F488252

General Info

Members Datasets Scaffolds Average Seq Length
1016 362 1016 197

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100018138|Ga0070671_1000181383
Length 225
Sequence MASIEFTAYARNTEGRGPSRRMRRDGKAPGIVYGGKAEPTPIELDHNALIHALKNEAFHASILTMKMDGGGLTKVLLRDVQMHPFKNEVLHVDFQRIDENRKIHMKVPLHFGNAEASPAVKVQGAIVSHVMTELDVSCLPKDLPEFIEVDLSELDTAHSLHVSGVKLPAGVTVVSTGKLDPVVATAVVPKAVVETEEAGAAGEGAAVAAPGEVEAKAPEAKAGKK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
219 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
257 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.26
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10052176 3300005327 Bacteria 3316
2 Ga0070658_10094661 3300005327 Bacteria 2465
3 Ga0070676_10000720 3300005328 Bacteria 16181
4 Ga0070676_10089817 3300005328 Bacteria 1880
5 Ga0070676_10207720 3300005328 Bacteria 1287
6 Ga0070676_10219145 3300005328 Bacteria 1256
7 Ga0070683_100009972 3300005329 Bacteria 8145
8 Ga0070690_100053219 3300005330 Bacteria 2589
9 Ga0070690_100059082 3300005330 Bacteria 2464
10 Ga0070690_100099739 3300005330 Bacteria 1924
11 Ga0070690_100198784 3300005330 Bacteria 1394
12 Ga0070690_100390049 3300005330 Bacteria 1020
13 Ga0070670_100002238 3300005331 Bacteria 15902
14 Ga0070670_100120363 3300005331 Bacteria 2264
15 Ga0070677_10000176 3300005333 Bacteria 22159
16 Ga0070677_10050268 3300005333 Bacteria 1683
17 Ga0068869_100000052 3300005334 Bacteria 50285
18 Ga0068869_100004582 3300005334 Bacteria 8612
19 Ga0068869_100015651 3300005334 Bacteria 5095
20 Ga0070666_10004430 3300005335 Bacteria 8555
21 Ga0070666_10053857 3300005335 Bacteria 2714
22 Ga0070666_10084282 3300005335 Bacteria 2175
23 Ga0070666_10342570 3300005335 Bacteria 1068
24 Ga0070680_100010396 3300005336 Bacteria 7175
25 Ga0070680_100059536 3300005336 Bacteria 3125
26 Ga0070680_100090622 3300005336 Bacteria 2531
27 Ga0070680_100092482 3300005336 Bacteria 2505
28 Ga0070680_100238501 3300005336 Bacteria 1537
29 Ga0070680_100251821 3300005336 Bacteria 1493
30 Ga0070682_100007547 3300005337 Bacteria 6128
31 Ga0068868_100001699 3300005338 Bacteria 15063
32 Ga0068868_100004375 3300005338 Bacteria 9902
33 Ga0068868_100032969 3300005338 Bacteria 3988
34 Ga0068868_100501601 3300005338 Bacteria 1063
35 Ga0070660_100011752 3300005339 Bacteria 6234
36 Ga0070660_100022454 3300005339 Bacteria 4666
37 Ga0070660_100035368 3300005339 Bacteria 3781
38 Ga0070660_100051098 3300005339 Bacteria 3182
39 Ga0070660_100065183 3300005339 Bacteria 2835
40 Ga0070660_100748472 3300005339 Bacteria 821
41 Ga0070689_100013222 3300005340 Bacteria 5967
42 Ga0070689_100088906 3300005340 Bacteria 2432
43 Ga0070691_10029939 3300005341 Bacteria 2548
44 Ga0070691_10068809 3300005341 Bacteria 1715
45 Ga0070691_10110306 3300005341 Bacteria 1376
46 Ga0070687_100000128 3300005343 Bacteria 26145
47 Ga0070687_100006911 3300005343 Bacteria 4688
48 Ga0070687_100056130 3300005343 Bacteria 2060
49 Ga0070687_100109142 3300005343 Bacteria 1563
50 Ga0070661_100000392 3300005344 Bacteria 33974
51 Ga0070661_100010044 3300005344 Bacteria 6571
52 Ga0070661_100168080 3300005344 Bacteria 1664
53 Ga0070661_100209476 3300005344 Bacteria 1492
54 Ga0070661_100216120 3300005344 Bacteria 1469
55 Ga0070661_100351208 3300005344 Unclassified 1157
56 Ga0070692_10045232 3300005345 Bacteria 2269
57 Ga0070692_10048396 3300005345 Bacteria 2203
58 Ga0070692_10136534 3300005345 Bacteria 1384
59 Ga0070692_10181590 3300005345 Bacteria 1220
60 Ga0070668_100005934 3300005347 Bacteria 9053
61 Ga0070668_100008423 3300005347 Bacteria 7658
62 Ga0070668_100011112 3300005347 Bacteria 6701
63 Ga0070668_100048382 3300005347 Bacteria 3270
64 Ga0070668_100067542 3300005347 Bacteria 2777
65 Ga0070668_100345214 3300005347 Bacteria 1258
66 Ga0070669_100003481 3300005353 Bacteria 11347
67 Ga0070669_100016656 3300005353 Bacteria 5246
68 Ga0070669_100034459 3300005353 Bacteria 3665
69 Ga0070669_100040659 3300005353 Bacteria 3380
70 Ga0070669_100430303 3300005353 Bacteria 1085
71 Ga0070675_100001602 3300005354 Bacteria 16693
72 Ga0070675_100084468 3300005354 Bacteria 2652
73 Ga0070671_100002715 3300005355 Bacteria 13732
74 Ga0070671_100018138 3300005355 Bacteria 5715
75 Ga0070671_100018963 3300005355 Bacteria 5594
76 Ga0070671_100082230 3300005355 Bacteria 2692
77 Ga0070671_100090588 3300005355 Bacteria 2560
78 Ga0070671_100312053 3300005355 Bacteria 1340
79 Ga0070671_100463760 3300005355 Bacteria 1087
80 Ga0070674_100003479 3300005356 Bacteria 8844
81 Ga0070674_100093723 3300005356 Bacteria 2173
82 Ga0070674_100100440 3300005356 Bacteria 2107
83 Ga0070674_100247308 3300005356 Bacteria 1399
84 Ga0070674_100334058 3300005356 Bacteria 1219
85 Ga0070673_100008335 3300005364 Bacteria 6886
86 Ga0070673_100216059 3300005364 Bacteria 1658
87 Ga0070673_100222860 3300005364 Bacteria 1633
88 Ga0070673_100265279 3300005364 Bacteria 1501
89 Ga0070688_100005212 3300005365 Bacteria 6824
90 Ga0070688_100068197 3300005365 Bacteria 2268
91 Ga0070688_100339510 3300005365 Bacteria 1096
92 Ga0070659_100001691 3300005366 Bacteria 15881
93 Ga0070659_100005390 3300005366 Bacteria 9179
94 Ga0070659_100014688 3300005366 Bacteria 5855
95 Ga0070659_100019730 3300005366 Bacteria 5115
96 Ga0070659_100154620 3300005366 Bacteria 1872
97 Ga0070667_100000716 3300005367 Bacteria 31923
98 Ga0070667_100024663 3300005367 Bacteria 4997
99 Ga0070667_100068550 3300005367 Bacteria 3018
100 Ga0070667_100138037 3300005367 Bacteria 2133
101 Ga0070709_10060179 3300005434 Bacteria 2413
102 Ga0070709_10231722 3300005434 Unclassified 1322
103 Ga0070714_100034611 3300005435 Bacteria 4230
104 Ga0070714_100082256 3300005435 Bacteria 2805
105 Ga0070714_100507553 3300005435 Bacteria 1150
106 Ga0070713_100008819 3300005436 Bacteria 7178
107 Ga0070713_100066173 3300005436 Bacteria 3038
108 Ga0070713_100311904 3300005436 Bacteria 1451
109 Ga0070710_10046185 3300005437 Bacteria 2424
110 Ga0070701_10005323 3300005438 Bacteria 5302
111 Ga0070701_10079502 3300005438 Bacteria 1771
112 Ga0070701_10293584 3300005438 Bacteria 997
113 Ga0070711_100013106 3300005439 Bacteria 5199
114 Ga0070711_100252190 3300005439 Bacteria 1385
115 Ga0070705_100000193 3300005440 Bacteria 35796
116 Ga0070705_100007465 3300005440 Bacteria 5380
117 Ga0070705_100033542 3300005440 Bacteria 2862
118 Ga0070705_100050017 3300005440 Bacteria 2430
119 Ga0070700_100567556 3300005441 Bacteria 884
120 Ga0070694_100001063 3300005444 Bacteria 15690
121 Ga0070694_100023200 3300005444 Bacteria 3987
122 Ga0070694_100042994 3300005444 Bacteria 3019
123 Ga0070694_100098627 3300005444 Bacteria 2063
124 Ga0070694_100173109 3300005444 Bacteria 1592
125 Ga0070694_100258144 3300005444 Bacteria 1321
126 Ga0070708_100000176 3300005445 Bacteria 45698
127 Ga0070708_100127839 3300005445 Bacteria 2350
128 Ga0070708_100356505 3300005445 Bacteria 1378
129 Ga0070663_100004256 3300005455 Bacteria 8377
130 Ga0070663_100007149 3300005455 Bacteria 6777
131 Ga0070663_100011572 3300005455 Bacteria 5545
132 Ga0070663_100015849 3300005455 Bacteria 4878
133 Ga0070678_100003106 3300005456 Bacteria 9206
134 Ga0070678_100123518 3300005456 Bacteria 2045
135 Ga0070678_100148293 3300005456 Bacteria 1886
136 Ga0070678_100264087 3300005456 Bacteria 1449
137 Ga0070678_100569684 3300005456 Bacteria 1007
138 Ga0070662_100000258 3300005457 Bacteria 31405
139 Ga0070662_100121685 3300005457 Bacteria 2001
140 Ga0070662_100128052 3300005457 Bacteria 1954
141 Ga0070662_100185667 3300005457 Bacteria 1641
142 Ga0070681_10008346 3300005458 Bacteria 10146
143 Ga0070681_10010817 3300005458 Bacteria 9019
144 Ga0070681_10045346 3300005458 Bacteria 4399
145 Ga0070681_10061558 3300005458 Bacteria 3727
146 Ga0070681_10062579 3300005458 Bacteria 3695
147 Ga0070681_10217935 3300005458 Bacteria 1824
148 Ga0068867_100007802 3300005459 Bacteria 7570
149 Ga0068867_100010852 3300005459 Bacteria 6425
150 Ga0068867_100012889 3300005459 Bacteria 5915
151 Ga0068867_100137620 3300005459 Bacteria 1905
152 Ga0068867_100141769 3300005459 Bacteria 1879
153 Ga0070685_10005807 3300005466 Bacteria 6274
154 Ga0070685_10317608 3300005466 Bacteria 1055
155 Ga0070706_100065380 3300005467 Bacteria 3363
156 Ga0070706_100102433 3300005467 Bacteria 2661
157 Ga0070706_100137111 3300005467 Bacteria 2284
158 Ga0070706_100156172 3300005467 Bacteria 2129
159 Ga0070707_100152720 3300005468 Bacteria 2248
160 Ga0070707_100282674 3300005468 Bacteria 1612
161 Ga0070698_100077039 3300005471 Bacteria 3335
162 Ga0070698_100371848 3300005471 Bacteria 1361
163 Ga0070699_100256171 3300005518 Bacteria 1564
164 Ga0070679_100000683 3300005530 Bacteria 29027
165 Ga0070679_100002702 3300005530 Bacteria 16148
166 Ga0070679_100016516 3300005530 Bacteria 7125
167 Ga0070679_100076267 3300005530 Bacteria 3342
168 Ga0070679_100418954 3300005530 Bacteria 1285
169 Ga0070684_100008702 3300005535 Bacteria 7956
170 Ga0070684_100022709 3300005535 Bacteria 5237
171 Ga0070684_100539613 3300005535 Bacteria 1082
172 Ga0070697_100013235 3300005536 Bacteria 6469
173 Ga0070697_100018277 3300005536 Bacteria 5525
174 Ga0068853_100006431 3300005539 Bacteria 9336
175 Ga0068853_100018619 3300005539 Bacteria 5750
176 Ga0068853_100094970 3300005539 Bacteria 2628
177 Ga0068853_100173941 3300005539 Bacteria 1949
178 Ga0068853_100261074 3300005539 Bacteria 1592
179 Ga0068853_100476869 3300005539 Bacteria 1176
180 Ga0070672_100004013 3300005543 Bacteria 9593
181 Ga0070672_100079921 3300005543 Bacteria 2618
182 Ga0070672_100354377 3300005543 Bacteria 1251
183 Ga0070672_100562234 3300005543 Bacteria 991
184 Ga0070686_100000132 3300005544 Bacteria 52774
185 Ga0070686_100001879 3300005544 Bacteria 11698
186 Ga0070686_100035706 3300005544 Bacteria 3071
187 Ga0070686_100165295 3300005544 Bacteria 1561
188 Ga0070686_100269321 3300005544 Bacteria 1252
189 Ga0070695_100000140 3300005545 Bacteria 33449
190 Ga0070695_100018106 3300005545 Bacteria 4277
191 Ga0070695_100038262 3300005545 Bacteria 3026
192 Ga0070695_100156043 3300005545 Bacteria 1597
193 Ga0070696_100000008 3300005546 Bacteria 101365
194 Ga0070696_100008459 3300005546 Bacteria 6886
195 Ga0070696_100013241 3300005546 Bacteria 5535
196 Ga0070696_100020612 3300005546 Bacteria 4466
197 Ga0070696_100146670 3300005546 Bacteria 1729
198 Ga0070696_100160728 3300005546 Bacteria 1655
199 Ga0070693_100000589 3300005547 Bacteria 16080
200 Ga0070693_100001678 3300005547 Bacteria 10031
201 Ga0070693_100316312 3300005547 Bacteria 1057
202 Ga0070665_100003912 3300005548 Bacteria 15739
203 Ga0070665_100011282 3300005548 Bacteria 9038
204 Ga0070665_100036802 3300005548 Bacteria 4922
205 Ga0070665_100050831 3300005548 Bacteria 4159
206 Ga0070704_100000165 3300005549 Bacteria 26127
207 Ga0070704_100020253 3300005549 Bacteria 4286
208 Ga0070704_100034742 3300005549 Bacteria 3422
209 Ga0070704_100063663 3300005549 Bacteria 2648
210 Ga0070704_100106527 3300005549 Bacteria 2124
211 Ga0070704_100225100 3300005549 Bacteria 1527
212 Ga0070704_100318526 3300005549 Bacteria 1302
213 Ga0068855_100004105 3300005563 Bacteria 17757
214 Ga0068855_100011214 3300005563 Bacteria 10822
215 Ga0068855_100014652 3300005563 Bacteria 9442
216 Ga0068855_100104238 3300005563 Bacteria 3263
217 Ga0068855_100588915 3300005563 Bacteria 1201
218 Ga0070664_100000205 3300005564 Bacteria 42407
219 Ga0070664_100005036 3300005564 Bacteria 10589
220 Ga0070664_100005978 3300005564 Bacteria 9837
221 Ga0070664_100015089 3300005564 Bacteria 6308
222 Ga0070664_100111672 3300005564 Bacteria 2386
223 Ga0070664_100166160 3300005564 Bacteria 1955
224 Ga0068857_100000227 3300005577 Bacteria 37461
225 Ga0068857_100082720 3300005577 Bacteria 2868
226 Ga0068857_100205132 3300005577 Bacteria 1798
227 Ga0068857_100235164 3300005577 Bacteria 1676
228 Ga0068854_100002346 3300005578 Bacteria 11668
229 Ga0068854_100011465 3300005578 Bacteria 5774
230 Ga0068854_100059470 3300005578 Bacteria 2762
231 Ga0068854_100067556 3300005578 Bacteria 2604
232 Ga0068854_100105681 3300005578 Bacteria 2117
233 Ga0068854_100123540 3300005578 Bacteria 1968
234 Ga0068856_100000487 3300005614 Bacteria 43983
235 Ga0068856_100002909 3300005614 Bacteria 17528
236 Ga0068856_100008422 3300005614 Bacteria 10041
237 Ga0068856_100351125 3300005614 Bacteria 1493
238 Ga0070702_100008035 3300005615 Bacteria 5090
239 Ga0070702_100058498 3300005615 Bacteria 2233
240 Ga0068852_100017243 3300005616 Bacteria 5663
241 Ga0068852_100021228 3300005616 Bacteria 5179
242 Ga0068852_100026372 3300005616 Bacteria 4722
243 Ga0068852_100070228 3300005616 Bacteria 3072
244 Ga0068852_100112116 3300005616 Bacteria 2481
245 Ga0068852_100215500 3300005616 Bacteria 1824
246 Ga0068859_100000241 3300005617 Bacteria 53802
247 Ga0068859_100003857 3300005617 Bacteria 15320
248 Ga0068859_100054150 3300005617 Bacteria 4035
249 Ga0068859_100063145 3300005617 Bacteria 3734
250 Ga0068859_100103497 3300005617 Bacteria 2905
251 Ga0068864_100000578 3300005618 Bacteria 31152
252 Ga0068864_100008295 3300005618 Bacteria 8568
253 Ga0068864_100040080 3300005618 Bacteria 4006
254 Ga0068864_100041129 3300005618 Bacteria 3954
255 Ga0068864_100052903 3300005618 Bacteria 3501
256 Ga0068866_10000198 3300005718 Bacteria 28274
257 Ga0068866_10046320 3300005718 Bacteria 2186
258 Ga0068866_10075327 3300005718 Bacteria 1796
259 Ga0068861_100000076 3300005719 Bacteria 47808
260 Ga0068861_100000253 3300005719 Bacteria 29666
261 Ga0068861_100187212 3300005719 Bacteria 1727
262 Ga0068851_10008483 3300005834 Bacteria 4753
263 Ga0068851_10032159 3300005834 Bacteria 2610
264 Ga0068851_10045100 3300005834 Bacteria 2227
265 Ga0068851_10169839 3300005834 Bacteria 1203
266 Ga0068870_10003058 3300005840 Bacteria 7050
267 Ga0068870_10012128 3300005840 Bacteria 4019
268 Ga0068863_100013334 3300005841 Bacteria 7925
269 Ga0068863_100021276 3300005841 Bacteria 6191
270 Ga0068863_100064043 3300005841 Bacteria 3477
271 Ga0068863_100355828 3300005841 Bacteria 1426
272 Ga0068863_100397998 3300005841 Bacteria 1347
273 Ga0068863_100504550 3300005841 Bacteria 1191
274 Ga0068858_100011707 3300005842 Bacteria 8272
275 Ga0068858_100016946 3300005842 Bacteria 6840
276 Ga0068858_100058849 3300005842 Bacteria 3553
277 Ga0068858_100074042 3300005842 Bacteria 3162
278 Ga0068858_100236381 3300005842 Bacteria 1733
279 Ga0068858_100302759 3300005842 Bacteria 1525
280 Ga0068860_100008803 3300005843 Bacteria 10055
281 Ga0068860_100049084 3300005843 Bacteria 4022
282 Ga0068860_100058232 3300005843 Bacteria 3673
283 Ga0068860_100147698 3300005843 Bacteria 2263
284 Ga0068860_100247948 3300005843 Bacteria 1733
285 Ga0068860_100434743 3300005843 Bacteria 1303
286 Ga0068860_100440323 3300005843 Bacteria 1294
287 Ga0068862_100008122 3300005844 Bacteria 8681
288 Ga0068862_100010103 3300005844 Bacteria 7791
289 Ga0068862_100076353 3300005844 Bacteria 2899
290 Ga0068862_100763390 3300005844 Bacteria 942
291 Ga0081539_10004443 3300005985 Bacteria 15484
292 Ga0070717_10253814 3300006028 Bacteria 1554
293 Ga0070715_10038796 3300006163 Bacteria 1979
294 Ga0070716_100003884 3300006173 Bacteria 7096
295 Ga0070716_100025390 3300006173 Bacteria 3162
296 Ga0070716_100027806 3300006173 Bacteria 3042
297 Ga0070716_100076946 3300006173 Bacteria 1979
298 Ga0070716_100349376 3300006173 Bacteria 1046
299 Ga0070712_100012107 3300006175 Bacteria 5481
300 Ga0070712_100210401 3300006175 Bacteria 1533
301 Ga0075369_10061649 3300006186 Bacteria 1637
302 Ga0075366_10008743 3300006195 Bacteria 5638
303 Ga0097621_100002626 3300006237 Bacteria 12302
304 Ga0097621_100004081 3300006237 Bacteria 10134
305 Ga0097621_100007751 3300006237 Bacteria 7697
306 Ga0097621_100014593 3300006237 Bacteria 5886
307 Ga0097621_100049002 3300006237 Bacteria 3430
308 Ga0097621_100200592 3300006237 Bacteria 1732
309 Ga0068871_100000152 3300006358 Bacteria 45602
310 Ga0068871_100003130 3300006358 Bacteria 11355
311 Ga0068871_100009487 3300006358 Bacteria 7055
312 Ga0068871_100054710 3300006358 Bacteria 3239
313 Ga0068871_100063497 3300006358 Bacteria 3021
314 Ga0068871_100076662 3300006358 Bacteria 2762
315 Ga0075431_100007163 3300006847 Bacteria 11088
316 Ga0075431_100026010 3300006847 Bacteria 5999
317 Ga0075431_100056192 3300006847 Bacteria 4060
318 Ga0075431_100068491 3300006847 Bacteria 3663
319 Ga0075433_10025046 3300006852 Bacteria 5043
320 Ga0075433_10192339 3300006852 Bacteria 1815
321 Ga0075434_100001259 3300006871 Bacteria 21116
322 Ga0075434_100193720 3300006871 Bacteria 2053
323 Ga0075429_100000184 3300006880 Bacteria 40869
324 Ga0075429_100012597 3300006880 Bacteria 7331
325 Ga0075429_100020944 3300006880 Bacteria 5672
326 Ga0068865_100000386 3300006881 Bacteria 24465
327 Ga0068865_100010875 3300006881 Bacteria 5677
328 Ga0068865_100021906 3300006881 Bacteria 4161
329 Ga0068865_100063301 3300006881 Bacteria 2599
330 Ga0068865_100073564 3300006881 Bacteria 2430
331 Ga0068865_100130283 3300006881 Bacteria 1884
332 Ga0068865_100331735 3300006881 Bacteria 1227
333 Ga0075436_100000890 3300006914 Bacteria 19852
334 Ga0075436_100006126 3300006914 Bacteria 8257
335 Ga0075436_100012648 3300006914 Bacteria 5782
336 Ga0075436_100018398 3300006914 Bacteria 4783
337 Ga0075436_100062532 3300006914 Bacteria 2573
338 Ga0075436_100370940 3300006914 Bacteria 1034
339 Ga0097620_100000241 3300006931 Bacteria 53802
340 Ga0097620_100003857 3300006931 Bacteria 15320
341 Ga0097620_100054151 3300006931 Bacteria 4035
342 Ga0097620_100063145 3300006931 Bacteria 3734
343 Ga0097620_100103500 3300006931 Bacteria 2905
344 Ga0075435_100000315 3300007076 Bacteria 29765
345 Ga0075435_100005931 3300007076 Bacteria 8594
346 Ga0075435_100297295 3300007076 Bacteria 1380
347 Ga0075435_100716893 3300007076 Unclassified 870
348 Ga0099794_10025067 3300007265 Bacteria 2743
349 Ga0105240_10004875 3300009093 Bacteria 20188
350 Ga0105240_10030167 3300009093 Bacteria 7053
351 Ga0105240_10180712 3300009093 Bacteria 2489
352 Ga0111539_10007490 3300009094 Bacteria 13972
353 Ga0105245_10000221 3300009098 Bacteria 54253
354 Ga0105245_10021823 3300009098 Bacteria 5619
355 Ga0105245_10025750 3300009098 Bacteria 5172
356 Ga0105245_10448119 3300009098 Bacteria 1299
357 Ga0114129_10000677 3300009147 Bacteria 42898
358 Ga0114129_10021743 3300009147 Bacteria 9104
359 Ga0114129_10114894 3300009147 Bacteria 3711
360 Ga0114129_10605243 3300009147 Bacteria 1419
361 Ga0114129_11463336 3300009147 Bacteria 841
362 Ga0105243_10000288 3300009148 Bacteria 55680
363 Ga0105243_10035567 3300009148 Bacteria 3862
364 Ga0105243_10184554 3300009148 Bacteria 1817
365 Ga0105243_10439065 3300009148 Bacteria 1222
366 Ga0105241_10002581 3300009174 Bacteria 13585
367 Ga0105241_10028741 3300009174 Bacteria 4143
368 Ga0105241_10051469 3300009174 Bacteria 3141
369 Ga0105241_10079678 3300009174 Bacteria 2562
370 Ga0105241_10350688 3300009174 Bacteria 1281
371 Ga0105242_10000461 3300009176 Bacteria 32284
372 Ga0105242_10017032 3300009176 Bacteria 5659
373 Ga0105242_10095570 3300009176 Bacteria 2509
374 Ga0105242_10357409 3300009176 Bacteria 1351
375 Ga0105248_10001222 3300009177 Bacteria 28675
376 Ga0105248_10003921 3300009177 Bacteria 16450
377 Ga0105248_10118063 3300009177 Bacteria 2992
378 Ga0105248_10208218 3300009177 Bacteria 2203
379 Ga0105248_10271166 3300009177 Bacteria 1911
380 Ga0105237_10030227 3300009545 Bacteria 5505
381 Ga0105237_10192631 3300009545 Bacteria 2038
382 Ga0105238_10003371 3300009551 Bacteria 15944
383 Ga0105238_10007349 3300009551 Bacteria 11029
384 Ga0105238_10018196 3300009551 Bacteria 7145
385 Ga0105238_10520087 3300009551 Unclassified 1192
386 Ga0105249_10169191 3300009553 Bacteria 2118
387 Ga0105239_10015966 3300010375 Bacteria 8310
388 Ga0105239_10045584 3300010375 Bacteria 4806
389 Ga0105239_10422299 3300010375 Bacteria 1511
390 Ga0105246_10132786 3300011119 Bacteria 1862
391 Ga0157373_10003392 3300013100 Bacteria 12052
392 Ga0157373_10017867 3300013100 Bacteria 5163
393 Ga0157373_10050231 3300013100 Bacteria 2970
394 Ga0157373_10077134 3300013100 Bacteria 2351
395 Ga0157373_10143650 3300013100 Bacteria 1678
396 Ga0157371_10000365 3300013102 Bacteria 57144
397 Ga0157371_10036699 3300013102 Bacteria 3510
398 Ga0157371_10037810 3300013102 Bacteria 3454
399 Ga0157370_10002179 3300013104 Bacteria 23894
400 Ga0157370_10005373 3300013104 Bacteria 14382
401 Ga0157370_10023445 3300013104 Bacteria 6125
402 Ga0157370_10025827 3300013104 Bacteria 5811
403 Ga0157370_10200793 3300013104 Bacteria 1850
404 Ga0157370_10743051 3300013104 Bacteria 894
405 Ga0157369_10009942 3300013105 Bacteria 10867
406 Ga0157369_10013881 3300013105 Bacteria 9099
407 Ga0157374_10026374 3300013296 Bacteria 5228
408 Ga0157374_10032245 3300013296 Bacteria 4769
409 Ga0157374_10464360 3300013296 Bacteria 1268
410 Ga0157374_10770784 3300013296 Bacteria 977
411 Ga0157374_11628820 3300013296 Bacteria 670
412 Ga0157378_10001018 3300013297 Bacteria 25585
413 Ga0157378_10085015 3300013297 Bacteria 2865
414 Ga0157378_10182126 3300013297 Bacteria 1977
415 Ga0163162_10028905 3300013306 Bacteria 5487
416 Ga0163162_10053780 3300013306 Bacteria 4047
417 Ga0163162_10193467 3300013306 Bacteria 2162
418 Ga0163162_10334504 3300013306 Bacteria 1647
419 Ga0157372_10002696 3300013307 Bacteria 19185
420 Ga0157372_10008257 3300013307 Bacteria 11071
421 Ga0157372_10065337 3300013307 Bacteria 4084
422 Ga0157372_10120174 3300013307 Bacteria 3017
423 Ga0157372_10184731 3300013307 Bacteria 2414
424 Ga0157372_10196365 3300013307 Bacteria 2337
425 Ga0157372_10476520 3300013307 Bacteria 1455
426 Ga0157375_10001841 3300013308 Bacteria 18235
427 Ga0157375_10072751 3300013308 Bacteria 3455
428 Ga0157375_10329658 3300013308 Bacteria 1691
429 Ga0157375_10333941 3300013308 Bacteria 1681
430 Ga0157375_10585815 3300013308 Unclassified 1275
431 Ga0157375_11327166 3300013308 Bacteria 846
432 Ga0163163_10002440 3300014325 Bacteria 15727
433 Ga0163163_10215629 3300014325 Bacteria 1968
434 Ga0163163_10321335 3300014325 Bacteria 1601
435 Ga0157380_10189881 3300014326 Bacteria 1813
436 Ga0157380_10361338 3300014326 Bacteria 1362
437 Ga0157380_10729053 3300014326 Bacteria 1000
438 Ga0182008_10213145 3300014497 Bacteria 986
439 Ga0157379_10003260 3300014968 Bacteria 13751
440 Ga0157379_10122144 3300014968 Bacteria 2343
441 Ga0157379_10246320 3300014968 Bacteria 1622
442 Ga0157376_10076418 3300014969 Bacteria 2861
443 Ga0157376_10217100 3300014969 Bacteria 1769
444 Ga0157376_10300112 3300014969 Bacteria 1520
445 Ga0157376_10549040 3300014969 Bacteria 1143
446 Ga0157376_11046862 3300014969 Bacteria 840
447 Ga0163161_10015854 3300017792 Bacteria 5256
448 Ga0163161_10059840 3300017792 Bacteria 2771
449 Ga0163161_10192696 3300017792 Bacteria 1568
450 Ga0206356_10482904 3300020070 Bacteria 2242
451 Ga0206354_10403941 3300020081 Bacteria 1647
452 Ga0213871_10073559 3300021441 Bacteria 969
453 Ga0207697_10010410 3300025315 Bacteria 3975
454 Ga0207656_10012105 3300025321 Bacteria 3275
455 Ga0207653_10016186 3300025885 Bacteria 2342
456 Ga0207682_10000108 3300025893 Bacteria 37635
457 Ga0207682_10026746 3300025893 Bacteria 2296
458 Ga0207682_10027927 3300025893 Bacteria 2249
459 Ga0207642_10000085 3300025899 Bacteria 24466
460 Ga0207642_10045543 3300025899 Bacteria 1948
461 Ga0207642_10082160 3300025899 Bacteria 1568
462 Ga0207642_10131669 3300025899 Bacteria 1306
463 Ga0207688_10031463 3300025901 Bacteria 2929
464 Ga0207680_10047056 3300025903 Bacteria 2553
465 Ga0207680_10096996 3300025903 Bacteria 1887
466 Ga0207680_10181891 3300025903 Bacteria 1422
467 Ga0207685_10016992 3300025905 Bacteria 2341
468 Ga0207699_10051930 3300025906 Bacteria 2424
469 Ga0207699_10156035 3300025906 Unclassified 1515
470 Ga0207645_10001398 3300025907 Bacteria 19761
471 Ga0207645_10031124 3300025907 Bacteria 3435
472 Ga0207645_10037379 3300025907 Bacteria 3115
473 Ga0207645_10113951 3300025907 Bacteria 1752
474 Ga0207643_10007265 3300025908 Bacteria 5943
475 Ga0207643_10007501 3300025908 Bacteria 5856
476 Ga0207643_10068271 3300025908 Bacteria 2042
477 Ga0207705_10010774 3300025909 Bacteria 6639
478 Ga0207705_10086078 3300025909 Bacteria 2297
479 Ga0207705_10127628 3300025909 Bacteria 1891
480 Ga0207684_10087067 3300025910 Bacteria 2661
481 Ga0207684_10179429 3300025910 Bacteria 1826
482 Ga0207654_10020693 3300025911 Bacteria 3492
483 Ga0207654_10027390 3300025911 Bacteria 3097
484 Ga0207654_10084679 3300025911 Bacteria 1917
485 Ga0207707_10002721 3300025912 Bacteria 15790
486 Ga0207707_10004480 3300025912 Bacteria 12290
487 Ga0207707_10006896 3300025912 Bacteria 9909
488 Ga0207707_10022447 3300025912 Bacteria 5517
489 Ga0207707_10027811 3300025912 Bacteria 4944
490 Ga0207707_10084051 3300025912 Bacteria 2780
491 Ga0207707_10145238 3300025912 Bacteria 2074
492 Ga0207695_10037513 3300025913 Bacteria 5228
493 Ga0207671_10474438 3300025914 Bacteria 997
494 Ga0207693_10117602 3300025915 Bacteria 2087
495 Ga0207693_10425463 3300025915 Unclassified 1038
496 Ga0207663_10100789 3300025916 Bacteria 1939
497 Ga0207663_10105221 3300025916 Bacteria 1904
498 Ga0207660_10091427 3300025917 Bacteria 2257
499 Ga0207660_10186994 3300025917 Bacteria 1611
500 Ga0207660_10359882 3300025917 Bacteria 1167
501 Ga0207660_10679457 3300025917 Bacteria 840
502 Ga0207662_10000229 3300025918 Bacteria 25944
503 Ga0207662_10055441 3300025918 Bacteria 2365
504 Ga0207662_10075939 3300025918 Bacteria 2042
505 Ga0207662_10134817 3300025918 Bacteria 1560
506 Ga0207657_10000967 3300025919 Bacteria 30457
507 Ga0207657_10001126 3300025919 Bacteria 28383
508 Ga0207657_10001232 3300025919 Bacteria 27321
509 Ga0207657_10012659 3300025919 Bacteria 8314
510 Ga0207657_10061779 3300025919 Bacteria 3210
511 Ga0207657_10072164 3300025919 Bacteria 2921
512 Ga0207657_10148115 3300025919 Bacteria 1913
513 Ga0207649_10002455 3300025920 Bacteria 10377
514 Ga0207649_10008201 3300025920 Bacteria 5688
515 Ga0207649_10010946 3300025920 Bacteria 4989
516 Ga0207649_10014444 3300025920 Bacteria 4422
517 Ga0207649_10205476 3300025920 Bacteria 1394
518 Ga0207652_10000882 3300025921 Bacteria 28372
519 Ga0207652_10002520 3300025921 Bacteria 15398
520 Ga0207652_10009099 3300025921 Bacteria 7997
521 Ga0207652_10055124 3300025921 Bacteria 3418
522 Ga0207652_10074377 3300025921 Bacteria 2958
523 Ga0207652_10098654 3300025921 Bacteria 2577
524 Ga0207652_10914487 3300025921 Bacteria 775
525 Ga0207646_10025064 3300025922 Bacteria 5459
526 Ga0207646_10130746 3300025922 Bacteria 2259
527 Ga0207681_10038557 3300025923 Bacteria 3167
528 Ga0207681_10040702 3300025923 Bacteria 3094
529 Ga0207681_10176924 3300025923 Bacteria 1622
530 Ga0207694_10009032 3300025924 Bacteria 7523
531 Ga0207694_10025337 3300025924 Bacteria 4508
532 Ga0207650_10332548 3300025925 Bacteria 1246
533 Ga0207659_10005193 3300025926 Bacteria 7886
534 Ga0207659_10245799 3300025926 Bacteria 1450
535 Ga0207687_10000486 3300025927 Bacteria 26740
536 Ga0207687_10005511 3300025927 Bacteria 8375
537 Ga0207687_10066405 3300025927 Bacteria 2564
538 Ga0207700_10000018 3300025928 Bacteria 191007
539 Ga0207700_10139177 3300025928 Bacteria 1992
540 Ga0207664_10017700 3300025929 Bacteria 5231
541 Ga0207664_10063613 3300025929 Bacteria 2949
542 Ga0207664_10086002 3300025929 Bacteria 2567
543 Ga0207664_10433331 3300025929 Bacteria 1172
544 Ga0207644_10001357 3300025931 Bacteria 15745
545 Ga0207644_10008526 3300025931 Bacteria 6707
546 Ga0207644_10014361 3300025931 Bacteria 5297
547 Ga0207644_10074172 3300025931 Bacteria 2497
548 Ga0207690_10000438 3300025932 Bacteria 27116
549 Ga0207690_10013514 3300025932 Bacteria 4907
550 Ga0207690_10098419 3300025932 Bacteria 2083
551 Ga0207706_10000024 3300025933 Bacteria 151942
552 Ga0207706_10128898 3300025933 Bacteria 2225
553 Ga0207706_10146356 3300025933 Bacteria 2078
554 Ga0207706_10152260 3300025933 Bacteria 2034
555 Ga0207706_10179659 3300025933 Bacteria 1858
556 Ga0207706_10239668 3300025933 Bacteria 1586
557 Ga0207686_10000246 3300025934 Bacteria 41384
558 Ga0207686_10002440 3300025934 Bacteria 10115
559 Ga0207686_10010576 3300025934 Bacteria 5027
560 Ga0207686_10039695 3300025934 Bacteria 2857
561 Ga0207686_10305948 3300025934 Bacteria 1182
562 Ga0207709_10003459 3300025935 Bacteria 9374
563 Ga0207709_10390550 3300025935 Unclassified 1061
564 Ga0207670_10007491 3300025936 Bacteria 6093
565 Ga0207670_10702435 3300025936 Unclassified 837
566 Ga0207669_10173524 3300025937 Bacteria 1537
567 Ga0207669_10454847 3300025937 Bacteria 1015
568 Ga0207704_10006065 3300025938 Bacteria 5600
569 Ga0207704_10013925 3300025938 Bacteria 4045
570 Ga0207704_10365035 3300025938 Bacteria 1128
571 Ga0207665_10019748 3300025939 Bacteria 4428
572 Ga0207665_10049897 3300025939 Bacteria 2813
573 Ga0207665_10085522 3300025939 Bacteria 2177
574 Ga0207665_10210708 3300025939 Bacteria 1419
575 Ga0207665_10435324 3300025939 Bacteria 1004
576 Ga0207691_10000144 3300025940 Bacteria 65346
577 Ga0207691_10008753 3300025940 Bacteria 9707
578 Ga0207691_10015497 3300025940 Bacteria 7247
579 Ga0207691_10038029 3300025940 Bacteria 4452
580 Ga0207691_10042446 3300025940 Bacteria 4193
581 Ga0207691_10051419 3300025940 Bacteria 3767
582 Ga0207691_10094234 3300025940 Bacteria 2680
583 Ga0207691_10101529 3300025940 Bacteria 2567
584 Ga0207691_10313037 3300025940 Bacteria 1347
585 Ga0207691_10386679 3300025940 Bacteria 1194
586 Ga0207691_10423619 3300025940 Bacteria 1134
587 Ga0207711_10009735 3300025941 Bacteria 7997
588 Ga0207711_10013017 3300025941 Bacteria 6909
589 Ga0207711_10102642 3300025941 Bacteria 2532
590 Ga0207689_10000406 3300025942 Bacteria 40450
591 Ga0207689_10000978 3300025942 Bacteria 27386
592 Ga0207689_10115900 3300025942 Bacteria 2202
593 Ga0207689_10116936 3300025942 Bacteria 2192
594 Ga0207689_10141071 3300025942 Bacteria 1985
595 Ga0207661_10085862 3300025944 Bacteria 2610
596 Ga0207661_10259481 3300025944 Bacteria 1547
597 Ga0207679_10001794 3300025945 Bacteria 13364
598 Ga0207679_10079034 3300025945 Bacteria 2507
599 Ga0207679_10097694 3300025945 Bacteria 2288
600 Ga0207679_10137313 3300025945 Bacteria 1971
601 Ga0207679_10343364 3300025945 Bacteria 1299
602 Ga0207667_10000980 3300025949 Bacteria 36468
603 Ga0207667_10004348 3300025949 Bacteria 17354
604 Ga0207667_10007573 3300025949 Bacteria 13030
605 Ga0207667_10046426 3300025949 Bacteria 4599
606 Ga0207667_10318087 3300025949 Bacteria 1589
607 Ga0207667_10406588 3300025949 Bacteria 1386
608 Ga0207651_10007030 3300025960 Bacteria 5965
609 Ga0207651_10011598 3300025960 Bacteria 4941
610 Ga0207651_10168126 3300025960 Bacteria 1726
611 Ga0207651_10200705 3300025960 Bacteria 1598
612 Ga0207651_10233730 3300025960 Bacteria 1494
613 Ga0207651_10266638 3300025960 Bacteria 1408
614 Ga0207651_10431714 3300025960 Bacteria 1127
615 Ga0207668_10004592 3300025972 Bacteria 8122
616 Ga0207668_10018406 3300025972 Bacteria 4395
617 Ga0207668_10035192 3300025972 Bacteria 3332
618 Ga0207668_10061869 3300025972 Bacteria 2634
619 Ga0207668_10094530 3300025972 Bacteria 2204
620 Ga0207640_10007371 3300025981 Bacteria 6073
621 Ga0207640_10010488 3300025981 Bacteria 5219
622 Ga0207640_10298455 3300025981 Bacteria 1273
623 Ga0207640_10329236 3300025981 Bacteria 1219
624 Ga0207640_10343351 3300025981 Bacteria 1197
625 Ga0207658_10008828 3300025986 Bacteria 6839
626 Ga0207658_10009537 3300025986 Bacteria 6590
627 Ga0207658_10055769 3300025986 Bacteria 2930
628 Ga0207658_10058738 3300025986 Bacteria 2864
629 Ga0207658_10195117 3300025986 Bacteria 1686
630 Ga0207658_10329877 3300025986 Bacteria 1323
631 Ga0207677_10001890 3300026023 Bacteria 11061
632 Ga0207677_10003803 3300026023 Bacteria 8019
633 Ga0207677_10004747 3300026023 Bacteria 7327
634 Ga0207677_10085791 3300026023 Bacteria 2274
635 Ga0207703_10003987 3300026035 Bacteria 12228
636 Ga0207703_10004855 3300026035 Bacteria 10942
637 Ga0207703_10048950 3300026035 Bacteria 3414
638 Ga0207703_10066506 3300026035 Bacteria 2965
639 Ga0207703_10167918 3300026035 Bacteria 1927
640 Ga0207639_10006632 3300026041 Bacteria 7871
641 Ga0207639_10010462 3300026041 Bacteria 6426
642 Ga0207639_10017248 3300026041 Bacteria 5118
643 Ga0207639_10053114 3300026041 Bacteria 3090
644 Ga0207639_10085831 3300026041 Bacteria 2504
645 Ga0207639_10201540 3300026041 Bacteria 1707
646 Ga0207639_10618004 3300026041 Bacteria 1000
647 Ga0207639_10844219 3300026041 Bacteria 855
648 Ga0207678_10003863 3300026067 Bacteria 13466
649 Ga0207678_10005913 3300026067 Bacteria 10903
650 Ga0207678_10009576 3300026067 Bacteria 8521
651 Ga0207678_10039015 3300026067 Bacteria 4123
652 Ga0207708_10000601 3300026075 Bacteria 27771
653 Ga0207708_10013446 3300026075 Bacteria 6119
654 Ga0207708_10218120 3300026075 Bacteria 1527
655 Ga0207708_10685442 3300026075 Bacteria 875
656 Ga0207702_10002130 3300026078 Bacteria 19048
657 Ga0207702_10004791 3300026078 Bacteria 11922
658 Ga0207702_10077972 3300026078 Bacteria 2867
659 Ga0207702_10353634 3300026078 Bacteria 1406
660 Ga0207702_10442890 3300026078 Bacteria 1259
661 Ga0207702_10926893 3300026078 Bacteria 863
662 Ga0207641_10009435 3300026088 Bacteria 8040
663 Ga0207641_10032926 3300026088 Bacteria 4305
664 Ga0207641_10207146 3300026088 Bacteria 1811
665 Ga0207641_10316995 3300026088 Bacteria 1477
666 Ga0207648_10001220 3300026089 Bacteria 28819
667 Ga0207648_10001453 3300026089 Bacteria 26107
668 Ga0207648_10002998 3300026089 Bacteria 17847
669 Ga0207648_10003153 3300026089 Bacteria 17372
670 Ga0207648_10004011 3300026089 Bacteria 15277
671 Ga0207648_10091378 3300026089 Bacteria 2661
672 Ga0207648_10610524 3300026089 Bacteria 1006
673 Ga0207676_10007930 3300026095 Bacteria 7553
674 Ga0207676_10009383 3300026095 Bacteria 6964
675 Ga0207676_10025643 3300026095 Bacteria 4375
676 Ga0207676_10077037 3300026095 Bacteria 2696
677 Ga0207676_10092852 3300026095 Bacteria 2483
678 Ga0207674_10000520 3300026116 Bacteria 50513
679 Ga0207674_10000883 3300026116 Bacteria 39210
680 Ga0207674_10001132 3300026116 Bacteria 34607
681 Ga0207674_10013288 3300026116 Bacteria 9145
682 Ga0207674_10217205 3300026116 Bacteria 1860
683 Ga0207675_100001116 3300026118 Bacteria 26576
684 Ga0207675_100001531 3300026118 Bacteria 23160
685 Ga0207675_100111342 3300026118 Bacteria 2583
686 Ga0207675_100152579 3300026118 Bacteria 2200
687 Ga0207675_100401530 3300026118 Bacteria 1351
688 Ga0207675_101041621 3300026118 Unclassified 837
689 Ga0207683_10000180 3300026121 Bacteria 54163
690 Ga0207683_10000243 3300026121 Bacteria 48324
691 Ga0207683_10004243 3300026121 Bacteria 12370
692 Ga0207683_10019201 3300026121 Bacteria 5835
693 Ga0207683_10290262 3300026121 Bacteria 1495
694 Ga0207698_10000855 3300026142 Bacteria 17695
695 Ga0207698_10007717 3300026142 Bacteria 6751
696 Ga0207698_10011203 3300026142 Bacteria 5802
697 Ga0207698_10017392 3300026142 Bacteria 4876
698 Ga0207698_10155628 3300026142 Bacteria 1991
699 Ga0207698_10458306 3300026142 Unclassified 1232
700 Ga0209969_1012971 3300027360 Bacteria 1204
701 Ga0209967_1002268 3300027364 Bacteria 2497
702 Ga0209981_1000622 3300027378 Bacteria 4475
703 Ga0209999_1000548 3300027543 Bacteria 5894
704 Ga0209983_1042234 3300027665 Bacteria 988
705 Ga0209974_10003824 3300027876 Bacteria 5395
706 Ga0207428_10000453 3300027907 Bacteria 49756
707 Ga0207428_10153945 3300027907 Bacteria 1749
708 Ga0268266_10004772 3300028379 Bacteria 12889
709 Ga0268266_10187044 3300028379 Bacteria 1889
710 Ga0268266_10219018 3300028379 Bacteria 1749
711 Ga0268266_10339510 3300028379 Bacteria 1410
712 Ga0268266_10431608 3300028379 Bacteria 1250
713 Ga0268266_10489497 3300028379 Bacteria 1173
714 Ga0268266_10619159 3300028379 Bacteria 1040
715 Ga0268265_10019589 3300028380 Bacteria 4706
716 Ga0268265_10019780 3300028380 Bacteria 4687
717 Ga0268265_10233736 3300028380 Bacteria 1617
718 Ga0268264_10000466 3300028381 Bacteria 55015
719 Ga0268264_10003290 3300028381 Bacteria 13971
720 Ga0268264_10015619 3300028381 Bacteria 6221
721 Ga0268264_10034902 3300028381 Bacteria 4140
722 Ga0268264_10040910 3300028381 Bacteria 3830
723 Ga0268264_10172123 3300028381 Bacteria 1959
724 Ga0268264_10333460 3300028381 Bacteria 1438
725 Ga0265330_10022376 3300031235 Bacteria 2876
726 Ga0265332_10000832 3300031238 Bacteria 18732
727 Ga0265329_10001252 3300031242 Bacteria 12416
728 Ga0265339_10044090 3300031249 Bacteria 2462
729 Ga0265331_10000960 3300031250 Bacteria 22931
730 Ga0265327_10002886 3300031251 Bacteria 17287
731 Ga0307408_100015307 3300031548 Bacteria 5106
732 Ga0307408_100188609 3300031548 Bacteria 1659
733 Ga0307408_100545509 3300031548 Bacteria 1022
734 Ga0316575_10006194 3300031665 Bacteria 4292
735 Ga0316579_10001228 3300031691 Bacteria 9188
736 Ga0316578_10116085 3300031728 Bacteria 1608
737 Ga0307405_10395721 3300031731 Bacteria 1080
738 Ga0307410_10048707 3300031852 Bacteria 2840
739 Ga0307410_10371392 3300031852 Bacteria 1148
740 Ga0307406_10001453 3300031901 Bacteria 13100
741 Ga0307406_10149717 3300031901 Bacteria 1663
742 Ga0307407_10509503 3300031903 Bacteria 883
743 Ga0307412_10012749 3300031911 Bacteria 4906
744 Ga0307409_100037174 3300031995 Bacteria 3587
745 Ga0307409_100124756 3300031995 Bacteria 2188
746 Ga0307409_100685187 3300031995 Bacteria 1023
747 Ga0307416_100007436 3300032002 Bacteria 6967
748 Ga0307416_100031414 3300032002 Bacteria 3998
749 Ga0307416_100064655 3300032002 Bacteria 3002
750 Ga0307416_100278974 3300032002 Bacteria 1646
751 Ga0307416_100571770 3300032002 Bacteria 1206
752 Ga0307414_10058726 3300032004 Bacteria 2712
753 Ga0307414_10153704 3300032004 Bacteria 1819
754 Ga0307411_10000456 3300032005 Bacteria 14093
755 Ga0307415_100004617 3300032126 Bacteria 7188
756 Ga0316583_10000892 3300032133 Bacteria 9552
757 Ga0316593_10016441 3300032168 Bacteria 2243
758 Ga0316596_1047872 3300033541 Bacteria 1129
759 Ga0373948_0015693 3300034817 Bacteria 1393
760 Ga0373928_0002221 3300035084 Bacteria 3781
761 Ga0373934_0005696 3300035086 Bacteria 4612
762 Ga0373940_0061899 3300035088 Bacteria 1072
763 Ga0373952_0009653 3300035092 Bacteria 1853
764 Ga0373923_0019402 3300035111 Bacteria 2632
765 Ga0373923_0033623 3300035111 Bacteria 2076
766 Ga0373923_0060143 3300035111 Bacteria 1612
767 Ga0373923_0106893 3300035111 Bacteria 1239
768 Ga0373932_0001230 3300035112 Bacteria 7268
769 Ga0373932_0028552 3300035112 Bacteria 1534
770 Ga0373941_0014187 3300035115 Bacteria 2123
771 Ga0373941_0097270 3300035115 Bacteria 1019
772 Ga0373945_0018142 3300035116 Bacteria 2392
773 Ga0373945_0023912 3300035116 Bacteria 2113
774 Ga0373953_0024693 3300035117 Bacteria 2288
775 Ga0373953_0026419 3300035117 Bacteria 2224
776 Ga0373953_0097050 3300035117 Bacteria 1237
777 Ga0373954_0091907 3300035118 Bacteria 1458
778 Ga0373956_0000019 3300035119 Bacteria 50599
779 Ga0373956_0011985 3300035119 Bacteria 3583
780 Ga0373956_0014647 3300035119 Bacteria 3278
781 Ga0373956_0020351 3300035119 Bacteria 2822
782 Ga0373957_0005872 3300035120 Bacteria 3833
783 Ga0373957_0035481 3300035120 Bacteria 1853
784 Ga0373960_0022010 3300035121 Bacteria 1702
785 Ga0373943_0025451 3300035170 Bacteria 2766
786 Ga0373943_0077418 3300035170 Bacteria 1698
787 Ga0373946_0041632 3300035171 Bacteria 1885
788 Ga0373955_0002173 3300035172 Bacteria 8492
789 Ga0373955_0007763 3300035172 Bacteria 4944
790 Ga0373955_0026989 3300035172 Bacteria 2964
791 Ga0373955_0038007 3300035172 Bacteria 2562
792 Ga0373955_0060478 3300035172 Bacteria 2089
793 Ga0373961_0072541 3300035241 Bacteria 1067
794 Ga0373962_0004486 3300035242 Bacteria 3375
795 Ga0316574_0000875 3300035398 Bacteria 13290
796 Ga0373924_0000260 3300035410 Bacteria 16197
797 Ga0373924_0017922 3300035410 Bacteria 2723
798 Ga0373924_0020147 3300035410 Bacteria 2589
799 Ga0373924_0071551 3300035410 Bacteria 1463
800 Ga0373931_0000246 3300035691 Bacteria 22990
801 Ga0373931_0008409 3300035691 Bacteria 4895
802 Ga0373931_0009089 3300035691 Bacteria 4740
803 Ga0373931_0062308 3300035691 Bacteria 2013
804 Ga0373935_0004744 3300035692 Bacteria 7995
805 Ga0373935_0018123 3300035692 Bacteria 4279
806 Ga0373935_0042242 3300035692 Bacteria 2866
807 Ga0373935_0102008 3300035692 Bacteria 1893
808 Ga0373935_0144266 3300035692 Bacteria 1610
809 Ga0373927_0005710 3300035695 Bacteria 8544
810 Ga0373927_0021909 3300035695 Bacteria 4188
811 Ga0373927_0080668 3300035695 Bacteria 2108
812 Ga0373927_0088659 3300035695 Bacteria 2008
813 Ga0373927_0179891 3300035695 Bacteria 1387
814 Ga0373927_0299179 3300035695 Bacteria 1059
815 Ga0373933_0003592 3300035724 Bacteria 8614
816 Ga0373947_0011294 3300035725 Bacteria 5126
817 Ga0373937_0001120 3300036401 Bacteria 22587
818 Ga0373937_0013063 3300036401 Bacteria 7314
819 Ga0373937_0038755 3300036401 Bacteria 4342
820 Ga0373937_0050874 3300036401 Bacteria 3797
821 Ga0373937_0185844 3300036401 Bacteria 1952
822 Ga0373937_0282325 3300036401 Bacteria 1568
823 Ga0373937_0370931 3300036401 Bacteria 1357
824 Ga0373937_0621877 3300036401 Bacteria 1025
825 Ga0316582_0001739 3300036647 Bacteria 9792
826 Ga0316584_0074177 3300036712 Bacteria 2551
827 Ga0373925_0004904 3300037068 Bacteria 10060
828 Ga0373925_0026384 3300037068 Bacteria 4251
829 Ga0373925_0184682 3300037068 Bacteria 1652
830 Ga0373925_0579745 3300037068 Bacteria 923
831 Ga0395900_0231738 3300037418 Bacteria 1857
832 Ga0395905_0166081 3300037471 Bacteria 2074
833 Ga0316581_0004698 3300037588 Bacteria 3504
834 Ga0395901_0570279 3300038443 Bacteria 1145
835 Ga0436360_0630722 3300039438 Bacteria 1765
836 Ga0439461_0019178 3300041410 Bacteria 1345
837 Ga0451804_0230508 3300041463 Bacteria 856
838 Ga0451853_2489227 3300041512 Bacteria 2518
839 Ga0451853_3775619 3300041512 Bacteria 1210
840 Ga0439441_001149 3300042001 Bacteria 3331
841 Ga0439441_010510 3300042001 Bacteria 1554
842 Ga0439446_0001421 3300042156 Bacteria 5447
843 Ga0439434_0041814 3300042435 Bacteria 1408
844 Ga0439435_0000201 3300042436 Bacteria 8440
845 Ga0451577_0332306 3300042876 Bacteria 1378
846 Ga0451577_0390999 3300042876 Bacteria 1262
847 Ga0466972_0000109 3300044658 Bacteria 71407
848 Ga0466964_0097045 3300044706 Bacteria 1293
849 Ga0453684_0343504 3300044712 Bacteria 1685
850 Ga0453684_0477116 3300044712 Bacteria 1384
851 Ga0451576_0004986 3300045051 Bacteria 16889
852 Ga0451576_0017839 3300045051 Bacteria 7795
853 Ga0451576_0025224 3300045051 Bacteria 6407
854 Ga0451576_0067887 3300045051 Bacteria 3711
855 Ga0451576_0341727 3300045051 Bacteria 1567
856 Ga0466967_0088205 3300045976 Bacteria 2814
857 Ga0495592_0006145 3300046454 Bacteria 8933
858 Ga0495592_0101693 3300046454 Bacteria 2047
859 Ga0495629_0026784 3300046459 Bacteria 4093
860 Ga0495651_0000147 3300046462 Bacteria 51361
861 Ga0495651_0063793 3300046462 Bacteria 2815
862 Ga0495653_0066795 3300046463 Bacteria 2703
863 Ga0495580_0014770 3300046472 Bacteria 5916
864 Ga0495580_0033392 3300046472 Bacteria 3708
865 Ga0495580_0051240 3300046472 Bacteria 2918
866 Ga0495580_0200060 3300046472 Bacteria 1376
867 Ga0495582_0003373 3300046473 Bacteria 8987
868 Ga0495582_0006496 3300046473 Bacteria 6489
869 Ga0495639_0009650 3300046475 Bacteria 4141
870 Ga0495639_0030167 3300046475 Bacteria 2410
871 Ga0495662_0008253 3300046476 Bacteria 5129
872 Ga0495662_0082379 3300046476 Bacteria 1565
873 Ga0495594_0041855 3300046499 Bacteria 2508
874 Ga0495608_0021304 3300046511 Bacteria 4449
875 Ga0495618_0036328 3300046514 Bacteria 3091
876 Ga0495628_0112374 3300046516 Bacteria 2094
877 Ga0495630_0012562 3300046517 Bacteria 6153
878 Ga0495644_0086736 3300046523 Bacteria 1180
879 Ga0495666_0008731 3300046526 Bacteria 5076
880 Ga0495666_0025398 3300046526 Bacteria 2924
881 Ga0495665_0016589 3300046531 Bacteria 3967
882 Ga0495665_0020301 3300046531 Bacteria 3570
883 Ga0495665_0026322 3300046531 Bacteria 3124
884 Ga0495640_0019306 3300046533 Bacteria 5034
885 Ga0495586_0005194 3300046535 Bacteria 6969
886 Ga0495586_0030083 3300046535 Bacteria 2906
887 Ga0495587_0036403 3300046536 Bacteria 2960
888 Ga0495598_0016783 3300046537 Bacteria 1875
889 Ga0495621_0001797 3300046539 Bacteria 5638
890 Ga0495621_0034073 3300046539 Bacteria 1758
891 Ga0495645_0095337 3300046543 Bacteria 2121
892 Ga0495645_0258987 3300046543 Bacteria 1153
893 Ga0495667_0062293 3300046559 Bacteria 2444
894 Ga0495667_0152022 3300046559 Bacteria 1490
895 Ga0495667_0273402 3300046559 Bacteria 1073
896 Ga0495634_0016550 3300046642 Bacteria 5271
897 Ga0495635_0019881 3300046663 Bacteria 4679
898 Ga0495659_0035892 3300046664 Bacteria 1749
899 Ga0495659_0052397 3300046664 Bacteria 1489
900 Ga0495659_0076928 3300046664 Bacteria 1260
901 Ga0495588_0034970 3300046674 Bacteria 2544
902 Ga0495588_0255943 3300046674 Unclassified 923
903 Ga0495599_0002850 3300046678 Bacteria 10077
904 Ga0495599_0078691 3300046678 Bacteria 2059
905 Ga0495599_0190062 3300046678 Bacteria 1263
906 Ga0495599_0288611 3300046678 Bacteria 992
907 Ga0495646_0064942 3300046680 Bacteria 2162
908 Ga0495647_0002583 3300046681 Bacteria 5741
909 Ga0495647_0020484 3300046681 Bacteria 2374
910 Ga0495647_0022948 3300046681 Bacteria 2258
911 Ga0495658_0005486 3300046683 Bacteria 6234
912 Ga0495658_0051948 3300046683 Bacteria 2323
913 Ga0495658_0138164 3300046683 Bacteria 1488
914 Ga0495669_0001556 3300046684 Bacteria 9436
915 Ga0495613_0135864 3300046689 Bacteria 1759
916 Ga0495624_0360363 3300046690 Bacteria 874
917 Ga0495600_0096519 3300046809 Bacteria 1927
918 Ga0495600_0119092 3300046809 Bacteria 1717
919 Ga0495581_0005184 3300047315 Bacteria 7540
920 Ga0495581_0035161 3300047315 Bacteria 2899
921 Ga0495604_0021442 3300047317 Bacteria 5158
922 Ga0495604_0265562 3300047317 Bacteria 1165
923 Ga0495674_0001483 3300047319 Bacteria 22973
924 Ga0495674_0254966 3300047319 Bacteria 1443
925 Ga0495680_0047561 3300047322 Bacteria 3374
926 Ga0495680_0070786 3300047322 Bacteria 2657
927 Ga0495675_0029189 3300047444 Bacteria 3517
928 Ga0495677_0061459 3300047445 Bacteria 1393
929 Ga0495684_0003095 3300047471 Bacteria 13063
930 Ga0495684_0035081 3300047471 Bacteria 3848
931 Ga0495614_0023180 3300048089 Bacteria 2678
932 Ga0496100_0471830 3300048903 Bacteria 964
933 Ga0496101_0005725 3300048904 Bacteria 7938
934 Ga0496101_0062341 3300048904 Bacteria 2711
935 Ga0496102_0024025 3300048905 Bacteria 5418
936 Ga0496102_0036172 3300048905 Bacteria 4447
937 Ga0496102_0366345 3300048905 Bacteria 1356
938 Ga0496103_0020619 3300048906 Bacteria 3960
939 Ga0496103_0046418 3300048906 Bacteria 2682
940 Ga0496104_0044131 3300048907 Bacteria 4189
941 Ga0496105_0030331 3300048908 Bacteria 4431
942 Ga0496105_0504022 3300048908 Bacteria 950
943 Ga0496106_0000575 3300048909 Bacteria 26234
944 Ga0496107_0009688 3300048910 Bacteria 6678
945 Ga0496108_0252379 3300048911 Bacteria 1534
946 Ga0496108_0260105 3300048911 Bacteria 1510
947 Ga0496109_0014328 3300048912 Bacteria 6899
948 Ga0496109_0421054 3300048912 Bacteria 1262
949 Ga0496111_0510037 3300048914 Bacteria 885
950 Ga0496112_0024796 3300048915 Bacteria 5752
951 Ga0496113_0026989 3300048916 Bacteria 4112
952 Ga0496114_0164359 3300048917 Bacteria 1932
953 Ga0496115_0007599 3300048918 Bacteria 7984
954 Ga0501032_0124299 3300049569 Bacteria 1705
955 Ga0501039_0596307 3300049575 Bacteria 866
956 Ga0501040_0051112 3300049576 Bacteria 2828
957 Ga0501041_0127200 3300049577 Bacteria 1586
958 Ga0501042_0106829 3300049578 Bacteria 2015
959 Ga0501048_0066364 3300049582 Bacteria 2551
960 Ga0501067_0064566 3300049583 Bacteria 2027
961 Ga0501068_0259125 3300049584 Bacteria 1109
962 Ga0501068_0387592 3300049584 Bacteria 900
963 Ga0501069_0118637 3300049585 Bacteria 1510
964 Ga0501072_0024303 3300049588 Bacteria 4713
965 Ga0501073_0112644 3300049589 Bacteria 1887
966 Ga0501073_0204014 3300049589 Bacteria 1367
967 Ga0501073_0225856 3300049589 Bacteria 1293
968 Ga0501073_0435878 3300049589 Bacteria 906
969 Ga0501074_0308324 3300049590 Bacteria 1124
970 Ga0501075_0076795 3300049591 Bacteria 2527
971 Ga0501076_0197232 3300049592 Bacteria 1643
972 Ga0501079_0273390 3300049741 Bacteria 1321
973 Ga0501080_0005591 3300049742 Bacteria 11234
974 Ga0501080_0160598 3300049742 Bacteria 2075
975 Ga0501080_0505417 3300049742 Bacteria 1080
976 Ga0501081_0516298 3300049743 Bacteria 891
977 Ga0501083_0072187 3300049744 Bacteria 2294
978 nmdc:mga0k408_45152_c1 3300050493 Bacteria 2542
979 nmdc:mga05p37_117008_c1 3300050507 Bacteria 3276
980 nmdc:mga05p37_1554_c1 3300050507 Bacteria 26686
981 nmdc:mga05p37_244_c1 3300050507 Bacteria 55725
982 nmdc:mga05p37_530143_c1 3300050507 Bacteria 1345
983 nmdc:mga09592_110_c1 3300050508 Bacteria 51342
984 nmdc:mga09592_207897_c1 3300050508 Bacteria 1695
985 nmdc:mga09592_357_c1 3300050508 Bacteria 33391
986 nmdc:mga0qj67_11958_c1 3300050509 Bacteria 6522
987 nmdc:mga0qj67_44845_c1 3300050509 Bacteria 3487
988 nmdc:mga06r32_100679_c1 3300050510 Bacteria 2835
989 nmdc:mga06r32_30508_c1 3300050510 Bacteria 5059
990 nmdc:mga08y16_2203_c1 3300050511 Bacteria 19987
991 nmdc:mga0n895_13156_c1 3300050512 Bacteria 7452
992 nmdc:mga0n895_395993_c1 3300050512 Bacteria 1397
993 nmdc:mga0rr50_1052_c1 3300050513 Bacteria 15004
994 nmdc:mga0rr50_540422_c1 3300050513 Bacteria 992
995 nmdc:mga08x19_11429_c1 3300050514 Bacteria 5342
996 nmdc:mga08x19_1195_c1 3300050514 Bacteria 16236
997 nmdc:mga08x19_44252_c1 3300050514 Bacteria 2842
998 nmdc:mga08x19_76111_c1 3300050514 Bacteria 2196
999 nmdc:mga08x19_8923_c1 3300050514 Bacteria 5982
1000 nmdc:mga08x19_98944_c1 3300050514 Bacteria 1933
1001 nmdc:mga0a205_1081_c1 3300050515 Bacteria 22629
1002 nmdc:mga0a205_20705_c1 3300050515 Bacteria 6211
1003 nmdc:mga0a205_249303_c1 3300050515 Bacteria 1655
1004 nmdc:mga0a205_269131_c1 3300050515 Bacteria 1581
1005 nmdc:mga0a205_469702_c1 3300050515 Bacteria 1117
1006 nmdc:mga0sz30_4945_c2 3300050516 Bacteria 3488
1007 Ga0495601_0103821 3300053077 Bacteria 1837
1008 Ga0495601_0125927 3300053077 Bacteria 1667
1009 Ga0495612_0029406 3300053078 Bacteria 2213
1010 Ga0495619_0001795 3300053085 Bacteria 14257
1011 Ga0495619_0213466 3300053085 Bacteria 1336
1012 Ga0500616_0100211 3300053153 Bacteria 1417
1013 Ga0501084_0054978 3300054114 Bacteria 3330
1014 Ga0501082_0278701 3300060353 Bacteria 1455
1015 Ga0501082_0610324 3300060353 Bacteria 955
1016 Ga0530510_0150261 3300061734 Bacteria 1720

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100018106 Ga0070695_1000181063 179
2 3300005345 Ga0070692_10136534 Ga0070692_101365342 180
3 3300005444 Ga0070694_100098627 Ga0070694_1000986272 180
4 3300005546 Ga0070696_100013241 Ga0070696_1000132417 180
5 3300005549 Ga0070704_100020253 Ga0070704_1000202535 180
6 3300025922 Ga0207646_10130746 Ga0207646_101307463 180
7 3300027360 Ga0209969_1012971 Ga0209969_10129712 180
8 3300027364 Ga0209967_1002268 Ga0209967_10022682 180
9 3300027378 Ga0209981_1000622 Ga0209981_10006226 180
10 3300027543 Ga0209999_1000548 Ga0209999_10005485 180
11 3300031548 Ga0307408_100545509 Ga0307408_1005455092 180
12 3300032002 Ga0307416_100064655 Ga0307416_1000646554 180
13 3300041410 Ga0439461_0019178 Ga0439461_0019178_421_1164 180
14 3300042156 Ga0439446_0001421 Ga0439446_0001421_1330_2073 180
15 3300042435 Ga0439434_0041814 Ga0439434_0041814_464_1207 180
16 3300042436 Ga0439435_0000201 Ga0439435_0000201_7444_8187 180
17 3300050514 nmdc:mga08x19_44252_c1 nmdc:mga08x19_44252_c1_1227_1958 180
18 3300005330 Ga0070690_100099739 Ga0070690_1000997391 181
19 3300005618 Ga0068864_100052903 Ga0068864_1000529034 181
20 3300006847 Ga0075431_100068491 Ga0075431_1000684914 181
21 3300006871 Ga0075434_100001259 Ga0075434_10000125919 181
22 3300006880 Ga0075429_100000184 Ga0075429_10000018430 181
23 3300006914 Ga0075436_100000890 Ga0075436_10000089024 181
24 3300007076 Ga0075435_100000315 Ga0075435_10000031519 181
25 3300009094 Ga0111539_10007490 Ga0111539_1000749012 181
26 3300009147 Ga0114129_10000677 Ga0114129_1000067731 181
27 3300010375 Ga0105239_10422299 Ga0105239_104222992 181
28 3300026095 Ga0207676_10077037 Ga0207676_100770372 181
29 3300027907 Ga0207428_10000453 Ga0207428_100004536 181
30 3300027907 Ga0207428_10153945 Ga0207428_101539451 181
31 3300034817 Ga0373948_0015693 Ga0373948_0015693_304_1077 181
32 3300035084 Ga0373928_0002221 Ga0373928_0002221_2929_3702 181
33 3300035111 Ga0373923_0060143 Ga0373923_0060143_371_1162 181
34 3300044658 Ga0466972_0000109 Ga0466972_0000109_52955_53551 181
35 3300045051 Ga0451576_0004986 Ga0451576_0004986_401_1171 181
36 3300050507 nmdc:mga05p37_244_c1 nmdc:mga05p37_244_c1_40250_41023 181
37 3300050508 nmdc:mga09592_110_c1 nmdc:mga09592_110_c1_35598_36371 181
38 3300050511 nmdc:mga08y16_2203_c1 nmdc:mga08y16_2203_c1_18113_18886 181
39 3300050512 nmdc:mga0n895_13156_c1 nmdc:mga0n895_13156_c1_1097_1867 181
40 3300050513 nmdc:mga0rr50_1052_c1 nmdc:mga0rr50_1052_c1_6210_6980 181
41 3300050514 nmdc:mga08x19_1195_c1 nmdc:mga08x19_1195_c1_12464_13234 181
42 3300050515 nmdc:mga0a205_1081_c1 nmdc:mga0a205_1081_c1_15791_16561 181
43 3300005336 Ga0070680_100238501 Ga0070680_1002385012 182
44 3300005344 Ga0070661_100216120 Ga0070661_1002161202 182
45 3300005444 Ga0070694_100258144 Ga0070694_1002581442 182
46 3300005539 Ga0068853_100476869 Ga0068853_1004768691 182
47 3300035088 Ga0373940_0061899 Ga0373940_0061899_227_1000 182
48 3300035092 Ga0373952_0009653 Ga0373952_0009653_518_1291 182
49 3300035112 Ga0373932_0001230 Ga0373932_0001230_4059_4832 182
50 3300035115 Ga0373941_0014187 Ga0373941_0014187_732_1505 182
51 3300035116 Ga0373945_0023912 Ga0373945_0023912_184_957 182
52 3300035242 Ga0373962_0004486 Ga0373962_0004486_453_1226 182
53 3300035691 Ga0373931_0000246 Ga0373931_0000246_20405_21178 182
54 3300035692 Ga0373935_0144266 Ga0373935_0144266_628_1392 182
55 3300045051 Ga0451576_0017839 Ga0451576_0017839_3838_4611 182
56 3300046472 Ga0495580_0014770 Ga0495580_0014770_4339_5103 182
57 3300046473 Ga0495582_0006496 Ga0495582_0006496_5534_6298 182
58 3300046475 Ga0495639_0030167 Ga0495639_0030167_1448_2221 182
59 3300046499 Ga0495594_0041855 Ga0495594_0041855_1215_1979 182
60 3300046526 Ga0495666_0008731 Ga0495666_0008731_2424_3197 182
61 3300046531 Ga0495665_0020301 Ga0495665_0020301_749_1522 182
62 3300046535 Ga0495586_0005194 Ga0495586_0005194_4837_5610 182
63 3300046674 Ga0495588_0034970 Ga0495588_0034970_1342_2106 182
64 3300046681 Ga0495647_0002583 Ga0495647_0002583_1733_2497 182
65 3300046683 Ga0495658_0005486 Ga0495658_0005486_435_1208 182
66 3300047315 Ga0495581_0035161 Ga0495581_0035161_370_1143 182
67 3300005330 Ga0070690_100053219 Ga0070690_1000532193 183
68 3300005334 Ga0068869_100000052 Ga0068869_10000005261 183
69 3300005336 Ga0070680_100010396 Ga0070680_1000103963 183
70 3300005337 Ga0070682_100007547 Ga0070682_1000075477 183
71 3300005338 Ga0068868_100001699 Ga0068868_1000016997 183
72 3300005340 Ga0070689_100013222 Ga0070689_1000132225 183
73 3300005341 Ga0070691_10068809 Ga0070691_100688092 183
74 3300005343 Ga0070687_100000128 Ga0070687_10000012811 183
75 3300005345 Ga0070692_10048396 Ga0070692_100483962 183
76 3300005355 Ga0070671_100082230 Ga0070671_1000822303 183
77 3300005356 Ga0070674_100247308 Ga0070674_1002473082 183
78 3300005364 Ga0070673_100222860 Ga0070673_1002228602 183
79 3300005365 Ga0070688_100339510 Ga0070688_1003395102 183
80 3300005438 Ga0070701_10005323 Ga0070701_100053235 183
81 3300005440 Ga0070705_100000193 Ga0070705_10000019310 183
82 3300005444 Ga0070694_100001063 Ga0070694_10000106311 183
83 3300005444 Ga0070694_100023200 Ga0070694_1000232004 183
84 3300005456 Ga0070678_100264087 Ga0070678_1002640872 183
85 3300005458 Ga0070681_10045346 Ga0070681_100453466 183
86 3300005471 Ga0070698_100077039 Ga0070698_1000770394 183
87 3300005530 Ga0070679_100002702 Ga0070679_10000270220 183
88 3300005544 Ga0070686_100000132 Ga0070686_10000013256 183
89 3300005545 Ga0070695_100000140 Ga0070695_10000014020 183
90 3300005546 Ga0070696_100000008 Ga0070696_10000000887 183
91 3300005547 Ga0070693_100000589 Ga0070693_10000058912 183
92 3300005549 Ga0070704_100000165 Ga0070704_10000016523 183
93 3300005563 Ga0068855_100011214 Ga0068855_1000112143 183
94 3300005615 Ga0070702_100008035 Ga0070702_1000080356 183
95 3300005616 Ga0068852_100070228 Ga0068852_1000702282 183
96 3300005718 Ga0068866_10000198 Ga0068866_1000019811 183
97 3300005719 Ga0068861_100000076 Ga0068861_10000007612 183
98 3300005844 Ga0068862_100010103 Ga0068862_1000101033 183
99 3300005985 Ga0081539_10004443 Ga0081539_100044434 183
100 3300006237 Ga0097621_100002626 Ga0097621_10000262615 183
101 3300006358 Ga0068871_100000152 Ga0068871_10000015226 183
102 3300006847 Ga0075431_100007163 Ga0075431_1000071632 183
103 3300006880 Ga0075429_100012597 Ga0075429_1000125975 183
104 3300006881 Ga0068865_100000386 Ga0068865_10000038611 183
105 3300009098 Ga0105245_10000221 Ga0105245_1000022159 183
106 3300009147 Ga0114129_10114894 Ga0114129_101148945 183
107 3300009148 Ga0105243_10000288 Ga0105243_1000028859 183
108 3300009174 Ga0105241_10028741 Ga0105241_100287414 183
109 3300009176 Ga0105242_10000461 Ga0105242_1000046131 183
110 3300009177 Ga0105248_10208218 Ga0105248_102082183 183
111 3300010375 Ga0105239_10045584 Ga0105239_100455842 183
112 3300011119 Ga0105246_10132786 Ga0105246_101327862 183
113 3300013297 Ga0157378_10001018 Ga0157378_1000101811 183
114 3300014969 Ga0157376_10076418 Ga0157376_100764182 183
115 3300025885 Ga0207653_10016186 Ga0207653_100161863 183
116 3300025899 Ga0207642_10000085 Ga0207642_100000859 183
117 3300025901 Ga0207688_10031463 Ga0207688_100314632 183
118 3300025911 Ga0207654_10020693 Ga0207654_100206933 183
119 3300025912 Ga0207707_10027811 Ga0207707_100278114 183
120 3300025917 Ga0207660_10091427 Ga0207660_100914272 183
121 3300025918 Ga0207662_10000229 Ga0207662_1000022924 183
122 3300025921 Ga0207652_10002520 Ga0207652_1000252018 183
123 3300025927 Ga0207687_10000486 Ga0207687_1000048611 183
124 3300025933 Ga0207706_10152260 Ga0207706_101522601 183
125 3300025934 Ga0207686_10000246 Ga0207686_1000024623 183
126 3300025935 Ga0207709_10003459 Ga0207709_100034596 183
127 3300025936 Ga0207670_10007491 Ga0207670_100074915 183
128 3300025937 Ga0207669_10454847 Ga0207669_104548472 183
129 3300025938 Ga0207704_10006065 Ga0207704_100060654 183
130 3300025940 Ga0207691_10423619 Ga0207691_104236192 183
131 3300025942 Ga0207689_10000406 Ga0207689_1000040611 183
132 3300025949 Ga0207667_10004348 Ga0207667_100043483 183
133 3300025960 Ga0207651_10233730 Ga0207651_102337302 183
134 3300026023 Ga0207677_10004747 Ga0207677_100047474 183
135 3300026041 Ga0207639_10618004 Ga0207639_106180041 183
136 3300026075 Ga0207708_10000601 Ga0207708_1000060132 183
137 3300026089 Ga0207648_10001453 Ga0207648_1000145311 183
138 3300026118 Ga0207675_100001116 Ga0207675_10000111612 183
139 3300026121 Ga0207683_10290262 Ga0207683_102902622 183
140 3300026142 Ga0207698_10155628 Ga0207698_101556282 183
141 3300028380 Ga0268265_10019589 Ga0268265_100195895 183
142 3300028381 Ga0268264_10003290 Ga0268264_100032903 183
143 3300041463 Ga0451804_0230508 Ga0451804_0230508_26_745 183
144 3300041512 Ga0451853_2489227 Ga0451853_2489227_1053_1772 183
145 3300042001 Ga0439441_010510 Ga0439441_010510_776_1528 183
146 3300044712 Ga0453684_0477116 Ga0453684_0477116_519_1187 183
147 3300048917 Ga0496114_0164359 Ga0496114_0164359_608_1384 183
148 3300049575 Ga0501039_0596307 Ga0501039_0596307_66_830 183
149 3300050507 nmdc:mga05p37_1554_c1 nmdc:mga05p37_1554_c1_8863_9615 183
150 3300050508 nmdc:mga09592_357_c1 nmdc:mga09592_357_c1_17985_18737 183
151 3300050510 nmdc:mga06r32_30508_c1 nmdc:mga06r32_30508_c1_3985_4737 183
152 3300050515 nmdc:mga0a205_469702_c1 nmdc:mga0a205_469702_c1_99_851 183
153 3300005328 Ga0070676_10207720 Ga0070676_102077201 184
154 3300005331 Ga0070670_100120363 Ga0070670_1001203633 184
155 3300005333 Ga0070677_10050268 Ga0070677_100502681 184
156 3300005347 Ga0070668_100048382 Ga0070668_1000483822 184
157 3300005354 Ga0070675_100084468 Ga0070675_1000844681 184
158 3300005356 Ga0070674_100334058 Ga0070674_1003340582 184
159 3300005367 Ga0070667_100138037 Ga0070667_1001380372 184
160 3300005457 Ga0070662_100185667 Ga0070662_1001856672 184
161 3300005459 Ga0068867_100012889 Ga0068867_1000128898 184
162 3300005548 Ga0070665_100036802 Ga0070665_1000368026 184
163 3300005578 Ga0068854_100123540 Ga0068854_1001235402 184
164 3300005719 Ga0068861_100187212 Ga0068861_1001872122 184
165 3300005834 Ga0068851_10045100 Ga0068851_100451002 184
166 3300013296 Ga0157374_10464360 Ga0157374_104643602 184
167 3300013308 Ga0157375_10333941 Ga0157375_103339412 184
168 3300025893 Ga0207682_10027927 Ga0207682_100279273 184
169 3300025907 Ga0207645_10113951 Ga0207645_101139512 184
170 3300025908 Ga0207643_10068271 Ga0207643_100682713 184
171 3300025933 Ga0207706_10239668 Ga0207706_102396682 184
172 3300025939 Ga0207665_10435324 Ga0207665_104353242 184
173 3300025940 Ga0207691_10051419 Ga0207691_100514194 184
174 3300025940 Ga0207691_10101529 Ga0207691_101015292 184
175 3300025960 Ga0207651_10431714 Ga0207651_104317141 184
176 3300025972 Ga0207668_10018406 Ga0207668_100184064 184
177 3300025981 Ga0207640_10343351 Ga0207640_103433511 184
178 3300025986 Ga0207658_10195117 Ga0207658_101951173 184
179 3300025986 Ga0207658_10329877 Ga0207658_103298771 184
180 3300026118 Ga0207675_100152579 Ga0207675_1001525793 184
181 3300028379 Ga0268266_10187044 Ga0268266_101870442 184
182 3300035112 Ga0373932_0028552 Ga0373932_0028552_458_1210 184
183 3300035241 Ga0373961_0072541 Ga0373961_0072541_248_1000 184
184 3300035410 Ga0373924_0000260 Ga0373924_0000260_7379_8059 184
185 3300035691 Ga0373931_0009089 Ga0373931_0009089_3629_4381 184
186 3300036401 Ga0373937_0050874 Ga0373937_0050874_1239_1991 184
187 3300041512 Ga0451853_3775619 Ga0451853_3775619_51_743 184
188 3300044706 Ga0466964_0097045 Ga0466964_0097045_344_1111 184
189 3300045051 Ga0451576_0025224 Ga0451576_0025224_489_1097 184
190 3300045051 Ga0451576_0067887 Ga0451576_0067887_1033_1644 184
191 3300046537 Ga0495598_0016783 Ga0495598_0016783_579_1340 184
192 3300046683 Ga0495658_0051948 Ga0495658_0051948_676_1428 184
193 3300049585 Ga0501069_0118637 Ga0501069_0118637_319_1071 184
194 3300050508 nmdc:mga09592_207897_c1 nmdc:mga09592_207897_c1_165_923 184
195 3300050509 nmdc:mga0qj67_44845_c1 nmdc:mga0qj67_44845_c1_2315_3073 184
196 3300005328 Ga0070676_10219145 Ga0070676_102191451 185
197 3300005330 Ga0070690_100059082 Ga0070690_1000590822 185
198 3300005330 Ga0070690_100198784 Ga0070690_1001987842 185
199 3300005330 Ga0070690_100390049 Ga0070690_1003900491 185
200 3300005331 Ga0070670_100002238 Ga0070670_1000022384 185
201 3300005334 Ga0068869_100004582 Ga0068869_1000045822 185
202 3300005335 Ga0070666_10053857 Ga0070666_100538573 185
203 3300005335 Ga0070666_10084282 Ga0070666_100842822 185
204 3300005336 Ga0070680_100090622 Ga0070680_1000906224 185
205 3300005338 Ga0068868_100004375 Ga0068868_1000043753 185
206 3300005339 Ga0070660_100011752 Ga0070660_1000117526 185
207 3300005340 Ga0070689_100088906 Ga0070689_1000889063 185
208 3300005341 Ga0070691_10029939 Ga0070691_100299392 185
209 3300005341 Ga0070691_10110306 Ga0070691_101103061 185
210 3300005343 Ga0070687_100006911 Ga0070687_1000069112 185
211 3300005343 Ga0070687_100056130 Ga0070687_1000561302 185
212 3300005343 Ga0070687_100109142 Ga0070687_1001091421 185
213 3300005344 Ga0070661_100168080 Ga0070661_1001680801 185
214 3300005344 Ga0070661_100351208 Ga0070661_1003512081 185
215 3300005345 Ga0070692_10045232 Ga0070692_100452321 185
216 3300005345 Ga0070692_10181590 Ga0070692_101815901 185
217 3300005347 Ga0070668_100011112 Ga0070668_1000111128 185
218 3300005347 Ga0070668_100067542 Ga0070668_1000675423 185
219 3300005353 Ga0070669_100003481 Ga0070669_10000348110 185
220 3300005353 Ga0070669_100034459 Ga0070669_1000344591 185
221 3300005353 Ga0070669_100430303 Ga0070669_1004303032 185
222 3300005355 Ga0070671_100090588 Ga0070671_1000905882 185
223 3300005355 Ga0070671_100312053 Ga0070671_1003120532 185
224 3300005356 Ga0070674_100093723 Ga0070674_1000937231 185
225 3300005364 Ga0070673_100216059 Ga0070673_1002160592 185
226 3300005364 Ga0070673_100265279 Ga0070673_1002652792 185
227 3300005365 Ga0070688_100005212 Ga0070688_1000052128 185
228 3300005365 Ga0070688_100068197 Ga0070688_1000681972 185
229 3300005366 Ga0070659_100005390 Ga0070659_1000053904 185
230 3300005367 Ga0070667_100000716 Ga0070667_10000071613 185
231 3300005434 Ga0070709_10060179 Ga0070709_100601792 185
232 3300005434 Ga0070709_10231722 Ga0070709_102317221 185
233 3300005435 Ga0070714_100034611 Ga0070714_1000346112 185
234 3300005436 Ga0070713_100008819 Ga0070713_1000088197 185
235 3300005436 Ga0070713_100066173 Ga0070713_1000661733 185
236 3300005437 Ga0070710_10046185 Ga0070710_100461852 185
237 3300005438 Ga0070701_10079502 Ga0070701_100795021 185
238 3300005438 Ga0070701_10293584 Ga0070701_102935841 185
239 3300005439 Ga0070711_100013106 Ga0070711_1000131065 185
240 3300005439 Ga0070711_100252190 Ga0070711_1002521901 185
241 3300005440 Ga0070705_100007465 Ga0070705_1000074655 185
242 3300005440 Ga0070705_100033542 Ga0070705_1000335422 185
243 3300005440 Ga0070705_100050017 Ga0070705_1000500172 185
244 3300005441 Ga0070700_100567556 Ga0070700_1005675561 185
245 3300005444 Ga0070694_100042994 Ga0070694_1000429944 185
246 3300005444 Ga0070694_100173109 Ga0070694_1001731091 185
247 3300005445 Ga0070708_100000176 Ga0070708_10000017634 185
248 3300005445 Ga0070708_100127839 Ga0070708_1001278391 185
249 3300005445 Ga0070708_100356505 Ga0070708_1003565051 185
250 3300005455 Ga0070663_100007149 Ga0070663_1000071496 185
251 3300005456 Ga0070678_100123518 Ga0070678_1001235183 185
252 3300005456 Ga0070678_100148293 Ga0070678_1001482931 185
253 3300005456 Ga0070678_100569684 Ga0070678_1005696841 185
254 3300005457 Ga0070662_100121685 Ga0070662_1001216853 185
255 3300005457 Ga0070662_100128052 Ga0070662_1001280522 185
256 3300005458 Ga0070681_10008346 Ga0070681_1000834611 185
257 3300005458 Ga0070681_10061558 Ga0070681_100615585 185
258 3300005459 Ga0068867_100007802 Ga0068867_1000078021 185
259 3300005459 Ga0068867_100010852 Ga0068867_1000108523 185
260 3300005459 Ga0068867_100137620 Ga0068867_1001376202 185
261 3300005459 Ga0068867_100141769 Ga0068867_1001417691 185
262 3300005466 Ga0070685_10005807 Ga0070685_100058073 185
263 3300005466 Ga0070685_10317608 Ga0070685_103176081 185
264 3300005467 Ga0070706_100065380 Ga0070706_1000653802 185
265 3300005467 Ga0070706_100102433 Ga0070706_1001024333 185
266 3300005467 Ga0070706_100137111 Ga0070706_1001371112 185
267 3300005467 Ga0070706_100156172 Ga0070706_1001561722 185
268 3300005468 Ga0070707_100152720 Ga0070707_1001527202 185
269 3300005468 Ga0070707_100282674 Ga0070707_1002826742 185
270 3300005471 Ga0070698_100371848 Ga0070698_1003718481 185
271 3300005518 Ga0070699_100256171 Ga0070699_1002561711 185
272 3300005530 Ga0070679_100000683 Ga0070679_10000068319 185
273 3300005530 Ga0070679_100076267 Ga0070679_1000762672 185
274 3300005535 Ga0070684_100022709 Ga0070684_1000227092 185
275 3300005536 Ga0070697_100013235 Ga0070697_1000132355 185
276 3300005536 Ga0070697_100018277 Ga0070697_1000182776 185
277 3300005539 Ga0068853_100094970 Ga0068853_1000949704 185
278 3300005539 Ga0068853_100173941 Ga0068853_1001739413 185
279 3300005543 Ga0070672_100079921 Ga0070672_1000799213 185
280 3300005543 Ga0070672_100562234 Ga0070672_1005622341 185
281 3300005544 Ga0070686_100001879 Ga0070686_1000018793 185
282 3300005544 Ga0070686_100035706 Ga0070686_1000357064 185
283 3300005544 Ga0070686_100165295 Ga0070686_1001652952 185
284 3300005544 Ga0070686_100269321 Ga0070686_1002693212 185
285 3300005545 Ga0070695_100038262 Ga0070695_1000382622 185
286 3300005545 Ga0070695_100156043 Ga0070695_1001560431 185
287 3300005546 Ga0070696_100008459 Ga0070696_1000084595 185
288 3300005546 Ga0070696_100020612 Ga0070696_1000206122 185
289 3300005546 Ga0070696_100146670 Ga0070696_1001466702 185
290 3300005546 Ga0070696_100160728 Ga0070696_1001607282 185
291 3300005547 Ga0070693_100001678 Ga0070693_1000016788 185
292 3300005547 Ga0070693_100316312 Ga0070693_1003163121 185
293 3300005548 Ga0070665_100003912 Ga0070665_1000039122 185
294 3300005549 Ga0070704_100034742 Ga0070704_1000347424 185
295 3300005549 Ga0070704_100063663 Ga0070704_1000636631 185
296 3300005549 Ga0070704_100106527 Ga0070704_1001065272 185
297 3300005549 Ga0070704_100225100 Ga0070704_1002251002 185
298 3300005549 Ga0070704_100318526 Ga0070704_1003185262 185
299 3300005563 Ga0068855_100104238 Ga0068855_1001042382 185
300 3300005564 Ga0070664_100111672 Ga0070664_1001116723 185
301 3300005564 Ga0070664_100166160 Ga0070664_1001661602 185
302 3300005577 Ga0068857_100082720 Ga0068857_1000827202 185
303 3300005577 Ga0068857_100205132 Ga0068857_1002051323 185
304 3300005578 Ga0068854_100011465 Ga0068854_1000114652 185
305 3300005578 Ga0068854_100067556 Ga0068854_1000675562 185
306 3300005614 Ga0068856_100351125 Ga0068856_1003511252 185
307 3300005615 Ga0070702_100058498 Ga0070702_1000584982 185
308 3300005616 Ga0068852_100112116 Ga0068852_1001121162 185
309 3300005617 Ga0068859_100000241 Ga0068859_10000024155 185
310 3300005617 Ga0068859_100003857 Ga0068859_1000038578 185
311 3300005617 Ga0068859_100054150 Ga0068859_1000541503 185
312 3300005618 Ga0068864_100000578 Ga0068864_10000057824 185
313 3300005618 Ga0068864_100008295 Ga0068864_1000082957 185
314 3300005618 Ga0068864_100040080 Ga0068864_1000400803 185
315 3300005718 Ga0068866_10046320 Ga0068866_100463202 185
316 3300005718 Ga0068866_10075327 Ga0068866_100753272 185
317 3300005719 Ga0068861_100000253 Ga0068861_10000025322 185
318 3300005834 Ga0068851_10032159 Ga0068851_100321591 185
319 3300005840 Ga0068870_10003058 Ga0068870_100030585 185
320 3300005840 Ga0068870_10012128 Ga0068870_100121286 185
321 3300005841 Ga0068863_100013334 Ga0068863_10001333410 185
322 3300005841 Ga0068863_100504550 Ga0068863_1005045501 185
323 3300005842 Ga0068858_100016946 Ga0068858_1000169469 185
324 3300005842 Ga0068858_100074042 Ga0068858_1000740423 185
325 3300005842 Ga0068858_100236381 Ga0068858_1002363813 185
326 3300005843 Ga0068860_100008803 Ga0068860_1000088038 185
327 3300005843 Ga0068860_100049084 Ga0068860_1000490842 185
328 3300005843 Ga0068860_100434743 Ga0068860_1004347432 185
329 3300005843 Ga0068860_100440323 Ga0068860_1004403231 185
330 3300005844 Ga0068862_100076353 Ga0068862_1000763533 185
331 3300005844 Ga0068862_100763390 Ga0068862_1007633901 185
332 3300006028 Ga0070717_10253814 Ga0070717_102538143 185
333 3300006163 Ga0070715_10038796 Ga0070715_100387962 185
334 3300006173 Ga0070716_100003884 Ga0070716_1000038843 185
335 3300006173 Ga0070716_100025390 Ga0070716_1000253902 185
336 3300006173 Ga0070716_100027806 Ga0070716_1000278064 185
337 3300006173 Ga0070716_100076946 Ga0070716_1000769462 185
338 3300006173 Ga0070716_100349376 Ga0070716_1003493761 185
339 3300006175 Ga0070712_100012107 Ga0070712_1000121071 185
340 3300006175 Ga0070712_100210401 Ga0070712_1002104013 185
341 3300006186 Ga0075369_10061649 Ga0075369_100616493 185
342 3300006195 Ga0075366_10008743 Ga0075366_100087434 185
343 3300006237 Ga0097621_100007751 Ga0097621_1000077516 185
344 3300006237 Ga0097621_100014593 Ga0097621_1000145937 185
345 3300006358 Ga0068871_100003130 Ga0068871_1000031307 185
346 3300006358 Ga0068871_100009487 Ga0068871_1000094877 185
347 3300006358 Ga0068871_100054710 Ga0068871_1000547104 185
348 3300006358 Ga0068871_100063497 Ga0068871_1000634973 185
349 3300006847 Ga0075431_100026010 Ga0075431_1000260103 185
350 3300006847 Ga0075431_100056192 Ga0075431_1000561923 185
351 3300006852 Ga0075433_10025046 Ga0075433_100250467 185
352 3300006852 Ga0075433_10192339 Ga0075433_101923392 185
353 3300006871 Ga0075434_100193720 Ga0075434_1001937202 185
354 3300006880 Ga0075429_100020944 Ga0075429_1000209442 185
355 3300006881 Ga0068865_100063301 Ga0068865_1000633012 185
356 3300006881 Ga0068865_100073564 Ga0068865_1000735642 185
357 3300006881 Ga0068865_100130283 Ga0068865_1001302832 185
358 3300006881 Ga0068865_100331735 Ga0068865_1003317352 185
359 3300006914 Ga0075436_100006126 Ga0075436_1000061262 185
360 3300006914 Ga0075436_100012648 Ga0075436_1000126484 185
361 3300006914 Ga0075436_100018398 Ga0075436_1000183984 185
362 3300006914 Ga0075436_100062532 Ga0075436_1000625322 185
363 3300006914 Ga0075436_100370940 Ga0075436_1003709402 185
364 3300006931 Ga0097620_100000241 Ga0097620_10000024155 185
365 3300006931 Ga0097620_100003857 Ga0097620_1000038578 185
366 3300006931 Ga0097620_100054151 Ga0097620_1000541515 185
367 3300007076 Ga0075435_100005931 Ga0075435_1000059318 185
368 3300007076 Ga0075435_100297295 Ga0075435_1002972952 185
369 3300007076 Ga0075435_100716893 Ga0075435_1007168931 185
370 3300007265 Ga0099794_10025067 Ga0099794_100250672 185
371 3300009098 Ga0105245_10021823 Ga0105245_100218233 185
372 3300009098 Ga0105245_10025750 Ga0105245_100257503 185
373 3300009098 Ga0105245_10448119 Ga0105245_104481191 185
374 3300009147 Ga0114129_10021743 Ga0114129_100217436 185
375 3300009147 Ga0114129_10605243 Ga0114129_106052432 185
376 3300009147 Ga0114129_11463336 Ga0114129_114633361 185
377 3300009148 Ga0105243_10035567 Ga0105243_100355673 185
378 3300009148 Ga0105243_10184554 Ga0105243_101845541 185
379 3300009148 Ga0105243_10439065 Ga0105243_104390652 185
380 3300009174 Ga0105241_10051469 Ga0105241_100514693 185
381 3300009174 Ga0105241_10079678 Ga0105241_100796783 185
382 3300009174 Ga0105241_10350688 Ga0105241_103506881 185
383 3300009176 Ga0105242_10017032 Ga0105242_100170327 185
384 3300009176 Ga0105242_10095570 Ga0105242_100955702 185
385 3300009176 Ga0105242_10357409 Ga0105242_103574092 185
386 3300009177 Ga0105248_10003921 Ga0105248_1000392119 185
387 3300009177 Ga0105248_10271166 Ga0105248_102711663 185
388 3300009551 Ga0105238_10018196 Ga0105238_100181963 185
389 3300009551 Ga0105238_10520087 Ga0105238_105200872 185
390 3300009553 Ga0105249_10169191 Ga0105249_101691912 185
391 3300013100 Ga0157373_10017867 Ga0157373_100178673 185
392 3300013100 Ga0157373_10050231 Ga0157373_100502312 185
393 3300013102 Ga0157371_10036699 Ga0157371_100366992 185
394 3300013104 Ga0157370_10002179 Ga0157370_1000217912 185
395 3300013104 Ga0157370_10200793 Ga0157370_102007931 185
396 3300013104 Ga0157370_10743051 Ga0157370_107430511 185
397 3300013296 Ga0157374_10770784 Ga0157374_107707841 185
398 3300013296 Ga0157374_11628820 Ga0157374_116288201 185
399 3300013297 Ga0157378_10085015 Ga0157378_100850153 185
400 3300013297 Ga0157378_10182126 Ga0157378_101821262 185
401 3300013306 Ga0163162_10028905 Ga0163162_100289053 185
402 3300013306 Ga0163162_10053780 Ga0163162_100537803 185
403 3300013306 Ga0163162_10193467 Ga0163162_101934673 185
404 3300013307 Ga0157372_10065337 Ga0157372_100653375 185
405 3300013307 Ga0157372_10184731 Ga0157372_101847312 185
406 3300013308 Ga0157375_10072751 Ga0157375_100727512 185
407 3300013308 Ga0157375_10585815 Ga0157375_105858151 185
408 3300013308 Ga0157375_11327166 Ga0157375_113271661 185
409 3300014325 Ga0163163_10002440 Ga0163163_1000244017 185
410 3300014325 Ga0163163_10321335 Ga0163163_103213351 185
411 3300014326 Ga0157380_10361338 Ga0157380_103613382 185
412 3300014968 Ga0157379_10003260 Ga0157379_100032609 185
413 3300014968 Ga0157379_10246320 Ga0157379_102463202 185
414 3300014969 Ga0157376_10217100 Ga0157376_102171002 185
415 3300014969 Ga0157376_10549040 Ga0157376_105490401 185
416 3300017792 Ga0163161_10015854 Ga0163161_100158546 185
417 3300017792 Ga0163161_10059840 Ga0163161_100598401 185
418 3300017792 Ga0163161_10192696 Ga0163161_101926962 185
419 3300021441 Ga0213871_10073559 Ga0213871_100735591 185
420 3300025893 Ga0207682_10026746 Ga0207682_100267463 185
421 3300025899 Ga0207642_10045543 Ga0207642_100455432 185
422 3300025899 Ga0207642_10082160 Ga0207642_100821602 185
423 3300025899 Ga0207642_10131669 Ga0207642_101316691 185
424 3300025903 Ga0207680_10096996 Ga0207680_100969962 185
425 3300025905 Ga0207685_10016992 Ga0207685_100169923 185
426 3300025906 Ga0207699_10051930 Ga0207699_100519303 185
427 3300025906 Ga0207699_10156035 Ga0207699_101560352 185
428 3300025908 Ga0207643_10007265 Ga0207643_100072654 185
429 3300025908 Ga0207643_10007501 Ga0207643_100075013 185
430 3300025910 Ga0207684_10087067 Ga0207684_100870673 185
431 3300025910 Ga0207684_10179429 Ga0207684_101794292 185
432 3300025911 Ga0207654_10027390 Ga0207654_100273903 185
433 3300025911 Ga0207654_10084679 Ga0207654_100846792 185
434 3300025912 Ga0207707_10002721 Ga0207707_100027211 185
435 3300025912 Ga0207707_10022447 Ga0207707_100224472 185
436 3300025912 Ga0207707_10084051 Ga0207707_100840513 185
437 3300025912 Ga0207707_10145238 Ga0207707_101452383 185
438 3300025915 Ga0207693_10117602 Ga0207693_101176022 185
439 3300025915 Ga0207693_10425463 Ga0207693_104254632 185
440 3300025916 Ga0207663_10100789 Ga0207663_101007892 185
441 3300025916 Ga0207663_10105221 Ga0207663_101052212 185
442 3300025918 Ga0207662_10055441 Ga0207662_100554413 185
443 3300025918 Ga0207662_10075939 Ga0207662_100759392 185
444 3300025918 Ga0207662_10134817 Ga0207662_101348172 185
445 3300025919 Ga0207657_10001232 Ga0207657_1000123220 185
446 3300025920 Ga0207649_10014444 Ga0207649_100144444 185
447 3300025920 Ga0207649_10205476 Ga0207649_102054762 185
448 3300025921 Ga0207652_10000882 Ga0207652_1000088213 185
449 3300025921 Ga0207652_10055124 Ga0207652_100551242 185
450 3300025921 Ga0207652_10074377 Ga0207652_100743775 185
451 3300025922 Ga0207646_10025064 Ga0207646_100250646 185
452 3300025923 Ga0207681_10040702 Ga0207681_100407023 185
453 3300025923 Ga0207681_10176924 Ga0207681_101769243 185
454 3300025925 Ga0207650_10332548 Ga0207650_103325482 185
455 3300025926 Ga0207659_10245799 Ga0207659_102457992 185
456 3300025927 Ga0207687_10005511 Ga0207687_100055118 185
457 3300025927 Ga0207687_10066405 Ga0207687_100664053 185
458 3300025928 Ga0207700_10000018 Ga0207700_10000018115 185
459 3300025928 Ga0207700_10139177 Ga0207700_101391771 185
460 3300025929 Ga0207664_10086002 Ga0207664_100860023 185
461 3300025929 Ga0207664_10433331 Ga0207664_104333312 185
462 3300025931 Ga0207644_10074172 Ga0207644_100741723 185
463 3300025933 Ga0207706_10128898 Ga0207706_101288982 185
464 3300025933 Ga0207706_10146356 Ga0207706_101463562 185
465 3300025933 Ga0207706_10179659 Ga0207706_101796593 185
466 3300025934 Ga0207686_10002440 Ga0207686_100024402 185
467 3300025934 Ga0207686_10010576 Ga0207686_100105767 185
468 3300025934 Ga0207686_10039695 Ga0207686_100396951 185
469 3300025934 Ga0207686_10305948 Ga0207686_103059482 185
470 3300025935 Ga0207709_10390550 Ga0207709_103905501 185
471 3300025936 Ga0207670_10702435 Ga0207670_107024351 185
472 3300025937 Ga0207669_10173524 Ga0207669_101735241 185
473 3300025938 Ga0207704_10013925 Ga0207704_100139252 185
474 3300025938 Ga0207704_10365035 Ga0207704_103650351 185
475 3300025939 Ga0207665_10019748 Ga0207665_100197485 185
476 3300025939 Ga0207665_10049897 Ga0207665_100498974 185
477 3300025939 Ga0207665_10085522 Ga0207665_100855222 185
478 3300025939 Ga0207665_10210708 Ga0207665_102107082 185
479 3300025940 Ga0207691_10015497 Ga0207691_100154978 185
480 3300025940 Ga0207691_10038029 Ga0207691_100380294 185
481 3300025940 Ga0207691_10042446 Ga0207691_100424461 185
482 3300025940 Ga0207691_10313037 Ga0207691_103130372 185
483 3300025940 Ga0207691_10386679 Ga0207691_103866791 185
484 3300025941 Ga0207711_10009735 Ga0207711_100097352 185
485 3300025941 Ga0207711_10013017 Ga0207711_100130176 185
486 3300025942 Ga0207689_10000978 Ga0207689_1000097819 185
487 3300025942 Ga0207689_10115900 Ga0207689_101159003 185
488 3300025942 Ga0207689_10116936 Ga0207689_101169362 185
489 3300025944 Ga0207661_10085862 Ga0207661_100858622 185
490 3300025945 Ga0207679_10079034 Ga0207679_100790343 185
491 3300025945 Ga0207679_10137313 Ga0207679_101373131 185
492 3300025960 Ga0207651_10168126 Ga0207651_101681262 185
493 3300025960 Ga0207651_10200705 Ga0207651_102007052 185
494 3300025960 Ga0207651_10266638 Ga0207651_102666381 185
495 3300025972 Ga0207668_10035192 Ga0207668_100351922 185
496 3300025972 Ga0207668_10094530 Ga0207668_100945302 185
497 3300025981 Ga0207640_10007371 Ga0207640_100073715 185
498 3300025986 Ga0207658_10009537 Ga0207658_100095372 185
499 3300025986 Ga0207658_10058738 Ga0207658_100587383 185
500 3300026023 Ga0207677_10003803 Ga0207677_100038032 185
501 3300026023 Ga0207677_10085791 Ga0207677_100857913 185
502 3300026035 Ga0207703_10003987 Ga0207703_100039879 185
503 3300026035 Ga0207703_10004855 Ga0207703_100048555 185
504 3300026035 Ga0207703_10066506 Ga0207703_100665063 185
505 3300026041 Ga0207639_10010462 Ga0207639_100104625 185
506 3300026041 Ga0207639_10053114 Ga0207639_100531142 185
507 3300026041 Ga0207639_10201540 Ga0207639_102015402 185
508 3300026067 Ga0207678_10005913 Ga0207678_100059138 185
509 3300026075 Ga0207708_10013446 Ga0207708_100134467 185
510 3300026075 Ga0207708_10218120 Ga0207708_102181201 185
511 3300026075 Ga0207708_10685442 Ga0207708_106854421 185
512 3300026078 Ga0207702_10353634 Ga0207702_103536342 185
513 3300026078 Ga0207702_10442890 Ga0207702_104428902 185
514 3300026088 Ga0207641_10009435 Ga0207641_100094355 185
515 3300026088 Ga0207641_10316995 Ga0207641_103169952 185
516 3300026089 Ga0207648_10002998 Ga0207648_1000299812 185
517 3300026089 Ga0207648_10003153 Ga0207648_100031538 185
518 3300026089 Ga0207648_10004011 Ga0207648_1000401111 185
519 3300026089 Ga0207648_10610524 Ga0207648_106105242 185
520 3300026095 Ga0207676_10009383 Ga0207676_100093831 185
521 3300026095 Ga0207676_10025643 Ga0207676_100256433 185
522 3300026116 Ga0207674_10001132 Ga0207674_100011329 185
523 3300026116 Ga0207674_10013288 Ga0207674_100132882 185
524 3300026116 Ga0207674_10217205 Ga0207674_102172053 185
525 3300026118 Ga0207675_100001531 Ga0207675_10000153110 185
526 3300026118 Ga0207675_100111342 Ga0207675_1001113424 185
527 3300026118 Ga0207675_101041621 Ga0207675_1010416211 185
528 3300026121 Ga0207683_10000243 Ga0207683_100002432 185
529 3300026121 Ga0207683_10004243 Ga0207683_1000424311 185
530 3300026121 Ga0207683_10019201 Ga0207683_100192012 185
531 3300026142 Ga0207698_10458306 Ga0207698_104583061 185
532 3300027665 Ga0209983_1042234 Ga0209983_10422341 185
533 3300028379 Ga0268266_10219018 Ga0268266_102190183 185
534 3300028379 Ga0268266_10339510 Ga0268266_103395102 185
535 3300028379 Ga0268266_10489497 Ga0268266_104894972 185
536 3300028380 Ga0268265_10019780 Ga0268265_100197806 185
537 3300028381 Ga0268264_10000466 Ga0268264_100004662 185
538 3300028381 Ga0268264_10015619 Ga0268264_100156192 185
539 3300028381 Ga0268264_10034902 Ga0268264_100349024 185
540 3300028381 Ga0268264_10172123 Ga0268264_101721232 185
541 3300031235 Ga0265330_10022376 Ga0265330_100223761 185
542 3300031238 Ga0265332_10000832 Ga0265332_100008321 185
543 3300031242 Ga0265329_10001252 Ga0265329_100012528 185
544 3300031249 Ga0265339_10044090 Ga0265339_100440903 185
545 3300031250 Ga0265331_10000960 Ga0265331_1000096013 185
546 3300031251 Ga0265327_10002886 Ga0265327_1000288611 185
547 3300031548 Ga0307408_100188609 Ga0307408_1001886092 185
548 3300031665 Ga0316575_10006194 Ga0316575_100061944 185
549 3300031691 Ga0316579_10001228 Ga0316579_100012283 185
550 3300031728 Ga0316578_10116085 Ga0316578_101160852 185
551 3300031731 Ga0307405_10395721 Ga0307405_103957212 185
552 3300031852 Ga0307410_10371392 Ga0307410_103713921 185
553 3300031901 Ga0307406_10149717 Ga0307406_101497172 185
554 3300031903 Ga0307407_10509503 Ga0307407_105095031 185
555 3300031995 Ga0307409_100124756 Ga0307409_1001247563 185
556 3300031995 Ga0307409_100685187 Ga0307409_1006851872 185
557 3300032002 Ga0307416_100031414 Ga0307416_1000314146 185
558 3300032002 Ga0307416_100278974 Ga0307416_1002789742 185
559 3300032002 Ga0307416_100571770 Ga0307416_1005717702 185
560 3300032004 Ga0307414_10153704 Ga0307414_101537043 185
561 3300032133 Ga0316583_10000892 Ga0316583_100008924 185
562 3300032168 Ga0316593_10016441 Ga0316593_100164411 185
563 3300033541 Ga0316596_1047872 Ga0316596_10478722 185
564 3300035086 Ga0373934_0005696 Ga0373934_0005696_3034_3774 185
565 3300035111 Ga0373923_0019402 Ga0373923_0019402_769_1530 185
566 3300035111 Ga0373923_0033623 Ga0373923_0033623_703_1443 185
567 3300035111 Ga0373923_0106893 Ga0373923_0106893_303_1085 185
568 3300035115 Ga0373941_0097270 Ga0373941_0097270_187_954 185
569 3300035116 Ga0373945_0018142 Ga0373945_0018142_1347_2081 185
570 3300035117 Ga0373953_0024693 Ga0373953_0024693_882_1664 185
571 3300035117 Ga0373953_0026419 Ga0373953_0026419_506_1258 185
572 3300035117 Ga0373953_0097050 Ga0373953_0097050_278_1039 185
573 3300035118 Ga0373954_0091907 Ga0373954_0091907_245_979 185
574 3300035119 Ga0373956_0000019 Ga0373956_0000019_4858_5610 185
575 3300035119 Ga0373956_0011985 Ga0373956_0011985_2454_3194 185
576 3300035119 Ga0373956_0014647 Ga0373956_0014647_1665_2447 185
577 3300035119 Ga0373956_0020351 Ga0373956_0020351_1725_2459 185
578 3300035120 Ga0373957_0005872 Ga0373957_0005872_1550_2311 185
579 3300035120 Ga0373957_0035481 Ga0373957_0035481_175_915 185
580 3300035121 Ga0373960_0022010 Ga0373960_0022010_678_1445 185
581 3300035170 Ga0373943_0025451 Ga0373943_0025451_416_1156 185
582 3300035170 Ga0373943_0077418 Ga0373943_0077418_679_1413 185
583 3300035171 Ga0373946_0041632 Ga0373946_0041632_1101_1835 185
584 3300035172 Ga0373955_0002173 Ga0373955_0002173_5898_6650 185
585 3300035172 Ga0373955_0007763 Ga0373955_0007763_704_1486 185
586 3300035172 Ga0373955_0026989 Ga0373955_0026989_1294_2028 185
587 3300035172 Ga0373955_0038007 Ga0373955_0038007_921_1682 185
588 3300035172 Ga0373955_0060478 Ga0373955_0060478_35_775 185
589 3300035398 Ga0316574_0000875 Ga0316574_0000875_7975_8661 185
590 3300035410 Ga0373924_0017922 Ga0373924_0017922_1310_2092 185
591 3300035410 Ga0373924_0020147 Ga0373924_0020147_564_1325 185
592 3300035410 Ga0373924_0071551 Ga0373924_0071551_329_1069 185
593 3300035691 Ga0373931_0008409 Ga0373931_0008409_3808_4575 185
594 3300035691 Ga0373931_0062308 Ga0373931_0062308_1224_1943 185
595 3300035692 Ga0373935_0004744 Ga0373935_0004744_4219_4953 185
596 3300035692 Ga0373935_0018123 Ga0373935_0018123_603_1364 185
597 3300035692 Ga0373935_0042242 Ga0373935_0042242_1103_1837 185
598 3300035692 Ga0373935_0102008 Ga0373935_0102008_189_968 185
599 3300035695 Ga0373927_0005710 Ga0373927_0005710_741_1511 185
600 3300035695 Ga0373927_0021909 Ga0373927_0021909_112_858 185
601 3300035695 Ga0373927_0080668 Ga0373927_0080668_713_1447 185
602 3300035695 Ga0373927_0088659 Ga0373927_0088659_895_1656 185
603 3300035695 Ga0373927_0179891 Ga0373927_0179891_163_942 185
604 3300035695 Ga0373927_0299179 Ga0373927_0299179_213_947 185
605 3300035724 Ga0373933_0003592 Ga0373933_0003592_6020_6772 185
606 3300035725 Ga0373947_0011294 Ga0373947_0011294_2332_3066 185
607 3300036401 Ga0373937_0001120 Ga0373937_0001120_14786_15538 185
608 3300036401 Ga0373937_0013063 Ga0373937_0013063_2293_3027 185
609 3300036401 Ga0373937_0038755 Ga0373937_0038755_1307_2089 185
610 3300036401 Ga0373937_0185844 Ga0373937_0185844_50_802 185
611 3300036401 Ga0373937_0282325 Ga0373937_0282325_634_1395 185
612 3300036401 Ga0373937_0370931 Ga0373937_0370931_215_943 185
613 3300036401 Ga0373937_0621877 Ga0373937_0621877_51_806 185
614 3300036647 Ga0316582_0001739 Ga0316582_0001739_965_1669 185
615 3300036712 Ga0316584_0074177 Ga0316584_0074177_886_1590 185
616 3300037068 Ga0373925_0004904 Ga0373925_0004904_5179_5913 185
617 3300037068 Ga0373925_0026384 Ga0373925_0026384_990_1751 185
618 3300037068 Ga0373925_0184682 Ga0373925_0184682_537_1283 185
619 3300037068 Ga0373925_0579745 Ga0373925_0579745_17_787 185
620 3300037588 Ga0316581_0004698 Ga0316581_0004698_1284_1988 185
621 3300039438 Ga0436360_0630722 Ga0436360_0630722_213_959 185
622 3300042001 Ga0439441_001149 Ga0439441_001149_2149_2913 185
623 3300042876 Ga0451577_0332306 Ga0451577_0332306_537_1193 185
624 3300045051 Ga0451576_0341727 Ga0451576_0341727_31_807 185
625 3300045976 Ga0466967_0088205 Ga0466967_0088205_1433_2173 185
626 3300046454 Ga0495592_0006145 Ga0495592_0006145_923_1681 185
627 3300046454 Ga0495592_0101693 Ga0495592_0101693_441_1202 185
628 3300046459 Ga0495629_0026784 Ga0495629_0026784_1016_1750 185
629 3300046462 Ga0495651_0000147 Ga0495651_0000147_14641_15393 185
630 3300046462 Ga0495651_0063793 Ga0495651_0063793_227_988 185
631 3300046463 Ga0495653_0066795 Ga0495653_0066795_924_1685 185
632 3300046472 Ga0495580_0033392 Ga0495580_0033392_2490_3224 185
633 3300046472 Ga0495580_0051240 Ga0495580_0051240_197_958 185
634 3300046472 Ga0495580_0200060 Ga0495580_0200060_587_1327 185
635 3300046473 Ga0495582_0003373 Ga0495582_0003373_2343_3077 185
636 3300046475 Ga0495639_0009650 Ga0495639_0009650_1831_2592 185
637 3300046476 Ga0495662_0008253 Ga0495662_0008253_2148_2882 185
638 3300046476 Ga0495662_0082379 Ga0495662_0082379_79_840 185
639 3300046511 Ga0495608_0021304 Ga0495608_0021304_2166_2927 185
640 3300046514 Ga0495618_0036328 Ga0495618_0036328_2019_2780 185
641 3300046516 Ga0495628_0112374 Ga0495628_0112374_1284_2045 185
642 3300046517 Ga0495630_0012562 Ga0495630_0012562_4390_5151 185
643 3300046523 Ga0495644_0086736 Ga0495644_0086736_129_911 185
644 3300046526 Ga0495666_0025398 Ga0495666_0025398_641_1402 185
645 3300046531 Ga0495665_0016589 Ga0495665_0016589_1222_1956 185
646 3300046531 Ga0495665_0026322 Ga0495665_0026322_2192_2953 185
647 3300046533 Ga0495640_0019306 Ga0495640_0019306_3212_3973 185
648 3300046535 Ga0495586_0030083 Ga0495586_0030083_677_1438 185
649 3300046536 Ga0495587_0036403 Ga0495587_0036403_1523_2284 185
650 3300046539 Ga0495621_0001797 Ga0495621_0001797_1088_1825 185
651 3300046539 Ga0495621_0034073 Ga0495621_0034073_619_1377 185
652 3300046543 Ga0495645_0095337 Ga0495645_0095337_787_1545 185
653 3300046543 Ga0495645_0258987 Ga0495645_0258987_158_916 185
654 3300046559 Ga0495667_0062293 Ga0495667_0062293_860_1621 185
655 3300046559 Ga0495667_0152022 Ga0495667_0152022_392_1174 185
656 3300046559 Ga0495667_0273402 Ga0495667_0273402_155_907 185
657 3300046642 Ga0495634_0016550 Ga0495634_0016550_1624_2385 185
658 3300046663 Ga0495635_0019881 Ga0495635_0019881_1396_2130 185
659 3300046664 Ga0495659_0035892 Ga0495659_0035892_287_1024 185
660 3300046664 Ga0495659_0052397 Ga0495659_0052397_656_1417 185
661 3300046664 Ga0495659_0076928 Ga0495659_0076928_368_1156 185
662 3300046674 Ga0495588_0255943 Ga0495588_0255943_28_762 185
663 3300046678 Ga0495599_0002850 Ga0495599_0002850_2395_3153 185
664 3300046678 Ga0495599_0078691 Ga0495599_0078691_73_834 185
665 3300046678 Ga0495599_0190062 Ga0495599_0190062_306_1067 185
666 3300046678 Ga0495599_0288611 Ga0495599_0288611_51_809 185
667 3300046680 Ga0495646_0064942 Ga0495646_0064942_502_1263 185
668 3300046681 Ga0495647_0020484 Ga0495647_0020484_1384_2118 185
669 3300046681 Ga0495647_0022948 Ga0495647_0022948_821_1582 185
670 3300046683 Ga0495658_0138164 Ga0495658_0138164_677_1438 185
671 3300046684 Ga0495669_0001556 Ga0495669_0001556_8112_8873 185
672 3300046689 Ga0495613_0135864 Ga0495613_0135864_238_972 185
673 3300046690 Ga0495624_0360363 Ga0495624_0360363_59_820 185
674 3300046809 Ga0495600_0096519 Ga0495600_0096519_127_861 185
675 3300046809 Ga0495600_0119092 Ga0495600_0119092_626_1387 185
676 3300047315 Ga0495581_0005184 Ga0495581_0005184_6642_7376 185
677 3300047317 Ga0495604_0021442 Ga0495604_0021442_3212_3973 185
678 3300047317 Ga0495604_0265562 Ga0495604_0265562_77_859 185
679 3300047319 Ga0495674_0001483 Ga0495674_0001483_20576_21337 185
680 3300047319 Ga0495674_0254966 Ga0495674_0254966_479_1213 185
681 3300047322 Ga0495680_0047561 Ga0495680_0047561_1893_2627 185
682 3300047322 Ga0495680_0070786 Ga0495680_0070786_1220_1981 185
683 3300047444 Ga0495675_0029189 Ga0495675_0029189_1931_2692 185
684 3300047445 Ga0495677_0061459 Ga0495677_0061459_169_906 185
685 3300047471 Ga0495684_0003095 Ga0495684_0003095_4784_5518 185
686 3300047471 Ga0495684_0035081 Ga0495684_0035081_677_1438 185
687 3300048089 Ga0495614_0023180 Ga0495614_0023180_1221_1955 185
688 3300048904 Ga0496101_0062341 Ga0496101_0062341_964_1704 185
689 3300048905 Ga0496102_0024025 Ga0496102_0024025_779_1498 185
690 3300048905 Ga0496102_0366345 Ga0496102_0366345_436_1173 185
691 3300048906 Ga0496103_0046418 Ga0496103_0046418_1277_1996 185
692 3300048907 Ga0496104_0044131 Ga0496104_0044131_40_780 185
693 3300048908 Ga0496105_0030331 Ga0496105_0030331_573_1313 185
694 3300048908 Ga0496105_0504022 Ga0496105_0504022_220_930 185
695 3300048911 Ga0496108_0260105 Ga0496108_0260105_718_1437 185
696 3300048912 Ga0496109_0014328 Ga0496109_0014328_4758_5498 185
697 3300048915 Ga0496112_0024796 Ga0496112_0024796_2859_3599 185
698 3300048918 Ga0496115_0007599 Ga0496115_0007599_571_1311 185
699 3300049569 Ga0501032_0124299 Ga0501032_0124299_538_1275 185
700 3300049576 Ga0501040_0051112 Ga0501040_0051112_1458_2198 185
701 3300049577 Ga0501041_0127200 Ga0501041_0127200_233_973 185
702 3300049578 Ga0501042_0106829 Ga0501042_0106829_480_1220 185
703 3300049582 Ga0501048_0066364 Ga0501048_0066364_1202_1942 185
704 3300049583 Ga0501067_0064566 Ga0501067_0064566_806_1537 185
705 3300049584 Ga0501068_0259125 Ga0501068_0259125_236_973 185
706 3300049584 Ga0501068_0387592 Ga0501068_0387592_94_840 185
707 3300049588 Ga0501072_0024303 Ga0501072_0024303_1059_1799 185
708 3300049589 Ga0501073_0112644 Ga0501073_0112644_583_1332 185
709 3300049589 Ga0501073_0204014 Ga0501073_0204014_174_911 185
710 3300049589 Ga0501073_0225856 Ga0501073_0225856_22_753 185
711 3300049589 Ga0501073_0435878 Ga0501073_0435878_54_791 185
712 3300049590 Ga0501074_0308324 Ga0501074_0308324_190_930 185
713 3300049591 Ga0501075_0076795 Ga0501075_0076795_1304_2044 185
714 3300049592 Ga0501076_0197232 Ga0501076_0197232_474_1211 185
715 3300049741 Ga0501079_0273390 Ga0501079_0273390_398_1138 185
716 3300049742 Ga0501080_0005591 Ga0501080_0005591_7443_8174 185
717 3300049742 Ga0501080_0160598 Ga0501080_0160598_609_1358 185
718 3300049742 Ga0501080_0505417 Ga0501080_0505417_94_840 185
719 3300049743 Ga0501081_0516298 Ga0501081_0516298_115_876 185
720 3300049744 Ga0501083_0072187 Ga0501083_0072187_854_1585 185
721 3300050493 nmdc:mga0k408_45152_c1 nmdc:mga0k408_45152_c1_1456_2181 185
722 3300050507 nmdc:mga05p37_117008_c1 nmdc:mga05p37_117008_c1_558_1316 185
723 3300050507 nmdc:mga05p37_530143_c1 nmdc:mga05p37_530143_c1_11_793 185
724 3300050509 nmdc:mga0qj67_11958_c1 nmdc:mga0qj67_11958_c1_4535_5281 185
725 3300050510 nmdc:mga06r32_100679_c1 nmdc:mga06r32_100679_c1_352_1098 185
726 3300050512 nmdc:mga0n895_395993_c1 nmdc:mga0n895_395993_c1_430_1170 185
727 3300050513 nmdc:mga0rr50_540422_c1 nmdc:mga0rr50_540422_c1_208_954 185
728 3300050514 nmdc:mga08x19_11429_c1 nmdc:mga08x19_11429_c1_871_1653 185
729 3300050514 nmdc:mga08x19_76111_c1 nmdc:mga08x19_76111_c1_847_1593 185
730 3300050514 nmdc:mga08x19_8923_c1 nmdc:mga08x19_8923_c1_1370_2116 185
731 3300050514 nmdc:mga08x19_98944_c1 nmdc:mga08x19_98944_c1_1037_1825 185
732 3300050515 nmdc:mga0a205_20705_c1 nmdc:mga0a205_20705_c1_4019_4810 185
733 3300050515 nmdc:mga0a205_249303_c1 nmdc:mga0a205_249303_c1_216_935 185
734 3300050515 nmdc:mga0a205_269131_c1 nmdc:mga0a205_269131_c1_114_890 185
735 3300050516 nmdc:mga0sz30_4945_c2 nmdc:mga0sz30_4945_c2_178_903 185
736 3300053077 Ga0495601_0103821 Ga0495601_0103821_184_942 185
737 3300053077 Ga0495601_0125927 Ga0495601_0125927_197_937 185
738 3300053078 Ga0495612_0029406 Ga0495612_0029406_583_1317 185
739 3300053085 Ga0495619_0001795 Ga0495619_0001795_3587_4321 185
740 3300053085 Ga0495619_0213466 Ga0495619_0213466_453_1214 185
741 3300054114 Ga0501084_0054978 Ga0501084_0054978_2086_2817 185
742 3300060353 Ga0501082_0278701 Ga0501082_0278701_698_1438 185
743 3300060353 Ga0501082_0610324 Ga0501082_0610324_52_792 185
744 3300061734 Ga0530510_0150261 Ga0530510_0150261_879_1619 185
745 3300005327 Ga0070658_10052176 Ga0070658_100521764 186
746 3300005327 Ga0070658_10094661 Ga0070658_100946612 186
747 3300005328 Ga0070676_10000720 Ga0070676_100007203 186
748 3300005328 Ga0070676_10089817 Ga0070676_100898172 186
749 3300005329 Ga0070683_100009972 Ga0070683_1000099722 186
750 3300005333 Ga0070677_10000176 Ga0070677_100001764 186
751 3300005334 Ga0068869_100015651 Ga0068869_1000156512 186
752 3300005335 Ga0070666_10004430 Ga0070666_100044306 186
753 3300005335 Ga0070666_10342570 Ga0070666_103425701 186
754 3300005336 Ga0070680_100059536 Ga0070680_1000595363 186
755 3300005336 Ga0070680_100092482 Ga0070680_1000924823 186
756 3300005336 Ga0070680_100251821 Ga0070680_1002518211 186
757 3300005338 Ga0068868_100032969 Ga0068868_1000329693 186
758 3300005338 Ga0068868_100501601 Ga0068868_1005016012 186
759 3300005339 Ga0070660_100022454 Ga0070660_1000224546 186
760 3300005339 Ga0070660_100035368 Ga0070660_1000353685 186
761 3300005339 Ga0070660_100051098 Ga0070660_1000510985 186
762 3300005339 Ga0070660_100065183 Ga0070660_1000651833 186
763 3300005339 Ga0070660_100748472 Ga0070660_1007484721 186
764 3300005344 Ga0070661_100000392 Ga0070661_1000003928 186
765 3300005344 Ga0070661_100010044 Ga0070661_1000100443 186
766 3300005344 Ga0070661_100209476 Ga0070661_1002094762 186
767 3300005347 Ga0070668_100005934 Ga0070668_1000059347 186
768 3300005347 Ga0070668_100008423 Ga0070668_1000084237 186
769 3300005347 Ga0070668_100345214 Ga0070668_1003452141 186
770 3300005353 Ga0070669_100016656 Ga0070669_1000166564 186
771 3300005353 Ga0070669_100040659 Ga0070669_1000406594 186
772 3300005354 Ga0070675_100001602 Ga0070675_10000160211 186
773 3300005355 Ga0070671_100002715 Ga0070671_10000271510 186
774 3300005355 Ga0070671_100018138 Ga0070671_1000181383 186
775 3300005355 Ga0070671_100018963 Ga0070671_1000189635 186
776 3300005355 Ga0070671_100463760 Ga0070671_1004637601 186
777 3300005356 Ga0070674_100003479 Ga0070674_1000034794 186
778 3300005356 Ga0070674_100100440 Ga0070674_1001004402 186
779 3300005364 Ga0070673_100008335 Ga0070673_1000083356 186
780 3300005366 Ga0070659_100001691 Ga0070659_1000016918 186
781 3300005366 Ga0070659_100014688 Ga0070659_1000146886 186
782 3300005366 Ga0070659_100019730 Ga0070659_1000197303 186
783 3300005366 Ga0070659_100154620 Ga0070659_1001546202 186
784 3300005367 Ga0070667_100024663 Ga0070667_1000246635 186
785 3300005367 Ga0070667_100068550 Ga0070667_1000685503 186
786 3300005435 Ga0070714_100082256 Ga0070714_1000822561 186
787 3300005435 Ga0070714_100507553 Ga0070714_1005075532 186
788 3300005436 Ga0070713_100311904 Ga0070713_1003119041 186
789 3300005455 Ga0070663_100004256 Ga0070663_1000042567 186
790 3300005455 Ga0070663_100011572 Ga0070663_1000115725 186
791 3300005455 Ga0070663_100015849 Ga0070663_1000158493 186
792 3300005456 Ga0070678_100003106 Ga0070678_1000031067 186
793 3300005457 Ga0070662_100000258 Ga0070662_10000025825 186
794 3300005458 Ga0070681_10010817 Ga0070681_100108177 186
795 3300005458 Ga0070681_10062579 Ga0070681_100625793 186
796 3300005458 Ga0070681_10217935 Ga0070681_102179353 186
797 3300005530 Ga0070679_100016516 Ga0070679_1000165169 186
798 3300005530 Ga0070679_100418954 Ga0070679_1004189541 186
799 3300005535 Ga0070684_100008702 Ga0070684_1000087026 186
800 3300005535 Ga0070684_100539613 Ga0070684_1005396131 186
801 3300005539 Ga0068853_100006431 Ga0068853_10000643111 186
802 3300005539 Ga0068853_100018619 Ga0068853_1000186198 186
803 3300005539 Ga0068853_100261074 Ga0068853_1002610742 186
804 3300005543 Ga0070672_100004013 Ga0070672_1000040139 186
805 3300005543 Ga0070672_100354377 Ga0070672_1003543771 186
806 3300005548 Ga0070665_100011282 Ga0070665_1000112826 186
807 3300005548 Ga0070665_100050831 Ga0070665_1000508314 186
808 3300005563 Ga0068855_100004105 Ga0068855_1000041056 186
809 3300005563 Ga0068855_100014652 Ga0068855_1000146527 186
810 3300005563 Ga0068855_100588915 Ga0068855_1005889151 186
811 3300005564 Ga0070664_100000205 Ga0070664_10000020519 186
812 3300005564 Ga0070664_100005036 Ga0070664_1000050369 186
813 3300005564 Ga0070664_100005978 Ga0070664_1000059783 186
814 3300005564 Ga0070664_100015089 Ga0070664_1000150893 186
815 3300005577 Ga0068857_100000227 Ga0068857_10000022724 186
816 3300005577 Ga0068857_100235164 Ga0068857_1002351642 186
817 3300005578 Ga0068854_100002346 Ga0068854_10000234614 186
818 3300005578 Ga0068854_100059470 Ga0068854_1000594703 186
819 3300005578 Ga0068854_100105681 Ga0068854_1001056813 186
820 3300005614 Ga0068856_100000487 Ga0068856_10000048723 186
821 3300005614 Ga0068856_100002909 Ga0068856_10000290913 186
822 3300005614 Ga0068856_100008422 Ga0068856_1000084227 186
823 3300005616 Ga0068852_100017243 Ga0068852_1000172436 186
824 3300005616 Ga0068852_100021228 Ga0068852_1000212282 186
825 3300005616 Ga0068852_100026372 Ga0068852_1000263724 186
826 3300005616 Ga0068852_100215500 Ga0068852_1002155002 186
827 3300005617 Ga0068859_100063145 Ga0068859_1000631452 186
828 3300005617 Ga0068859_100103497 Ga0068859_1001034973 186
829 3300005618 Ga0068864_100041129 Ga0068864_1000411292 186
830 3300005834 Ga0068851_10008483 Ga0068851_100084833 186
831 3300005834 Ga0068851_10169839 Ga0068851_101698392 186
832 3300005841 Ga0068863_100021276 Ga0068863_1000212763 186
833 3300005841 Ga0068863_100064043 Ga0068863_1000640433 186
834 3300005841 Ga0068863_100355828 Ga0068863_1003558282 186
835 3300005841 Ga0068863_100397998 Ga0068863_1003979982 186
836 3300005842 Ga0068858_100011707 Ga0068858_1000117074 186
837 3300005842 Ga0068858_100058849 Ga0068858_1000588493 186
838 3300005842 Ga0068858_100302759 Ga0068858_1003027592 186
839 3300005843 Ga0068860_100058232 Ga0068860_1000582324 186
840 3300005843 Ga0068860_100147698 Ga0068860_1001476982 186
841 3300005843 Ga0068860_100247948 Ga0068860_1002479482 186
842 3300005844 Ga0068862_100008122 Ga0068862_1000081222 186
843 3300006237 Ga0097621_100004081 Ga0097621_1000040813 186
844 3300006237 Ga0097621_100049002 Ga0097621_1000490022 186
845 3300006237 Ga0097621_100200592 Ga0097621_1002005923 186
846 3300006358 Ga0068871_100076662 Ga0068871_1000766622 186
847 3300006881 Ga0068865_100010875 Ga0068865_1000108752 186
848 3300006881 Ga0068865_100021906 Ga0068865_1000219061 186
849 3300006931 Ga0097620_100063145 Ga0097620_1000631452 186
850 3300006931 Ga0097620_100103500 Ga0097620_1001035003 186
851 3300009093 Ga0105240_10004875 Ga0105240_1000487510 186
852 3300009093 Ga0105240_10030167 Ga0105240_100301673 186
853 3300009093 Ga0105240_10180712 Ga0105240_101807123 186
854 3300009174 Ga0105241_10002581 Ga0105241_100025813 186
855 3300009177 Ga0105248_10001222 Ga0105248_100012222 186
856 3300009177 Ga0105248_10118063 Ga0105248_101180632 186
857 3300009545 Ga0105237_10030227 Ga0105237_100302277 186
858 3300009545 Ga0105237_10192631 Ga0105237_101926313 186
859 3300009551 Ga0105238_10003371 Ga0105238_1000337110 186
860 3300009551 Ga0105238_10007349 Ga0105238_100073491 186
861 3300010375 Ga0105239_10015966 Ga0105239_100159669 186
862 3300013100 Ga0157373_10003392 Ga0157373_1000339210 186
863 3300013100 Ga0157373_10077134 Ga0157373_100771343 186
864 3300013100 Ga0157373_10143650 Ga0157373_101436502 186
865 3300013102 Ga0157371_10000365 Ga0157371_1000036527 186
866 3300013102 Ga0157371_10037810 Ga0157371_100378104 186
867 3300013104 Ga0157370_10005373 Ga0157370_1000537315 186
868 3300013104 Ga0157370_10023445 Ga0157370_100234457 186
869 3300013104 Ga0157370_10025827 Ga0157370_100258278 186
870 3300013105 Ga0157369_10009942 Ga0157369_1000994210 186
871 3300013105 Ga0157369_10013881 Ga0157369_100138817 186
872 3300013296 Ga0157374_10026374 Ga0157374_100263747 186
873 3300013296 Ga0157374_10032245 Ga0157374_100322455 186
874 3300013306 Ga0163162_10334504 Ga0163162_103345042 186
875 3300013307 Ga0157372_10002696 Ga0157372_1000269616 186
876 3300013307 Ga0157372_10008257 Ga0157372_100082577 186
877 3300013307 Ga0157372_10120174 Ga0157372_101201743 186
878 3300013307 Ga0157372_10196365 Ga0157372_101963651 186
879 3300013307 Ga0157372_10476520 Ga0157372_104765202 186
880 3300013308 Ga0157375_10001841 Ga0157375_100018418 186
881 3300013308 Ga0157375_10329658 Ga0157375_103296582 186
882 3300014325 Ga0163163_10215629 Ga0163163_102156291 186
883 3300014326 Ga0157380_10189881 Ga0157380_101898813 186
884 3300014326 Ga0157380_10729053 Ga0157380_107290531 186
885 3300014497 Ga0182008_10213145 Ga0182008_102131451 186
886 3300014968 Ga0157379_10122144 Ga0157379_101221443 186
887 3300014969 Ga0157376_10300112 Ga0157376_103001122 186
888 3300014969 Ga0157376_11046862 Ga0157376_110468621 186
889 3300020070 Ga0206356_10482904 Ga0206356_104829042 186
890 3300020081 Ga0206354_10403941 Ga0206354_104039411 186
891 3300025315 Ga0207697_10010410 Ga0207697_100104102 186
892 3300025321 Ga0207656_10012105 Ga0207656_100121053 186
893 3300025893 Ga0207682_10000108 Ga0207682_1000010825 186
894 3300025903 Ga0207680_10047056 Ga0207680_100470563 186
895 3300025903 Ga0207680_10181891 Ga0207680_101818912 186
896 3300025907 Ga0207645_10001398 Ga0207645_1000139813 186
897 3300025907 Ga0207645_10031124 Ga0207645_100311242 186
898 3300025907 Ga0207645_10037379 Ga0207645_100373793 186
899 3300025909 Ga0207705_10010774 Ga0207705_100107748 186
900 3300025909 Ga0207705_10086078 Ga0207705_100860782 186
901 3300025909 Ga0207705_10127628 Ga0207705_101276281 186
902 3300025912 Ga0207707_10004480 Ga0207707_1000448013 186
903 3300025912 Ga0207707_10006896 Ga0207707_100068968 186
904 3300025913 Ga0207695_10037513 Ga0207695_100375137 186
905 3300025914 Ga0207671_10474438 Ga0207671_104744382 186
906 3300025917 Ga0207660_10186994 Ga0207660_101869943 186
907 3300025917 Ga0207660_10359882 Ga0207660_103598821 186
908 3300025917 Ga0207660_10679457 Ga0207660_106794571 186
909 3300025919 Ga0207657_10000967 Ga0207657_1000096722 186
910 3300025919 Ga0207657_10001126 Ga0207657_1000112616 186
911 3300025919 Ga0207657_10012659 Ga0207657_100126592 186
912 3300025919 Ga0207657_10061779 Ga0207657_100617791 186
913 3300025919 Ga0207657_10072164 Ga0207657_100721643 186
914 3300025919 Ga0207657_10148115 Ga0207657_101481152 186
915 3300025920 Ga0207649_10002455 Ga0207649_100024557 186
916 3300025920 Ga0207649_10008201 Ga0207649_100082016 186
917 3300025920 Ga0207649_10010946 Ga0207649_100109462 186
918 3300025921 Ga0207652_10009099 Ga0207652_100090998 186
919 3300025921 Ga0207652_10098654 Ga0207652_100986541 186
920 3300025921 Ga0207652_10914487 Ga0207652_109144871 186
921 3300025923 Ga0207681_10038557 Ga0207681_100385574 186
922 3300025924 Ga0207694_10009032 Ga0207694_100090327 186
923 3300025924 Ga0207694_10025337 Ga0207694_100253376 186
924 3300025926 Ga0207659_10005193 Ga0207659_100051936 186
925 3300025929 Ga0207664_10017700 Ga0207664_100177002 186
926 3300025929 Ga0207664_10063613 Ga0207664_100636134 186
927 3300025931 Ga0207644_10001357 Ga0207644_1000135716 186
928 3300025931 Ga0207644_10008526 Ga0207644_100085264 186
929 3300025931 Ga0207644_10014361 Ga0207644_100143616 186
930 3300025932 Ga0207690_10000438 Ga0207690_1000043816 186
931 3300025932 Ga0207690_10013514 Ga0207690_100135146 186
932 3300025932 Ga0207690_10098419 Ga0207690_100984193 186
933 3300025933 Ga0207706_10000024 Ga0207706_10000024122 186
934 3300025940 Ga0207691_10000144 Ga0207691_1000014423 186
935 3300025940 Ga0207691_10008753 Ga0207691_100087534 186
936 3300025940 Ga0207691_10094234 Ga0207691_100942343 186
937 3300025941 Ga0207711_10102642 Ga0207711_101026422 186
938 3300025942 Ga0207689_10141071 Ga0207689_101410712 186
939 3300025944 Ga0207661_10259481 Ga0207661_102594813 186
940 3300025945 Ga0207679_10001794 Ga0207679_100017947 186
941 3300025945 Ga0207679_10097694 Ga0207679_100976942 186
942 3300025945 Ga0207679_10343364 Ga0207679_103433642 186
943 3300025949 Ga0207667_10000980 Ga0207667_100009807 186
944 3300025949 Ga0207667_10007573 Ga0207667_100075733 186
945 3300025949 Ga0207667_10046426 Ga0207667_100464262 186
946 3300025949 Ga0207667_10318087 Ga0207667_103180872 186
947 3300025949 Ga0207667_10406588 Ga0207667_104065882 186
948 3300025960 Ga0207651_10007030 Ga0207651_100070307 186
949 3300025960 Ga0207651_10011598 Ga0207651_100115985 186
950 3300025972 Ga0207668_10004592 Ga0207668_100045926 186
951 3300025972 Ga0207668_10061869 Ga0207668_100618693 186
952 3300025981 Ga0207640_10010488 Ga0207640_100104881 186
953 3300025981 Ga0207640_10298455 Ga0207640_102984551 186
954 3300025981 Ga0207640_10329236 Ga0207640_103292362 186
955 3300025986 Ga0207658_10008828 Ga0207658_100088284 186
956 3300025986 Ga0207658_10055769 Ga0207658_100557693 186
957 3300026023 Ga0207677_10001890 Ga0207677_100018908 186
958 3300026035 Ga0207703_10048950 Ga0207703_100489505 186
959 3300026035 Ga0207703_10167918 Ga0207703_101679182 186
960 3300026041 Ga0207639_10006632 Ga0207639_100066327 186
961 3300026041 Ga0207639_10017248 Ga0207639_100172483 186
962 3300026041 Ga0207639_10085831 Ga0207639_100858312 186
963 3300026041 Ga0207639_10844219 Ga0207639_108442191 186
964 3300026067 Ga0207678_10003863 Ga0207678_100038636 186
965 3300026067 Ga0207678_10009576 Ga0207678_100095763 186
966 3300026067 Ga0207678_10039015 Ga0207678_100390153 186
967 3300026078 Ga0207702_10002130 Ga0207702_100021306 186
968 3300026078 Ga0207702_10004791 Ga0207702_100047913 186
969 3300026078 Ga0207702_10077972 Ga0207702_100779722 186
970 3300026078 Ga0207702_10926893 Ga0207702_109268931 186
971 3300026088 Ga0207641_10032926 Ga0207641_100329266 186
972 3300026088 Ga0207641_10207146 Ga0207641_102071462 186
973 3300026089 Ga0207648_10001220 Ga0207648_100012204 186
974 3300026089 Ga0207648_10091378 Ga0207648_100913783 186
975 3300026095 Ga0207676_10007930 Ga0207676_100079306 186
976 3300026095 Ga0207676_10092852 Ga0207676_100928523 186
977 3300026116 Ga0207674_10000520 Ga0207674_1000052020 186
978 3300026116 Ga0207674_10000883 Ga0207674_100008836 186
979 3300026118 Ga0207675_100401530 Ga0207675_1004015302 186
980 3300026121 Ga0207683_10000180 Ga0207683_1000018025 186
981 3300026142 Ga0207698_10000855 Ga0207698_100008559 186
982 3300026142 Ga0207698_10007717 Ga0207698_100077176 186
983 3300026142 Ga0207698_10011203 Ga0207698_100112032 186
984 3300026142 Ga0207698_10017392 Ga0207698_100173923 186
985 3300027876 Ga0209974_10003824 Ga0209974_100038242 186
986 3300028379 Ga0268266_10004772 Ga0268266_100047729 186
987 3300028379 Ga0268266_10431608 Ga0268266_104316081 186
988 3300028379 Ga0268266_10619159 Ga0268266_106191592 186
989 3300028380 Ga0268265_10233736 Ga0268265_102337362 186
990 3300028381 Ga0268264_10040910 Ga0268264_100409104 186
991 3300028381 Ga0268264_10333460 Ga0268264_103334601 186
992 3300031548 Ga0307408_100015307 Ga0307408_1000153072 186
993 3300031852 Ga0307410_10048707 Ga0307410_100487071 186
994 3300031901 Ga0307406_10001453 Ga0307406_100014532 186
995 3300031911 Ga0307412_10012749 Ga0307412_100127495 186
996 3300031995 Ga0307409_100037174 Ga0307409_1000371742 186
997 3300032002 Ga0307416_100007436 Ga0307416_1000074362 186
998 3300032004 Ga0307414_10058726 Ga0307414_100587262 186
999 3300032005 Ga0307411_10000456 Ga0307411_100004563 186
1000 3300032126 Ga0307415_100004617 Ga0307415_1000046178 186
1001 3300037418 Ga0395900_0231738 Ga0395900_0231738_365_1069 186
1002 3300037471 Ga0395905_0166081 Ga0395905_0166081_23_727 186
1003 3300038443 Ga0395901_0570279 Ga0395901_0570279_319_1023 186
1004 3300042876 Ga0451577_0390999 Ga0451577_0390999_452_1180 186
1005 3300044712 Ga0453684_0343504 Ga0453684_0343504_606_1334 186
1006 3300048903 Ga0496100_0471830 Ga0496100_0471830_20_742 186
1007 3300048904 Ga0496101_0005725 Ga0496101_0005725_6405_7127 186
1008 3300048905 Ga0496102_0036172 Ga0496102_0036172_637_1359 186
1009 3300048906 Ga0496103_0020619 Ga0496103_0020619_426_1148 186
1010 3300048909 Ga0496106_0000575 Ga0496106_0000575_5609_6331 186
1011 3300048910 Ga0496107_0009688 Ga0496107_0009688_5495_6217 186
1012 3300048911 Ga0496108_0252379 Ga0496108_0252379_177_950 186
1013 3300048912 Ga0496109_0421054 Ga0496109_0421054_17_721 186
1014 3300048914 Ga0496111_0510037 Ga0496111_0510037_117_830 186
1015 3300048916 Ga0496113_0026989 Ga0496113_0026989_799_1503 186
1016 3300053153 Ga0500616_0100211 Ga0500616_0100211_357_1127 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

102

190

0.95

PF01386

Ribosomal_L25p

Ribosomal L25p family

6

94

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7unw-assembly1.cif.gz_X pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9664 4 185
6spg-assembly1.cif.gz_V pseudomonas aeruginosa 70s ribosome from a clinical isolate 0.9584 4 185
6dnc-assembly1.cif.gz_Z e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon 0.9564 3 96
6ysi-assembly1.cif.gz_R acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9532 3 96
6ogg-assembly1.cif.gz_v 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). 0.9504 3 96
ID Description Score Start End Superfamily
af_F4JPA3_178_267_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9282 102 184 2.170.120.20
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9107 2 96 2.40.240.10
af_A0A1D6GLR4_38_141_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9044 7 91 2.40.240.10
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9042 97 185 2.170.120.20
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9018 2 96 2.40.240.10
ID Description Score Start End GO Terms
AF-A0A354Z455-F1-model_v4 50S ribosomal protein L25 0.9885 1 102 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2H9U0J8-F1-model_v4 Large ribosomal subunit protein bL25 0.9795 3 96 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-J9FQC0-F1-model_v4 Ribosomal 5S rRNA E-loop binding protein Ctc/L25/TL5 0.9791 27 110 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A4D6Y4G8-F1-model_v4 Large ribosomal subunit protein bL25 0.9758 3 96 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A3D0Q5D6-F1-model_v4 50S ribosomal protein L25 0.9736 4 112 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
89.94 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map