157374_100732432 | 329 |
| 553 | 3300014326 | Ga0157380_10155386 | Ga0157380_101553862 | 329 |
| 554 | 3300014968 | Ga0157379_10061246 | Ga0157379_100612462 | 329 |
| 555 | 3300025321 | Ga0207656_10001284 | Ga0207656_100012842 | 329 |
| 556 | 3300025906 | Ga0207699_10129328 | Ga0207699_101293282 | 329 |
| 557 | 3300025908 | Ga0207643_10030908 | Ga0207643_100309082 | 329 |
| 558 | 3300025909 | Ga0207705_10023381 | Ga0207705_100233813 | 329 |
| 559 | 3300025913 | Ga0207695_10086080 | Ga0207695_100860802 | 329 |
| 560 | 3300025922 | Ga0207646_10224210 | Ga0207646_102242102 | 329 |
| 561 | 3300025931 | Ga0207644_10274214 | Ga0207644_102742142 | 329 |
| 562 | 3300025940 | Ga0207691_10008832 | Ga0207691_100088323 | 329 |
| 563 | 3300025942 | Ga0207689_10037778 | Ga0207689_100377782 | 329 |
| 564 | 3300025945 | Ga0207679_10230318 | Ga0207679_102303181 | 329 |
| 565 | 3300026035 | Ga0207703_10003975 | Ga0207703_100039751 | 329 |
| 566 | 3300026075 | Ga0207708_10140222 | Ga0207708_101402222 | 329 |
| 567 | 3300026095 | Ga0207676_10162995 | Ga0207676_101629952 | 329 |
| 568 | 3300026116 | Ga0207674_10056236 | Ga0207674_100562364 | 329 |
| 569 | 3300031548 | Ga0307408_100090527 | Ga0307408_1000905272 | 329 |
| 570 | 3300032002 | Ga0307416_100042082 | Ga0307416_1000420822 | 329 |
| 571 | 3300036401 | Ga0373937_0026857 | Ga0373937_0026857_1544_2551 | 329 |
| 572 | 3300042001 | Ga0439441_000342 | Ga0439441_000342_1583_2587 | 329 |
| 573 | 3300044712 | Ga0453684_0205026 | Ga0453684_0205026_401_1408 | 329 |
| 574 | 3300045051 | Ga0451576_0253546 | Ga0451576_0253546_434_1435 | 329 |
| 575 | 3300046539 | Ga0495621_0036395 | Ga0495621_0036395_537_1571 | 329 |
| 576 | 3300046675 | Ga0495657_0080708 | Ga0495657_0080708_624_1631 | 329 |
| 577 | 3300048911 | Ga0496108_0178322 | Ga0496108_0178322_351_1349 | 329 |
| 578 | 3300050493 | nmdc:mga0k408_38601_c1 | nmdc:mga0k408_38601_c1_244_1245 | 329 |
| 579 | iso_pu_bacteria | 2734482258 | 2735817323 | 329 |
| 580 | 3300006846 | Ga0075430_100009206 | Ga0075430_1000092065 | 330 |
| 581 | 3300006847 | Ga0075431_100000324 | Ga0075431_10000032419 | 330 |
| 582 | 3300006880 | Ga0075429_100040723 | Ga0075429_1000407234 | 330 |
| 583 | 3300046516 | Ga0495628_0012002 | Ga0495628_0012002_3310_4335 | 330 |
| 584 | 3300047319 | Ga0495674_0039453 | Ga0495674_0039453_2240_3265 | 330 |
| 585 | 3300047320 | Ga0495672_0005040 | Ga0495672_0005040_2356_3381 | 330 |
| 586 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_399465_400490 | 330 |
| 587 | 3300050508 | nmdc:mga09592_30226_c1 | nmdc:mga09592_30226_c1_2343_3347 | 330 |
| 588 | 3300050509 | nmdc:mga0qj67_10467_c1 | nmdc:mga0qj67_10467_c1_5269_6273 | 330 |
| 589 | 3300050510 | nmdc:mga06r32_812_c1 | nmdc:mga06r32_812_c1_23516_24520 | 330 |
| 590 | 3300005290 | Ga0065712_10069020 | Ga0065712_100690209 | 331 |
| 591 | 3300005328 | Ga0070676_10031851 | Ga0070676_100318512 | 331 |
| 592 | 3300005329 | Ga0070683_100016822 | Ga0070683_1000168223 | 331 |
| 593 | 3300005331 | Ga0070670_100000420 | Ga0070670_10000042025 | 331 |
| 594 | 3300005335 | Ga0070666_10027648 | Ga0070666_100276482 | 331 |
| 595 | 3300005338 | Ga0068868_100000481 | Ga0068868_10000048122 | 331 |
| 596 | 3300005344 | Ga0070661_100085006 | Ga0070661_1000850062 | 331 |
| 597 | 3300005354 | Ga0070675_100011753 | Ga0070675_1000117533 | 331 |
| 598 | 3300005355 | Ga0070671_100000233 | Ga0070671_10000023327 | 331 |
| 599 | 3300005356 | Ga0070674_100009927 | Ga0070674_1000099274 | 331 |
| 600 | 3300005364 | Ga0070673_100034846 | Ga0070673_1000348464 | 331 |
| 601 | 3300005367 | Ga0070667_100441502 | Ga0070667_1004415021 | 331 |
| 602 | 3300005456 | Ga0070678_100006098 | Ga0070678_1000060985 | 331 |
| 603 | 3300005543 | Ga0070672_100001511 | Ga0070672_1000015113 | 331 |
| 604 | 3300005564 | Ga0070664_100008955 | Ga0070664_1000089555 | 331 |
| 605 | 3300005578 | Ga0068854_100013526 | Ga0068854_1000135264 | 331 |
| 606 | 3300005616 | Ga0068852_100004168 | Ga0068852_1000041685 | 331 |
| 607 | 3300005618 | Ga0068864_100005062 | Ga0068864_1000050622 | 331 |
| 608 | 3300005841 | Ga0068863_100012296 | Ga0068863_1000122963 | 331 |
| 609 | 3300006237 | Ga0097621_100002059 | Ga0097621_10000205910 | 331 |
| 610 | 3300006358 | Ga0068871_100005061 | Ga0068871_1000050613 | 331 |
| 611 | 3300009148 | Ga0105243_10196189 | Ga0105243_101961892 | 331 |
| 612 | 3300009176 | Ga0105242_10349857 | Ga0105242_103498572 | 331 |
| 613 | 3300009177 | Ga0105248_10005187 | Ga0105248_1000518712 | 331 |
| 614 | 3300009177 | Ga0105248_10076691 | Ga0105248_100766912 | 331 |
| 615 | 3300009177 | Ga0105248_10089123 | Ga0105248_100891232 | 331 |
| 616 | 3300013296 | Ga0157374_10172545 | Ga0157374_101725452 | 331 |
| 617 | 3300013297 | Ga0157378_10001901 | Ga0157378_100019013 | 331 |
| 618 | 3300013306 | Ga0163162_10203073 | Ga0163162_102030732 | 331 |
| 619 | 3300013308 | Ga0157375_10001103 | Ga0157375_1000110320 | 331 |
| 620 | 3300014745 | Ga0157377_10064112 | Ga0157377_100641122 | 331 |
| 621 | 3300014969 | Ga0157376_10020591 | Ga0157376_100205913 | 331 |
| 622 | 3300025321 | Ga0207656_10012445 | Ga0207656_100124452 | 331 |
| 623 | 3300025903 | Ga0207680_10029264 | Ga0207680_100292642 | 331 |
| 624 | 3300025907 | Ga0207645_10016689 | Ga0207645_100166893 | 331 |
| 625 | 3300025931 | Ga0207644_10018061 | Ga0207644_100180612 | 331 |
| 626 | 3300025938 | Ga0207704_10013921 | Ga0207704_100139212 | 331 |
| 627 | 3300025940 | Ga0207691_10000625 | Ga0207691_100006252 | 331 |
| 628 | 3300025941 | Ga0207711_10230884 | Ga0207711_102308842 | 331 |
| 629 | 3300025945 | Ga0207679_10006685 | Ga0207679_100066853 | 331 |
| 630 | 3300025960 | Ga0207651_10005150 | Ga0207651_100051503 | 331 |
| 631 | 3300026023 | Ga0207677_10005372 | Ga0207677_100053723 | 331 |
| 632 | 3300026088 | Ga0207641_10085529 | Ga0207641_100855293 | 331 |
| 633 | 3300026121 | Ga0207683_10000611 | Ga0207683_100006113 | 331 |
| 634 | 3300026142 | Ga0207698_10001809 | Ga0207698_1000180910 | 331 |
| 635 | 3300027876 | Ga0209974_10005799 | Ga0209974_100057993 | 331 |
| 636 | 3300028800 | Ga0265338_10000350 | Ga0265338_1000035013 | 331 |
| 637 | 3300036401 | Ga0373937_0040869 | Ga0373937_0040869_977_1993 | 331 |
| 638 | 3300044712 | Ga0453684_0243395 | Ga0453684_0243395_380_1390 | 331 |
| 639 | 3300046529 | Ga0495652_0225071 | Ga0495652_0225071_162_1178 | 331 |
| 640 | 3300046543 | Ga0495645_0001930 | Ga0495645_0001930_8867_9883 | 331 |
| 641 | 3300046559 | Ga0495667_0014114 | Ga0495667_0014114_349_1365 | 331 |
| 642 | 3300046675 | Ga0495657_0163068 | Ga0495657_0163068_133_1149 | 331 |
| 643 | 3300046678 | Ga0495599_0012523 | Ga0495599_0012523_189_1205 | 331 |
| 644 | 3300046679 | Ga0495623_0013457 | Ga0495623_0013457_299_1315 | 331 |
| 645 | 3300047322 | Ga0495680_0190935 | Ga0495680_0190935_189_1205 | 331 |
| 646 | 3300048905 | Ga0496102_0274038 | Ga0496102_0274038_501_1505 | 331 |
| 647 | 3300048911 | Ga0496108_0007533 | Ga0496108_0007533_4101_5105 | 331 |
| 648 | 3300048913 | Ga0496110_0000706 | Ga0496110_0000706_17083_18087 | 331 |
| 649 | 3300003794 | Ga0055531_10001635 | Ga0055531_100016352 | 332 |
| 650 | 3300013308 | Ga0157375_10276889 | Ga0157375_102768892 | 332 |
| 651 | 3300014745 | Ga0157377_10016731 | Ga0157377_100167313 | 332 |
| 652 | 3300025303 | Ga0209051_1000351 | Ga0209051_10003512 | 332 |
| 653 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015244 | 332 |
| 654 | 3300035090 | Ga0373949_0002756 | Ga0373949_0002756_245_1252 | 332 |
| 655 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_1332000_1333007 | 332 |
| 656 | 3300030745 | Ga0316182_1006065 | Ga0316182_10060652 | 333 |
| 657 | 3300045051 | Ga0451576_0160305 | Ga0451576_0160305_66_1094 | 333 |
| 658 | 3300049742 | Ga0501080_0004879 | Ga0501080_0004879_5593_6639 | 333 |
| 659 | 3300049824 | Ga0501045_0242669 | Ga0501045_0242669_280_1287 | 333 |
| 660 | 3300005985 | Ga0081539_10016258 | Ga0081539_100162585 | 334 |
| 661 | 3300009094 | Ga0111539_10060748 | Ga0111539_100607482 | 334 |
| 662 | 3300045051 | Ga0451576_0318573 | Ga0451576_0318573_507_1547 | 334 |
| 663 | 3300050511 | nmdc:mga08y16_88346_c1 | nmdc:mga08y16_88346_c1_862_1875 | 334 |
| 664 | 3300053125 | Ga0500618_016401 | Ga0500618_016401_330_1469 | 334 |
| 665 | 3300005295 | Ga0065707_10142323 | Ga0065707_101423232 | 335 |
| 666 | 3300005367 | Ga0070667_100401430 | Ga0070667_1004014301 | 335 |
| 667 | 3300005543 | Ga0070672_100018915 | Ga0070672_1000189152 | 335 |
| 668 | 3300005844 | Ga0068862_100025277 | Ga0068862_1000252773 | 335 |
| 669 | 3300005844 | Ga0068862_100098802 | Ga0068862_1000988022 | 335 |
| 670 | 3300005937 | Ga0081455_10083505 | Ga0081455_100835052 | 335 |
| 671 | 3300006881 | Ga0068865_100002021 | Ga0068865_1000020217 | 335 |
| 672 | 3300009148 | Ga0105243_10052189 | Ga0105243_100521891 | 335 |
| 673 | 3300009553 | Ga0105249_10426249 | Ga0105249_104262491 | 335 |
| 674 | 3300011119 | Ga0105246_10316737 | Ga0105246_103167371 | 335 |
| 675 | 3300025909 | Ga0207705_10161331 | Ga0207705_101613311 | 335 |
| 676 | 3300025935 | Ga0207709_10181419 | Ga0207709_101814191 | 335 |
| 677 | 3300025940 | Ga0207691_10081441 | Ga0207691_100814412 | 335 |
| 678 | 3300025986 | Ga0207658_10051643 | Ga0207658_100516433 | 335 |
| 679 | 3300026067 | Ga0207678_10073392 | Ga0207678_100733922 | 335 |
| 680 | 3300026089 | Ga0207648_10026807 | Ga0207648_100268071 | 335 |
| 681 | 3300028380 | Ga0268265_10001580 | Ga0268265_100015807 | 335 |
| 682 | 3300028380 | Ga0268265_10054256 | Ga0268265_100542561 | 335 |
| 683 | 3300028380 | Ga0268265_10149146 | Ga0268265_101491462 | 335 |
| 684 | 3300028381 | Ga0268264_10000909 | Ga0268264_1000090914 | 335 |
| 685 | 3300028794 | Ga0307515_10000058 | Ga0307515_10000058163 | 335 |
| 686 | 3300028794 | Ga0307515_10001320 | Ga0307515_1000132036 | 335 |
| 687 | 3300042876 | Ga0451577_0095475 | Ga0451577_0095475_1316_2368 | 335 |
| 688 | 3300042876 | Ga0451577_0220298 | Ga0451577_0220298_14_1087 | 335 |
| 689 | 3300045051 | Ga0451576_0016403 | Ga0451576_0016403_1595_2668 | 335 |
| 690 | 3300049587 | Ga0501071_0070335 | Ga0501071_0070335_1332_2387 | 335 |
| 691 | 3300049590 | Ga0501074_0046248 | Ga0501074_0046248_1213_2268 | 335 |
| 692 | 3300049591 | Ga0501075_0000411 | Ga0501075_0000411_8571_9626 | 335 |
| 693 | 3300049741 | Ga0501079_0002789 | Ga0501079_0002789_4079_5134 | 335 |
| 694 | 3300049822 | Ga0501035_0097495 | Ga0501035_0097495_837_1892 | 335 |
| 695 | 3300060353 | Ga0501082_0026242 | Ga0501082_0026242_2714_3769 | 335 |
| 696 | iso_pu_bacteria | 2904434214 | 2904435295 | 335 |
| 697 | 3300009036 | Ga0105244_10006962 | Ga0105244_100069626 | 336 |
| 698 | 3300009148 | Ga0105243_10003372 | Ga0105243_100033722 | 336 |
| 699 | 3300011119 | Ga0105246_10005048 | Ga0105246_100050485 | 336 |
| 700 | 3300013104 | Ga0157370_10009801 | Ga0157370_100098015 | 336 |
| 701 | 3300014497 | Ga0182008_10002687 | Ga0182008_100026878 | 336 |
| 702 | 3300014497 | Ga0182008_10015230 | Ga0182008_100152303 | 336 |
| 703 | 3300015261 | Ga0182006_1007705 | Ga0182006_10077053 | 336 |
| 704 | 3300015262 | Ga0182007_10001351 | Ga0182007_100013518 | 336 |
| 705 | 3300046453 | Ga0495627_007760 | Ga0495627_007760_436_1566 | 336 |
| 706 | 3300046674 | Ga0495588_0041360 | Ga0495588_0041360_962_2032 | 336 |
| 707 | 3300048919 | Ga0496116_0021075 | Ga0496116_0021075_3302_4372 | 336 |
| 708 | 3300048920 | Ga0496117_0008098 | Ga0496117_0008098_2640_3710 | 336 |
| 709 | 3300048921 | Ga0496118_0029901 | Ga0496118_0029901_2512_3582 | 336 |
| 710 | 3300048924 | Ga0496121_0089624 | Ga0496121_0089624_1093_2163 | 336 |
| 711 | 3300048928 | Ga0496125_0034504 | Ga0496125_0034504_1272_2342 | 336 |
| 712 | 3300048928 | Ga0496125_0058511 | Ga0496125_0058511_643_1773 | 336 |
| 713 | 3300005547 | Ga0070693_100065905 | Ga0070693_1000659052 | 337 |
| 714 | 3300005614 | Ga0068856_100038071 | Ga0068856_1000380712 | 337 |
| 715 | 3300009174 | Ga0105241_10010806 | Ga0105241_100108064 | 337 |
| 716 | 3300009551 | Ga0105238_10004061 | Ga0105238_100040615 | 337 |
| 717 | 3300010375 | Ga0105239_10504717 | Ga0105239_105047171 | 337 |
| 718 | 3300013102 | Ga0157371_10068354 | Ga0157371_100683541 | 337 |
| 719 | 3300013105 | Ga0157369_10048969 | Ga0157369_100489694 | 337 |
| 720 | 3300013307 | Ga0157372_10066547 | Ga0157372_100665473 | 337 |
| 721 | 3300025912 | Ga0207707_10252201 | Ga0207707_102522012 | 337 |
| 722 | 3300025924 | Ga0207694_10082862 | Ga0207694_100828622 | 337 |
| 723 | 3300026142 | Ga0207698_10237043 | Ga0207698_102370432 | 337 |
| 724 | 3300041997 | Ga0439431_0001324 | Ga0439431_0001324_2100_3182 | 337 |
| 725 | 3300042156 | Ga0439446_0030557 | Ga0439446_0030557_294_1376 | 337 |
| 726 | 3300049742 | Ga0501080_0298218 | Ga0501080_0298218_29_1069 | 337 |
| 727 | 3300053121 | Ga0500607_023878 | Ga0500607_023878_607_1704 | 337 |
| 728 | 3300006186 | Ga0075369_10001702 | Ga0075369_100017028 | 338 |
| 729 | 3300006195 | Ga0075366_10017190 | Ga0075366_100171903 | 338 |
| 730 | 3300013306 | Ga0163162_10032414 | Ga0163162_100324142 | 338 |
| 731 | 3300014969 | Ga0157376_10199412 | Ga0157376_101994122 | 338 |
| 732 | 3300017792 | Ga0163161_10162583 | Ga0163161_101625832 | 338 |
| 733 | 3300025941 | Ga0207711_10146325 | Ga0207711_101463252 | 338 |
| 734 | 3300027614 | Ga0209970_1003460 | Ga0209970_10034603 | 338 |
| 735 | 3300042876 | Ga0451577_0008793 | Ga0451577_0008793_6891_7934 | 338 |
| 736 | 3300042876 | Ga0451577_0037209 | Ga0451577_0037209_2120_3163 | 338 |
| 737 | 3300042876 | Ga0451577_0136974 | Ga0451577_0136974_815_1900 | 338 |
| 738 | 3300044712 | Ga0453684_0023470 | Ga0453684_0023470_5040_6125 | 338 |
| 739 | 3300045051 | Ga0451576_0002877 | Ga0451576_0002877_8575_9618 | 338 |
| 740 | 3300045051 | Ga0451576_0010170 | Ga0451576_0010170_6573_7658 | 338 |
| 741 | 3300049571 | Ga0501034_0047636 | Ga0501034_0047636_956_2047 | 338 |
| 742 | 3300049581 | Ga0501047_0025433 | Ga0501047_0025433_737_1780 | 338 |
| 743 | 3300049585 | Ga0501069_0000942 | Ga0501069_0000942_6773_7816 | 338 |
| 744 | 3300049586 | Ga0501070_0014380 | Ga0501070_0014380_3813_4856 | 338 |
| 745 | 3300049589 | Ga0501073_0005339 | Ga0501073_0005339_3412_4455 | 338 |
| 746 | 3300049590 | Ga0501074_0005970 | Ga0501074_0005970_6075_7118 | 338 |
| 747 | 3300049741 | Ga0501079_0006549 | Ga0501079_0006549_1638_2681 | 338 |
| 748 | 3300049744 | Ga0501083_0012662 | Ga0501083_0012662_1210_2253 | 338 |
| 749 | 3300049822 | Ga0501035_0212421 | Ga0501035_0212421_33_1076 | 338 |
| 750 | 3300049823 | Ga0501044_0175921 | Ga0501044_0175921_228_1271 | 338 |
| 751 | 3300060353 | Ga0501082_0065813 | Ga0501082_0065813_1242_2285 | 338 |
| 752 | iso_pu_bacteria | 2842677519 | 2842678124 | 338 |
| 753 | iso_pu_bacteria | 2885192300 | 2885193608 | 338 |
| 754 | iso_pu_bacteria | 2904449895 | 2904451306 | 338 |
| 755 | iso_pu_bacteria | 2904456579 | 2904458168 | 338 |
| 756 | iso_pu_bacteria | 2919462493 | 2919466707 | 338 |
| 757 | iso_pu_bacteria | 2929520902 | 2929526217 | 338 |
| 758 | iso_pu_bacteria | 2945972063 | 2945974600 | 338 |
| 759 | 3300005459 | Ga0068867_100051793 | Ga0068867_1000517932 | 339 |
| 760 | 3300026089 | Ga0207648_10063517 | Ga0207648_100635172 | 339 |
| 761 | 3300028379 | Ga0268266_10255986 | Ga0268266_102559862 | 339 |
| 762 | 3300041498 | Ga0451841_0312808 | Ga0451841_0312808_54_1133 | 339 |
| 763 | iso_pu_bacteria | 2513020051 | 2513229902 | 339 |
| 764 | iso_pu_bacteria | 2643221658 | 2644327228 | 339 |
| 765 | iso_pu_bacteria | 2643221672 | 2644399586 | 339 |
| 766 | iso_pu_bacteria | 2738541277 | 2738721671 | 339 |
| 767 | iso_pu_bacteria | 2738541307 | 2738883525 | 339 |
| 768 | iso_pu_bacteria | 2738543019 | 2739282035 | 339 |
| 769 | iso_pu_bacteria | 2885198086 | 2885204102 | 339 |
| 770 | iso_pu_bacteria | 2885211737 | 2885217564 | 339 |
| 771 | iso_pu_bacteria | 2928084124 | 2928085424 | 339 |
| 772 | iso_pu_bacteria | 2945909444 | 2945915203 | 339 |
| 773 | iso_pu_bacteria | 2954767861 | 2954769808 | 339 |
| 774 | 3300005548 | Ga0070665_100021204 | Ga0070665_1000212042 | 340 |
| 775 | 3300006914 | Ga0075436_100014968 | Ga0075436_1000149682 | 340 |
| 776 | 3300007076 | Ga0075435_100073655 | Ga0075435_1000736552 | 340 |
| 777 | 3300028379 | Ga0268266_10038502 | Ga0268266_100385022 | 340 |
| 778 | 3300050512 | nmdc:mga0n895_121741_c1 | nmdc:mga0n895_121741_c1_854_1930 | 340 |
| 779 | 3300050514 | nmdc:mga08x19_3510_c1 | nmdc:mga08x19_3510_c1_1823_2902 | 340 |
| 780 | 3300005842 | Ga0068858_100244528 | Ga0068858_1002445282 | 341 |
| 781 | 3300006178 | Ga0075367_10027731 | Ga0075367_100277312 | 341 |
| 782 | 3300014969 | Ga0157376_10251591 | Ga0157376_102515911 | 341 |
| 783 | 3300017792 | Ga0163161_10004590 | Ga0163161_100045902 | 341 |
| 784 | 3300031731 | Ga0307405_10186056 | Ga0307405_101860561 | 341 |
| 785 | 3300031901 | Ga0307406_10299273 | Ga0307406_102992731 | 341 |
| 786 | 3300031911 | Ga0307412_10026388 | Ga0307412_100263882 | 341 |
| 787 | 3300045051 | Ga0451576_0003213 | Ga0451576_0003213_6830_7927 | 341 |
| 788 | 3300046459 | Ga0495629_0085607 | Ga0495629_0085607_341_1435 | 341 |
| 789 | 3300046475 | Ga0495639_0005541 | Ga0495639_0005541_1509_2603 | 341 |
| 790 | 3300048903 | Ga0496100_0102754 | Ga0496100_0102754_686_1780 | 341 |
| 791 | 3300048904 | Ga0496101_0001900 | Ga0496101_0001900_4647_5741 | 341 |
| 792 | 3300048905 | Ga0496102_0004231 | Ga0496102_0004231_6215_7309 | 341 |
| 793 | 3300048907 | Ga0496104_0002663 | Ga0496104_0002663_7849_8943 | 341 |
| 794 | 3300048908 | Ga0496105_0001549 | Ga0496105_0001549_12992_14086 | 341 |
| 795 | 3300048909 | Ga0496106_0034566 | Ga0496106_0034566_2602_3696 | 341 |
| 796 | 3300048910 | Ga0496107_0043853 | Ga0496107_0043853_1568_2662 | 341 |
| 797 | 3300048912 | Ga0496109_0054988 | Ga0496109_0054988_2413_3507 | 341 |
| 798 | 3300048914 | Ga0496111_0063090 | Ga0496111_0063090_1222_2316 | 341 |
| 799 | 3300048915 | Ga0496112_0270186 | Ga0496112_0270186_291_1385 | 341 |
| 800 | 3300001979 | JGI24740J21852_10005758 | JGI24740J21852_100057585 | 342 |
| 801 | 3300003792 | Ga0055540_1001942 | Ga0055540_10019427 | 342 |
| 802 | 3300005456 | Ga0070678_100043183 | Ga0070678_1000431833 | 342 |
| 803 | 3300005543 | Ga0070672_100070674 | Ga0070672_1000706742 | 342 |
| 804 | 3300005577 | Ga0068857_100073964 | Ga0068857_1000739642 | 342 |
| 805 | 3300006048 | Ga0075363_100012669 | Ga0075363_1000126692 | 342 |
| 806 | 3300006051 | Ga0075364_10034245 | Ga0075364_100342452 | 342 |
| 807 | 3300006058 | Ga0075432_10011661 | Ga0075432_100116612 | 342 |
| 808 | 3300006177 | Ga0075362_10009361 | Ga0075362_100093613 | 342 |
| 809 | 3300006177 | Ga0075362_10030280 | Ga0075362_100302802 | 342 |
| 810 | 3300006186 | Ga0075369_10024886 | Ga0075369_100248862 | 342 |
| 811 | 3300006353 | Ga0075370_10027737 | Ga0075370_100277371 | 342 |
| 812 | 3300013306 | Ga0163162_10006818 | Ga0163162_100068187 | 342 |
| 813 | 3300014497 | Ga0182008_10002165 | Ga0182008_100021652 | 342 |
| 814 | 3300014497 | Ga0182008_10014557 | Ga0182008_100145572 | 342 |
| 815 | 3300015261 | Ga0182006_1016938 | Ga0182006_10169382 | 342 |
| 816 | 3300015262 | Ga0182007_10001176 | Ga0182007_1000117610 | 342 |
| 817 | 3300015683 | Ga0183362_10004 | Ga0183362_10004226 | 342 |
| 818 | 3300017792 | Ga0163161_10001684 | Ga0163161_1000168411 | 342 |
| 819 | 3300017792 | Ga0163161_10032713 | Ga0163161_100327132 | 342 |
| 820 | 3300025303 | Ga0209051_1000227 | Ga0209051_100022729 | 342 |
| 821 | 3300025933 | Ga0207706_10275578 | Ga0207706_102755782 | 342 |
| 822 | 3300026116 | Ga0207674_10097405 | Ga0207674_100974052 | 342 |
| 823 | 3300026121 | Ga0207683_10056794 | Ga0207683_100567943 | 342 |
| 824 | 3300028794 | Ga0307515_10000468 | Ga0307515_1000046816 | 342 |
| 825 | 3300030733 | Ga0314311_1019906 | Ga0314311_10199062 | 342 |
| 826 | 3300031238 | Ga0265332_10000006 | Ga0265332_100000068 | 342 |
| 827 | 3300031251 | Ga0265327_10013789 | Ga0265327_100137893 | 342 |
| 828 | 3300031901 | Ga0307406_10002313 | Ga0307406_100023133 | 342 |
| 829 | 3300031911 | Ga0307412_10196884 | Ga0307412_101968841 | 342 |
| 830 | 3300032002 | Ga0307416_100126191 | Ga0307416_1001261913 | 342 |
| 831 | 3300032002 | Ga0307416_100201197 | Ga0307416_1002011972 | 342 |
| 832 | 3300041406 | Ga0439439_0006043 | Ga0439439_0006043_1390_2484 | 342 |
| 833 | 3300041410 | Ga0439461_0018591 | Ga0439461_0018591_177_1271 | 342 |
| 834 | 3300041411 | Ga0439466_0008421 | Ga0439466_0008421_1202_2296 | 342 |
| 835 | 3300041411 | Ga0439466_0016927 | Ga0439466_0016927_1116_2210 | 342 |
| 836 | 3300041411 | Ga0439466_0018100 | Ga0439466_0018100_783_1877 | 342 |
| 837 | 3300041413 | Ga0439465_0005112 | Ga0439465_0005112_2247_3341 | 342 |
| 838 | 3300041997 | Ga0439431_0008028 | Ga0439431_0008028_1086_2180 | 342 |
| 839 | 3300041997 | Ga0439431_0009507 | Ga0439431_0009507_245_1339 | 342 |
| 840 | 3300041999 | Ga0439433_0000088 | Ga0439433_0000088_8897_9991 | 342 |
| 841 | 3300041999 | Ga0439433_0001045 | Ga0439433_0001045_4446_5540 | 342 |
| 842 | 3300042002 | Ga0439442_000991 | Ga0439442_000991_4110_5204 | 342 |
| 843 | 3300042002 | Ga0439442_002915 | Ga0439442_002915_1286_2380 | 342 |
| 844 | 3300042002 | Ga0439442_005941 | Ga0439442_005941_311_1405 | 342 |
| 845 | 3300042004 | Ga0439445_0000038 | Ga0439445_0000038_7180_8274 | 342 |
| 846 | 3300042006 | Ga0439432_004611 | Ga0439432_004611_35_1129 | 342 |
| 847 | 3300042007 | Ga0439449_0000654 | Ga0439449_0000654_5900_6994 | 342 |
| 848 | 3300042007 | Ga0439449_0001890 | Ga0439449_0001890_1399_2493 | 342 |
| 849 | 3300042007 | Ga0439449_0001985 | Ga0439449_0001985_3225_4319 | 342 |
| 850 | 3300042010 | Ga0439452_003838 | Ga0439452_003838_729_1823 | 342 |
| 851 | 3300042010 | Ga0439452_005074 | Ga0439452_005074_31_1125 | 342 |
| 852 | 3300042014 | Ga0439457_002262 | Ga0439457_002262_269_1363 | 342 |
| 853 | 3300042015 | Ga0439462_0001430 | Ga0439462_0001430_2868_3962 | 342 |
| 854 | 3300042121 | Ga0450919_002040 | Ga0450919_002040_622_1716 | 342 |
| 855 | 3300042122 | Ga0450920_005881 | Ga0450920_005881_1044_2138 | 342 |
| 856 | 3300042125 | Ga0450923_000082 | Ga0450923_000082_5733_6827 | 342 |
| 857 | 3300042145 | Ga0450906_004114 | Ga0450906_004114_612_1706 | 342 |
| 858 | 3300042145 | Ga0450906_005854 | Ga0450906_005854_311_1405 | 342 |
| 859 | 3300042156 | Ga0439446_0006771 | Ga0439446_0006771_576_1670 | 342 |
| 860 | 3300042184 | Ga0450908_000361 | Ga0450908_000361_364_1458 | 342 |
| 861 | 3300042185 | Ga0450909_004127 | Ga0450909_004127_35_1129 | 342 |
| 862 | 3300042435 | Ga0439434_0003215 | Ga0439434_0003215_965_2059 | 342 |
| 863 | 3300042531 | Ga0450918_001007 | Ga0450918_001007_3617_4711 | 342 |
| 864 | 3300044683 | Ga0466965_0008451 | Ga0466965_0008451_2576_3670 | 342 |
| 865 | 3300044901 | Ga0466960_0031324 | Ga0466960_0031324_1177_2271 | 342 |
| 866 | 3300046543 | Ga0495645_0138284 | Ga0495645_0138284_394_1491 | 342 |
| 867 | 3300046615 | Ga0495656_0001092 | Ga0495656_0001092_4620_5714 | 342 |
| 868 | 3300046660 | Ga0495625_0000114 | Ga0495625_0000114_112042_113136 | 342 |
| 869 | 3300046689 | Ga0495613_0226815 | Ga0495613_0226815_168_1265 | 342 |
| 870 | 3300048913 | Ga0496110_0097087 | Ga0496110_0097087_876_1973 | 342 |
| 871 | 3300049679 | Ga0501249_004119 | Ga0501249_004119_1278_2372 | 342 |
| 872 | 3300050490 | nmdc:mga03n38_2559_c1 | nmdc:mga03n38_2559_c1_4476_5570 | 342 |
| 873 | 3300050491 | nmdc:mga00v17_73454_c1 | nmdc:mga00v17_73454_c1_354_1448 | 342 |
| 874 | 3300050492 | nmdc:mga0yw44_66932_c1 | nmdc:mga0yw44_66932_c1_256_1350 | 342 |
| 875 | 3300050493 | nmdc:mga0k408_27742_c1 | nmdc:mga0k408_27742_c1_1272_2366 | 342 |
| 876 | 3300050493 | nmdc:mga0k408_51893_c1 | nmdc:mga0k408_51893_c1_198_1292 | 342 |
| 877 | 3300050496 | nmdc:mga07m45_162435_c1 | nmdc:mga07m45_162435_c1_116_1252 | 342 |
| 878 | 3300053136 | Ga0500559_0002136 | Ga0500559_0002136_2829_3917 | 342 |
| 879 | iso_pu_bacteria | 2721755763 | 2723876406 | 342 |
| 880 | iso_pu_bacteria | 2939631187 | 2939634704 | 342 |
| 881 | 3300002773 | JGI25152J39213_1005420 | JGI25152J39213_10054203 | 343 |
| 882 | 3300002987 | JGI25159J45721_1011185 | JGI25159J45721_10111852 | 343 |
| 883 | 3300003771 | Ga0055526_1005405 | Ga0055526_10054055 | 343 |
| 884 | 3300003773 | Ga0055537_1000341 | Ga0055537_10003413 | 343 |
| 885 | 3300003781 | Ga0055536_1002361 | Ga0055536_10023611 | 343 |
| 886 | 3300003781 | Ga0055536_1002834 | Ga0055536_10028342 | 343 |
| 887 | 3300003784 | Ga0055534_1000320 | Ga0055534_10003203 | 343 |
| 888 | 3300003790 | Ga0055528_1002843 | Ga0055528_10028433 | 343 |
| 889 | 3300003790 | Ga0055528_1004744 | Ga0055528_10047444 | 343 |
| 890 | 3300003791 | Ga0055530_10026300 | Ga0055530_100263001 | 343 |
| 891 | 3300003792 | Ga0055540_1001647 | Ga0055540_10016476 | 343 |
| 892 | 3300003792 | Ga0055540_1001867 | Ga0055540_10018678 | 343 |
| 893 | 3300003794 | Ga0055531_10002896 | Ga0055531_100028962 | 343 |
| 894 | 3300005288 | Ga0065714_10005802 | Ga0065714_100058022 | 343 |
| 895 | 3300005457 | Ga0070662_100005005 | Ga0070662_1000050058 | 343 |
| 896 | 3300005548 | Ga0070665_100146290 | Ga0070665_1001462903 | 343 |
| 897 | 3300005564 | Ga0070664_100153629 | Ga0070664_1001536292 | 343 |
| 898 | 3300005577 | Ga0068857_100151436 | Ga0068857_1001514362 | 343 |
| 899 | 3300006948 | Ga0099826_10031839 | Ga0099826_100318393 | 343 |
| 900 | 3300009148 | Ga0105243_10002206 | Ga0105243_100022068 | 343 |
| 901 | 3300013297 | Ga0157378_10008040 | Ga0157378_100080405 | 343 |
| 902 | 3300014497 | Ga0182008_10000260 | Ga0182008_1000026029 | 343 |
| 903 | 3300017792 | Ga0163161_10004016 | Ga0163161_100040165 | 343 |
| 904 | 3300025263 | Ga0209565_1000283 | Ga0209565_10002833 | 343 |
| 905 | 3300025273 | Ga0209673_1000136 | Ga0209673_1000136122 | 343 |
| 906 | 3300025273 | Ga0209673_1016929 | Ga0209673_10169292 | 343 |
| 907 | 3300025291 | Ga0209675_1000071 | Ga0209675_1000071122 | 343 |
| 908 | 3300025292 | Ga0209676_1000643 | Ga0209676_100064315 | 343 |
| 909 | 3300025292 | Ga0209676_1000659 | Ga0209676_100065916 | 343 |
| 910 | 3300025298 | Ga0209050_1000945 | Ga0209050_100094514 | 343 |
| 911 | 3300025303 | Ga0209051_1000180 | Ga0209051_100018028 | 343 |
| 912 | 3300025303 | Ga0209051_1000513 | Ga0209051_100051323 | 343 |
| 913 | 3300025304 | Ga0209257_1001106 | Ga0209257_100110625 | 343 |
| 914 | 3300025304 | Ga0209257_1004691 | Ga0209257_10046913 | 343 |
| 915 | 3300025728 | Ga0207655_1002301 | Ga0207655_100230113 | 343 |
| 916 | 3300025933 | Ga0207706_10036312 | Ga0207706_100363122 | 343 |
| 917 | 3300025935 | Ga0207709_10000436 | Ga0207709_1000043631 | 343 |
| 918 | 3300025935 | Ga0207709_10000534 | Ga0207709_1000053418 | 343 |
| 919 | 3300025945 | Ga0207679_10107408 | Ga0207679_101074082 | 343 |
| 920 | 3300026116 | Ga0207674_10048165 | Ga0207674_100481654 | 343 |
| 921 | 3300027666 | Ga0209282_1000795 | Ga0209282_10007954 | 343 |
| 922 | 3300031238 | Ga0265332_10015105 | Ga0265332_100151053 | 343 |
| 923 | 3300031711 | Ga0265314_10000481 | Ga0265314_1000048130 | 343 |
| 924 | 3300031731 | Ga0307405_10032286 | Ga0307405_100322863 | 343 |
| 925 | 3300032005 | Ga0307411_10002662 | Ga0307411_100026622 | 343 |
| 926 | 3300046460 | Ga0495638_0023942 | Ga0495638_0023942_1421_2518 | 343 |
| 927 | 3300046513 | Ga0495616_0002565 | Ga0495616_0002565_6703_7800 | 343 |
| 928 | 3300046518 | Ga0495631_0001040 | Ga0495631_0001040_11639_12736 | 343 |
| 929 | 3300046557 | Ga0495622_0023983 | Ga0495622_0023983_1229_2326 | 343 |
| 930 | 3300046616 | Ga0495668_0006944 | Ga0495668_0006944_875_1972 | 343 |
| 931 | 3300046691 | Ga0495670_0056757 | Ga0495670_0056757_546_1643 | 343 |
| 932 | 3300047673 | Ga0495593_0008132 | Ga0495593_0008132_1037_2134 | 343 |
| 933 | 3300048088 | Ga0495602_0185750 | Ga0495602_0185750_484_1581 | 343 |
| 934 | 3300048089 | Ga0495614_0003394 | Ga0495614_0003394_1458_2555 | 343 |
| 935 | 3300048926 | Ga0496123_0073392 | Ga0496123_0073392_186_1283 | 343 |
| 936 | 3300053110 | Ga0500571_000098 | Ga0500571_000098_20493_21590 | 343 |
| 937 | 3300053118 | Ga0500594_0000650 | Ga0500594_0000650_1937_3034 | 343 |
| 938 | 3300053136 | Ga0500559_0028570 | Ga0500559_0028570_326_1423 | 343 |
| 939 | 3300053151 | Ga0500604_0053702 | Ga0500604_0053702_116_1213 | 343 |
| 940 | 3300053153 | Ga0500616_0014630 | Ga0500616_0014630_2026_3123 | 343 |
| 941 | 3300003761 | Ga0055535_1000759 | Ga0055535_100075916 | 344 |
| 942 | 3300044666 | Ga0466977_0004540 | Ga0466977_0004540_2148_3233 | 344 |
| 943 | iso_pu_bacteria | 2596583598 | 2597030777 | 349 |
| 944 | iso_pu_bacteria | 2599185178 | 2599447007 | 349 |
| 945 | iso_pu_bacteria | 2885266251 | 2885268945 | 349 |
| 946 | iso_pu_bacteria | 2900577576 | 2900582293 | 349 |
| 947 | iso_pu_bacteria | 2928058823 | 2928061291 | 349 |
| 948 | 3300001979 | JGI24740J21852_10000394 | JGI24740J21852_100003945 | 352 |
| 949 | 3300002738 | JGI25154J39366_1000650 | JGI25154J39366_10006505 | 352 |
| 950 | 3300003841 | Ga0055541_1000379 | Ga0055541_100037911 | 352 |
| 951 | 3300025224 | Ga0209784_100595 | Ga0209784_1005959 | 352 |
| 952 | 3300025225 | Ga0209566_100430 | Ga0209566_10043012 | 352 |
| 953 | 3300025225 | Ga0209566_100569 | Ga0209566_10056912 | 352 |
| 954 | 3300025226 | Ga0209674_100248 | Ga0209674_10024821 | 352 |
| 955 | 3300025230 | Ga0209563_104187 | Ga0209563_1041872 | 352 |
| 956 | 3300025246 | Ga0209646_1000055 | Ga0209646_1000055258 | 352 |
| 957 | 3300025253 | Ga0209677_102421 | Ga0209677_1024213 | 352 |
| 958 | 3300025254 | Ga0209148_1000109 | Ga0209148_100010946 | 352 |
| 959 | 3300001915 | JGI24741J21665_1000490 | JGI24741J21665_100049010 | 353 |
| 960 | 3300001979 | JGI24740J21852_10000170 | JGI24740J21852_1000017014 | 353 |
| 961 | 3300003752 | Ga0055539_1000230 | Ga0055539_100023016 | 353 |
| 962 | 3300003752 | Ga0055539_1000294 | Ga0055539_100029416 | 353 |
| 963 | 3300003756 | Ga0055533_1005484 | Ga0055533_10054843 | 353 |
| 964 | 3300003758 | Ga0055532_1000006 | Ga0055532_1000006118 | 353 |
| 965 | 3300003759 | Ga0055525_1000414 | Ga0055525_10004148 | 353 |
| 966 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004118 | 353 |
| 967 | 3300003763 | Ga0055529_1000022 | Ga0055529_1000022203 | 353 |
| 968 | 3300005344 | Ga0070661_100000012 | Ga0070661_100000012151 | 353 |
| 969 | 3300005366 | Ga0070659_100001485 | Ga0070659_10000148510 | 353 |
| 970 | 3300005455 | Ga0070663_100000020 | Ga0070663_1000000209 | 353 |
| 971 | 3300005564 | Ga0070664_100000003 | Ga0070664_100000003203 | 353 |
| 972 | 3300005577 | Ga0068857_100061974 | Ga0068857_1000619742 | 353 |
| 973 | 3300005578 | Ga0068854_100000063 | Ga0068854_1000000634 | 353 |
| 974 | 3300005614 | Ga0068856_100000011 | Ga0068856_100000011120 | 353 |
| 975 | 3300009093 | Ga0105240_10098276 | Ga0105240_100982761 | 353 |
| 976 | 3300013100 | Ga0157373_10004380 | Ga0157373_100043804 | 353 |
| 977 | 3300013102 | Ga0157371_10000083 | Ga0157371_10000083119 | 353 |
| 978 | 3300013104 | Ga0157370_10000141 | Ga0157370_1000014159 | 353 |
| 979 | 3300013105 | Ga0157369_10003851 | Ga0157369_1000385111 | 353 |
| 980 | 3300013307 | Ga0157372_10000775 | Ga0157372_1000077516 | 353 |
| 981 | 3300014497 | Ga0182008_10072392 | Ga0182008_100723922 | 353 |
| 982 | 3300015261 | Ga0182006_1003724 | Ga0182006_10037245 | 353 |
| 983 | 3300015261 | Ga0182006_1005768 | Ga0182006_10057682 | 353 |
| 984 | 3300020070 | Ga0206356_10375286 | Ga0206356_103752862 | 353 |
| 985 | 3300020077 | Ga0206351_10502756 | Ga0206351_105027565 | 353 |
| 986 | 3300020610 | Ga0154015_1372279 | Ga0154015_137227914 | 353 |
| 987 | 3300025224 | Ga0209784_100150 | Ga0209784_10015032 | 353 |
| 988 | 3300025224 | Ga0209784_100554 | Ga0209784_1005548 | 353 |
| 989 | 3300025225 | Ga0209566_100002 | Ga0209566_100002952 | 353 |
| 990 | 3300025226 | Ga0209674_100010 | Ga0209674_100010186 | 353 |
| 991 | 3300025226 | Ga0209674_100050 | Ga0209674_100050121 | 353 |
| 992 | 3300025228 | Ga0209672_100218 | Ga0209672_10021821 | 353 |
| 993 | 3300025229 | Ga0209147_100015 | Ga0209147_100015425 | 353 |
| 994 | 3300025230 | Ga0209563_100004 | Ga0209563_100004363 | 353 |
| 995 | 3300025230 | Ga0209563_100026 | Ga0209563_100026386 | 353 |
| 996 | 3300025242 | Ga0209258_100021 | Ga0209258_100021425 | 353 |
| 997 | 3300025253 | Ga0209677_100007 | Ga0209677_100007951 | 353 |
| 998 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028425 | 353 |
| 999 | 3300025913 | Ga0207695_10004143 | Ga0207695_1000414319 | 353 |
| 1000 | 3300025920 | Ga0207649_10000302 | Ga0207649_1000030225 | 353 |
| 1001 | 3300025932 | Ga0207690_10001630 | Ga0207690_100016304 | 353 |
| 1002 | 3300025945 | Ga0207679_10000007 | Ga0207679_1000000716 | 353 |
| 1003 | 3300025981 | Ga0207640_10000224 | Ga0207640_1000022436 | 353 |
| 1004 | 3300026067 | Ga0207678_10000030 | Ga0207678_100000309 | 353 |
| 1005 | 3300026078 | Ga0207702_10000054 | Ga0207702_1000005443 | 353 |
| 1006 | 3300026116 | Ga0207674_10026678 | Ga0207674_100266785 | 353 |
| 1007 | 3300037312 | Ga0395899_0169538 | Ga0395899_0169538_109_1170 | 353 |
| 1008 | 3300037418 | Ga0395900_0169363 | Ga0395900_0169363_355_1416 | 353 |
| 1009 | 3300044658 | Ga0466972_0006017 | Ga0466972_0006017_193_1254 | 353 |
| 1010 | 3300044683 | Ga0466965_0005919 | Ga0466965_0005919_823_1884 | 353 |
| 1011 | 3300044693 | Ga0466961_0000499 | Ga0466961_0000499_15740_16801 | 353 |
| 1012 | 3300044706 | Ga0466964_0005193 | Ga0466964_0005193_3632_4693 | 353 |
| 1013 | 3300044735 | Ga0466968_0011804 | Ga0466968_0011804_1880_2941 | 353 |
| 1014 | 3300044842 | Ga0466957_0032413 | Ga0466957_0032413_193_1254 | 353 |
| 1015 | 3300045976 | Ga0466967_0003717 | Ga0466967_0003717_1020_2081 | 353 |
| 1016 | 3300061719 | Ga0466962_0002885 | Ga0466962_0002885_3501_4562 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3csv-assembly1.cif.gz_A-2 | crystal structure of a putative aminoglycoside phosphotransferase (yp_614837.1) from silicibacter sp. tm1040 at 2.15 a resolution | 0.8818 | 15 | 342 |
| 3csv-assembly1.cif.gz_A-2 | crystal structure of a putative aminoglycoside phosphotransferase (yp_614837.1) from silicibacter sp. tm1040 at 2.15 a resolution | 0.8409 | 15 | 342 |
| 8agy-assembly1.cif.gz_A | the corramycin phosphotransferase in complex with corramycin | 0.7325 | 19 | 348 |
| 8ahd-assembly1.cif.gz_A | the apo structure of the corramycin phosphotransferase | 0.7024 | 19 | 348 |
| 8agy-assembly1.cif.gz_A | the corramycin phosphotransferase in complex with corramycin | 0.6968 | 19 | 348 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3csvA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8635 | 106 | 342 | 3.90.1200.10 |
| 3csvA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8131 | 106 | 342 | 3.90.1200.10 |
| 3csvA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.8041 | 15 | 105 | 3.30.200.20 |
| 1j7lA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.8009 | 37 | 104 | 3.30.200.20 |
| 3csvA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7859 | 15 | 105 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349LNE9-F1-model_v4 | Aminoglycoside phosphotransferase | 0.9877 | 105 | 341 |
GO:0005524
GO:0016740 |
| AF-A0A522KAK5-F1-model_v4 | deleted | 0.9845 | 128 | 343 |
|
| AF-A0A847DSW8-F1-model_v4 | Phosphotransferase | 0.9799 | 13 | 344 |
GO:0005524
GO:0016740 |
| AF-W9T8M1-F1-model_v4 | Aminoglycoside phosphotransferase | 0.9759 | 86 | 341 |
GO:0005524
GO:0016740 |
| AF-A0A7Y8M745-F1-model_v4 | Phosphotransferase | 0.9751 | 14 | 318 |
GO:0005524
GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar