F488252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1016 | 362 | 1016 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100018138|Ga0070671_1000181383 |
| Length | 225 |
| Sequence | MASIEFTAYARNTEGRGPSRRMRRDGKAPGIVYGGKAEPTPIELDHNALIHALKNEAFHASILTMKMDGGGLTKVLLRDVQMHPFKNEVLHVDFQRIDENRKIHMKVPLHFGNAEASPAVKVQGAIVSHVMTELDVSCLPKDLPEFIEVDLSELDTAHSLHVSGVKLPAGVTVVSTGKLDPVVATAVVPKAVVETEEAGAAGEGAAVAAPGEVEAKAPEAKAGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 207 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 219 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 257 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.39 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 2.26 |
| Rhizosphere | 97.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10052176 | 3300005327 | Bacteria | 3316 |
| 2 | Ga0070658_10094661 | 3300005327 | Bacteria | 2465 |
| 3 | Ga0070676_10000720 | 3300005328 | Bacteria | 16181 |
| 4 | Ga0070676_10089817 | 3300005328 | Bacteria | 1880 |
| 5 | Ga0070676_10207720 | 3300005328 | Bacteria | 1287 |
| 6 | Ga0070676_10219145 | 3300005328 | Bacteria | 1256 |
| 7 | Ga0070683_100009972 | 3300005329 | Bacteria | 8145 |
| 8 | Ga0070690_100053219 | 3300005330 | Bacteria | 2589 |
| 9 | Ga0070690_100059082 | 3300005330 | Bacteria | 2464 |
| 10 | Ga0070690_100099739 | 3300005330 | Bacteria | 1924 |
| 11 | Ga0070690_100198784 | 3300005330 | Bacteria | 1394 |
| 12 | Ga0070690_100390049 | 3300005330 | Bacteria | 1020 |
| 13 | Ga0070670_100002238 | 3300005331 | Bacteria | 15902 |
| 14 | Ga0070670_100120363 | 3300005331 | Bacteria | 2264 |
| 15 | Ga0070677_10000176 | 3300005333 | Bacteria | 22159 |
| 16 | Ga0070677_10050268 | 3300005333 | Bacteria | 1683 |
| 17 | Ga0068869_100000052 | 3300005334 | Bacteria | 50285 |
| 18 | Ga0068869_100004582 | 3300005334 | Bacteria | 8612 |
| 19 | Ga0068869_100015651 | 3300005334 | Bacteria | 5095 |
| 20 | Ga0070666_10004430 | 3300005335 | Bacteria | 8555 |
| 21 | Ga0070666_10053857 | 3300005335 | Bacteria | 2714 |
| 22 | Ga0070666_10084282 | 3300005335 | Bacteria | 2175 |
| 23 | Ga0070666_10342570 | 3300005335 | Bacteria | 1068 |
| 24 | Ga0070680_100010396 | 3300005336 | Bacteria | 7175 |
| 25 | Ga0070680_100059536 | 3300005336 | Bacteria | 3125 |
| 26 | Ga0070680_100090622 | 3300005336 | Bacteria | 2531 |
| 27 | Ga0070680_100092482 | 3300005336 | Bacteria | 2505 |
| 28 | Ga0070680_100238501 | 3300005336 | Bacteria | 1537 |
| 29 | Ga0070680_100251821 | 3300005336 | Bacteria | 1493 |
| 30 | Ga0070682_100007547 | 3300005337 | Bacteria | 6128 |
| 31 | Ga0068868_100001699 | 3300005338 | Bacteria | 15063 |
| 32 | Ga0068868_100004375 | 3300005338 | Bacteria | 9902 |
| 33 | Ga0068868_100032969 | 3300005338 | Bacteria | 3988 |
| 34 | Ga0068868_100501601 | 3300005338 | Bacteria | 1063 |
| 35 | Ga0070660_100011752 | 3300005339 | Bacteria | 6234 |
| 36 | Ga0070660_100022454 | 3300005339 | Bacteria | 4666 |
| 37 | Ga0070660_100035368 | 3300005339 | Bacteria | 3781 |
| 38 | Ga0070660_100051098 | 3300005339 | Bacteria | 3182 |
| 39 | Ga0070660_100065183 | 3300005339 | Bacteria | 2835 |
| 40 | Ga0070660_100748472 | 3300005339 | Bacteria | 821 |
| 41 | Ga0070689_100013222 | 3300005340 | Bacteria | 5967 |
| 42 | Ga0070689_100088906 | 3300005340 | Bacteria | 2432 |
| 43 | Ga0070691_10029939 | 3300005341 | Bacteria | 2548 |
| 44 | Ga0070691_10068809 | 3300005341 | Bacteria | 1715 |
| 45 | Ga0070691_10110306 | 3300005341 | Bacteria | 1376 |
| 46 | Ga0070687_100000128 | 3300005343 | Bacteria | 26145 |
| 47 | Ga0070687_100006911 | 3300005343 | Bacteria | 4688 |
| 48 | Ga0070687_100056130 | 3300005343 | Bacteria | 2060 |
| 49 | Ga0070687_100109142 | 3300005343 | Bacteria | 1563 |
| 50 | Ga0070661_100000392 | 3300005344 | Bacteria | 33974 |
| 51 | Ga0070661_100010044 | 3300005344 | Bacteria | 6571 |
| 52 | Ga0070661_100168080 | 3300005344 | Bacteria | 1664 |
| 53 | Ga0070661_100209476 | 3300005344 | Bacteria | 1492 |
| 54 | Ga0070661_100216120 | 3300005344 | Bacteria | 1469 |
| 55 | Ga0070661_100351208 | 3300005344 | Unclassified | 1157 |
| 56 | Ga0070692_10045232 | 3300005345 | Bacteria | 2269 |
| 57 | Ga0070692_10048396 | 3300005345 | Bacteria | 2203 |
| 58 | Ga0070692_10136534 | 3300005345 | Bacteria | 1384 |
| 59 | Ga0070692_10181590 | 3300005345 | Bacteria | 1220 |
| 60 | Ga0070668_100005934 | 3300005347 | Bacteria | 9053 |
| 61 | Ga0070668_100008423 | 3300005347 | Bacteria | 7658 |
| 62 | Ga0070668_100011112 | 3300005347 | Bacteria | 6701 |
| 63 | Ga0070668_100048382 | 3300005347 | Bacteria | 3270 |
| 64 | Ga0070668_100067542 | 3300005347 | Bacteria | 2777 |
| 65 | Ga0070668_100345214 | 3300005347 | Bacteria | 1258 |
| 66 | Ga0070669_100003481 | 3300005353 | Bacteria | 11347 |
| 67 | Ga0070669_100016656 | 3300005353 | Bacteria | 5246 |
| 68 | Ga0070669_100034459 | 3300005353 | Bacteria | 3665 |
| 69 | Ga0070669_100040659 | 3300005353 | Bacteria | 3380 |
| 70 | Ga0070669_100430303 | 3300005353 | Bacteria | 1085 |
| 71 | Ga0070675_100001602 | 3300005354 | Bacteria | 16693 |
| 72 | Ga0070675_100084468 | 3300005354 | Bacteria | 2652 |
| 73 | Ga0070671_100002715 | 3300005355 | Bacteria | 13732 |
| 74 | Ga0070671_100018138 | 3300005355 | Bacteria | 5715 |
| 75 | Ga0070671_100018963 | 3300005355 | Bacteria | 5594 |
| 76 | Ga0070671_100082230 | 3300005355 | Bacteria | 2692 |
| 77 | Ga0070671_100090588 | 3300005355 | Bacteria | 2560 |
| 78 | Ga0070671_100312053 | 3300005355 | Bacteria | 1340 |
| 79 | Ga0070671_100463760 | 3300005355 | Bacteria | 1087 |
| 80 | Ga0070674_100003479 | 3300005356 | Bacteria | 8844 |
| 81 | Ga0070674_100093723 | 3300005356 | Bacteria | 2173 |
| 82 | Ga0070674_100100440 | 3300005356 | Bacteria | 2107 |
| 83 | Ga0070674_100247308 | 3300005356 | Bacteria | 1399 |
| 84 | Ga0070674_100334058 | 3300005356 | Bacteria | 1219 |
| 85 | Ga0070673_100008335 | 3300005364 | Bacteria | 6886 |
| 86 | Ga0070673_100216059 | 3300005364 | Bacteria | 1658 |
| 87 | Ga0070673_100222860 | 3300005364 | Bacteria | 1633 |
| 88 | Ga0070673_100265279 | 3300005364 | Bacteria | 1501 |
| 89 | Ga0070688_100005212 | 3300005365 | Bacteria | 6824 |
| 90 | Ga0070688_100068197 | 3300005365 | Bacteria | 2268 |
| 91 | Ga0070688_100339510 | 3300005365 | Bacteria | 1096 |
| 92 | Ga0070659_100001691 | 3300005366 | Bacteria | 15881 |
| 93 | Ga0070659_100005390 | 3300005366 | Bacteria | 9179 |
| 94 | Ga0070659_100014688 | 3300005366 | Bacteria | 5855 |
| 95 | Ga0070659_100019730 | 3300005366 | Bacteria | 5115 |
| 96 | Ga0070659_100154620 | 3300005366 | Bacteria | 1872 |
| 97 | Ga0070667_100000716 | 3300005367 | Bacteria | 31923 |
| 98 | Ga0070667_100024663 | 3300005367 | Bacteria | 4997 |
| 99 | Ga0070667_100068550 | 3300005367 | Bacteria | 3018 |
| 100 | Ga0070667_100138037 | 3300005367 | Bacteria | 2133 |
| 101 | Ga0070709_10060179 | 3300005434 | Bacteria | 2413 |
| 102 | Ga0070709_10231722 | 3300005434 | Unclassified | 1322 |
| 103 | Ga0070714_100034611 | 3300005435 | Bacteria | 4230 |
| 104 | Ga0070714_100082256 | 3300005435 | Bacteria | 2805 |
| 105 | Ga0070714_100507553 | 3300005435 | Bacteria | 1150 |
| 106 | Ga0070713_100008819 | 3300005436 | Bacteria | 7178 |
| 107 | Ga0070713_100066173 | 3300005436 | Bacteria | 3038 |
| 108 | Ga0070713_100311904 | 3300005436 | Bacteria | 1451 |
| 109 | Ga0070710_10046185 | 3300005437 | Bacteria | 2424 |
| 110 | Ga0070701_10005323 | 3300005438 | Bacteria | 5302 |
| 111 | Ga0070701_10079502 | 3300005438 | Bacteria | 1771 |
| 112 | Ga0070701_10293584 | 3300005438 | Bacteria | 997 |
| 113 | Ga0070711_100013106 | 3300005439 | Bacteria | 5199 |
| 114 | Ga0070711_100252190 | 3300005439 | Bacteria | 1385 |
| 115 | Ga0070705_100000193 | 3300005440 | Bacteria | 35796 |
| 116 | Ga0070705_100007465 | 3300005440 | Bacteria | 5380 |
| 117 | Ga0070705_100033542 | 3300005440 | Bacteria | 2862 |
| 118 | Ga0070705_100050017 | 3300005440 | Bacteria | 2430 |
| 119 | Ga0070700_100567556 | 3300005441 | Bacteria | 884 |
| 120 | Ga0070694_100001063 | 3300005444 | Bacteria | 15690 |
| 121 | Ga0070694_100023200 | 3300005444 | Bacteria | 3987 |
| 122 | Ga0070694_100042994 | 3300005444 | Bacteria | 3019 |
| 123 | Ga0070694_100098627 | 3300005444 | Bacteria | 2063 |
| 124 | Ga0070694_100173109 | 3300005444 | Bacteria | 1592 |
| 125 | Ga0070694_100258144 | 3300005444 | Bacteria | 1321 |
| 126 | Ga0070708_100000176 | 3300005445 | Bacteria | 45698 |
| 127 | Ga0070708_100127839 | 3300005445 | Bacteria | 2350 |
| 128 | Ga0070708_100356505 | 3300005445 | Bacteria | 1378 |
| 129 | Ga0070663_100004256 | 3300005455 | Bacteria | 8377 |
| 130 | Ga0070663_100007149 | 3300005455 | Bacteria | 6777 |
| 131 | Ga0070663_100011572 | 3300005455 | Bacteria | 5545 |
| 132 | Ga0070663_100015849 | 3300005455 | Bacteria | 4878 |
| 133 | Ga0070678_100003106 | 3300005456 | Bacteria | 9206 |
| 134 | Ga0070678_100123518 | 3300005456 | Bacteria | 2045 |
| 135 | Ga0070678_100148293 | 3300005456 | Bacteria | 1886 |
| 136 | Ga0070678_100264087 | 3300005456 | Bacteria | 1449 |
| 137 | Ga0070678_100569684 | 3300005456 | Bacteria | 1007 |
| 138 | Ga0070662_100000258 | 3300005457 | Bacteria | 31405 |
| 139 | Ga0070662_100121685 | 3300005457 | Bacteria | 2001 |
| 140 | Ga0070662_100128052 | 3300005457 | Bacteria | 1954 |
| 141 | Ga0070662_100185667 | 3300005457 | Bacteria | 1641 |
| 142 | Ga0070681_10008346 | 3300005458 | Bacteria | 10146 |
| 143 | Ga0070681_10010817 | 3300005458 | Bacteria | 9019 |
| 144 | Ga0070681_10045346 | 3300005458 | Bacteria | 4399 |
| 145 | Ga0070681_10061558 | 3300005458 | Bacteria | 3727 |
| 146 | Ga0070681_10062579 | 3300005458 | Bacteria | 3695 |
| 147 | Ga0070681_10217935 | 3300005458 | Bacteria | 1824 |
| 148 | Ga0068867_100007802 | 3300005459 | Bacteria | 7570 |
| 149 | Ga0068867_100010852 | 3300005459 | Bacteria | 6425 |
| 150 | Ga0068867_100012889 | 3300005459 | Bacteria | 5915 |
| 151 | Ga0068867_100137620 | 3300005459 | Bacteria | 1905 |
| 152 | Ga0068867_100141769 | 3300005459 | Bacteria | 1879 |
| 153 | Ga0070685_10005807 | 3300005466 | Bacteria | 6274 |
| 154 | Ga0070685_10317608 | 3300005466 | Bacteria | 1055 |
| 155 | Ga0070706_100065380 | 3300005467 | Bacteria | 3363 |
| 156 | Ga0070706_100102433 | 3300005467 | Bacteria | 2661 |
| 157 | Ga0070706_100137111 | 3300005467 | Bacteria | 2284 |
| 158 | Ga0070706_100156172 | 3300005467 | Bacteria | 2129 |
| 159 | Ga0070707_100152720 | 3300005468 | Bacteria | 2248 |
| 160 | Ga0070707_100282674 | 3300005468 | Bacteria | 1612 |
| 161 | Ga0070698_100077039 | 3300005471 | Bacteria | 3335 |
| 162 | Ga0070698_100371848 | 3300005471 | Bacteria | 1361 |
| 163 | Ga0070699_100256171 | 3300005518 | Bacteria | 1564 |
| 164 | Ga0070679_100000683 | 3300005530 | Bacteria | 29027 |
| 165 | Ga0070679_100002702 | 3300005530 | Bacteria | 16148 |
| 166 | Ga0070679_100016516 | 3300005530 | Bacteria | 7125 |
| 167 | Ga0070679_100076267 | 3300005530 | Bacteria | 3342 |
| 168 | Ga0070679_100418954 | 3300005530 | Bacteria | 1285 |
| 169 | Ga0070684_100008702 | 3300005535 | Bacteria | 7956 |
| 170 | Ga0070684_100022709 | 3300005535 | Bacteria | 5237 |
| 171 | Ga0070684_100539613 | 3300005535 | Bacteria | 1082 |
| 172 | Ga0070697_100013235 | 3300005536 | Bacteria | 6469 |
| 173 | Ga0070697_100018277 | 3300005536 | Bacteria | 5525 |
| 174 | Ga0068853_100006431 | 3300005539 | Bacteria | 9336 |
| 175 | Ga0068853_100018619 | 3300005539 | Bacteria | 5750 |
| 176 | Ga0068853_100094970 | 3300005539 | Bacteria | 2628 |
| 177 | Ga0068853_100173941 | 3300005539 | Bacteria | 1949 |
| 178 | Ga0068853_100261074 | 3300005539 | Bacteria | 1592 |
| 179 | Ga0068853_100476869 | 3300005539 | Bacteria | 1176 |
| 180 | Ga0070672_100004013 | 3300005543 | Bacteria | 9593 |
| 181 | Ga0070672_100079921 | 3300005543 | Bacteria | 2618 |
| 182 | Ga0070672_100354377 | 3300005543 | Bacteria | 1251 |
| 183 | Ga0070672_100562234 | 3300005543 | Bacteria | 991 |
| 184 | Ga0070686_100000132 | 3300005544 | Bacteria | 52774 |
| 185 | Ga0070686_100001879 | 3300005544 | Bacteria | 11698 |
| 186 | Ga0070686_100035706 | 3300005544 | Bacteria | 3071 |
| 187 | Ga0070686_100165295 | 3300005544 | Bacteria | 1561 |
| 188 | Ga0070686_100269321 | 3300005544 | Bacteria | 1252 |
| 189 | Ga0070695_100000140 | 3300005545 | Bacteria | 33449 |
| 190 | Ga0070695_100018106 | 3300005545 | Bacteria | 4277 |
| 191 | Ga0070695_100038262 | 3300005545 | Bacteria | 3026 |
| 192 | Ga0070695_100156043 | 3300005545 | Bacteria | 1597 |
| 193 | Ga0070696_100000008 | 3300005546 | Bacteria | 101365 |
| 194 | Ga0070696_100008459 | 3300005546 | Bacteria | 6886 |
| 195 | Ga0070696_100013241 | 3300005546 | Bacteria | 5535 |
| 196 | Ga0070696_100020612 | 3300005546 | Bacteria | 4466 |
| 197 | Ga0070696_100146670 | 3300005546 | Bacteria | 1729 |
| 198 | Ga0070696_100160728 | 3300005546 | Bacteria | 1655 |
| 199 | Ga0070693_100000589 | 3300005547 | Bacteria | 16080 |
| 200 | Ga0070693_100001678 | 3300005547 | Bacteria | 10031 |
| 201 | Ga0070693_100316312 | 3300005547 | Bacteria | 1057 |
| 202 | Ga0070665_100003912 | 3300005548 | Bacteria | 15739 |
| 203 | Ga0070665_100011282 | 3300005548 | Bacteria | 9038 |
| 204 | Ga0070665_100036802 | 3300005548 | Bacteria | 4922 |
| 205 | Ga0070665_100050831 | 3300005548 | Bacteria | 4159 |
| 206 | Ga0070704_100000165 | 3300005549 | Bacteria | 26127 |
| 207 | Ga0070704_100020253 | 3300005549 | Bacteria | 4286 |
| 208 | Ga0070704_100034742 | 3300005549 | Bacteria | 3422 |
| 209 | Ga0070704_100063663 | 3300005549 | Bacteria | 2648 |
| 210 | Ga0070704_100106527 | 3300005549 | Bacteria | 2124 |
| 211 | Ga0070704_100225100 | 3300005549 | Bacteria | 1527 |
| 212 | Ga0070704_100318526 | 3300005549 | Bacteria | 1302 |
| 213 | Ga0068855_100004105 | 3300005563 | Bacteria | 17757 |
| 214 | Ga0068855_100011214 | 3300005563 | Bacteria | 10822 |
| 215 | Ga0068855_100014652 | 3300005563 | Bacteria | 9442 |
| 216 | Ga0068855_100104238 | 3300005563 | Bacteria | 3263 |
| 217 | Ga0068855_100588915 | 3300005563 | Bacteria | 1201 |
| 218 | Ga0070664_100000205 | 3300005564 | Bacteria | 42407 |
| 219 | Ga0070664_100005036 | 3300005564 | Bacteria | 10589 |
| 220 | Ga0070664_100005978 | 3300005564 | Bacteria | 9837 |
| 221 | Ga0070664_100015089 | 3300005564 | Bacteria | 6308 |
| 222 | Ga0070664_100111672 | 3300005564 | Bacteria | 2386 |
| 223 | Ga0070664_100166160 | 3300005564 | Bacteria | 1955 |
| 224 | Ga0068857_100000227 | 3300005577 | Bacteria | 37461 |
| 225 | Ga0068857_100082720 | 3300005577 | Bacteria | 2868 |
| 226 | Ga0068857_100205132 | 3300005577 | Bacteria | 1798 |
| 227 | Ga0068857_100235164 | 3300005577 | Bacteria | 1676 |
| 228 | Ga0068854_100002346 | 3300005578 | Bacteria | 11668 |
| 229 | Ga0068854_100011465 | 3300005578 | Bacteria | 5774 |
| 230 | Ga0068854_100059470 | 3300005578 | Bacteria | 2762 |
| 231 | Ga0068854_100067556 | 3300005578 | Bacteria | 2604 |
| 232 | Ga0068854_100105681 | 3300005578 | Bacteria | 2117 |
| 233 | Ga0068854_100123540 | 3300005578 | Bacteria | 1968 |
| 234 | Ga0068856_100000487 | 3300005614 | Bacteria | 43983 |
| 235 | Ga0068856_100002909 | 3300005614 | Bacteria | 17528 |
| 236 | Ga0068856_100008422 | 3300005614 | Bacteria | 10041 |
| 237 | Ga0068856_100351125 | 3300005614 | Bacteria | 1493 |
| 238 | Ga0070702_100008035 | 3300005615 | Bacteria | 5090 |
| 239 | Ga0070702_100058498 | 3300005615 | Bacteria | 2233 |
| 240 | Ga0068852_100017243 | 3300005616 | Bacteria | 5663 |
| 241 | Ga0068852_100021228 | 3300005616 | Bacteria | 5179 |
| 242 | Ga0068852_100026372 | 3300005616 | Bacteria | 4722 |
| 243 | Ga0068852_100070228 | 3300005616 | Bacteria | 3072 |
| 244 | Ga0068852_100112116 | 3300005616 | Bacteria | 2481 |
| 245 | Ga0068852_100215500 | 3300005616 | Bacteria | 1824 |
| 246 | Ga0068859_100000241 | 3300005617 | Bacteria | 53802 |
| 247 | Ga0068859_100003857 | 3300005617 | Bacteria | 15320 |
| 248 | Ga0068859_100054150 | 3300005617 | Bacteria | 4035 |
| 249 | Ga0068859_100063145 | 3300005617 | Bacteria | 3734 |
| 250 | Ga0068859_100103497 | 3300005617 | Bacteria | 2905 |
| 251 | Ga0068864_100000578 | 3300005618 | Bacteria | 31152 |
| 252 | Ga0068864_100008295 | 3300005618 | Bacteria | 8568 |
| 253 | Ga0068864_100040080 | 3300005618 | Bacteria | 4006 |
| 254 | Ga0068864_100041129 | 3300005618 | Bacteria | 3954 |
| 255 | Ga0068864_100052903 | 3300005618 | Bacteria | 3501 |
| 256 | Ga0068866_10000198 | 3300005718 | Bacteria | 28274 |
| 257 | Ga0068866_10046320 | 3300005718 | Bacteria | 2186 |
| 258 | Ga0068866_10075327 | 3300005718 | Bacteria | 1796 |
| 259 | Ga0068861_100000076 | 3300005719 | Bacteria | 47808 |
| 260 | Ga0068861_100000253 | 3300005719 | Bacteria | 29666 |
| 261 | Ga0068861_100187212 | 3300005719 | Bacteria | 1727 |
| 262 | Ga0068851_10008483 | 3300005834 | Bacteria | 4753 |
| 263 | Ga0068851_10032159 | 3300005834 | Bacteria | 2610 |
| 264 | Ga0068851_10045100 | 3300005834 | Bacteria | 2227 |
| 265 | Ga0068851_10169839 | 3300005834 | Bacteria | 1203 |
| 266 | Ga0068870_10003058 | 3300005840 | Bacteria | 7050 |
| 267 | Ga0068870_10012128 | 3300005840 | Bacteria | 4019 |
| 268 | Ga0068863_100013334 | 3300005841 | Bacteria | 7925 |
| 269 | Ga0068863_100021276 | 3300005841 | Bacteria | 6191 |
| 270 | Ga0068863_100064043 | 3300005841 | Bacteria | 3477 |
| 271 | Ga0068863_100355828 | 3300005841 | Bacteria | 1426 |
| 272 | Ga0068863_100397998 | 3300005841 | Bacteria | 1347 |
| 273 | Ga0068863_100504550 | 3300005841 | Bacteria | 1191 |
| 274 | Ga0068858_100011707 | 3300005842 | Bacteria | 8272 |
| 275 | Ga0068858_100016946 | 3300005842 | Bacteria | 6840 |
| 276 | Ga0068858_100058849 | 3300005842 | Bacteria | 3553 |
| 277 | Ga0068858_100074042 | 3300005842 | Bacteria | 3162 |
| 278 | Ga0068858_100236381 | 3300005842 | Bacteria | 1733 |
| 279 | Ga0068858_100302759 | 3300005842 | Bacteria | 1525 |
| 280 | Ga0068860_100008803 | 3300005843 | Bacteria | 10055 |
| 281 | Ga0068860_100049084 | 3300005843 | Bacteria | 4022 |
| 282 | Ga0068860_100058232 | 3300005843 | Bacteria | 3673 |
| 283 | Ga0068860_100147698 | 3300005843 | Bacteria | 2263 |
| 284 | Ga0068860_100247948 | 3300005843 | Bacteria | 1733 |
| 285 | Ga0068860_100434743 | 3300005843 | Bacteria | 1303 |
| 286 | Ga0068860_100440323 | 3300005843 | Bacteria | 1294 |
| 287 | Ga0068862_100008122 | 3300005844 | Bacteria | 8681 |
| 288 | Ga0068862_100010103 | 3300005844 | Bacteria | 7791 |
| 289 | Ga0068862_100076353 | 3300005844 | Bacteria | 2899 |
| 290 | Ga0068862_100763390 | 3300005844 | Bacteria | 942 |
| 291 | Ga0081539_10004443 | 3300005985 | Bacteria | 15484 |
| 292 | Ga0070717_10253814 | 3300006028 | Bacteria | 1554 |
| 293 | Ga0070715_10038796 | 3300006163 | Bacteria | 1979 |
| 294 | Ga0070716_100003884 | 3300006173 | Bacteria | 7096 |
| 295 | Ga0070716_100025390 | 3300006173 | Bacteria | 3162 |
| 296 | Ga0070716_100027806 | 3300006173 | Bacteria | 3042 |
| 297 | Ga0070716_100076946 | 3300006173 | Bacteria | 1979 |
| 298 | Ga0070716_100349376 | 3300006173 | Bacteria | 1046 |
| 299 | Ga0070712_100012107 | 3300006175 | Bacteria | 5481 |
| 300 | Ga0070712_100210401 | 3300006175 | Bacteria | 1533 |
| 301 | Ga0075369_10061649 | 3300006186 | Bacteria | 1637 |
| 302 | Ga0075366_10008743 | 3300006195 | Bacteria | 5638 |
| 303 | Ga0097621_100002626 | 3300006237 | Bacteria | 12302 |
| 304 | Ga0097621_100004081 | 3300006237 | Bacteria | 10134 |
| 305 | Ga0097621_100007751 | 3300006237 | Bacteria | 7697 |
| 306 | Ga0097621_100014593 | 3300006237 | Bacteria | 5886 |
| 307 | Ga0097621_100049002 | 3300006237 | Bacteria | 3430 |
| 308 | Ga0097621_100200592 | 3300006237 | Bacteria | 1732 |
| 309 | Ga0068871_100000152 | 3300006358 | Bacteria | 45602 |
| 310 | Ga0068871_100003130 | 3300006358 | Bacteria | 11355 |
| 311 | Ga0068871_100009487 | 3300006358 | Bacteria | 7055 |
| 312 | Ga0068871_100054710 | 3300006358 | Bacteria | 3239 |
| 313 | Ga0068871_100063497 | 3300006358 | Bacteria | 3021 |
| 314 | Ga0068871_100076662 | 3300006358 | Bacteria | 2762 |
| 315 | Ga0075431_100007163 | 3300006847 | Bacteria | 11088 |
| 316 | Ga0075431_100026010 | 3300006847 | Bacteria | 5999 |
| 317 | Ga0075431_100056192 | 3300006847 | Bacteria | 4060 |
| 318 | Ga0075431_100068491 | 3300006847 | Bacteria | 3663 |
| 319 | Ga0075433_10025046 | 3300006852 | Bacteria | 5043 |
| 320 | Ga0075433_10192339 | 3300006852 | Bacteria | 1815 |
| 321 | Ga0075434_100001259 | 3300006871 | Bacteria | 21116 |
| 322 | Ga0075434_100193720 | 3300006871 | Bacteria | 2053 |
| 323 | Ga0075429_100000184 | 3300006880 | Bacteria | 40869 |
| 324 | Ga0075429_100012597 | 3300006880 | Bacteria | 7331 |
| 325 | Ga0075429_100020944 | 3300006880 | Bacteria | 5672 |
| 326 | Ga0068865_100000386 | 3300006881 | Bacteria | 24465 |
| 327 | Ga0068865_100010875 | 3300006881 | Bacteria | 5677 |
| 328 | Ga0068865_100021906 | 3300006881 | Bacteria | 4161 |
| 329 | Ga0068865_100063301 | 3300006881 | Bacteria | 2599 |
| 330 | Ga0068865_100073564 | 3300006881 | Bacteria | 2430 |
| 331 | Ga0068865_100130283 | 3300006881 | Bacteria | 1884 |
| 332 | Ga0068865_100331735 | 3300006881 | Bacteria | 1227 |
| 333 | Ga0075436_100000890 | 3300006914 | Bacteria | 19852 |
| 334 | Ga0075436_100006126 | 3300006914 | Bacteria | 8257 |
| 335 | Ga0075436_100012648 | 3300006914 | Bacteria | 5782 |
| 336 | Ga0075436_100018398 | 3300006914 | Bacteria | 4783 |
| 337 | Ga0075436_100062532 | 3300006914 | Bacteria | 2573 |
| 338 | Ga0075436_100370940 | 3300006914 | Bacteria | 1034 |
| 339 | Ga0097620_100000241 | 3300006931 | Bacteria | 53802 |
| 340 | Ga0097620_100003857 | 3300006931 | Bacteria | 15320 |
| 341 | Ga0097620_100054151 | 3300006931 | Bacteria | 4035 |
| 342 | Ga0097620_100063145 | 3300006931 | Bacteria | 3734 |
| 343 | Ga0097620_100103500 | 3300006931 | Bacteria | 2905 |
| 344 | Ga0075435_100000315 | 3300007076 | Bacteria | 29765 |
| 345 | Ga0075435_100005931 | 3300007076 | Bacteria | 8594 |
| 346 | Ga0075435_100297295 | 3300007076 | Bacteria | 1380 |
| 347 | Ga0075435_100716893 | 3300007076 | Unclassified | 870 |
| 348 | Ga0099794_10025067 | 3300007265 | Bacteria | 2743 |
| 349 | Ga0105240_10004875 | 3300009093 | Bacteria | 20188 |
| 350 | Ga0105240_10030167 | 3300009093 | Bacteria | 7053 |
| 351 | Ga0105240_10180712 | 3300009093 | Bacteria | 2489 |
| 352 | Ga0111539_10007490 | 3300009094 | Bacteria | 13972 |
| 353 | Ga0105245_10000221 | 3300009098 | Bacteria | 54253 |
| 354 | Ga0105245_10021823 | 3300009098 | Bacteria | 5619 |
| 355 | Ga0105245_10025750 | 3300009098 | Bacteria | 5172 |
| 356 | Ga0105245_10448119 | 3300009098 | Bacteria | 1299 |
| 357 | Ga0114129_10000677 | 3300009147 | Bacteria | 42898 |
| 358 | Ga0114129_10021743 | 3300009147 | Bacteria | 9104 |
| 359 | Ga0114129_10114894 | 3300009147 | Bacteria | 3711 |
| 360 | Ga0114129_10605243 | 3300009147 | Bacteria | 1419 |
| 361 | Ga0114129_11463336 | 3300009147 | Bacteria | 841 |
| 362 | Ga0105243_10000288 | 3300009148 | Bacteria | 55680 |
| 363 | Ga0105243_10035567 | 3300009148 | Bacteria | 3862 |
| 364 | Ga0105243_10184554 | 3300009148 | Bacteria | 1817 |
| 365 | Ga0105243_10439065 | 3300009148 | Bacteria | 1222 |
| 366 | Ga0105241_10002581 | 3300009174 | Bacteria | 13585 |
| 367 | Ga0105241_10028741 | 3300009174 | Bacteria | 4143 |
| 368 | Ga0105241_10051469 | 3300009174 | Bacteria | 3141 |
| 369 | Ga0105241_10079678 | 3300009174 | Bacteria | 2562 |
| 370 | Ga0105241_10350688 | 3300009174 | Bacteria | 1281 |
| 371 | Ga0105242_10000461 | 3300009176 | Bacteria | 32284 |
| 372 | Ga0105242_10017032 | 3300009176 | Bacteria | 5659 |
| 373 | Ga0105242_10095570 | 3300009176 | Bacteria | 2509 |
| 374 | Ga0105242_10357409 | 3300009176 | Bacteria | 1351 |
| 375 | Ga0105248_10001222 | 3300009177 | Bacteria | 28675 |
| 376 | Ga0105248_10003921 | 3300009177 | Bacteria | 16450 |
| 377 | Ga0105248_10118063 | 3300009177 | Bacteria | 2992 |
| 378 | Ga0105248_10208218 | 3300009177 | Bacteria | 2203 |
| 379 | Ga0105248_10271166 | 3300009177 | Bacteria | 1911 |
| 380 | Ga0105237_10030227 | 3300009545 | Bacteria | 5505 |
| 381 | Ga0105237_10192631 | 3300009545 | Bacteria | 2038 |
| 382 | Ga0105238_10003371 | 3300009551 | Bacteria | 15944 |
| 383 | Ga0105238_10007349 | 3300009551 | Bacteria | 11029 |
| 384 | Ga0105238_10018196 | 3300009551 | Bacteria | 7145 |
| 385 | Ga0105238_10520087 | 3300009551 | Unclassified | 1192 |
| 386 | Ga0105249_10169191 | 3300009553 | Bacteria | 2118 |
| 387 | Ga0105239_10015966 | 3300010375 | Bacteria | 8310 |
| 388 | Ga0105239_10045584 | 3300010375 | Bacteria | 4806 |
| 389 | Ga0105239_10422299 | 3300010375 | Bacteria | 1511 |
| 390 | Ga0105246_10132786 | 3300011119 | Bacteria | 1862 |
| 391 | Ga0157373_10003392 | 3300013100 | Bacteria | 12052 |
| 392 | Ga0157373_10017867 | 3300013100 | Bacteria | 5163 |
| 393 | Ga0157373_10050231 | 3300013100 | Bacteria | 2970 |
| 394 | Ga0157373_10077134 | 3300013100 | Bacteria | 2351 |
| 395 | Ga0157373_10143650 | 3300013100 | Bacteria | 1678 |
| 396 | Ga0157371_10000365 | 3300013102 | Bacteria | 57144 |
| 397 | Ga0157371_10036699 | 3300013102 | Bacteria | 3510 |
| 398 | Ga0157371_10037810 | 3300013102 | Bacteria | 3454 |
| 399 | Ga0157370_10002179 | 3300013104 | Bacteria | 23894 |
| 400 | Ga0157370_10005373 | 3300013104 | Bacteria | 14382 |
| 401 | Ga0157370_10023445 | 3300013104 | Bacteria | 6125 |
| 402 | Ga0157370_10025827 | 3300013104 | Bacteria | 5811 |
| 403 | Ga0157370_10200793 | 3300013104 | Bacteria | 1850 |
| 404 | Ga0157370_10743051 | 3300013104 | Bacteria | 894 |
| 405 | Ga0157369_10009942 | 3300013105 | Bacteria | 10867 |
| 406 | Ga0157369_10013881 | 3300013105 | Bacteria | 9099 |
| 407 | Ga0157374_10026374 | 3300013296 | Bacteria | 5228 |
| 408 | Ga0157374_10032245 | 3300013296 | Bacteria | 4769 |
| 409 | Ga0157374_10464360 | 3300013296 | Bacteria | 1268 |
| 410 | Ga0157374_10770784 | 3300013296 | Bacteria | 977 |
| 411 | Ga0157374_11628820 | 3300013296 | Bacteria | 670 |
| 412 | Ga0157378_10001018 | 3300013297 | Bacteria | 25585 |
| 413 | Ga0157378_10085015 | 3300013297 | Bacteria | 2865 |
| 414 | Ga0157378_10182126 | 3300013297 | Bacteria | 1977 |
| 415 | Ga0163162_10028905 | 3300013306 | Bacteria | 5487 |
| 416 | Ga0163162_10053780 | 3300013306 | Bacteria | 4047 |
| 417 | Ga0163162_10193467 | 3300013306 | Bacteria | 2162 |
| 418 | Ga0163162_10334504 | 3300013306 | Bacteria | 1647 |
| 419 | Ga0157372_10002696 | 3300013307 | Bacteria | 19185 |
| 420 | Ga0157372_10008257 | 3300013307 | Bacteria | 11071 |
| 421 | Ga0157372_10065337 | 3300013307 | Bacteria | 4084 |
| 422 | Ga0157372_10120174 | 3300013307 | Bacteria | 3017 |
| 423 | Ga0157372_10184731 | 3300013307 | Bacteria | 2414 |
| 424 | Ga0157372_10196365 | 3300013307 | Bacteria | 2337 |
| 425 | Ga0157372_10476520 | 3300013307 | Bacteria | 1455 |
| 426 | Ga0157375_10001841 | 3300013308 | Bacteria | 18235 |
| 427 | Ga0157375_10072751 | 3300013308 | Bacteria | 3455 |
| 428 | Ga0157375_10329658 | 3300013308 | Bacteria | 1691 |
| 429 | Ga0157375_10333941 | 3300013308 | Bacteria | 1681 |
| 430 | Ga0157375_10585815 | 3300013308 | Unclassified | 1275 |
| 431 | Ga0157375_11327166 | 3300013308 | Bacteria | 846 |
| 432 | Ga0163163_10002440 | 3300014325 | Bacteria | 15727 |
| 433 | Ga0163163_10215629 | 3300014325 | Bacteria | 1968 |
| 434 | Ga0163163_10321335 | 3300014325 | Bacteria | 1601 |
| 435 | Ga0157380_10189881 | 3300014326 | Bacteria | 1813 |
| 436 | Ga0157380_10361338 | 3300014326 | Bacteria | 1362 |
| 437 | Ga0157380_10729053 | 3300014326 | Bacteria | 1000 |
| 438 | Ga0182008_10213145 | 3300014497 | Bacteria | 986 |
| 439 | Ga0157379_10003260 | 3300014968 | Bacteria | 13751 |
| 440 | Ga0157379_10122144 | 3300014968 | Bacteria | 2343 |
| 441 | Ga0157379_10246320 | 3300014968 | Bacteria | 1622 |
| 442 | Ga0157376_10076418 | 3300014969 | Bacteria | 2861 |
| 443 | Ga0157376_10217100 | 3300014969 | Bacteria | 1769 |
| 444 | Ga0157376_10300112 | 3300014969 | Bacteria | 1520 |
| 445 | Ga0157376_10549040 | 3300014969 | Bacteria | 1143 |
| 446 | Ga0157376_11046862 | 3300014969 | Bacteria | 840 |
| 447 | Ga0163161_10015854 | 3300017792 | Bacteria | 5256 |
| 448 | Ga0163161_10059840 | 3300017792 | Bacteria | 2771 |
| 449 | Ga0163161_10192696 | 3300017792 | Bacteria | 1568 |
| 450 | Ga0206356_10482904 | 3300020070 | Bacteria | 2242 |
| 451 | Ga0206354_10403941 | 3300020081 | Bacteria | 1647 |
| 452 | Ga0213871_10073559 | 3300021441 | Bacteria | 969 |
| 453 | Ga0207697_10010410 | 3300025315 | Bacteria | 3975 |
| 454 | Ga0207656_10012105 | 3300025321 | Bacteria | 3275 |
| 455 | Ga0207653_10016186 | 3300025885 | Bacteria | 2342 |
| 456 | Ga0207682_10000108 | 3300025893 | Bacteria | 37635 |
| 457 | Ga0207682_10026746 | 3300025893 | Bacteria | 2296 |
| 458 | Ga0207682_10027927 | 3300025893 | Bacteria | 2249 |
| 459 | Ga0207642_10000085 | 3300025899 | Bacteria | 24466 |
| 460 | Ga0207642_10045543 | 3300025899 | Bacteria | 1948 |
| 461 | Ga0207642_10082160 | 3300025899 | Bacteria | 1568 |
| 462 | Ga0207642_10131669 | 3300025899 | Bacteria | 1306 |
| 463 | Ga0207688_10031463 | 3300025901 | Bacteria | 2929 |
| 464 | Ga0207680_10047056 | 3300025903 | Bacteria | 2553 |
| 465 | Ga0207680_10096996 | 3300025903 | Bacteria | 1887 |
| 466 | Ga0207680_10181891 | 3300025903 | Bacteria | 1422 |
| 467 | Ga0207685_10016992 | 3300025905 | Bacteria | 2341 |
| 468 | Ga0207699_10051930 | 3300025906 | Bacteria | 2424 |
| 469 | Ga0207699_10156035 | 3300025906 | Unclassified | 1515 |
| 470 | Ga0207645_10001398 | 3300025907 | Bacteria | 19761 |
| 471 | Ga0207645_10031124 | 3300025907 | Bacteria | 3435 |
| 472 | Ga0207645_10037379 | 3300025907 | Bacteria | 3115 |
| 473 | Ga0207645_10113951 | 3300025907 | Bacteria | 1752 |
| 474 | Ga0207643_10007265 | 3300025908 | Bacteria | 5943 |
| 475 | Ga0207643_10007501 | 3300025908 | Bacteria | 5856 |
| 476 | Ga0207643_10068271 | 3300025908 | Bacteria | 2042 |
| 477 | Ga0207705_10010774 | 3300025909 | Bacteria | 6639 |
| 478 | Ga0207705_10086078 | 3300025909 | Bacteria | 2297 |
| 479 | Ga0207705_10127628 | 3300025909 | Bacteria | 1891 |
| 480 | Ga0207684_10087067 | 3300025910 | Bacteria | 2661 |
| 481 | Ga0207684_10179429 | 3300025910 | Bacteria | 1826 |
| 482 | Ga0207654_10020693 | 3300025911 | Bacteria | 3492 |
| 483 | Ga0207654_10027390 | 3300025911 | Bacteria | 3097 |
| 484 | Ga0207654_10084679 | 3300025911 | Bacteria | 1917 |
| 485 | Ga0207707_10002721 | 3300025912 | Bacteria | 15790 |
| 486 | Ga0207707_10004480 | 3300025912 | Bacteria | 12290 |
| 487 | Ga0207707_10006896 | 3300025912 | Bacteria | 9909 |
| 488 | Ga0207707_10022447 | 3300025912 | Bacteria | 5517 |
| 489 | Ga0207707_10027811 | 3300025912 | Bacteria | 4944 |
| 490 | Ga0207707_10084051 | 3300025912 | Bacteria | 2780 |
| 491 | Ga0207707_10145238 | 3300025912 | Bacteria | 2074 |
| 492 | Ga0207695_10037513 | 3300025913 | Bacteria | 5228 |
| 493 | Ga0207671_10474438 | 3300025914 | Bacteria | 997 |
| 494 | Ga0207693_10117602 | 3300025915 | Bacteria | 2087 |
| 495 | Ga0207693_10425463 | 3300025915 | Unclassified | 1038 |
| 496 | Ga0207663_10100789 | 3300025916 | Bacteria | 1939 |
| 497 | Ga0207663_10105221 | 3300025916 | Bacteria | 1904 |
| 498 | Ga0207660_10091427 | 3300025917 | Bacteria | 2257 |
| 499 | Ga0207660_10186994 | 3300025917 | Bacteria | 1611 |
| 500 | Ga0207660_10359882 | 3300025917 | Bacteria | 1167 |
| 501 | Ga0207660_10679457 | 3300025917 | Bacteria | 840 |
| 502 | Ga0207662_10000229 | 3300025918 | Bacteria | 25944 |
| 503 | Ga0207662_10055441 | 3300025918 | Bacteria | 2365 |
| 504 | Ga0207662_10075939 | 3300025918 | Bacteria | 2042 |
| 505 | Ga0207662_10134817 | 3300025918 | Bacteria | 1560 |
| 506 | Ga0207657_10000967 | 3300025919 | Bacteria | 30457 |
| 507 | Ga0207657_10001126 | 3300025919 | Bacteria | 28383 |
| 508 | Ga0207657_10001232 | 3300025919 | Bacteria | 27321 |
| 509 | Ga0207657_10012659 | 3300025919 | Bacteria | 8314 |
| 510 | Ga0207657_10061779 | 3300025919 | Bacteria | 3210 |
| 511 | Ga0207657_10072164 | 3300025919 | Bacteria | 2921 |
| 512 | Ga0207657_10148115 | 3300025919 | Bacteria | 1913 |
| 513 | Ga0207649_10002455 | 3300025920 | Bacteria | 10377 |
| 514 | Ga0207649_10008201 | 3300025920 | Bacteria | 5688 |
| 515 | Ga0207649_10010946 | 3300025920 | Bacteria | 4989 |
| 516 | Ga0207649_10014444 | 3300025920 | Bacteria | 4422 |
| 517 | Ga0207649_10205476 | 3300025920 | Bacteria | 1394 |
| 518 | Ga0207652_10000882 | 3300025921 | Bacteria | 28372 |
| 519 | Ga0207652_10002520 | 3300025921 | Bacteria | 15398 |
| 520 | Ga0207652_10009099 | 3300025921 | Bacteria | 7997 |
| 521 | Ga0207652_10055124 | 3300025921 | Bacteria | 3418 |
| 522 | Ga0207652_10074377 | 3300025921 | Bacteria | 2958 |
| 523 | Ga0207652_10098654 | 3300025921 | Bacteria | 2577 |
| 524 | Ga0207652_10914487 | 3300025921 | Bacteria | 775 |
| 525 | Ga0207646_10025064 | 3300025922 | Bacteria | 5459 |
| 526 | Ga0207646_10130746 | 3300025922 | Bacteria | 2259 |
| 527 | Ga0207681_10038557 | 3300025923 | Bacteria | 3167 |
| 528 | Ga0207681_10040702 | 3300025923 | Bacteria | 3094 |
| 529 | Ga0207681_10176924 | 3300025923 | Bacteria | 1622 |
| 530 | Ga0207694_10009032 | 3300025924 | Bacteria | 7523 |
| 531 | Ga0207694_10025337 | 3300025924 | Bacteria | 4508 |
| 532 | Ga0207650_10332548 | 3300025925 | Bacteria | 1246 |
| 533 | Ga0207659_10005193 | 3300025926 | Bacteria | 7886 |
| 534 | Ga0207659_10245799 | 3300025926 | Bacteria | 1450 |
| 535 | Ga0207687_10000486 | 3300025927 | Bacteria | 26740 |
| 536 | Ga0207687_10005511 | 3300025927 | Bacteria | 8375 |
| 537 | Ga0207687_10066405 | 3300025927 | Bacteria | 2564 |
| 538 | Ga0207700_10000018 | 3300025928 | Bacteria | 191007 |
| 539 | Ga0207700_10139177 | 3300025928 | Bacteria | 1992 |
| 540 | Ga0207664_10017700 | 3300025929 | Bacteria | 5231 |
| 541 | Ga0207664_10063613 | 3300025929 | Bacteria | 2949 |
| 542 | Ga0207664_10086002 | 3300025929 | Bacteria | 2567 |
| 543 | Ga0207664_10433331 | 3300025929 | Bacteria | 1172 |
| 544 | Ga0207644_10001357 | 3300025931 | Bacteria | 15745 |
| 545 | Ga0207644_10008526 | 3300025931 | Bacteria | 6707 |
| 546 | Ga0207644_10014361 | 3300025931 | Bacteria | 5297 |
| 547 | Ga0207644_10074172 | 3300025931 | Bacteria | 2497 |
| 548 | Ga0207690_10000438 | 3300025932 | Bacteria | 27116 |
| 549 | Ga0207690_10013514 | 3300025932 | Bacteria | 4907 |
| 550 | Ga0207690_10098419 | 3300025932 | Bacteria | 2083 |
| 551 | Ga0207706_10000024 | 3300025933 | Bacteria | 151942 |
| 552 | Ga0207706_10128898 | 3300025933 | Bacteria | 2225 |
| 553 | Ga0207706_10146356 | 3300025933 | Bacteria | 2078 |
| 554 | Ga0207706_10152260 | 3300025933 | Bacteria | 2034 |
| 555 | Ga0207706_10179659 | 3300025933 | Bacteria | 1858 |
| 556 | Ga0207706_10239668 | 3300025933 | Bacteria | 1586 |
| 557 | Ga0207686_10000246 | 3300025934 | Bacteria | 41384 |
| 558 | Ga0207686_10002440 | 3300025934 | Bacteria | 10115 |
| 559 | Ga0207686_10010576 | 3300025934 | Bacteria | 5027 |
| 560 | Ga0207686_10039695 | 3300025934 | Bacteria | 2857 |
| 561 | Ga0207686_10305948 | 3300025934 | Bacteria | 1182 |
| 562 | Ga0207709_10003459 | 3300025935 | Bacteria | 9374 |
| 563 | Ga0207709_10390550 | 3300025935 | Unclassified | 1061 |
| 564 | Ga0207670_10007491 | 3300025936 | Bacteria | 6093 |
| 565 | Ga0207670_10702435 | 3300025936 | Unclassified | 837 |
| 566 | Ga0207669_10173524 | 3300025937 | Bacteria | 1537 |
| 567 | Ga0207669_10454847 | 3300025937 | Bacteria | 1015 |
| 568 | Ga0207704_10006065 | 3300025938 | Bacteria | 5600 |
| 569 | Ga0207704_10013925 | 3300025938 | Bacteria | 4045 |
| 570 | Ga0207704_10365035 | 3300025938 | Bacteria | 1128 |
| 571 | Ga0207665_10019748 | 3300025939 | Bacteria | 4428 |
| 572 | Ga0207665_10049897 | 3300025939 | Bacteria | 2813 |
| 573 | Ga0207665_10085522 | 3300025939 | Bacteria | 2177 |
| 574 | Ga0207665_10210708 | 3300025939 | Bacteria | 1419 |
| 575 | Ga0207665_10435324 | 3300025939 | Bacteria | 1004 |
| 576 | Ga0207691_10000144 | 3300025940 | Bacteria | 65346 |
| 577 | Ga0207691_10008753 | 3300025940 | Bacteria | 9707 |
| 578 | Ga0207691_10015497 | 3300025940 | Bacteria | 7247 |
| 579 | Ga0207691_10038029 | 3300025940 | Bacteria | 4452 |
| 580 | Ga0207691_10042446 | 3300025940 | Bacteria | 4193 |
| 581 | Ga0207691_10051419 | 3300025940 | Bacteria | 3767 |
| 582 | Ga0207691_10094234 | 3300025940 | Bacteria | 2680 |
| 583 | Ga0207691_10101529 | 3300025940 | Bacteria | 2567 |
| 584 | Ga0207691_10313037 | 3300025940 | Bacteria | 1347 |
| 585 | Ga0207691_10386679 | 3300025940 | Bacteria | 1194 |
| 586 | Ga0207691_10423619 | 3300025940 | Bacteria | 1134 |
| 587 | Ga0207711_10009735 | 3300025941 | Bacteria | 7997 |
| 588 | Ga0207711_10013017 | 3300025941 | Bacteria | 6909 |
| 589 | Ga0207711_10102642 | 3300025941 | Bacteria | 2532 |
| 590 | Ga0207689_10000406 | 3300025942 | Bacteria | 40450 |
| 591 | Ga0207689_10000978 | 3300025942 | Bacteria | 27386 |
| 592 | Ga0207689_10115900 | 3300025942 | Bacteria | 2202 |
| 593 | Ga0207689_10116936 | 3300025942 | Bacteria | 2192 |
| 594 | Ga0207689_10141071 | 3300025942 | Bacteria | 1985 |
| 595 | Ga0207661_10085862 | 3300025944 | Bacteria | 2610 |
| 596 | Ga0207661_10259481 | 3300025944 | Bacteria | 1547 |
| 597 | Ga0207679_10001794 | 3300025945 | Bacteria | 13364 |
| 598 | Ga0207679_10079034 | 3300025945 | Bacteria | 2507 |
| 599 | Ga0207679_10097694 | 3300025945 | Bacteria | 2288 |
| 600 | Ga0207679_10137313 | 3300025945 | Bacteria | 1971 |
| 601 | Ga0207679_10343364 | 3300025945 | Bacteria | 1299 |
| 602 | Ga0207667_10000980 | 3300025949 | Bacteria | 36468 |
| 603 | Ga0207667_10004348 | 3300025949 | Bacteria | 17354 |
| 604 | Ga0207667_10007573 | 3300025949 | Bacteria | 13030 |
| 605 | Ga0207667_10046426 | 3300025949 | Bacteria | 4599 |
| 606 | Ga0207667_10318087 | 3300025949 | Bacteria | 1589 |
| 607 | Ga0207667_10406588 | 3300025949 | Bacteria | 1386 |
| 608 | Ga0207651_10007030 | 3300025960 | Bacteria | 5965 |
| 609 | Ga0207651_10011598 | 3300025960 | Bacteria | 4941 |
| 610 | Ga0207651_10168126 | 3300025960 | Bacteria | 1726 |
| 611 | Ga0207651_10200705 | 3300025960 | Bacteria | 1598 |
| 612 | Ga0207651_10233730 | 3300025960 | Bacteria | 1494 |
| 613 | Ga0207651_10266638 | 3300025960 | Bacteria | 1408 |
| 614 | Ga0207651_10431714 | 3300025960 | Bacteria | 1127 |
| 615 | Ga0207668_10004592 | 3300025972 | Bacteria | 8122 |
| 616 | Ga0207668_10018406 | 3300025972 | Bacteria | 4395 |
| 617 | Ga0207668_10035192 | 3300025972 | Bacteria | 3332 |
| 618 | Ga0207668_10061869 | 3300025972 | Bacteria | 2634 |
| 619 | Ga0207668_10094530 | 3300025972 | Bacteria | 2204 |
| 620 | Ga0207640_10007371 | 3300025981 | Bacteria | 6073 |
| 621 | Ga0207640_10010488 | 3300025981 | Bacteria | 5219 |
| 622 | Ga0207640_10298455 | 3300025981 | Bacteria | 1273 |
| 623 | Ga0207640_10329236 | 3300025981 | Bacteria | 1219 |
| 624 | Ga0207640_10343351 | 3300025981 | Bacteria | 1197 |
| 625 | Ga0207658_10008828 | 3300025986 | Bacteria | 6839 |
| 626 | Ga0207658_10009537 | 3300025986 | Bacteria | 6590 |
| 627 | Ga0207658_10055769 | 3300025986 | Bacteria | 2930 |
| 628 | Ga0207658_10058738 | 3300025986 | Bacteria | 2864 |
| 629 | Ga0207658_10195117 | 3300025986 | Bacteria | 1686 |
| 630 | Ga0207658_10329877 | 3300025986 | Bacteria | 1323 |
| 631 | Ga0207677_10001890 | 3300026023 | Bacteria | 11061 |
| 632 | Ga0207677_10003803 | 3300026023 | Bacteria | 8019 |
| 633 | Ga0207677_10004747 | 3300026023 | Bacteria | 7327 |
| 634 | Ga0207677_10085791 | 3300026023 | Bacteria | 2274 |
| 635 | Ga0207703_10003987 | 3300026035 | Bacteria | 12228 |
| 636 | Ga0207703_10004855 | 3300026035 | Bacteria | 10942 |
| 637 | Ga0207703_10048950 | 3300026035 | Bacteria | 3414 |
| 638 | Ga0207703_10066506 | 3300026035 | Bacteria | 2965 |
| 639 | Ga0207703_10167918 | 3300026035 | Bacteria | 1927 |
| 640 | Ga0207639_10006632 | 3300026041 | Bacteria | 7871 |
| 641 | Ga0207639_10010462 | 3300026041 | Bacteria | 6426 |
| 642 | Ga0207639_10017248 | 3300026041 | Bacteria | 5118 |
| 643 | Ga0207639_10053114 | 3300026041 | Bacteria | 3090 |
| 644 | Ga0207639_10085831 | 3300026041 | Bacteria | 2504 |
| 645 | Ga0207639_10201540 | 3300026041 | Bacteria | 1707 |
| 646 | Ga0207639_10618004 | 3300026041 | Bacteria | 1000 |
| 647 | Ga0207639_10844219 | 3300026041 | Bacteria | 855 |
| 648 | Ga0207678_10003863 | 3300026067 | Bacteria | 13466 |
| 649 | Ga0207678_10005913 | 3300026067 | Bacteria | 10903 |
| 650 | Ga0207678_10009576 | 3300026067 | Bacteria | 8521 |
| 651 | Ga0207678_10039015 | 3300026067 | Bacteria | 4123 |
| 652 | Ga0207708_10000601 | 3300026075 | Bacteria | 27771 |
| 653 | Ga0207708_10013446 | 3300026075 | Bacteria | 6119 |
| 654 | Ga0207708_10218120 | 3300026075 | Bacteria | 1527 |
| 655 | Ga0207708_10685442 | 3300026075 | Bacteria | 875 |
| 656 | Ga0207702_10002130 | 3300026078 | Bacteria | 19048 |
| 657 | Ga0207702_10004791 | 3300026078 | Bacteria | 11922 |
| 658 | Ga0207702_10077972 | 3300026078 | Bacteria | 2867 |
| 659 | Ga0207702_10353634 | 3300026078 | Bacteria | 1406 |
| 660 | Ga0207702_10442890 | 3300026078 | Bacteria | 1259 |
| 661 | Ga0207702_10926893 | 3300026078 | Bacteria | 863 |
| 662 | Ga0207641_10009435 | 3300026088 | Bacteria | 8040 |
| 663 | Ga0207641_10032926 | 3300026088 | Bacteria | 4305 |
| 664 | Ga0207641_10207146 | 3300026088 | Bacteria | 1811 |
| 665 | Ga0207641_10316995 | 3300026088 | Bacteria | 1477 |
| 666 | Ga0207648_10001220 | 3300026089 | Bacteria | 28819 |
| 667 | Ga0207648_10001453 | 3300026089 | Bacteria | 26107 |
| 668 | Ga0207648_10002998 | 3300026089 | Bacteria | 17847 |
| 669 | Ga0207648_10003153 | 3300026089 | Bacteria | 17372 |
| 670 | Ga0207648_10004011 | 3300026089 | Bacteria | 15277 |
| 671 | Ga0207648_10091378 | 3300026089 | Bacteria | 2661 |
| 672 | Ga0207648_10610524 | 3300026089 | Bacteria | 1006 |
| 673 | Ga0207676_10007930 | 3300026095 | Bacteria | 7553 |
| 674 | Ga0207676_10009383 | 3300026095 | Bacteria | 6964 |
| 675 | Ga0207676_10025643 | 3300026095 | Bacteria | 4375 |
| 676 | Ga0207676_10077037 | 3300026095 | Bacteria | 2696 |
| 677 | Ga0207676_10092852 | 3300026095 | Bacteria | 2483 |
| 678 | Ga0207674_10000520 | 3300026116 | Bacteria | 50513 |
| 679 | Ga0207674_10000883 | 3300026116 | Bacteria | 39210 |
| 680 | Ga0207674_10001132 | 3300026116 | Bacteria | 34607 |
| 681 | Ga0207674_10013288 | 3300026116 | Bacteria | 9145 |
| 682 | Ga0207674_10217205 | 3300026116 | Bacteria | 1860 |
| 683 | Ga0207675_100001116 | 3300026118 | Bacteria | 26576 |
| 684 | Ga0207675_100001531 | 3300026118 | Bacteria | 23160 |
| 685 | Ga0207675_100111342 | 3300026118 | Bacteria | 2583 |
| 686 | Ga0207675_100152579 | 3300026118 | Bacteria | 2200 |
| 687 | Ga0207675_100401530 | 3300026118 | Bacteria | 1351 |
| 688 | Ga0207675_101041621 | 3300026118 | Unclassified | 837 |
| 689 | Ga0207683_10000180 | 3300026121 | Bacteria | 54163 |
| 690 | Ga0207683_10000243 | 3300026121 | Bacteria | 48324 |
| 691 | Ga0207683_10004243 | 3300026121 | Bacteria | 12370 |
| 692 | Ga0207683_10019201 | 3300026121 | Bacteria | 5835 |
| 693 | Ga0207683_10290262 | 3300026121 | Bacteria | 1495 |
| 694 | Ga0207698_10000855 | 3300026142 | Bacteria | 17695 |
| 695 | Ga0207698_10007717 | 3300026142 | Bacteria | 6751 |
| 696 | Ga0207698_10011203 | 3300026142 | Bacteria | 5802 |
| 697 | Ga0207698_10017392 | 3300026142 | Bacteria | 4876 |
| 698 | Ga0207698_10155628 | 3300026142 | Bacteria | 1991 |
| 699 | Ga0207698_10458306 | 3300026142 | Unclassified | 1232 |
| 700 | Ga0209969_1012971 | 3300027360 | Bacteria | 1204 |
| 701 | Ga0209967_1002268 | 3300027364 | Bacteria | 2497 |
| 702 | Ga0209981_1000622 | 3300027378 | Bacteria | 4475 |
| 703 | Ga0209999_1000548 | 3300027543 | Bacteria | 5894 |
| 704 | Ga0209983_1042234 | 3300027665 | Bacteria | 988 |
| 705 | Ga0209974_10003824 | 3300027876 | Bacteria | 5395 |
| 706 | Ga0207428_10000453 | 3300027907 | Bacteria | 49756 |
| 707 | Ga0207428_10153945 | 3300027907 | Bacteria | 1749 |
| 708 | Ga0268266_10004772 | 3300028379 | Bacteria | 12889 |
| 709 | Ga0268266_10187044 | 3300028379 | Bacteria | 1889 |
| 710 | Ga0268266_10219018 | 3300028379 | Bacteria | 1749 |
| 711 | Ga0268266_10339510 | 3300028379 | Bacteria | 1410 |
| 712 | Ga0268266_10431608 | 3300028379 | Bacteria | 1250 |
| 713 | Ga0268266_10489497 | 3300028379 | Bacteria | 1173 |
| 714 | Ga0268266_10619159 | 3300028379 | Bacteria | 1040 |
| 715 | Ga0268265_10019589 | 3300028380 | Bacteria | 4706 |
| 716 | Ga0268265_10019780 | 3300028380 | Bacteria | 4687 |
| 717 | Ga0268265_10233736 | 3300028380 | Bacteria | 1617 |
| 718 | Ga0268264_10000466 | 3300028381 | Bacteria | 55015 |
| 719 | Ga0268264_10003290 | 3300028381 | Bacteria | 13971 |
| 720 | Ga0268264_10015619 | 3300028381 | Bacteria | 6221 |
| 721 | Ga0268264_10034902 | 3300028381 | Bacteria | 4140 |
| 722 | Ga0268264_10040910 | 3300028381 | Bacteria | 3830 |
| 723 | Ga0268264_10172123 | 3300028381 | Bacteria | 1959 |
| 724 | Ga0268264_10333460 | 3300028381 | Bacteria | 1438 |
| 725 | Ga0265330_10022376 | 3300031235 | Bacteria | 2876 |
| 726 | Ga0265332_10000832 | 3300031238 | Bacteria | 18732 |
| 727 | Ga0265329_10001252 | 3300031242 | Bacteria | 12416 |
| 728 | Ga0265339_10044090 | 3300031249 | Bacteria | 2462 |
| 729 | Ga0265331_10000960 | 3300031250 | Bacteria | 22931 |
| 730 | Ga0265327_10002886 | 3300031251 | Bacteria | 17287 |
| 731 | Ga0307408_100015307 | 3300031548 | Bacteria | 5106 |
| 732 | Ga0307408_100188609 | 3300031548 | Bacteria | 1659 |
| 733 | Ga0307408_100545509 | 3300031548 | Bacteria | 1022 |
| 734 | Ga0316575_10006194 | 3300031665 | Bacteria | 4292 |
| 735 | Ga0316579_10001228 | 3300031691 | Bacteria | 9188 |
| 736 | Ga0316578_10116085 | 3300031728 | Bacteria | 1608 |
| 737 | Ga0307405_10395721 | 3300031731 | Bacteria | 1080 |
| 738 | Ga0307410_10048707 | 3300031852 | Bacteria | 2840 |
| 739 | Ga0307410_10371392 | 3300031852 | Bacteria | 1148 |
| 740 | Ga0307406_10001453 | 3300031901 | Bacteria | 13100 |
| 741 | Ga0307406_10149717 | 3300031901 | Bacteria | 1663 |
| 742 | Ga0307407_10509503 | 3300031903 | Bacteria | 883 |
| 743 | Ga0307412_10012749 | 3300031911 | Bacteria | 4906 |
| 744 | Ga0307409_100037174 | 3300031995 | Bacteria | 3587 |
| 745 | Ga0307409_100124756 | 3300031995 | Bacteria | 2188 |
| 746 | Ga0307409_100685187 | 3300031995 | Bacteria | 1023 |
| 747 | Ga0307416_100007436 | 3300032002 | Bacteria | 6967 |
| 748 | Ga0307416_100031414 | 3300032002 | Bacteria | 3998 |
| 749 | Ga0307416_100064655 | 3300032002 | Bacteria | 3002 |
| 750 | Ga0307416_100278974 | 3300032002 | Bacteria | 1646 |
| 751 | Ga0307416_100571770 | 3300032002 | Bacteria | 1206 |
| 752 | Ga0307414_10058726 | 3300032004 | Bacteria | 2712 |
| 753 | Ga0307414_10153704 | 3300032004 | Bacteria | 1819 |
| 754 | Ga0307411_10000456 | 3300032005 | Bacteria | 14093 |
| 755 | Ga0307415_100004617 | 3300032126 | Bacteria | 7188 |
| 756 | Ga0316583_10000892 | 3300032133 | Bacteria | 9552 |
| 757 | Ga0316593_10016441 | 3300032168 | Bacteria | 2243 |
| 758 | Ga0316596_1047872 | 3300033541 | Bacteria | 1129 |
| 759 | Ga0373948_0015693 | 3300034817 | Bacteria | 1393 |
| 760 | Ga0373928_0002221 | 3300035084 | Bacteria | 3781 |
| 761 | Ga0373934_0005696 | 3300035086 | Bacteria | 4612 |
| 762 | Ga0373940_0061899 | 3300035088 | Bacteria | 1072 |
| 763 | Ga0373952_0009653 | 3300035092 | Bacteria | 1853 |
| 764 | Ga0373923_0019402 | 3300035111 | Bacteria | 2632 |
| 765 | Ga0373923_0033623 | 3300035111 | Bacteria | 2076 |
| 766 | Ga0373923_0060143 | 3300035111 | Bacteria | 1612 |
| 767 | Ga0373923_0106893 | 3300035111 | Bacteria | 1239 |
| 768 | Ga0373932_0001230 | 3300035112 | Bacteria | 7268 |
| 769 | Ga0373932_0028552 | 3300035112 | Bacteria | 1534 |
| 770 | Ga0373941_0014187 | 3300035115 | Bacteria | 2123 |
| 771 | Ga0373941_0097270 | 3300035115 | Bacteria | 1019 |
| 772 | Ga0373945_0018142 | 3300035116 | Bacteria | 2392 |
| 773 | Ga0373945_0023912 | 3300035116 | Bacteria | 2113 |
| 774 | Ga0373953_0024693 | 3300035117 | Bacteria | 2288 |
| 775 | Ga0373953_0026419 | 3300035117 | Bacteria | 2224 |
| 776 | Ga0373953_0097050 | 3300035117 | Bacteria | 1237 |
| 777 | Ga0373954_0091907 | 3300035118 | Bacteria | 1458 |
| 778 | Ga0373956_0000019 | 3300035119 | Bacteria | 50599 |
| 779 | Ga0373956_0011985 | 3300035119 | Bacteria | 3583 |
| 780 | Ga0373956_0014647 | 3300035119 | Bacteria | 3278 |
| 781 | Ga0373956_0020351 | 3300035119 | Bacteria | 2822 |
| 782 | Ga0373957_0005872 | 3300035120 | Bacteria | 3833 |
| 783 | Ga0373957_0035481 | 3300035120 | Bacteria | 1853 |
| 784 | Ga0373960_0022010 | 3300035121 | Bacteria | 1702 |
| 785 | Ga0373943_0025451 | 3300035170 | Bacteria | 2766 |
| 786 | Ga0373943_0077418 | 3300035170 | Bacteria | 1698 |
| 787 | Ga0373946_0041632 | 3300035171 | Bacteria | 1885 |
| 788 | Ga0373955_0002173 | 3300035172 | Bacteria | 8492 |
| 789 | Ga0373955_0007763 | 3300035172 | Bacteria | 4944 |
| 790 | Ga0373955_0026989 | 3300035172 | Bacteria | 2964 |
| 791 | Ga0373955_0038007 | 3300035172 | Bacteria | 2562 |
| 792 | Ga0373955_0060478 | 3300035172 | Bacteria | 2089 |
| 793 | Ga0373961_0072541 | 3300035241 | Bacteria | 1067 |
| 794 | Ga0373962_0004486 | 3300035242 | Bacteria | 3375 |
| 795 | Ga0316574_0000875 | 3300035398 | Bacteria | 13290 |
| 796 | Ga0373924_0000260 | 3300035410 | Bacteria | 16197 |
| 797 | Ga0373924_0017922 | 3300035410 | Bacteria | 2723 |
| 798 | Ga0373924_0020147 | 3300035410 | Bacteria | 2589 |
| 799 | Ga0373924_0071551 | 3300035410 | Bacteria | 1463 |
| 800 | Ga0373931_0000246 | 3300035691 | Bacteria | 22990 |
| 801 | Ga0373931_0008409 | 3300035691 | Bacteria | 4895 |
| 802 | Ga0373931_0009089 | 3300035691 | Bacteria | 4740 |
| 803 | Ga0373931_0062308 | 3300035691 | Bacteria | 2013 |
| 804 | Ga0373935_0004744 | 3300035692 | Bacteria | 7995 |
| 805 | Ga0373935_0018123 | 3300035692 | Bacteria | 4279 |
| 806 | Ga0373935_0042242 | 3300035692 | Bacteria | 2866 |
| 807 | Ga0373935_0102008 | 3300035692 | Bacteria | 1893 |
| 808 | Ga0373935_0144266 | 3300035692 | Bacteria | 1610 |
| 809 | Ga0373927_0005710 | 3300035695 | Bacteria | 8544 |
| 810 | Ga0373927_0021909 | 3300035695 | Bacteria | 4188 |
| 811 | Ga0373927_0080668 | 3300035695 | Bacteria | 2108 |
| 812 | Ga0373927_0088659 | 3300035695 | Bacteria | 2008 |
| 813 | Ga0373927_0179891 | 3300035695 | Bacteria | 1387 |
| 814 | Ga0373927_0299179 | 3300035695 | Bacteria | 1059 |
| 815 | Ga0373933_0003592 | 3300035724 | Bacteria | 8614 |
| 816 | Ga0373947_0011294 | 3300035725 | Bacteria | 5126 |
| 817 | Ga0373937_0001120 | 3300036401 | Bacteria | 22587 |
| 818 | Ga0373937_0013063 | 3300036401 | Bacteria | 7314 |
| 819 | Ga0373937_0038755 | 3300036401 | Bacteria | 4342 |
| 820 | Ga0373937_0050874 | 3300036401 | Bacteria | 3797 |
| 821 | Ga0373937_0185844 | 3300036401 | Bacteria | 1952 |
| 822 | Ga0373937_0282325 | 3300036401 | Bacteria | 1568 |
| 823 | Ga0373937_0370931 | 3300036401 | Bacteria | 1357 |
| 824 | Ga0373937_0621877 | 3300036401 | Bacteria | 1025 |
| 825 | Ga0316582_0001739 | 3300036647 | Bacteria | 9792 |
| 826 | Ga0316584_0074177 | 3300036712 | Bacteria | 2551 |
| 827 | Ga0373925_0004904 | 3300037068 | Bacteria | 10060 |
| 828 | Ga0373925_0026384 | 3300037068 | Bacteria | 4251 |
| 829 | Ga0373925_0184682 | 3300037068 | Bacteria | 1652 |
| 830 | Ga0373925_0579745 | 3300037068 | Bacteria | 923 |
| 831 | Ga0395900_0231738 | 3300037418 | Bacteria | 1857 |
| 832 | Ga0395905_0166081 | 3300037471 | Bacteria | 2074 |
| 833 | Ga0316581_0004698 | 3300037588 | Bacteria | 3504 |
| 834 | Ga0395901_0570279 | 3300038443 | Bacteria | 1145 |
| 835 | Ga0436360_0630722 | 3300039438 | Bacteria | 1765 |
| 836 | Ga0439461_0019178 | 3300041410 | Bacteria | 1345 |
| 837 | Ga0451804_0230508 | 3300041463 | Bacteria | 856 |
| 838 | Ga0451853_2489227 | 3300041512 | Bacteria | 2518 |
| 839 | Ga0451853_3775619 | 3300041512 | Bacteria | 1210 |
| 840 | Ga0439441_001149 | 3300042001 | Bacteria | 3331 |
| 841 | Ga0439441_010510 | 3300042001 | Bacteria | 1554 |
| 842 | Ga0439446_0001421 | 3300042156 | Bacteria | 5447 |
| 843 | Ga0439434_0041814 | 3300042435 | Bacteria | 1408 |
| 844 | Ga0439435_0000201 | 3300042436 | Bacteria | 8440 |
| 845 | Ga0451577_0332306 | 3300042876 | Bacteria | 1378 |
| 846 | Ga0451577_0390999 | 3300042876 | Bacteria | 1262 |
| 847 | Ga0466972_0000109 | 3300044658 | Bacteria | 71407 |
| 848 | Ga0466964_0097045 | 3300044706 | Bacteria | 1293 |
| 849 | Ga0453684_0343504 | 3300044712 | Bacteria | 1685 |
| 850 | Ga0453684_0477116 | 3300044712 | Bacteria | 1384 |
| 851 | Ga0451576_0004986 | 3300045051 | Bacteria | 16889 |
| 852 | Ga0451576_0017839 | 3300045051 | Bacteria | 7795 |
| 853 | Ga0451576_0025224 | 3300045051 | Bacteria | 6407 |
| 854 | Ga0451576_0067887 | 3300045051 | Bacteria | 3711 |
| 855 | Ga0451576_0341727 | 3300045051 | Bacteria | 1567 |
| 856 | Ga0466967_0088205 | 3300045976 | Bacteria | 2814 |
| 857 | Ga0495592_0006145 | 3300046454 | Bacteria | 8933 |
| 858 | Ga0495592_0101693 | 3300046454 | Bacteria | 2047 |
| 859 | Ga0495629_0026784 | 3300046459 | Bacteria | 4093 |
| 860 | Ga0495651_0000147 | 3300046462 | Bacteria | 51361 |
| 861 | Ga0495651_0063793 | 3300046462 | Bacteria | 2815 |
| 862 | Ga0495653_0066795 | 3300046463 | Bacteria | 2703 |
| 863 | Ga0495580_0014770 | 3300046472 | Bacteria | 5916 |
| 864 | Ga0495580_0033392 | 3300046472 | Bacteria | 3708 |
| 865 | Ga0495580_0051240 | 3300046472 | Bacteria | 2918 |
| 866 | Ga0495580_0200060 | 3300046472 | Bacteria | 1376 |
| 867 | Ga0495582_0003373 | 3300046473 | Bacteria | 8987 |
| 868 | Ga0495582_0006496 | 3300046473 | Bacteria | 6489 |
| 869 | Ga0495639_0009650 | 3300046475 | Bacteria | 4141 |
| 870 | Ga0495639_0030167 | 3300046475 | Bacteria | 2410 |
| 871 | Ga0495662_0008253 | 3300046476 | Bacteria | 5129 |
| 872 | Ga0495662_0082379 | 3300046476 | Bacteria | 1565 |
| 873 | Ga0495594_0041855 | 3300046499 | Bacteria | 2508 |
| 874 | Ga0495608_0021304 | 3300046511 | Bacteria | 4449 |
| 875 | Ga0495618_0036328 | 3300046514 | Bacteria | 3091 |
| 876 | Ga0495628_0112374 | 3300046516 | Bacteria | 2094 |
| 877 | Ga0495630_0012562 | 3300046517 | Bacteria | 6153 |
| 878 | Ga0495644_0086736 | 3300046523 | Bacteria | 1180 |
| 879 | Ga0495666_0008731 | 3300046526 | Bacteria | 5076 |
| 880 | Ga0495666_0025398 | 3300046526 | Bacteria | 2924 |
| 881 | Ga0495665_0016589 | 3300046531 | Bacteria | 3967 |
| 882 | Ga0495665_0020301 | 3300046531 | Bacteria | 3570 |
| 883 | Ga0495665_0026322 | 3300046531 | Bacteria | 3124 |
| 884 | Ga0495640_0019306 | 3300046533 | Bacteria | 5034 |
| 885 | Ga0495586_0005194 | 3300046535 | Bacteria | 6969 |
| 886 | Ga0495586_0030083 | 3300046535 | Bacteria | 2906 |
| 887 | Ga0495587_0036403 | 3300046536 | Bacteria | 2960 |
| 888 | Ga0495598_0016783 | 3300046537 | Bacteria | 1875 |
| 889 | Ga0495621_0001797 | 3300046539 | Bacteria | 5638 |
| 890 | Ga0495621_0034073 | 3300046539 | Bacteria | 1758 |
| 891 | Ga0495645_0095337 | 3300046543 | Bacteria | 2121 |
| 892 | Ga0495645_0258987 | 3300046543 | Bacteria | 1153 |
| 893 | Ga0495667_0062293 | 3300046559 | Bacteria | 2444 |
| 894 | Ga0495667_0152022 | 3300046559 | Bacteria | 1490 |
| 895 | Ga0495667_0273402 | 3300046559 | Bacteria | 1073 |
| 896 | Ga0495634_0016550 | 3300046642 | Bacteria | 5271 |
| 897 | Ga0495635_0019881 | 3300046663 | Bacteria | 4679 |
| 898 | Ga0495659_0035892 | 3300046664 | Bacteria | 1749 |
| 899 | Ga0495659_0052397 | 3300046664 | Bacteria | 1489 |
| 900 | Ga0495659_0076928 | 3300046664 | Bacteria | 1260 |
| 901 | Ga0495588_0034970 | 3300046674 | Bacteria | 2544 |
| 902 | Ga0495588_0255943 | 3300046674 | Unclassified | 923 |
| 903 | Ga0495599_0002850 | 3300046678 | Bacteria | 10077 |
| 904 | Ga0495599_0078691 | 3300046678 | Bacteria | 2059 |
| 905 | Ga0495599_0190062 | 3300046678 | Bacteria | 1263 |
| 906 | Ga0495599_0288611 | 3300046678 | Bacteria | 992 |
| 907 | Ga0495646_0064942 | 3300046680 | Bacteria | 2162 |
| 908 | Ga0495647_0002583 | 3300046681 | Bacteria | 5741 |
| 909 | Ga0495647_0020484 | 3300046681 | Bacteria | 2374 |
| 910 | Ga0495647_0022948 | 3300046681 | Bacteria | 2258 |
| 911 | Ga0495658_0005486 | 3300046683 | Bacteria | 6234 |
| 912 | Ga0495658_0051948 | 3300046683 | Bacteria | 2323 |
| 913 | Ga0495658_0138164 | 3300046683 | Bacteria | 1488 |
| 914 | Ga0495669_0001556 | 3300046684 | Bacteria | 9436 |
| 915 | Ga0495613_0135864 | 3300046689 | Bacteria | 1759 |
| 916 | Ga0495624_0360363 | 3300046690 | Bacteria | 874 |
| 917 | Ga0495600_0096519 | 3300046809 | Bacteria | 1927 |
| 918 | Ga0495600_0119092 | 3300046809 | Bacteria | 1717 |
| 919 | Ga0495581_0005184 | 3300047315 | Bacteria | 7540 |
| 920 | Ga0495581_0035161 | 3300047315 | Bacteria | 2899 |
| 921 | Ga0495604_0021442 | 3300047317 | Bacteria | 5158 |
| 922 | Ga0495604_0265562 | 3300047317 | Bacteria | 1165 |
| 923 | Ga0495674_0001483 | 3300047319 | Bacteria | 22973 |
| 924 | Ga0495674_0254966 | 3300047319 | Bacteria | 1443 |
| 925 | Ga0495680_0047561 | 3300047322 | Bacteria | 3374 |
| 926 | Ga0495680_0070786 | 3300047322 | Bacteria | 2657 |
| 927 | Ga0495675_0029189 | 3300047444 | Bacteria | 3517 |
| 928 | Ga0495677_0061459 | 3300047445 | Bacteria | 1393 |
| 929 | Ga0495684_0003095 | 3300047471 | Bacteria | 13063 |
| 930 | Ga0495684_0035081 | 3300047471 | Bacteria | 3848 |
| 931 | Ga0495614_0023180 | 3300048089 | Bacteria | 2678 |
| 932 | Ga0496100_0471830 | 3300048903 | Bacteria | 964 |
| 933 | Ga0496101_0005725 | 3300048904 | Bacteria | 7938 |
| 934 | Ga0496101_0062341 | 3300048904 | Bacteria | 2711 |
| 935 | Ga0496102_0024025 | 3300048905 | Bacteria | 5418 |
| 936 | Ga0496102_0036172 | 3300048905 | Bacteria | 4447 |
| 937 | Ga0496102_0366345 | 3300048905 | Bacteria | 1356 |
| 938 | Ga0496103_0020619 | 3300048906 | Bacteria | 3960 |
| 939 | Ga0496103_0046418 | 3300048906 | Bacteria | 2682 |
| 940 | Ga0496104_0044131 | 3300048907 | Bacteria | 4189 |
| 941 | Ga0496105_0030331 | 3300048908 | Bacteria | 4431 |
| 942 | Ga0496105_0504022 | 3300048908 | Bacteria | 950 |
| 943 | Ga0496106_0000575 | 3300048909 | Bacteria | 26234 |
| 944 | Ga0496107_0009688 | 3300048910 | Bacteria | 6678 |
| 945 | Ga0496108_0252379 | 3300048911 | Bacteria | 1534 |
| 946 | Ga0496108_0260105 | 3300048911 | Bacteria | 1510 |
| 947 | Ga0496109_0014328 | 3300048912 | Bacteria | 6899 |
| 948 | Ga0496109_0421054 | 3300048912 | Bacteria | 1262 |
| 949 | Ga0496111_0510037 | 3300048914 | Bacteria | 885 |
| 950 | Ga0496112_0024796 | 3300048915 | Bacteria | 5752 |
| 951 | Ga0496113_0026989 | 3300048916 | Bacteria | 4112 |
| 952 | Ga0496114_0164359 | 3300048917 | Bacteria | 1932 |
| 953 | Ga0496115_0007599 | 3300048918 | Bacteria | 7984 |
| 954 | Ga0501032_0124299 | 3300049569 | Bacteria | 1705 |
| 955 | Ga0501039_0596307 | 3300049575 | Bacteria | 866 |
| 956 | Ga0501040_0051112 | 3300049576 | Bacteria | 2828 |
| 957 | Ga0501041_0127200 | 3300049577 | Bacteria | 1586 |
| 958 | Ga0501042_0106829 | 3300049578 | Bacteria | 2015 |
| 959 | Ga0501048_0066364 | 3300049582 | Bacteria | 2551 |
| 960 | Ga0501067_0064566 | 3300049583 | Bacteria | 2027 |
| 961 | Ga0501068_0259125 | 3300049584 | Bacteria | 1109 |
| 962 | Ga0501068_0387592 | 3300049584 | Bacteria | 900 |
| 963 | Ga0501069_0118637 | 3300049585 | Bacteria | 1510 |
| 964 | Ga0501072_0024303 | 3300049588 | Bacteria | 4713 |
| 965 | Ga0501073_0112644 | 3300049589 | Bacteria | 1887 |
| 966 | Ga0501073_0204014 | 3300049589 | Bacteria | 1367 |
| 967 | Ga0501073_0225856 | 3300049589 | Bacteria | 1293 |
| 968 | Ga0501073_0435878 | 3300049589 | Bacteria | 906 |
| 969 | Ga0501074_0308324 | 3300049590 | Bacteria | 1124 |
| 970 | Ga0501075_0076795 | 3300049591 | Bacteria | 2527 |
| 971 | Ga0501076_0197232 | 3300049592 | Bacteria | 1643 |
| 972 | Ga0501079_0273390 | 3300049741 | Bacteria | 1321 |
| 973 | Ga0501080_0005591 | 3300049742 | Bacteria | 11234 |
| 974 | Ga0501080_0160598 | 3300049742 | Bacteria | 2075 |
| 975 | Ga0501080_0505417 | 3300049742 | Bacteria | 1080 |
| 976 | Ga0501081_0516298 | 3300049743 | Bacteria | 891 |
| 977 | Ga0501083_0072187 | 3300049744 | Bacteria | 2294 |
| 978 | nmdc:mga0k408_45152_c1 | 3300050493 | Bacteria | 2542 |
| 979 | nmdc:mga05p37_117008_c1 | 3300050507 | Bacteria | 3276 |
| 980 | nmdc:mga05p37_1554_c1 | 3300050507 | Bacteria | 26686 |
| 981 | nmdc:mga05p37_244_c1 | 3300050507 | Bacteria | 55725 |
| 982 | nmdc:mga05p37_530143_c1 | 3300050507 | Bacteria | 1345 |
| 983 | nmdc:mga09592_110_c1 | 3300050508 | Bacteria | 51342 |
| 984 | nmdc:mga09592_207897_c1 | 3300050508 | Bacteria | 1695 |
| 985 | nmdc:mga09592_357_c1 | 3300050508 | Bacteria | 33391 |
| 986 | nmdc:mga0qj67_11958_c1 | 3300050509 | Bacteria | 6522 |
| 987 | nmdc:mga0qj67_44845_c1 | 3300050509 | Bacteria | 3487 |
| 988 | nmdc:mga06r32_100679_c1 | 3300050510 | Bacteria | 2835 |
| 989 | nmdc:mga06r32_30508_c1 | 3300050510 | Bacteria | 5059 |
| 990 | nmdc:mga08y16_2203_c1 | 3300050511 | Bacteria | 19987 |
| 991 | nmdc:mga0n895_13156_c1 | 3300050512 | Bacteria | 7452 |
| 992 | nmdc:mga0n895_395993_c1 | 3300050512 | Bacteria | 1397 |
| 993 | nmdc:mga0rr50_1052_c1 | 3300050513 | Bacteria | 15004 |
| 994 | nmdc:mga0rr50_540422_c1 | 3300050513 | Bacteria | 992 |
| 995 | nmdc:mga08x19_11429_c1 | 3300050514 | Bacteria | 5342 |
| 996 | nmdc:mga08x19_1195_c1 | 3300050514 | Bacteria | 16236 |
| 997 | nmdc:mga08x19_44252_c1 | 3300050514 | Bacteria | 2842 |
| 998 | nmdc:mga08x19_76111_c1 | 3300050514 | Bacteria | 2196 |
| 999 | nmdc:mga08x19_8923_c1 | 3300050514 | Bacteria | 5982 |
| 1000 | nmdc:mga08x19_98944_c1 | 3300050514 | Bacteria | 1933 |
| 1001 | nmdc:mga0a205_1081_c1 | 3300050515 | Bacteria | 22629 |
| 1002 | nmdc:mga0a205_20705_c1 | 3300050515 | Bacteria | 6211 |
| 1003 | nmdc:mga0a205_249303_c1 | 3300050515 | Bacteria | 1655 |
| 1004 | nmdc:mga0a205_269131_c1 | 3300050515 | Bacteria | 1581 |
| 1005 | nmdc:mga0a205_469702_c1 | 3300050515 | Bacteria | 1117 |
| 1006 | nmdc:mga0sz30_4945_c2 | 3300050516 | Bacteria | 3488 |
| 1007 | Ga0495601_0103821 | 3300053077 | Bacteria | 1837 |
| 1008 | Ga0495601_0125927 | 3300053077 | Bacteria | 1667 |
| 1009 | Ga0495612_0029406 | 3300053078 | Bacteria | 2213 |
| 1010 | Ga0495619_0001795 | 3300053085 | Bacteria | 14257 |
| 1011 | Ga0495619_0213466 | 3300053085 | Bacteria | 1336 |
| 1012 | Ga0500616_0100211 | 3300053153 | Bacteria | 1417 |
| 1013 | Ga0501084_0054978 | 3300054114 | Bacteria | 3330 |
| 1014 | Ga0501082_0278701 | 3300060353 | Bacteria | 1455 |
| 1015 | Ga0501082_0610324 | 3300060353 | Bacteria | 955 |
| 1016 | Ga0530510_0150261 | 3300061734 | Bacteria | 1720 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005545 | Ga0070695_100018106 | Ga0070695_1000181063 | 179 |
| 2 | 3300005345 | Ga0070692_10136534 | Ga0070692_101365342 | 180 |
| 3 | 3300005444 | Ga0070694_100098627 | Ga0070694_1000986272 | 180 |
| 4 | 3300005546 | Ga0070696_100013241 | Ga0070696_1000132417 | 180 |
| 5 | 3300005549 | Ga0070704_100020253 | Ga0070704_1000202535 | 180 |
| 6 | 3300025922 | Ga0207646_10130746 | Ga0207646_101307463 | 180 |
| 7 | 3300027360 | Ga0209969_1012971 | Ga0209969_10129712 | 180 |
| 8 | 3300027364 | Ga0209967_1002268 | Ga0209967_10022682 | 180 |
| 9 | 3300027378 | Ga0209981_1000622 | Ga0209981_10006226 | 180 |
| 10 | 3300027543 | Ga0209999_1000548 | Ga0209999_10005485 | 180 |
| 11 | 3300031548 | Ga0307408_100545509 | Ga0307408_1005455092 | 180 |
| 12 | 3300032002 | Ga0307416_100064655 | Ga0307416_1000646554 | 180 |
| 13 | 3300041410 | Ga0439461_0019178 | Ga0439461_0019178_421_1164 | 180 |
| 14 | 3300042156 | Ga0439446_0001421 | Ga0439446_0001421_1330_2073 | 180 |
| 15 | 3300042435 | Ga0439434_0041814 | Ga0439434_0041814_464_1207 | 180 |
| 16 | 3300042436 | Ga0439435_0000201 | Ga0439435_0000201_7444_8187 | 180 |
| 17 | 3300050514 | nmdc:mga08x19_44252_c1 | nmdc:mga08x19_44252_c1_1227_1958 | 180 |
| 18 | 3300005330 | Ga0070690_100099739 | Ga0070690_1000997391 | 181 |
| 19 | 3300005618 | Ga0068864_100052903 | Ga0068864_1000529034 | 181 |
| 20 | 3300006847 | Ga0075431_100068491 | Ga0075431_1000684914 | 181 |
| 21 | 3300006871 | Ga0075434_100001259 | Ga0075434_10000125919 | 181 |
| 22 | 3300006880 | Ga0075429_100000184 | Ga0075429_10000018430 | 181 |
| 23 | 3300006914 | Ga0075436_100000890 | Ga0075436_10000089024 | 181 |
| 24 | 3300007076 | Ga0075435_100000315 | Ga0075435_10000031519 | 181 |
| 25 | 3300009094 | Ga0111539_10007490 | Ga0111539_1000749012 | 181 |
| 26 | 3300009147 | Ga0114129_10000677 | Ga0114129_1000067731 | 181 |
| 27 | 3300010375 | Ga0105239_10422299 | Ga0105239_104222992 | 181 |
| 28 | 3300026095 | Ga0207676_10077037 | Ga0207676_100770372 | 181 |
| 29 | 3300027907 | Ga0207428_10000453 | Ga0207428_100004536 | 181 |
| 30 | 3300027907 | Ga0207428_10153945 | Ga0207428_101539451 | 181 |
| 31 | 3300034817 | Ga0373948_0015693 | Ga0373948_0015693_304_1077 | 181 |
| 32 | 3300035084 | Ga0373928_0002221 | Ga0373928_0002221_2929_3702 | 181 |
| 33 | 3300035111 | Ga0373923_0060143 | Ga0373923_0060143_371_1162 | 181 |
| 34 | 3300044658 | Ga0466972_0000109 | Ga0466972_0000109_52955_53551 | 181 |
| 35 | 3300045051 | Ga0451576_0004986 | Ga0451576_0004986_401_1171 | 181 |
| 36 | 3300050507 | nmdc:mga05p37_244_c1 | nmdc:mga05p37_244_c1_40250_41023 | 181 |
| 37 | 3300050508 | nmdc:mga09592_110_c1 | nmdc:mga09592_110_c1_35598_36371 | 181 |
| 38 | 3300050511 | nmdc:mga08y16_2203_c1 | nmdc:mga08y16_2203_c1_18113_18886 | 181 |
| 39 | 3300050512 | nmdc:mga0n895_13156_c1 | nmdc:mga0n895_13156_c1_1097_1867 | 181 |
| 40 | 3300050513 | nmdc:mga0rr50_1052_c1 | nmdc:mga0rr50_1052_c1_6210_6980 | 181 |
| 41 | 3300050514 | nmdc:mga08x19_1195_c1 | nmdc:mga08x19_1195_c1_12464_13234 | 181 |
| 42 | 3300050515 | nmdc:mga0a205_1081_c1 | nmdc:mga0a205_1081_c1_15791_16561 | 181 |
| 43 | 3300005336 | Ga0070680_100238501 | Ga0070680_1002385012 | 182 |
| 44 | 3300005344 | Ga0070661_100216120 | Ga0070661_1002161202 | 182 |
| 45 | 3300005444 | Ga0070694_100258144 | Ga0070694_1002581442 | 182 |
| 46 | 3300005539 | Ga0068853_100476869 | Ga0068853_1004768691 | 182 |
| 47 | 3300035088 | Ga0373940_0061899 | Ga0373940_0061899_227_1000 | 182 |
| 48 | 3300035092 | Ga0373952_0009653 | Ga0373952_0009653_518_1291 | 182 |
| 49 | 3300035112 | Ga0373932_0001230 | Ga0373932_0001230_4059_4832 | 182 |
| 50 | 3300035115 | Ga0373941_0014187 | Ga0373941_0014187_732_1505 | 182 |
| 51 | 3300035116 | Ga0373945_0023912 | Ga0373945_0023912_184_957 | 182 |
| 52 | 3300035242 | Ga0373962_0004486 | Ga0373962_0004486_453_1226 | 182 |
| 53 | 3300035691 | Ga0373931_0000246 | Ga0373931_0000246_20405_21178 | 182 |
| 54 | 3300035692 | Ga0373935_0144266 | Ga0373935_0144266_628_1392 | 182 |
| 55 | 3300045051 | Ga0451576_0017839 | Ga0451576_0017839_3838_4611 | 182 |
| 56 | 3300046472 | Ga0495580_0014770 | Ga0495580_0014770_4339_5103 | 182 |
| 57 | 3300046473 | Ga0495582_0006496 | Ga0495582_0006496_5534_6298 | 182 |
| 58 | 3300046475 | Ga0495639_0030167 | Ga0495639_0030167_1448_2221 | 182 |
| 59 | 3300046499 | Ga0495594_0041855 | Ga0495594_0041855_1215_1979 | 182 |
| 60 | 3300046526 | Ga0495666_0008731 | Ga0495666_0008731_2424_3197 | 182 |
| 61 | 3300046531 | Ga0495665_0020301 | Ga0495665_0020301_749_1522 | 182 |
| 62 | 3300046535 | Ga0495586_0005194 | Ga0495586_0005194_4837_5610 | 182 |
| 63 | 3300046674 | Ga0495588_0034970 | Ga0495588_0034970_1342_2106 | 182 |
| 64 | 3300046681 | Ga0495647_0002583 | Ga0495647_0002583_1733_2497 | 182 |
| 65 | 3300046683 | Ga0495658_0005486 | Ga0495658_0005486_435_1208 | 182 |
| 66 | 3300047315 | Ga0495581_0035161 | Ga0495581_0035161_370_1143 | 182 |
| 67 | 3300005330 | Ga0070690_100053219 | Ga0070690_1000532193 | 183 |
| 68 | 3300005334 | Ga0068869_100000052 | Ga0068869_10000005261 | 183 |
| 69 | 3300005336 | Ga0070680_100010396 | Ga0070680_1000103963 | 183 |
| 70 | 3300005337 | Ga0070682_100007547 | Ga0070682_1000075477 | 183 |
| 71 | 3300005338 | Ga0068868_100001699 | Ga0068868_1000016997 | 183 |
| 72 | 3300005340 | Ga0070689_100013222 | Ga0070689_1000132225 | 183 |
| 73 | 3300005341 | Ga0070691_10068809 | Ga0070691_100688092 | 183 |
| 74 | 3300005343 | Ga0070687_100000128 | Ga0070687_10000012811 | 183 |
| 75 | 3300005345 | Ga0070692_10048396 | Ga0070692_100483962 | 183 |
| 76 | 3300005355 | Ga0070671_100082230 | Ga0070671_1000822303 | 183 |
| 77 | 3300005356 | Ga0070674_100247308 | Ga0070674_1002473082 | 183 |
| 78 | 3300005364 | Ga0070673_100222860 | Ga0070673_1002228602 | 183 |
| 79 | 3300005365 | Ga0070688_100339510 | Ga0070688_1003395102 | 183 |
| 80 | 3300005438 | Ga0070701_10005323 | Ga0070701_100053235 | 183 |
| 81 | 3300005440 | Ga0070705_100000193 | Ga0070705_10000019310 | 183 |
| 82 | 3300005444 | Ga0070694_100001063 | Ga0070694_10000106311 | 183 |
| 83 | 3300005444 | Ga0070694_100023200 | Ga0070694_1000232004 | 183 |
| 84 | 3300005456 | Ga0070678_100264087 | Ga0070678_1002640872 | 183 |
| 85 | 3300005458 | Ga0070681_10045346 | Ga0070681_100453466 | 183 |
| 86 | 3300005471 | Ga0070698_100077039 | Ga0070698_1000770394 | 183 |
| 87 | 3300005530 | Ga0070679_100002702 | Ga0070679_10000270220 | 183 |
| 88 | 3300005544 | Ga0070686_100000132 | Ga0070686_10000013256 | 183 |
| 89 | 3300005545 | Ga0070695_100000140 | Ga0070695_10000014020 | 183 |
| 90 | 3300005546 | Ga0070696_100000008 | Ga0070696_10000000887 | 183 |
| 91 | 3300005547 | Ga0070693_100000589 | Ga0070693_10000058912 | 183 |
| 92 | 3300005549 | Ga0070704_100000165 | Ga0070704_10000016523 | 183 |
| 93 | 3300005563 | Ga0068855_100011214 | Ga0068855_1000112143 | 183 |
| 94 | 3300005615 | Ga0070702_100008035 | Ga0070702_1000080356 | 183 |
| 95 | 3300005616 | Ga0068852_100070228 | Ga0068852_1000702282 | 183 |
| 96 | 3300005718 | Ga0068866_10000198 | Ga0068866_1000019811 | 183 |
| 97 | 3300005719 | Ga0068861_100000076 | Ga0068861_10000007612 | 183 |
| 98 | 3300005844 | Ga0068862_100010103 | Ga0068862_1000101033 | 183 |
| 99 | 3300005985 | Ga0081539_10004443 | Ga0081539_100044434 | 183 |
| 100 | 3300006237 | Ga0097621_100002626 | Ga0097621_10000262615 | 183 |
| 101 | 3300006358 | Ga0068871_100000152 | Ga0068871_10000015226 | 183 |
| 102 | 3300006847 | Ga0075431_100007163 | Ga0075431_1000071632 | 183 |
| 103 | 3300006880 | Ga0075429_100012597 | Ga0075429_1000125975 | 183 |
| 104 | 3300006881 | Ga0068865_100000386 | Ga0068865_10000038611 | 183 |
| 105 | 3300009098 | Ga0105245_10000221 | Ga0105245_1000022159 | 183 |
| 106 | 3300009147 | Ga0114129_10114894 | Ga0114129_101148945 | 183 |
| 107 | 3300009148 | Ga0105243_10000288 | Ga0105243_1000028859 | 183 |
| 108 | 3300009174 | Ga0105241_10028741 | Ga0105241_100287414 | 183 |
| 109 | 3300009176 | Ga0105242_10000461 | Ga0105242_1000046131 | 183 |
| 110 | 3300009177 | Ga0105248_10208218 | Ga0105248_102082183 | 183 |
| 111 | 3300010375 | Ga0105239_10045584 | Ga0105239_100455842 | 183 |
| 112 | 3300011119 | Ga0105246_10132786 | Ga0105246_101327862 | 183 |
| 113 | 3300013297 | Ga0157378_10001018 | Ga0157378_1000101811 | 183 |
| 114 | 3300014969 | Ga0157376_10076418 | Ga0157376_100764182 | 183 |
| 115 | 3300025885 | Ga0207653_10016186 | Ga0207653_100161863 | 183 |
| 116 | 3300025899 | Ga0207642_10000085 | Ga0207642_100000859 | 183 |
| 117 | 3300025901 | Ga0207688_10031463 | Ga0207688_100314632 | 183 |
| 118 | 3300025911 | Ga0207654_10020693 | Ga0207654_100206933 | 183 |
| 119 | 3300025912 | Ga0207707_10027811 | Ga0207707_100278114 | 183 |
| 120 | 3300025917 | Ga0207660_10091427 | Ga0207660_100914272 | 183 |
| 121 | 3300025918 | Ga0207662_10000229 | Ga0207662_1000022924 | 183 |
| 122 | 3300025921 | Ga0207652_10002520 | Ga0207652_1000252018 | 183 |
| 123 | 3300025927 | Ga0207687_10000486 | Ga0207687_1000048611 | 183 |
| 124 | 3300025933 | Ga0207706_10152260 | Ga0207706_101522601 | 183 |
| 125 | 3300025934 | Ga0207686_10000246 | Ga0207686_1000024623 | 183 |
| 126 | 3300025935 | Ga0207709_10003459 | Ga0207709_100034596 | 183 |
| 127 | 3300025936 | Ga0207670_10007491 | Ga0207670_100074915 | 183 |
| 128 | 3300025937 | Ga0207669_10454847 | Ga0207669_104548472 | 183 |
| 129 | 3300025938 | Ga0207704_10006065 | Ga0207704_100060654 | 183 |
| 130 | 3300025940 | Ga0207691_10423619 | Ga0207691_104236192 | 183 |
| 131 | 3300025942 | Ga0207689_10000406 | Ga0207689_1000040611 | 183 |
| 132 | 3300025949 | Ga0207667_10004348 | Ga0207667_100043483 | 183 |
| 133 | 3300025960 | Ga0207651_10233730 | Ga0207651_102337302 | 183 |
| 134 | 3300026023 | Ga0207677_10004747 | Ga0207677_100047474 | 183 |
| 135 | 3300026041 | Ga0207639_10618004 | Ga0207639_106180041 | 183 |
| 136 | 3300026075 | Ga0207708_10000601 | Ga0207708_1000060132 | 183 |
| 137 | 3300026089 | Ga0207648_10001453 | Ga0207648_1000145311 | 183 |
| 138 | 3300026118 | Ga0207675_100001116 | Ga0207675_10000111612 | 183 |
| 139 | 3300026121 | Ga0207683_10290262 | Ga0207683_102902622 | 183 |
| 140 | 3300026142 | Ga0207698_10155628 | Ga0207698_101556282 | 183 |
| 141 | 3300028380 | Ga0268265_10019589 | Ga0268265_100195895 | 183 |
| 142 | 3300028381 | Ga0268264_10003290 | Ga0268264_100032903 | 183 |
| 143 | 3300041463 | Ga0451804_0230508 | Ga0451804_0230508_26_745 | 183 |
| 144 | 3300041512 | Ga0451853_2489227 | Ga0451853_2489227_1053_1772 | 183 |
| 145 | 3300042001 | Ga0439441_010510 | Ga0439441_010510_776_1528 | 183 |
| 146 | 3300044712 | Ga0453684_0477116 | Ga0453684_0477116_519_1187 | 183 |
| 147 | 3300048917 | Ga0496114_0164359 | Ga0496114_0164359_608_1384 | 183 |
| 148 | 3300049575 | Ga0501039_0596307 | Ga0501039_0596307_66_830 | 183 |
| 149 | 3300050507 | nmdc:mga05p37_1554_c1 | nmdc:mga05p37_1554_c1_8863_9615 | 183 |
| 150 | 3300050508 | nmdc:mga09592_357_c1 | nmdc:mga09592_357_c1_17985_18737 | 183 |
| 151 | 3300050510 | nmdc:mga06r32_30508_c1 | nmdc:mga06r32_30508_c1_3985_4737 | 183 |
| 152 | 3300050515 | nmdc:mga0a205_469702_c1 | nmdc:mga0a205_469702_c1_99_851 | 183 |
| 153 | 3300005328 | Ga0070676_10207720 | Ga0070676_102077201 | 184 |
| 154 | 3300005331 | Ga0070670_100120363 | Ga0070670_1001203633 | 184 |
| 155 | 3300005333 | Ga0070677_10050268 | Ga0070677_100502681 | 184 |
| 156 | 3300005347 | Ga0070668_100048382 | Ga0070668_1000483822 | 184 |
| 157 | 3300005354 | Ga0070675_100084468 | Ga0070675_1000844681 | 184 |
| 158 | 3300005356 | Ga0070674_100334058 | Ga0070674_1003340582 | 184 |
| 159 | 3300005367 | Ga0070667_100138037 | Ga0070667_1001380372 | 184 |
| 160 | 3300005457 | Ga0070662_100185667 | Ga0070662_1001856672 | 184 |
| 161 | 3300005459 | Ga0068867_100012889 | Ga0068867_1000128898 | 184 |
| 162 | 3300005548 | Ga0070665_100036802 | Ga0070665_1000368026 | 184 |
| 163 | 3300005578 | Ga0068854_100123540 | Ga0068854_1001235402 | 184 |
| 164 | 3300005719 | Ga0068861_100187212 | Ga0068861_1001872122 | 184 |
| 165 | 3300005834 | Ga0068851_10045100 | Ga0068851_100451002 | 184 |
| 166 | 3300013296 | Ga0157374_10464360 | Ga0157374_104643602 | 184 |
| 167 | 3300013308 | Ga0157375_10333941 | Ga0157375_103339412 | 184 |
| 168 | 3300025893 | Ga0207682_10027927 | Ga0207682_100279273 | 184 |
| 169 | 3300025907 | Ga0207645_10113951 | Ga0207645_101139512 | 184 |
| 170 | 3300025908 | Ga0207643_10068271 | Ga0207643_100682713 | 184 |
| 171 | 3300025933 | Ga0207706_10239668 | Ga0207706_102396682 | 184 |
| 172 | 3300025939 | Ga0207665_10435324 | Ga0207665_104353242 | 184 |
| 173 | 3300025940 | Ga0207691_10051419 | Ga0207691_100514194 | 184 |
| 174 | 3300025940 | Ga0207691_10101529 | Ga0207691_101015292 | 184 |
| 175 | 3300025960 | Ga0207651_10431714 | Ga0207651_104317141 | 184 |
| 176 | 3300025972 | Ga0207668_10018406 | Ga0207668_100184064 | 184 |
| 177 | 3300025981 | Ga0207640_10343351 | Ga0207640_103433511 | 184 |
| 178 | 3300025986 | Ga0207658_10195117 | Ga0207658_101951173 | 184 |
| 179 | 3300025986 | Ga0207658_10329877 | Ga0207658_103298771 | 184 |
| 180 | 3300026118 | Ga0207675_100152579 | Ga0207675_1001525793 | 184 |
| 181 | 3300028379 | Ga0268266_10187044 | Ga0268266_101870442 | 184 |
| 182 | 3300035112 | Ga0373932_0028552 | Ga0373932_0028552_458_1210 | 184 |
| 183 | 3300035241 | Ga0373961_0072541 | Ga0373961_0072541_248_1000 | 184 |
| 184 | 3300035410 | Ga0373924_0000260 | Ga0373924_0000260_7379_8059 | 184 |
| 185 | 3300035691 | Ga0373931_0009089 | Ga0373931_0009089_3629_4381 | 184 |
| 186 | 3300036401 | Ga0373937_0050874 | Ga0373937_0050874_1239_1991 | 184 |
| 187 | 3300041512 | Ga0451853_3775619 | Ga0451853_3775619_51_743 | 184 |
| 188 | 3300044706 | Ga0466964_0097045 | Ga0466964_0097045_344_1111 | 184 |
| 189 | 3300045051 | Ga0451576_0025224 | Ga0451576_0025224_489_1097 | 184 |
| 190 | 3300045051 | Ga0451576_0067887 | Ga0451576_0067887_1033_1644 | 184 |
| 191 | 3300046537 | Ga0495598_0016783 | Ga0495598_0016783_579_1340 | 184 |
| 192 | 3300046683 | Ga0495658_0051948 | Ga0495658_0051948_676_1428 | 184 |
| 193 | 3300049585 | Ga0501069_0118637 | Ga0501069_0118637_319_1071 | 184 |
| 194 | 3300050508 | nmdc:mga09592_207897_c1 | nmdc:mga09592_207897_c1_165_923 | 184 |
| 195 | 3300050509 | nmdc:mga0qj67_44845_c1 | nmdc:mga0qj67_44845_c1_2315_3073 | 184 |
| 196 | 3300005328 | Ga0070676_10219145 | Ga0070676_102191451 | 185 |
| 197 | 3300005330 | Ga0070690_100059082 | Ga0070690_1000590822 | 185 |
| 198 | 3300005330 | Ga0070690_100198784 | Ga0070690_1001987842 | 185 |
| 199 | 3300005330 | Ga0070690_100390049 | Ga0070690_1003900491 | 185 |
| 200 | 3300005331 | Ga0070670_100002238 | Ga0070670_1000022384 | 185 |
| 201 | 3300005334 | Ga0068869_100004582 | Ga0068869_1000045822 | 185 |
| 202 | 3300005335 | Ga0070666_10053857 | Ga0070666_100538573 | 185 |
| 203 | 3300005335 | Ga0070666_10084282 | Ga0070666_100842822 | 185 |
| 204 | 3300005336 | Ga0070680_100090622 | Ga0070680_1000906224 | 185 |
| 205 | 3300005338 | Ga0068868_100004375 | Ga0068868_1000043753 | 185 |
| 206 | 3300005339 | Ga0070660_100011752 | Ga0070660_1000117526 | 185 |
| 207 | 3300005340 | Ga0070689_100088906 | Ga0070689_1000889063 | 185 |
| 208 | 3300005341 | Ga0070691_10029939 | Ga0070691_100299392 | 185 |
| 209 | 3300005341 | Ga0070691_10110306 | Ga0070691_101103061 | 185 |
| 210 | 3300005343 | Ga0070687_100006911 | Ga0070687_1000069112 | 185 |
| 211 | 3300005343 | Ga0070687_100056130 | Ga0070687_1000561302 | 185 |
| 212 | 3300005343 | Ga0070687_100109142 | Ga0070687_1001091421 | 185 |
| 213 | 3300005344 | Ga0070661_100168080 | Ga0070661_1001680801 | 185 |
| 214 | 3300005344 | Ga0070661_100351208 | Ga0070661_1003512081 | 185 |
| 215 | 3300005345 | Ga0070692_10045232 | Ga0070692_100452321 | 185 |
| 216 | 3300005345 | Ga0070692_10181590 | Ga0070692_101815901 | 185 |
| 217 | 3300005347 | Ga0070668_100011112 | Ga0070668_1000111128 | 185 |
| 218 | 3300005347 | Ga0070668_100067542 | Ga0070668_1000675423 | 185 |
| 219 | 3300005353 | Ga0070669_100003481 | Ga0070669_10000348110 | 185 |
| 220 | 3300005353 | Ga0070669_100034459 | Ga0070669_1000344591 | 185 |
| 221 | 3300005353 | Ga0070669_100430303 | Ga0070669_1004303032 | 185 |
| 222 | 3300005355 | Ga0070671_100090588 | Ga0070671_1000905882 | 185 |
| 223 | 3300005355 | Ga0070671_100312053 | Ga0070671_1003120532 | 185 |
| 224 | 3300005356 | Ga0070674_100093723 | Ga0070674_1000937231 | 185 |
| 225 | 3300005364 | Ga0070673_100216059 | Ga0070673_1002160592 | 185 |
| 226 | 3300005364 | Ga0070673_100265279 | Ga0070673_1002652792 | 185 |
| 227 | 3300005365 | Ga0070688_100005212 | Ga0070688_1000052128 | 185 |
| 228 | 3300005365 | Ga0070688_100068197 | Ga0070688_1000681972 | 185 |
| 229 | 3300005366 | Ga0070659_100005390 | Ga0070659_1000053904 | 185 |
| 230 | 3300005367 | Ga0070667_100000716 | Ga0070667_10000071613 | 185 |
| 231 | 3300005434 | Ga0070709_10060179 | Ga0070709_100601792 | 185 |
| 232 | 3300005434 | Ga0070709_10231722 | Ga0070709_102317221 | 185 |
| 233 | 3300005435 | Ga0070714_100034611 | Ga0070714_1000346112 | 185 |
| 234 | 3300005436 | Ga0070713_100008819 | Ga0070713_1000088197 | 185 |
| 235 | 3300005436 | Ga0070713_100066173 | Ga0070713_1000661733 | 185 |
| 236 | 3300005437 | Ga0070710_10046185 | Ga0070710_100461852 | 185 |
| 237 | 3300005438 | Ga0070701_10079502 | Ga0070701_100795021 | 185 |
| 238 | 3300005438 | Ga0070701_10293584 | Ga0070701_102935841 | 185 |
| 239 | 3300005439 | Ga0070711_100013106 | Ga0070711_1000131065 | 185 |
| 240 | 3300005439 | Ga0070711_100252190 | Ga0070711_1002521901 | 185 |
| 241 | 3300005440 | Ga0070705_100007465 | Ga0070705_1000074655 | 185 |
| 242 | 3300005440 | Ga0070705_100033542 | Ga0070705_1000335422 | 185 |
| 243 | 3300005440 | Ga0070705_100050017 | Ga0070705_1000500172 | 185 |
| 244 | 3300005441 | Ga0070700_100567556 | Ga0070700_1005675561 | 185 |
| 245 | 3300005444 | Ga0070694_100042994 | Ga0070694_1000429944 | 185 |
| 246 | 3300005444 | Ga0070694_100173109 | Ga0070694_1001731091 | 185 |
| 247 | 3300005445 | Ga0070708_100000176 | Ga0070708_10000017634 | 185 |
| 248 | 3300005445 | Ga0070708_100127839 | Ga0070708_1001278391 | 185 |
| 249 | 3300005445 | Ga0070708_100356505 | Ga0070708_1003565051 | 185 |
| 250 | 3300005455 | Ga0070663_100007149 | Ga0070663_1000071496 | 185 |
| 251 | 3300005456 | Ga0070678_100123518 | Ga0070678_1001235183 | 185 |
| 252 | 3300005456 | Ga0070678_100148293 | Ga0070678_1001482931 | 185 |
| 253 | 3300005456 | Ga0070678_100569684 | Ga0070678_1005696841 | 185 |
| 254 | 3300005457 | Ga0070662_100121685 | Ga0070662_1001216853 | 185 |
| 255 | 3300005457 | Ga0070662_100128052 | Ga0070662_1001280522 | 185 |
| 256 | 3300005458 | Ga0070681_10008346 | Ga0070681_1000834611 | 185 |
| 257 | 3300005458 | Ga0070681_10061558 | Ga0070681_100615585 | 185 |
| 258 | 3300005459 | Ga0068867_100007802 | Ga0068867_1000078021 | 185 |
| 259 | 3300005459 | Ga0068867_100010852 | Ga0068867_1000108523 | 185 |
| 260 | 3300005459 | Ga0068867_100137620 | Ga0068867_1001376202 | 185 |
| 261 | 3300005459 | Ga0068867_100141769 | Ga0068867_1001417691 | 185 |
| 262 | 3300005466 | Ga0070685_10005807 | Ga0070685_100058073 | 185 |
| 263 | 3300005466 | Ga0070685_10317608 | Ga0070685_103176081 | 185 |
| 264 | 3300005467 | Ga0070706_100065380 | Ga0070706_1000653802 | 185 |
| 265 | 3300005467 | Ga0070706_100102433 | Ga0070706_1001024333 | 185 |
| 266 | 3300005467 | Ga0070706_100137111 | Ga0070706_1001371112 | 185 |
| 267 | 3300005467 | Ga0070706_100156172 | Ga0070706_1001561722 | 185 |
| 268 | 3300005468 | Ga0070707_100152720 | Ga0070707_1001527202 | 185 |
| 269 | 3300005468 | Ga0070707_100282674 | Ga0070707_1002826742 | 185 |
| 270 | 3300005471 | Ga0070698_100371848 | Ga0070698_1003718481 | 185 |
| 271 | 3300005518 | Ga0070699_100256171 | Ga0070699_1002561711 | 185 |
| 272 | 3300005530 | Ga0070679_100000683 | Ga0070679_10000068319 | 185 |
| 273 | 3300005530 | Ga0070679_100076267 | Ga0070679_1000762672 | 185 |
| 274 | 3300005535 | Ga0070684_100022709 | Ga0070684_1000227092 | 185 |
| 275 | 3300005536 | Ga0070697_100013235 | Ga0070697_1000132355 | 185 |
| 276 | 3300005536 | Ga0070697_100018277 | Ga0070697_1000182776 | 185 |
| 277 | 3300005539 | Ga0068853_100094970 | Ga0068853_1000949704 | 185 |
| 278 | 3300005539 | Ga0068853_100173941 | Ga0068853_1001739413 | 185 |
| 279 | 3300005543 | Ga0070672_100079921 | Ga0070672_1000799213 | 185 |
| 280 | 3300005543 | Ga0070672_100562234 | Ga0070672_1005622341 | 185 |
| 281 | 3300005544 | Ga0070686_100001879 | Ga0070686_1000018793 | 185 |
| 282 | 3300005544 | Ga0070686_100035706 | Ga0070686_1000357064 | 185 |
| 283 | 3300005544 | Ga0070686_100165295 | Ga0070686_1001652952 | 185 |
| 284 | 3300005544 | Ga0070686_100269321 | Ga0070686_1002693212 | 185 |
| 285 | 3300005545 | Ga0070695_100038262 | Ga0070695_1000382622 | 185 |
| 286 | 3300005545 | Ga0070695_100156043 | Ga0070695_1001560431 | 185 |
| 287 | 3300005546 | Ga0070696_100008459 | Ga0070696_1000084595 | 185 |
| 288 | 3300005546 | Ga0070696_100020612 | Ga0070696_1000206122 | 185 |
| 289 | 3300005546 | Ga0070696_100146670 | Ga0070696_1001466702 | 185 |
| 290 | 3300005546 | Ga0070696_100160728 | Ga0070696_1001607282 | 185 |
| 291 | 3300005547 | Ga0070693_100001678 | Ga0070693_1000016788 | 185 |
| 292 | 3300005547 | Ga0070693_100316312 | Ga0070693_1003163121 | 185 |
| 293 | 3300005548 | Ga0070665_100003912 | Ga0070665_1000039122 | 185 |
| 294 | 3300005549 | Ga0070704_100034742 | Ga0070704_1000347424 | 185 |
| 295 | 3300005549 | Ga0070704_100063663 | Ga0070704_1000636631 | 185 |
| 296 | 3300005549 | Ga0070704_100106527 | Ga0070704_1001065272 | 185 |
| 297 | 3300005549 | Ga0070704_100225100 | Ga0070704_1002251002 | 185 |
| 298 | 3300005549 | Ga0070704_100318526 | Ga0070704_1003185262 | 185 |
| 299 | 3300005563 | Ga0068855_100104238 | Ga0068855_1001042382 | 185 |
| 300 | 3300005564 | Ga0070664_100111672 | Ga0070664_1001116723 | 185 |
| 301 | 3300005564 | Ga0070664_100166160 | Ga0070664_1001661602 | 185 |
| 302 | 3300005577 | Ga0068857_100082720 | Ga0068857_1000827202 | 185 |
| 303 | 3300005577 | Ga0068857_100205132 | Ga0068857_1002051323 | 185 |
| 304 | 3300005578 | Ga0068854_100011465 | Ga0068854_1000114652 | 185 |
| 305 | 3300005578 | Ga0068854_100067556 | Ga0068854_1000675562 | 185 |
| 306 | 3300005614 | Ga0068856_100351125 | Ga0068856_1003511252 | 185 |
| 307 | 3300005615 | Ga0070702_100058498 | Ga0070702_1000584982 | 185 |
| 308 | 3300005616 | Ga0068852_100112116 | Ga0068852_1001121162 | 185 |
| 309 | 3300005617 | Ga0068859_100000241 | Ga0068859_10000024155 | 185 |
| 310 | 3300005617 | Ga0068859_100003857 | Ga0068859_1000038578 | 185 |
| 311 | 3300005617 | Ga0068859_100054150 | Ga0068859_1000541503 | 185 |
| 312 | 3300005618 | Ga0068864_100000578 | Ga0068864_10000057824 | 185 |
| 313 | 3300005618 | Ga0068864_100008295 | Ga0068864_1000082957 | 185 |
| 314 | 3300005618 | Ga0068864_100040080 | Ga0068864_1000400803 | 185 |
| 315 | 3300005718 | Ga0068866_10046320 | Ga0068866_100463202 | 185 |
| 316 | 3300005718 | Ga0068866_10075327 | Ga0068866_100753272 | 185 |
| 317 | 3300005719 | Ga0068861_100000253 | Ga0068861_10000025322 | 185 |
| 318 | 3300005834 | Ga0068851_10032159 | Ga0068851_100321591 | 185 |
| 319 | 3300005840 | Ga0068870_10003058 | Ga0068870_100030585 | 185 |
| 320 | 3300005840 | Ga0068870_10012128 | Ga0068870_100121286 | 185 |
| 321 | 3300005841 | Ga0068863_100013334 | Ga0068863_10001333410 | 185 |
| 322 | 3300005841 | Ga0068863_100504550 | Ga0068863_1005045501 | 185 |
| 323 | 3300005842 | Ga0068858_100016946 | Ga0068858_1000169469 | 185 |
| 324 | 3300005842 | Ga0068858_100074042 | Ga0068858_1000740423 | 185 |
| 325 | 3300005842 | Ga0068858_100236381 | Ga0068858_1002363813 | 185 |
| 326 | 3300005843 | Ga0068860_100008803 | Ga0068860_1000088038 | 185 |
| 327 | 3300005843 | Ga0068860_100049084 | Ga0068860_1000490842 | 185 |
| 328 | 3300005843 | Ga0068860_100434743 | Ga0068860_1004347432 | 185 |
| 329 | 3300005843 | Ga0068860_100440323 | Ga0068860_1004403231 | 185 |
| 330 | 3300005844 | Ga0068862_100076353 | Ga0068862_1000763533 | 185 |
| 331 | 3300005844 | Ga0068862_100763390 | Ga0068862_1007633901 | 185 |
| 332 | 3300006028 | Ga0070717_10253814 | Ga0070717_102538143 | 185 |
| 333 | 3300006163 | Ga0070715_10038796 | Ga0070715_100387962 | 185 |
| 334 | 3300006173 | Ga0070716_100003884 | Ga0070716_1000038843 | 185 |
| 335 | 3300006173 | Ga0070716_100025390 | Ga0070716_1000253902 | 185 |
| 336 | 3300006173 | Ga0070716_100027806 | Ga0070716_1000278064 | 185 |
| 337 | 3300006173 | Ga0070716_100076946 | Ga0070716_1000769462 | 185 |
| 338 | 3300006173 | Ga0070716_100349376 | Ga0070716_1003493761 | 185 |
| 339 | 3300006175 | Ga0070712_100012107 | Ga0070712_1000121071 | 185 |
| 340 | 3300006175 | Ga0070712_100210401 | Ga0070712_1002104013 | 185 |
| 341 | 3300006186 | Ga0075369_10061649 | Ga0075369_100616493 | 185 |
| 342 | 3300006195 | Ga0075366_10008743 | Ga0075366_100087434 | 185 |
| 343 | 3300006237 | Ga0097621_100007751 | Ga0097621_1000077516 | 185 |
| 344 | 3300006237 | Ga0097621_100014593 | Ga0097621_1000145937 | 185 |
| 345 | 3300006358 | Ga0068871_100003130 | Ga0068871_1000031307 | 185 |
| 346 | 3300006358 | Ga0068871_100009487 | Ga0068871_1000094877 | 185 |
| 347 | 3300006358 | Ga0068871_100054710 | Ga0068871_1000547104 | 185 |
| 348 | 3300006358 | Ga0068871_100063497 | Ga0068871_1000634973 | 185 |
| 349 | 3300006847 | Ga0075431_100026010 | Ga0075431_1000260103 | 185 |
| 350 | 3300006847 | Ga0075431_100056192 | Ga0075431_1000561923 | 185 |
| 351 | 3300006852 | Ga0075433_10025046 | Ga0075433_100250467 | 185 |
| 352 | 3300006852 | Ga0075433_10192339 | Ga0075433_101923392 | 185 |
| 353 | 3300006871 | Ga0075434_100193720 | Ga0075434_1001937202 | 185 |
| 354 | 3300006880 | Ga0075429_100020944 | Ga0075429_1000209442 | 185 |
| 355 | 3300006881 | Ga0068865_100063301 | Ga0068865_1000633012 | 185 |
| 356 | 3300006881 | Ga0068865_100073564 | Ga0068865_1000735642 | 185 |
| 357 | 3300006881 | Ga0068865_100130283 | Ga0068865_1001302832 | 185 |
| 358 | 3300006881 | Ga0068865_100331735 | Ga0068865_1003317352 | 185 |
| 359 | 3300006914 | Ga0075436_100006126 | Ga0075436_1000061262 | 185 |
| 360 | 3300006914 | Ga0075436_100012648 | Ga0075436_1000126484 | 185 |
| 361 | 3300006914 | Ga0075436_100018398 | Ga0075436_1000183984 | 185 |
| 362 | 3300006914 | Ga0075436_100062532 | Ga0075436_1000625322 | 185 |
| 363 | 3300006914 | Ga0075436_100370940 | Ga0075436_1003709402 | 185 |
| 364 | 3300006931 | Ga0097620_100000241 | Ga0097620_10000024155 | 185 |
| 365 | 3300006931 | Ga0097620_100003857 | Ga0097620_1000038578 | 185 |
| 366 | 3300006931 | Ga0097620_100054151 | Ga0097620_1000541515 | 185 |
| 367 | 3300007076 | Ga0075435_100005931 | Ga0075435_1000059318 | 185 |
| 368 | 3300007076 | Ga0075435_100297295 | Ga0075435_1002972952 | 185 |
| 369 | 3300007076 | Ga0075435_100716893 | Ga0075435_1007168931 | 185 |
| 370 | 3300007265 | Ga0099794_10025067 | Ga0099794_100250672 | 185 |
| 371 | 3300009098 | Ga0105245_10021823 | Ga0105245_100218233 | 185 |
| 372 | 3300009098 | Ga0105245_10025750 | Ga0105245_100257503 | 185 |
| 373 | 3300009098 | Ga0105245_10448119 | Ga0105245_104481191 | 185 |
| 374 | 3300009147 | Ga0114129_10021743 | Ga0114129_100217436 | 185 |
| 375 | 3300009147 | Ga0114129_10605243 | Ga0114129_106052432 | 185 |
| 376 | 3300009147 | Ga0114129_11463336 | Ga0114129_114633361 | 185 |
| 377 | 3300009148 | Ga0105243_10035567 | Ga0105243_100355673 | 185 |
| 378 | 3300009148 | Ga0105243_10184554 | Ga0105243_101845541 | 185 |
| 379 | 3300009148 | Ga0105243_10439065 | Ga0105243_104390652 | 185 |
| 380 | 3300009174 | Ga0105241_10051469 | Ga0105241_100514693 | 185 |
| 381 | 3300009174 | Ga0105241_10079678 | Ga0105241_100796783 | 185 |
| 382 | 3300009174 | Ga0105241_10350688 | Ga0105241_103506881 | 185 |
| 383 | 3300009176 | Ga0105242_10017032 | Ga0105242_100170327 | 185 |
| 384 | 3300009176 | Ga0105242_10095570 | Ga0105242_100955702 | 185 |
| 385 | 3300009176 | Ga0105242_10357409 | Ga0105242_103574092 | 185 |
| 386 | 3300009177 | Ga0105248_10003921 | Ga0105248_1000392119 | 185 |
| 387 | 3300009177 | Ga0105248_10271166 | Ga0105248_102711663 | 185 |
| 388 | 3300009551 | Ga0105238_10018196 | Ga0105238_100181963 | 185 |
| 389 | 3300009551 | Ga0105238_10520087 | Ga0105238_105200872 | 185 |
| 390 | 3300009553 | Ga0105249_10169191 | Ga0105249_101691912 | 185 |
| 391 | 3300013100 | Ga0157373_10017867 | Ga0157373_100178673 | 185 |
| 392 | 3300013100 | Ga0157373_10050231 | Ga0157373_100502312 | 185 |
| 393 | 3300013102 | Ga0157371_10036699 | Ga0157371_100366992 | 185 |
| 394 | 3300013104 | Ga0157370_10002179 | Ga0157370_1000217912 | 185 |
| 395 | 3300013104 | Ga0157370_10200793 | Ga0157370_102007931 | 185 |
| 396 | 3300013104 | Ga0157370_10743051 | Ga0157370_107430511 | 185 |
| 397 | 3300013296 | Ga0157374_10770784 | Ga0157374_107707841 | 185 |
| 398 | 3300013296 | Ga0157374_11628820 | Ga0157374_116288201 | 185 |
| 399 | 3300013297 | Ga0157378_10085015 | Ga0157378_100850153 | 185 |
| 400 | 3300013297 | Ga0157378_10182126 | Ga0157378_101821262 | 185 |
| 401 | 3300013306 | Ga0163162_10028905 | Ga0163162_100289053 | 185 |
| 402 | 3300013306 | Ga0163162_10053780 | Ga0163162_100537803 | 185 |
| 403 | 3300013306 | Ga0163162_10193467 | Ga0163162_101934673 | 185 |
| 404 | 3300013307 | Ga0157372_10065337 | Ga0157372_100653375 | 185 |
| 405 | 3300013307 | Ga0157372_10184731 | Ga0157372_101847312 | 185 |
| 406 | 3300013308 | Ga0157375_10072751 | Ga0157375_100727512 | 185 |
| 407 | 3300013308 | Ga0157375_10585815 | Ga0157375_105858151 | 185 |
| 408 | 3300013308 | Ga0157375_11327166 | Ga0157375_113271661 | 185 |
| 409 | 3300014325 | Ga0163163_10002440 | Ga0163163_1000244017 | 185 |
| 410 | 3300014325 | Ga0163163_10321335 | Ga0163163_103213351 | 185 |
| 411 | 3300014326 | Ga0157380_10361338 | Ga0157380_103613382 | 185 |
| 412 | 3300014968 | Ga0157379_10003260 | Ga0157379_100032609 | 185 |
| 413 | 3300014968 | Ga0157379_10246320 | Ga0157379_102463202 | 185 |
| 414 | 3300014969 | Ga0157376_10217100 | Ga0157376_102171002 | 185 |
| 415 | 3300014969 | Ga0157376_10549040 | Ga0157376_105490401 | 185 |
| 416 | 3300017792 | Ga0163161_10015854 | Ga0163161_100158546 | 185 |
| 417 | 3300017792 | Ga0163161_10059840 | Ga0163161_100598401 | 185 |
| 418 | 3300017792 | Ga0163161_10192696 | Ga0163161_101926962 | 185 |
| 419 | 3300021441 | Ga0213871_10073559 | Ga0213871_100735591 | 185 |
| 420 | 3300025893 | Ga0207682_10026746 | Ga0207682_100267463 | 185 |
| 421 | 3300025899 | Ga0207642_10045543 | Ga0207642_100455432 | 185 |
| 422 | 3300025899 | Ga0207642_10082160 | Ga0207642_100821602 | 185 |
| 423 | 3300025899 | Ga0207642_10131669 | Ga0207642_101316691 | 185 |
| 424 | 3300025903 | Ga0207680_10096996 | Ga0207680_100969962 | 185 |
| 425 | 3300025905 | Ga0207685_10016992 | Ga0207685_100169923 | 185 |
| 426 | 3300025906 | Ga0207699_10051930 | Ga0207699_100519303 | 185 |
| 427 | 3300025906 | Ga0207699_10156035 | Ga0207699_101560352 | 185 |
| 428 | 3300025908 | Ga0207643_10007265 | Ga0207643_100072654 | 185 |
| 429 | 3300025908 | Ga0207643_10007501 | Ga0207643_100075013 | 185 |
| 430 | 3300025910 | Ga0207684_10087067 | Ga0207684_100870673 | 185 |
| 431 | 3300025910 | Ga0207684_10179429 | Ga0207684_101794292 | 185 |
| 432 | 3300025911 | Ga0207654_10027390 | Ga0207654_100273903 | 185 |
| 433 | 3300025911 | Ga0207654_10084679 | Ga0207654_100846792 | 185 |
| 434 | 3300025912 | Ga0207707_10002721 | Ga0207707_100027211 | 185 |
| 435 | 3300025912 | Ga0207707_10022447 | Ga0207707_100224472 | 185 |
| 436 | 3300025912 | Ga0207707_10084051 | Ga0207707_100840513 | 185 |
| 437 | 3300025912 | Ga0207707_10145238 | Ga0207707_101452383 | 185 |
| 438 | 3300025915 | Ga0207693_10117602 | Ga0207693_101176022 | 185 |
| 439 | 3300025915 | Ga0207693_10425463 | Ga0207693_104254632 | 185 |
| 440 | 3300025916 | Ga0207663_10100789 | Ga0207663_101007892 | 185 |
| 441 | 3300025916 | Ga0207663_10105221 | Ga0207663_101052212 | 185 |
| 442 | 3300025918 | Ga0207662_10055441 | Ga0207662_100554413 | 185 |
| 443 | 3300025918 | Ga0207662_10075939 | Ga0207662_100759392 | 185 |
| 444 | 3300025918 | Ga0207662_10134817 | Ga0207662_101348172 | 185 |
| 445 | 3300025919 | Ga0207657_10001232 | Ga0207657_1000123220 | 185 |
| 446 | 3300025920 | Ga0207649_10014444 | Ga0207649_100144444 | 185 |
| 447 | 3300025920 | Ga0207649_10205476 | Ga0207649_102054762 | 185 |
| 448 | 3300025921 | Ga0207652_10000882 | Ga0207652_1000088213 | 185 |
| 449 | 3300025921 | Ga0207652_10055124 | Ga0207652_100551242 | 185 |
| 450 | 3300025921 | Ga0207652_10074377 | Ga0207652_100743775 | 185 |
| 451 | 3300025922 | Ga0207646_10025064 | Ga0207646_100250646 | 185 |
| 452 | 3300025923 | Ga0207681_10040702 | Ga0207681_100407023 | 185 |
| 453 | 3300025923 | Ga0207681_10176924 | Ga0207681_101769243 | 185 |
| 454 | 3300025925 | Ga0207650_10332548 | Ga0207650_103325482 | 185 |
| 455 | 3300025926 | Ga0207659_10245799 | Ga0207659_102457992 | 185 |
| 456 | 3300025927 | Ga0207687_10005511 | Ga0207687_100055118 | 185 |
| 457 | 3300025927 | Ga0207687_10066405 | Ga0207687_100664053 | 185 |
| 458 | 3300025928 | Ga0207700_10000018 | Ga0207700_10000018115 | 185 |
| 459 | 3300025928 | Ga0207700_10139177 | Ga0207700_101391771 | 185 |
| 460 | 3300025929 | Ga0207664_10086002 | Ga0207664_100860023 | 185 |
| 461 | 3300025929 | Ga0207664_10433331 | Ga0207664_104333312 | 185 |
| 462 | 3300025931 | Ga0207644_10074172 | Ga0207644_100741723 | 185 |
| 463 | 3300025933 | Ga0207706_10128898 | Ga0207706_101288982 | 185 |
| 464 | 3300025933 | Ga0207706_10146356 | Ga0207706_101463562 | 185 |
| 465 | 3300025933 | Ga0207706_10179659 | Ga0207706_101796593 | 185 |
| 466 | 3300025934 | Ga0207686_10002440 | Ga0207686_100024402 | 185 |
| 467 | 3300025934 | Ga0207686_10010576 | Ga0207686_100105767 | 185 |
| 468 | 3300025934 | Ga0207686_10039695 | Ga0207686_100396951 | 185 |
| 469 | 3300025934 | Ga0207686_10305948 | Ga0207686_103059482 | 185 |
| 470 | 3300025935 | Ga0207709_10390550 | Ga0207709_103905501 | 185 |
| 471 | 3300025936 | Ga0207670_10702435 | Ga0207670_107024351 | 185 |
| 472 | 3300025937 | Ga0207669_10173524 | Ga0207669_101735241 | 185 |
| 473 | 3300025938 | Ga0207704_10013925 | Ga0207704_100139252 | 185 |
| 474 | 3300025938 | Ga0207704_10365035 | Ga0207704_103650351 | 185 |
| 475 | 3300025939 | Ga0207665_10019748 | Ga0207665_100197485 | 185 |
| 476 | 3300025939 | Ga0207665_10049897 | Ga0207665_100498974 | 185 |
| 477 | 3300025939 | Ga0207665_10085522 | Ga0207665_100855222 | 185 |
| 478 | 3300025939 | Ga0207665_10210708 | Ga0207665_102107082 | 185 |
| 479 | 3300025940 | Ga0207691_10015497 | Ga0207691_100154978 | 185 |
| 480 | 3300025940 | Ga0207691_10038029 | Ga0207691_100380294 | 185 |
| 481 | 3300025940 | Ga0207691_10042446 | Ga0207691_100424461 | 185 |
| 482 | 3300025940 | Ga0207691_10313037 | Ga0207691_103130372 | 185 |
| 483 | 3300025940 | Ga0207691_10386679 | Ga0207691_103866791 | 185 |
| 484 | 3300025941 | Ga0207711_10009735 | Ga0207711_100097352 | 185 |
| 485 | 3300025941 | Ga0207711_10013017 | Ga0207711_100130176 | 185 |
| 486 | 3300025942 | Ga0207689_10000978 | Ga0207689_1000097819 | 185 |
| 487 | 3300025942 | Ga0207689_10115900 | Ga0207689_101159003 | 185 |
| 488 | 3300025942 | Ga0207689_10116936 | Ga0207689_101169362 | 185 |
| 489 | 3300025944 | Ga0207661_10085862 | Ga0207661_100858622 | 185 |
| 490 | 3300025945 | Ga0207679_10079034 | Ga0207679_100790343 | 185 |
| 491 | 3300025945 | Ga0207679_10137313 | Ga0207679_101373131 | 185 |
| 492 | 3300025960 | Ga0207651_10168126 | Ga0207651_101681262 | 185 |
| 493 | 3300025960 | Ga0207651_10200705 | Ga0207651_102007052 | 185 |
| 494 | 3300025960 | Ga0207651_10266638 | Ga0207651_102666381 | 185 |
| 495 | 3300025972 | Ga0207668_10035192 | Ga0207668_100351922 | 185 |
| 496 | 3300025972 | Ga0207668_10094530 | Ga0207668_100945302 | 185 |
| 497 | 3300025981 | Ga0207640_10007371 | Ga0207640_100073715 | 185 |
| 498 | 3300025986 | Ga0207658_10009537 | Ga0207658_100095372 | 185 |
| 499 | 3300025986 | Ga0207658_10058738 | Ga0207658_100587383 | 185 |
| 500 | 3300026023 | Ga0207677_10003803 | Ga0207677_100038032 | 185 |
| 501 | 3300026023 | Ga0207677_10085791 | Ga0207677_100857913 | 185 |
| 502 | 3300026035 | Ga0207703_10003987 | Ga0207703_100039879 | 185 |
| 503 | 3300026035 | Ga0207703_10004855 | Ga0207703_100048555 | 185 |
| 504 | 3300026035 | Ga0207703_10066506 | Ga0207703_100665063 | 185 |
| 505 | 3300026041 | Ga0207639_10010462 | Ga0207639_100104625 | 185 |
| 506 | 3300026041 | Ga0207639_10053114 | Ga0207639_100531142 | 185 |
| 507 | 3300026041 | Ga0207639_10201540 | Ga0207639_102015402 | 185 |
| 508 | 3300026067 | Ga0207678_10005913 | Ga0207678_100059138 | 185 |
| 509 | 3300026075 | Ga0207708_10013446 | Ga0207708_100134467 | 185 |
| 510 | 3300026075 | Ga0207708_10218120 | Ga0207708_102181201 | 185 |
| 511 | 3300026075 | Ga0207708_10685442 | Ga0207708_106854421 | 185 |
| 512 | 3300026078 | Ga0207702_10353634 | Ga0207702_103536342 | 185 |
| 513 | 3300026078 | Ga0207702_10442890 | Ga0207702_104428902 | 185 |
| 514 | 3300026088 | Ga0207641_10009435 | Ga0207641_100094355 | 185 |
| 515 | 3300026088 | Ga0207641_10316995 | Ga0207641_103169952 | 185 |
| 516 | 3300026089 | Ga0207648_10002998 | Ga0207648_1000299812 | 185 |
| 517 | 3300026089 | Ga0207648_10003153 | Ga0207648_100031538 | 185 |
| 518 | 3300026089 | Ga0207648_10004011 | Ga0207648_1000401111 | 185 |
| 519 | 3300026089 | Ga0207648_10610524 | Ga0207648_106105242 | 185 |
| 520 | 3300026095 | Ga0207676_10009383 | Ga0207676_100093831 | 185 |
| 521 | 3300026095 | Ga0207676_10025643 | Ga0207676_100256433 | 185 |
| 522 | 3300026116 | Ga0207674_10001132 | Ga0207674_100011329 | 185 |
| 523 | 3300026116 | Ga0207674_10013288 | Ga0207674_100132882 | 185 |
| 524 | 3300026116 | Ga0207674_10217205 | Ga0207674_102172053 | 185 |
| 525 | 3300026118 | Ga0207675_100001531 | Ga0207675_10000153110 | 185 |
| 526 | 3300026118 | Ga0207675_100111342 | Ga0207675_1001113424 | 185 |
| 527 | 3300026118 | Ga0207675_101041621 | Ga0207675_1010416211 | 185 |
| 528 | 3300026121 | Ga0207683_10000243 | Ga0207683_100002432 | 185 |
| 529 | 3300026121 | Ga0207683_10004243 | Ga0207683_1000424311 | 185 |
| 530 | 3300026121 | Ga0207683_10019201 | Ga0207683_100192012 | 185 |
| 531 | 3300026142 | Ga0207698_10458306 | Ga0207698_104583061 | 185 |
| 532 | 3300027665 | Ga0209983_1042234 | Ga0209983_10422341 | 185 |
| 533 | 3300028379 | Ga0268266_10219018 | Ga0268266_102190183 | 185 |
| 534 | 3300028379 | Ga0268266_10339510 | Ga0268266_103395102 | 185 |
| 535 | 3300028379 | Ga0268266_10489497 | Ga0268266_104894972 | 185 |
| 536 | 3300028380 | Ga0268265_10019780 | Ga0268265_100197806 | 185 |
| 537 | 3300028381 | Ga0268264_10000466 | Ga0268264_100004662 | 185 |
| 538 | 3300028381 | Ga0268264_10015619 | Ga0268264_100156192 | 185 |
| 539 | 3300028381 | Ga0268264_10034902 | Ga0268264_100349024 | 185 |
| 540 | 3300028381 | Ga0268264_10172123 | Ga0268264_101721232 | 185 |
| 541 | 3300031235 | Ga0265330_10022376 | Ga0265330_100223761 | 185 |
| 542 | 3300031238 | Ga0265332_10000832 | Ga0265332_100008321 | 185 |
| 543 | 3300031242 | Ga0265329_10001252 | Ga0265329_100012528 | 185 |
| 544 | 3300031249 | Ga0265339_10044090 | Ga0265339_100440903 | 185 |
| 545 | 3300031250 | Ga0265331_10000960 | Ga0265331_1000096013 | 185 |
| 546 | 3300031251 | Ga0265327_10002886 | Ga0265327_1000288611 | 185 |
| 547 | 3300031548 | Ga0307408_100188609 | Ga0307408_1001886092 | 185 |
| 548 | 3300031665 | Ga0316575_10006194 | Ga0316575_100061944 | 185 |
| 549 | 3300031691 | Ga0316579_10001228 | Ga0316579_100012283 | 185 |
| 550 | 3300031728 | Ga0316578_10116085 | Ga0316578_101160852 | 185 |
| 551 | 3300031731 | Ga0307405_10395721 | Ga0307405_103957212 | 185 |
| 552 | 3300031852 | Ga0307410_10371392 | Ga0307410_103713921 | 185 |
| 553 | 3300031901 | Ga0307406_10149717 | Ga0307406_101497172 | 185 |
| 554 | 3300031903 | Ga0307407_10509503 | Ga0307407_105095031 | 185 |
| 555 | 3300031995 | Ga0307409_100124756 | Ga0307409_1001247563 | 185 |
| 556 | 3300031995 | Ga0307409_100685187 | Ga0307409_1006851872 | 185 |
| 557 | 3300032002 | Ga0307416_100031414 | Ga0307416_1000314146 | 185 |
| 558 | 3300032002 | Ga0307416_100278974 | Ga0307416_1002789742 | 185 |
| 559 | 3300032002 | Ga0307416_100571770 | Ga0307416_1005717702 | 185 |
| 560 | 3300032004 | Ga0307414_10153704 | Ga0307414_101537043 | 185 |
| 561 | 3300032133 | Ga0316583_10000892 | Ga0316583_100008924 | 185 |
| 562 | 3300032168 | Ga0316593_10016441 | Ga0316593_100164411 | 185 |
| 563 | 3300033541 | Ga0316596_1047872 | Ga0316596_10478722 | 185 |
| 564 | 3300035086 | Ga0373934_0005696 | Ga0373934_0005696_3034_3774 | 185 |
| 565 | 3300035111 | Ga0373923_0019402 | Ga0373923_0019402_769_1530 | 185 |
| 566 | 3300035111 | Ga0373923_0033623 | Ga0373923_0033623_703_1443 | 185 |
| 567 | 3300035111 | Ga0373923_0106893 | Ga0373923_0106893_303_1085 | 185 |
| 568 | 3300035115 | Ga0373941_0097270 | Ga0373941_0097270_187_954 | 185 |
| 569 | 3300035116 | Ga0373945_0018142 | Ga0373945_0018142_1347_2081 | 185 |
| 570 | 3300035117 | Ga0373953_0024693 | Ga0373953_0024693_882_1664 | 185 |
| 571 | 3300035117 | Ga0373953_0026419 | Ga0373953_0026419_506_1258 | 185 |
| 572 | 3300035117 | Ga0373953_0097050 | Ga0373953_0097050_278_1039 | 185 |
| 573 | 3300035118 | Ga0373954_0091907 | Ga0373954_0091907_245_979 | 185 |
| 574 | 3300035119 | Ga0373956_0000019 | Ga0373956_0000019_4858_5610 | 185 |
| 575 | 3300035119 | Ga0373956_0011985 | Ga0373956_0011985_2454_3194 | 185 |
| 576 | 3300035119 | Ga0373956_0014647 | Ga0373956_0014647_1665_2447 | 185 |
| 577 | 3300035119 | Ga0373956_0020351 | Ga0373956_0020351_1725_2459 | 185 |
| 578 | 3300035120 | Ga0373957_0005872 | Ga0373957_0005872_1550_2311 | 185 |
| 579 | 3300035120 | Ga0373957_0035481 | Ga0373957_0035481_175_915 | 185 |
| 580 | 3300035121 | Ga0373960_0022010 | Ga0373960_0022010_678_1445 | 185 |
| 581 | 3300035170 | Ga0373943_0025451 | Ga0373943_0025451_416_1156 | 185 |
| 582 | 3300035170 | Ga0373943_0077418 | Ga0373943_0077418_679_1413 | 185 |
| 583 | 3300035171 | Ga0373946_0041632 | Ga0373946_0041632_1101_1835 | 185 |
| 584 | 3300035172 | Ga0373955_0002173 | Ga0373955_0002173_5898_6650 | 185 |
| 585 | 3300035172 | Ga0373955_0007763 | Ga0373955_0007763_704_1486 | 185 |
| 586 | 3300035172 | Ga0373955_0026989 | Ga0373955_0026989_1294_2028 | 185 |
| 587 | 3300035172 | Ga0373955_0038007 | Ga0373955_0038007_921_1682 | 185 |
| 588 | 3300035172 | Ga0373955_0060478 | Ga0373955_0060478_35_775 | 185 |
| 589 | 3300035398 | Ga0316574_0000875 | Ga0316574_0000875_7975_8661 | 185 |
| 590 | 3300035410 | Ga0373924_0017922 | Ga0373924_0017922_1310_2092 | 185 |
| 591 | 3300035410 | Ga0373924_0020147 | Ga0373924_0020147_564_1325 | 185 |
| 592 | 3300035410 | Ga0373924_0071551 | Ga0373924_0071551_329_1069 | 185 |
| 593 | 3300035691 | Ga0373931_0008409 | Ga0373931_0008409_3808_4575 | 185 |
| 594 | 3300035691 | Ga0373931_0062308 | Ga0373931_0062308_1224_1943 | 185 |
| 595 | 3300035692 | Ga0373935_0004744 | Ga0373935_0004744_4219_4953 | 185 |
| 596 | 3300035692 | Ga0373935_0018123 | Ga0373935_0018123_603_1364 | 185 |
| 597 | 3300035692 | Ga0373935_0042242 | Ga0373935_0042242_1103_1837 | 185 |
| 598 | 3300035692 | Ga0373935_0102008 | Ga0373935_0102008_189_968 | 185 |
| 599 | 3300035695 | Ga0373927_0005710 | Ga0373927_0005710_741_1511 | 185 |
| 600 | 3300035695 | Ga0373927_0021909 | Ga0373927_0021909_112_858 | 185 |
| 601 | 3300035695 | Ga0373927_0080668 | Ga0373927_0080668_713_1447 | 185 |
| 602 | 3300035695 | Ga0373927_0088659 | Ga0373927_0088659_895_1656 | 185 |
| 603 | 3300035695 | Ga0373927_0179891 | Ga0373927_0179891_163_942 | 185 |
| 604 | 3300035695 | Ga0373927_0299179 | Ga0373927_0299179_213_947 | 185 |
| 605 | 3300035724 | Ga0373933_0003592 | Ga0373933_0003592_6020_6772 | 185 |
| 606 | 3300035725 | Ga0373947_0011294 | Ga0373947_0011294_2332_3066 | 185 |
| 607 | 3300036401 | Ga0373937_0001120 | Ga0373937_0001120_14786_15538 | 185 |
| 608 | 3300036401 | Ga0373937_0013063 | Ga0373937_0013063_2293_3027 | 185 |
| 609 | 3300036401 | Ga0373937_0038755 | Ga0373937_0038755_1307_2089 | 185 |
| 610 | 3300036401 | Ga0373937_0185844 | Ga0373937_0185844_50_802 | 185 |
| 611 | 3300036401 | Ga0373937_0282325 | Ga0373937_0282325_634_1395 | 185 |
| 612 | 3300036401 | Ga0373937_0370931 | Ga0373937_0370931_215_943 | 185 |
| 613 | 3300036401 | Ga0373937_0621877 | Ga0373937_0621877_51_806 | 185 |
| 614 | 3300036647 | Ga0316582_0001739 | Ga0316582_0001739_965_1669 | 185 |
| 615 | 3300036712 | Ga0316584_0074177 | Ga0316584_0074177_886_1590 | 185 |
| 616 | 3300037068 | Ga0373925_0004904 | Ga0373925_0004904_5179_5913 | 185 |
| 617 | 3300037068 | Ga0373925_0026384 | Ga0373925_0026384_990_1751 | 185 |
| 618 | 3300037068 | Ga0373925_0184682 | Ga0373925_0184682_537_1283 | 185 |
| 619 | 3300037068 | Ga0373925_0579745 | Ga0373925_0579745_17_787 | 185 |
| 620 | 3300037588 | Ga0316581_0004698 | Ga0316581_0004698_1284_1988 | 185 |
| 621 | 3300039438 | Ga0436360_0630722 | Ga0436360_0630722_213_959 | 185 |
| 622 | 3300042001 | Ga0439441_001149 | Ga0439441_001149_2149_2913 | 185 |
| 623 | 3300042876 | Ga0451577_0332306 | Ga0451577_0332306_537_1193 | 185 |
| 624 | 3300045051 | Ga0451576_0341727 | Ga0451576_0341727_31_807 | 185 |
| 625 | 3300045976 | Ga0466967_0088205 | Ga0466967_0088205_1433_2173 | 185 |
| 626 | 3300046454 | Ga0495592_0006145 | Ga0495592_0006145_923_1681 | 185 |
| 627 | 3300046454 | Ga0495592_0101693 | Ga0495592_0101693_441_1202 | 185 |
| 628 | 3300046459 | Ga0495629_0026784 | Ga0495629_0026784_1016_1750 | 185 |
| 629 | 3300046462 | Ga0495651_0000147 | Ga0495651_0000147_14641_15393 | 185 |
| 630 | 3300046462 | Ga0495651_0063793 | Ga0495651_0063793_227_988 | 185 |
| 631 | 3300046463 | Ga0495653_0066795 | Ga0495653_0066795_924_1685 | 185 |
| 632 | 3300046472 | Ga0495580_0033392 | Ga0495580_0033392_2490_3224 | 185 |
| 633 | 3300046472 | Ga0495580_0051240 | Ga0495580_0051240_197_958 | 185 |
| 634 | 3300046472 | Ga0495580_0200060 | Ga0495580_0200060_587_1327 | 185 |
| 635 | 3300046473 | Ga0495582_0003373 | Ga0495582_0003373_2343_3077 | 185 |
| 636 | 3300046475 | Ga0495639_0009650 | Ga0495639_0009650_1831_2592 | 185 |
| 637 | 3300046476 | Ga0495662_0008253 | Ga0495662_0008253_2148_2882 | 185 |
| 638 | 3300046476 | Ga0495662_0082379 | Ga0495662_0082379_79_840 | 185 |
| 639 | 3300046511 | Ga0495608_0021304 | Ga0495608_0021304_2166_2927 | 185 |
| 640 | 3300046514 | Ga0495618_0036328 | Ga0495618_0036328_2019_2780 | 185 |
| 641 | 3300046516 | Ga0495628_0112374 | Ga0495628_0112374_1284_2045 | 185 |
| 642 | 3300046517 | Ga0495630_0012562 | Ga0495630_0012562_4390_5151 | 185 |
| 643 | 3300046523 | Ga0495644_0086736 | Ga0495644_0086736_129_911 | 185 |
| 644 | 3300046526 | Ga0495666_0025398 | Ga0495666_0025398_641_1402 | 185 |
| 645 | 3300046531 | Ga0495665_0016589 | Ga0495665_0016589_1222_1956 | 185 |
| 646 | 3300046531 | Ga0495665_0026322 | Ga0495665_0026322_2192_2953 | 185 |
| 647 | 3300046533 | Ga0495640_0019306 | Ga0495640_0019306_3212_3973 | 185 |
| 648 | 3300046535 | Ga0495586_0030083 | Ga0495586_0030083_677_1438 | 185 |
| 649 | 3300046536 | Ga0495587_0036403 | Ga0495587_0036403_1523_2284 | 185 |
| 650 | 3300046539 | Ga0495621_0001797 | Ga0495621_0001797_1088_1825 | 185 |
| 651 | 3300046539 | Ga0495621_0034073 | Ga0495621_0034073_619_1377 | 185 |
| 652 | 3300046543 | Ga0495645_0095337 | Ga0495645_0095337_787_1545 | 185 |
| 653 | 3300046543 | Ga0495645_0258987 | Ga0495645_0258987_158_916 | 185 |
| 654 | 3300046559 | Ga0495667_0062293 | Ga0495667_0062293_860_1621 | 185 |
| 655 | 3300046559 | Ga0495667_0152022 | Ga0495667_0152022_392_1174 | 185 |
| 656 | 3300046559 | Ga0495667_0273402 | Ga0495667_0273402_155_907 | 185 |
| 657 | 3300046642 | Ga0495634_0016550 | Ga0495634_0016550_1624_2385 | 185 |
| 658 | 3300046663 | Ga0495635_0019881 | Ga0495635_0019881_1396_2130 | 185 |
| 659 | 3300046664 | Ga0495659_0035892 | Ga0495659_0035892_287_1024 | 185 |
| 660 | 3300046664 | Ga0495659_0052397 | Ga0495659_0052397_656_1417 | 185 |
| 661 | 3300046664 | Ga0495659_0076928 | Ga0495659_0076928_368_1156 | 185 |
| 662 | 3300046674 | Ga0495588_0255943 | Ga0495588_0255943_28_762 | 185 |
| 663 | 3300046678 | Ga0495599_0002850 | Ga0495599_0002850_2395_3153 | 185 |
| 664 | 3300046678 | Ga0495599_0078691 | Ga0495599_0078691_73_834 | 185 |
| 665 | 3300046678 | Ga0495599_0190062 | Ga0495599_0190062_306_1067 | 185 |
| 666 | 3300046678 | Ga0495599_0288611 | Ga0495599_0288611_51_809 | 185 |
| 667 | 3300046680 | Ga0495646_0064942 | Ga0495646_0064942_502_1263 | 185 |
| 668 | 3300046681 | Ga0495647_0020484 | Ga0495647_0020484_1384_2118 | 185 |
| 669 | 3300046681 | Ga0495647_0022948 | Ga0495647_0022948_821_1582 | 185 |
| 670 | 3300046683 | Ga0495658_0138164 | Ga0495658_0138164_677_1438 | 185 |
| 671 | 3300046684 | Ga0495669_0001556 | Ga0495669_0001556_8112_8873 | 185 |
| 672 | 3300046689 | Ga0495613_0135864 | Ga0495613_0135864_238_972 | 185 |
| 673 | 3300046690 | Ga0495624_0360363 | Ga0495624_0360363_59_820 | 185 |
| 674 | 3300046809 | Ga0495600_0096519 | Ga0495600_0096519_127_861 | 185 |
| 675 | 3300046809 | Ga0495600_0119092 | Ga0495600_0119092_626_1387 | 185 |
| 676 | 3300047315 | Ga0495581_0005184 | Ga0495581_0005184_6642_7376 | 185 |
| 677 | 3300047317 | Ga0495604_0021442 | Ga0495604_0021442_3212_3973 | 185 |
| 678 | 3300047317 | Ga0495604_0265562 | Ga0495604_0265562_77_859 | 185 |
| 679 | 3300047319 | Ga0495674_0001483 | Ga0495674_0001483_20576_21337 | 185 |
| 680 | 3300047319 | Ga0495674_0254966 | Ga0495674_0254966_479_1213 | 185 |
| 681 | 3300047322 | Ga0495680_0047561 | Ga0495680_0047561_1893_2627 | 185 |
| 682 | 3300047322 | Ga0495680_0070786 | Ga0495680_0070786_1220_1981 | 185 |
| 683 | 3300047444 | Ga0495675_0029189 | Ga0495675_0029189_1931_2692 | 185 |
| 684 | 3300047445 | Ga0495677_0061459 | Ga0495677_0061459_169_906 | 185 |
| 685 | 3300047471 | Ga0495684_0003095 | Ga0495684_0003095_4784_5518 | 185 |
| 686 | 3300047471 | Ga0495684_0035081 | Ga0495684_0035081_677_1438 | 185 |
| 687 | 3300048089 | Ga0495614_0023180 | Ga0495614_0023180_1221_1955 | 185 |
| 688 | 3300048904 | Ga0496101_0062341 | Ga0496101_0062341_964_1704 | 185 |
| 689 | 3300048905 | Ga0496102_0024025 | Ga0496102_0024025_779_1498 | 185 |
| 690 | 3300048905 | Ga0496102_0366345 | Ga0496102_0366345_436_1173 | 185 |
| 691 | 3300048906 | Ga0496103_0046418 | Ga0496103_0046418_1277_1996 | 185 |
| 692 | 3300048907 | Ga0496104_0044131 | Ga0496104_0044131_40_780 | 185 |
| 693 | 3300048908 | Ga0496105_0030331 | Ga0496105_0030331_573_1313 | 185 |
| 694 | 3300048908 | Ga0496105_0504022 | Ga0496105_0504022_220_930 | 185 |
| 695 | 3300048911 | Ga0496108_0260105 | Ga0496108_0260105_718_1437 | 185 |
| 696 | 3300048912 | Ga0496109_0014328 | Ga0496109_0014328_4758_5498 | 185 |
| 697 | 3300048915 | Ga0496112_0024796 | Ga0496112_0024796_2859_3599 | 185 |
| 698 | 3300048918 | Ga0496115_0007599 | Ga0496115_0007599_571_1311 | 185 |
| 699 | 3300049569 | Ga0501032_0124299 | Ga0501032_0124299_538_1275 | 185 |
| 700 | 3300049576 | Ga0501040_0051112 | Ga0501040_0051112_1458_2198 | 185 |
| 701 | 3300049577 | Ga0501041_0127200 | Ga0501041_0127200_233_973 | 185 |
| 702 | 3300049578 | Ga0501042_0106829 | Ga0501042_0106829_480_1220 | 185 |
| 703 | 3300049582 | Ga0501048_0066364 | Ga0501048_0066364_1202_1942 | 185 |
| 704 | 3300049583 | Ga0501067_0064566 | Ga0501067_0064566_806_1537 | 185 |
| 705 | 3300049584 | Ga0501068_0259125 | Ga0501068_0259125_236_973 | 185 |
| 706 | 3300049584 | Ga0501068_0387592 | Ga0501068_0387592_94_840 | 185 |
| 707 | 3300049588 | Ga0501072_0024303 | Ga0501072_0024303_1059_1799 | 185 |
| 708 | 3300049589 | Ga0501073_0112644 | Ga0501073_0112644_583_1332 | 185 |
| 709 | 3300049589 | Ga0501073_0204014 | Ga0501073_0204014_174_911 | 185 |
| 710 | 3300049589 | Ga0501073_0225856 | Ga0501073_0225856_22_753 | 185 |
| 711 | 3300049589 | Ga0501073_0435878 | Ga0501073_0435878_54_791 | 185 |
| 712 | 3300049590 | Ga0501074_0308324 | Ga0501074_0308324_190_930 | 185 |
| 713 | 3300049591 | Ga0501075_0076795 | Ga0501075_0076795_1304_2044 | 185 |
| 714 | 3300049592 | Ga0501076_0197232 | Ga0501076_0197232_474_1211 | 185 |
| 715 | 3300049741 | Ga0501079_0273390 | Ga0501079_0273390_398_1138 | 185 |
| 716 | 3300049742 | Ga0501080_0005591 | Ga0501080_0005591_7443_8174 | 185 |
| 717 | 3300049742 | Ga0501080_0160598 | Ga0501080_0160598_609_1358 | 185 |
| 718 | 3300049742 | Ga0501080_0505417 | Ga0501080_0505417_94_840 | 185 |
| 719 | 3300049743 | Ga0501081_0516298 | Ga0501081_0516298_115_876 | 185 |
| 720 | 3300049744 | Ga0501083_0072187 | Ga0501083_0072187_854_1585 | 185 |
| 721 | 3300050493 | nmdc:mga0k408_45152_c1 | nmdc:mga0k408_45152_c1_1456_2181 | 185 |
| 722 | 3300050507 | nmdc:mga05p37_117008_c1 | nmdc:mga05p37_117008_c1_558_1316 | 185 |
| 723 | 3300050507 | nmdc:mga05p37_530143_c1 | nmdc:mga05p37_530143_c1_11_793 | 185 |
| 724 | 3300050509 | nmdc:mga0qj67_11958_c1 | nmdc:mga0qj67_11958_c1_4535_5281 | 185 |
| 725 | 3300050510 | nmdc:mga06r32_100679_c1 | nmdc:mga06r32_100679_c1_352_1098 | 185 |
| 726 | 3300050512 | nmdc:mga0n895_395993_c1 | nmdc:mga0n895_395993_c1_430_1170 | 185 |
| 727 | 3300050513 | nmdc:mga0rr50_540422_c1 | nmdc:mga0rr50_540422_c1_208_954 | 185 |
| 728 | 3300050514 | nmdc:mga08x19_11429_c1 | nmdc:mga08x19_11429_c1_871_1653 | 185 |
| 729 | 3300050514 | nmdc:mga08x19_76111_c1 | nmdc:mga08x19_76111_c1_847_1593 | 185 |
| 730 | 3300050514 | nmdc:mga08x19_8923_c1 | nmdc:mga08x19_8923_c1_1370_2116 | 185 |
| 731 | 3300050514 | nmdc:mga08x19_98944_c1 | nmdc:mga08x19_98944_c1_1037_1825 | 185 |
| 732 | 3300050515 | nmdc:mga0a205_20705_c1 | nmdc:mga0a205_20705_c1_4019_4810 | 185 |
| 733 | 3300050515 | nmdc:mga0a205_249303_c1 | nmdc:mga0a205_249303_c1_216_935 | 185 |
| 734 | 3300050515 | nmdc:mga0a205_269131_c1 | nmdc:mga0a205_269131_c1_114_890 | 185 |
| 735 | 3300050516 | nmdc:mga0sz30_4945_c2 | nmdc:mga0sz30_4945_c2_178_903 | 185 |
| 736 | 3300053077 | Ga0495601_0103821 | Ga0495601_0103821_184_942 | 185 |
| 737 | 3300053077 | Ga0495601_0125927 | Ga0495601_0125927_197_937 | 185 |
| 738 | 3300053078 | Ga0495612_0029406 | Ga0495612_0029406_583_1317 | 185 |
| 739 | 3300053085 | Ga0495619_0001795 | Ga0495619_0001795_3587_4321 | 185 |
| 740 | 3300053085 | Ga0495619_0213466 | Ga0495619_0213466_453_1214 | 185 |
| 741 | 3300054114 | Ga0501084_0054978 | Ga0501084_0054978_2086_2817 | 185 |
| 742 | 3300060353 | Ga0501082_0278701 | Ga0501082_0278701_698_1438 | 185 |
| 743 | 3300060353 | Ga0501082_0610324 | Ga0501082_0610324_52_792 | 185 |
| 744 | 3300061734 | Ga0530510_0150261 | Ga0530510_0150261_879_1619 | 185 |
| 745 | 3300005327 | Ga0070658_10052176 | Ga0070658_100521764 | 186 |
| 746 | 3300005327 | Ga0070658_10094661 | Ga0070658_100946612 | 186 |
| 747 | 3300005328 | Ga0070676_10000720 | Ga0070676_100007203 | 186 |
| 748 | 3300005328 | Ga0070676_10089817 | Ga0070676_100898172 | 186 |
| 749 | 3300005329 | Ga0070683_100009972 | Ga0070683_1000099722 | 186 |
| 750 | 3300005333 | Ga0070677_10000176 | Ga0070677_100001764 | 186 |
| 751 | 3300005334 | Ga0068869_100015651 | Ga0068869_1000156512 | 186 |
| 752 | 3300005335 | Ga0070666_10004430 | Ga0070666_100044306 | 186 |
| 753 | 3300005335 | Ga0070666_10342570 | Ga0070666_103425701 | 186 |
| 754 | 3300005336 | Ga0070680_100059536 | Ga0070680_1000595363 | 186 |
| 755 | 3300005336 | Ga0070680_100092482 | Ga0070680_1000924823 | 186 |
| 756 | 3300005336 | Ga0070680_100251821 | Ga0070680_1002518211 | 186 |
| 757 | 3300005338 | Ga0068868_100032969 | Ga0068868_1000329693 | 186 |
| 758 | 3300005338 | Ga0068868_100501601 | Ga0068868_1005016012 | 186 |
| 759 | 3300005339 | Ga0070660_100022454 | Ga0070660_1000224546 | 186 |
| 760 | 3300005339 | Ga0070660_100035368 | Ga0070660_1000353685 | 186 |
| 761 | 3300005339 | Ga0070660_100051098 | Ga0070660_1000510985 | 186 |
| 762 | 3300005339 | Ga0070660_100065183 | Ga0070660_1000651833 | 186 |
| 763 | 3300005339 | Ga0070660_100748472 | Ga0070660_1007484721 | 186 |
| 764 | 3300005344 | Ga0070661_100000392 | Ga0070661_1000003928 | 186 |
| 765 | 3300005344 | Ga0070661_100010044 | Ga0070661_1000100443 | 186 |
| 766 | 3300005344 | Ga0070661_100209476 | Ga0070661_1002094762 | 186 |
| 767 | 3300005347 | Ga0070668_100005934 | Ga0070668_1000059347 | 186 |
| 768 | 3300005347 | Ga0070668_100008423 | Ga0070668_1000084237 | 186 |
| 769 | 3300005347 | Ga0070668_100345214 | Ga0070668_1003452141 | 186 |
| 770 | 3300005353 | Ga0070669_100016656 | Ga0070669_1000166564 | 186 |
| 771 | 3300005353 | Ga0070669_100040659 | Ga0070669_1000406594 | 186 |
| 772 | 3300005354 | Ga0070675_100001602 | Ga0070675_10000160211 | 186 |
| 773 | 3300005355 | Ga0070671_100002715 | Ga0070671_10000271510 | 186 |
| 774 | 3300005355 | Ga0070671_100018138 | Ga0070671_1000181383 | 186 |
| 775 | 3300005355 | Ga0070671_100018963 | Ga0070671_1000189635 | 186 |
| 776 | 3300005355 | Ga0070671_100463760 | Ga0070671_1004637601 | 186 |
| 777 | 3300005356 | Ga0070674_100003479 | Ga0070674_1000034794 | 186 |
| 778 | 3300005356 | Ga0070674_100100440 | Ga0070674_1001004402 | 186 |
| 779 | 3300005364 | Ga0070673_100008335 | Ga0070673_1000083356 | 186 |
| 780 | 3300005366 | Ga0070659_100001691 | Ga0070659_1000016918 | 186 |
| 781 | 3300005366 | Ga0070659_100014688 | Ga0070659_1000146886 | 186 |
| 782 | 3300005366 | Ga0070659_100019730 | Ga0070659_1000197303 | 186 |
| 783 | 3300005366 | Ga0070659_100154620 | Ga0070659_1001546202 | 186 |
| 784 | 3300005367 | Ga0070667_100024663 | Ga0070667_1000246635 | 186 |
| 785 | 3300005367 | Ga0070667_100068550 | Ga0070667_1000685503 | 186 |
| 786 | 3300005435 | Ga0070714_100082256 | Ga0070714_1000822561 | 186 |
| 787 | 3300005435 | Ga0070714_100507553 | Ga0070714_1005075532 | 186 |
| 788 | 3300005436 | Ga0070713_100311904 | Ga0070713_1003119041 | 186 |
| 789 | 3300005455 | Ga0070663_100004256 | Ga0070663_1000042567 | 186 |
| 790 | 3300005455 | Ga0070663_100011572 | Ga0070663_1000115725 | 186 |
| 791 | 3300005455 | Ga0070663_100015849 | Ga0070663_1000158493 | 186 |
| 792 | 3300005456 | Ga0070678_100003106 | Ga0070678_1000031067 | 186 |
| 793 | 3300005457 | Ga0070662_100000258 | Ga0070662_10000025825 | 186 |
| 794 | 3300005458 | Ga0070681_10010817 | Ga0070681_100108177 | 186 |
| 795 | 3300005458 | Ga0070681_10062579 | Ga0070681_100625793 | 186 |
| 796 | 3300005458 | Ga0070681_10217935 | Ga0070681_102179353 | 186 |
| 797 | 3300005530 | Ga0070679_100016516 | Ga0070679_1000165169 | 186 |
| 798 | 3300005530 | Ga0070679_100418954 | Ga0070679_1004189541 | 186 |
| 799 | 3300005535 | Ga0070684_100008702 | Ga0070684_1000087026 | 186 |
| 800 | 3300005535 | Ga0070684_100539613 | Ga0070684_1005396131 | 186 |
| 801 | 3300005539 | Ga0068853_100006431 | Ga0068853_10000643111 | 186 |
| 802 | 3300005539 | Ga0068853_100018619 | Ga0068853_1000186198 | 186 |
| 803 | 3300005539 | Ga0068853_100261074 | Ga0068853_1002610742 | 186 |
| 804 | 3300005543 | Ga0070672_100004013 | Ga0070672_1000040139 | 186 |
| 805 | 3300005543 | Ga0070672_100354377 | Ga0070672_1003543771 | 186 |
| 806 | 3300005548 | Ga0070665_100011282 | Ga0070665_1000112826 | 186 |
| 807 | 3300005548 | Ga0070665_100050831 | Ga0070665_1000508314 | 186 |
| 808 | 3300005563 | Ga0068855_100004105 | Ga0068855_1000041056 | 186 |
| 809 | 3300005563 | Ga0068855_100014652 | Ga0068855_1000146527 | 186 |
| 810 | 3300005563 | Ga0068855_100588915 | Ga0068855_1005889151 | 186 |
| 811 | 3300005564 | Ga0070664_100000205 | Ga0070664_10000020519 | 186 |
| 812 | 3300005564 | Ga0070664_100005036 | Ga0070664_1000050369 | 186 |
| 813 | 3300005564 | Ga0070664_100005978 | Ga0070664_1000059783 | 186 |
| 814 | 3300005564 | Ga0070664_100015089 | Ga0070664_1000150893 | 186 |
| 815 | 3300005577 | Ga0068857_100000227 | Ga0068857_10000022724 | 186 |
| 816 | 3300005577 | Ga0068857_100235164 | Ga0068857_1002351642 | 186 |
| 817 | 3300005578 | Ga0068854_100002346 | Ga0068854_10000234614 | 186 |
| 818 | 3300005578 | Ga0068854_100059470 | Ga0068854_1000594703 | 186 |
| 819 | 3300005578 | Ga0068854_100105681 | Ga0068854_1001056813 | 186 |
| 820 | 3300005614 | Ga0068856_100000487 | Ga0068856_10000048723 | 186 |
| 821 | 3300005614 | Ga0068856_100002909 | Ga0068856_10000290913 | 186 |
| 822 | 3300005614 | Ga0068856_100008422 | Ga0068856_1000084227 | 186 |
| 823 | 3300005616 | Ga0068852_100017243 | Ga0068852_1000172436 | 186 |
| 824 | 3300005616 | Ga0068852_100021228 | Ga0068852_1000212282 | 186 |
| 825 | 3300005616 | Ga0068852_100026372 | Ga0068852_1000263724 | 186 |
| 826 | 3300005616 | Ga0068852_100215500 | Ga0068852_1002155002 | 186 |
| 827 | 3300005617 | Ga0068859_100063145 | Ga0068859_1000631452 | 186 |
| 828 | 3300005617 | Ga0068859_100103497 | Ga0068859_1001034973 | 186 |
| 829 | 3300005618 | Ga0068864_100041129 | Ga0068864_1000411292 | 186 |
| 830 | 3300005834 | Ga0068851_10008483 | Ga0068851_100084833 | 186 |
| 831 | 3300005834 | Ga0068851_10169839 | Ga0068851_101698392 | 186 |
| 832 | 3300005841 | Ga0068863_100021276 | Ga0068863_1000212763 | 186 |
| 833 | 3300005841 | Ga0068863_100064043 | Ga0068863_1000640433 | 186 |
| 834 | 3300005841 | Ga0068863_100355828 | Ga0068863_1003558282 | 186 |
| 835 | 3300005841 | Ga0068863_100397998 | Ga0068863_1003979982 | 186 |
| 836 | 3300005842 | Ga0068858_100011707 | Ga0068858_1000117074 | 186 |
| 837 | 3300005842 | Ga0068858_100058849 | Ga0068858_1000588493 | 186 |
| 838 | 3300005842 | Ga0068858_100302759 | Ga0068858_1003027592 | 186 |
| 839 | 3300005843 | Ga0068860_100058232 | Ga0068860_1000582324 | 186 |
| 840 | 3300005843 | Ga0068860_100147698 | Ga0068860_1001476982 | 186 |
| 841 | 3300005843 | Ga0068860_100247948 | Ga0068860_1002479482 | 186 |
| 842 | 3300005844 | Ga0068862_100008122 | Ga0068862_1000081222 | 186 |
| 843 | 3300006237 | Ga0097621_100004081 | Ga0097621_1000040813 | 186 |
| 844 | 3300006237 | Ga0097621_100049002 | Ga0097621_1000490022 | 186 |
| 845 | 3300006237 | Ga0097621_100200592 | Ga0097621_1002005923 | 186 |
| 846 | 3300006358 | Ga0068871_100076662 | Ga0068871_1000766622 | 186 |
| 847 | 3300006881 | Ga0068865_100010875 | Ga0068865_1000108752 | 186 |
| 848 | 3300006881 | Ga0068865_100021906 | Ga0068865_1000219061 | 186 |
| 849 | 3300006931 | Ga0097620_100063145 | Ga0097620_1000631452 | 186 |
| 850 | 3300006931 | Ga0097620_100103500 | Ga0097620_1001035003 | 186 |
| 851 | 3300009093 | Ga0105240_10004875 | Ga0105240_1000487510 | 186 |
| 852 | 3300009093 | Ga0105240_10030167 | Ga0105240_100301673 | 186 |
| 853 | 3300009093 | Ga0105240_10180712 | Ga0105240_101807123 | 186 |
| 854 | 3300009174 | Ga0105241_10002581 | Ga0105241_100025813 | 186 |
| 855 | 3300009177 | Ga0105248_10001222 | Ga0105248_100012222 | 186 |
| 856 | 3300009177 | Ga0105248_10118063 | Ga0105248_101180632 | 186 |
| 857 | 3300009545 | Ga0105237_10030227 | Ga0105237_100302277 | 186 |
| 858 | 3300009545 | Ga0105237_10192631 | Ga0105237_101926313 | 186 |
| 859 | 3300009551 | Ga0105238_10003371 | Ga0105238_1000337110 | 186 |
| 860 | 3300009551 | Ga0105238_10007349 | Ga0105238_100073491 | 186 |
| 861 | 3300010375 | Ga0105239_10015966 | Ga0105239_100159669 | 186 |
| 862 | 3300013100 | Ga0157373_10003392 | Ga0157373_1000339210 | 186 |
| 863 | 3300013100 | Ga0157373_10077134 | Ga0157373_100771343 | 186 |
| 864 | 3300013100 | Ga0157373_10143650 | Ga0157373_101436502 | 186 |
| 865 | 3300013102 | Ga0157371_10000365 | Ga0157371_1000036527 | 186 |
| 866 | 3300013102 | Ga0157371_10037810 | Ga0157371_100378104 | 186 |
| 867 | 3300013104 | Ga0157370_10005373 | Ga0157370_1000537315 | 186 |
| 868 | 3300013104 | Ga0157370_10023445 | Ga0157370_100234457 | 186 |
| 869 | 3300013104 | Ga0157370_10025827 | Ga0157370_100258278 | 186 |
| 870 | 3300013105 | Ga0157369_10009942 | Ga0157369_1000994210 | 186 |
| 871 | 3300013105 | Ga0157369_10013881 | Ga0157369_100138817 | 186 |
| 872 | 3300013296 | Ga0157374_10026374 | Ga0157374_100263747 | 186 |
| 873 | 3300013296 | Ga0157374_10032245 | Ga0157374_100322455 | 186 |
| 874 | 3300013306 | Ga0163162_10334504 | Ga0163162_103345042 | 186 |
| 875 | 3300013307 | Ga0157372_10002696 | Ga0157372_1000269616 | 186 |
| 876 | 3300013307 | Ga0157372_10008257 | Ga0157372_100082577 | 186 |
| 877 | 3300013307 | Ga0157372_10120174 | Ga0157372_101201743 | 186 |
| 878 | 3300013307 | Ga0157372_10196365 | Ga0157372_101963651 | 186 |
| 879 | 3300013307 | Ga0157372_10476520 | Ga0157372_104765202 | 186 |
| 880 | 3300013308 | Ga0157375_10001841 | Ga0157375_100018418 | 186 |
| 881 | 3300013308 | Ga0157375_10329658 | Ga0157375_103296582 | 186 |
| 882 | 3300014325 | Ga0163163_10215629 | Ga0163163_102156291 | 186 |
| 883 | 3300014326 | Ga0157380_10189881 | Ga0157380_101898813 | 186 |
| 884 | 3300014326 | Ga0157380_10729053 | Ga0157380_107290531 | 186 |
| 885 | 3300014497 | Ga0182008_10213145 | Ga0182008_102131451 | 186 |
| 886 | 3300014968 | Ga0157379_10122144 | Ga0157379_101221443 | 186 |
| 887 | 3300014969 | Ga0157376_10300112 | Ga0157376_103001122 | 186 |
| 888 | 3300014969 | Ga0157376_11046862 | Ga0157376_110468621 | 186 |
| 889 | 3300020070 | Ga0206356_10482904 | Ga0206356_104829042 | 186 |
| 890 | 3300020081 | Ga0206354_10403941 | Ga0206354_104039411 | 186 |
| 891 | 3300025315 | Ga0207697_10010410 | Ga0207697_100104102 | 186 |
| 892 | 3300025321 | Ga0207656_10012105 | Ga0207656_100121053 | 186 |
| 893 | 3300025893 | Ga0207682_10000108 | Ga0207682_1000010825 | 186 |
| 894 | 3300025903 | Ga0207680_10047056 | Ga0207680_100470563 | 186 |
| 895 | 3300025903 | Ga0207680_10181891 | Ga0207680_101818912 | 186 |
| 896 | 3300025907 | Ga0207645_10001398 | Ga0207645_1000139813 | 186 |
| 897 | 3300025907 | Ga0207645_10031124 | Ga0207645_100311242 | 186 |
| 898 | 3300025907 | Ga0207645_10037379 | Ga0207645_100373793 | 186 |
| 899 | 3300025909 | Ga0207705_10010774 | Ga0207705_100107748 | 186 |
| 900 | 3300025909 | Ga0207705_10086078 | Ga0207705_100860782 | 186 |
| 901 | 3300025909 | Ga0207705_10127628 | Ga0207705_101276281 | 186 |
| 902 | 3300025912 | Ga0207707_10004480 | Ga0207707_1000448013 | 186 |
| 903 | 3300025912 | Ga0207707_10006896 | Ga0207707_100068968 | 186 |
| 904 | 3300025913 | Ga0207695_10037513 | Ga0207695_100375137 | 186 |
| 905 | 3300025914 | Ga0207671_10474438 | Ga0207671_104744382 | 186 |
| 906 | 3300025917 | Ga0207660_10186994 | Ga0207660_101869943 | 186 |
| 907 | 3300025917 | Ga0207660_10359882 | Ga0207660_103598821 | 186 |
| 908 | 3300025917 | Ga0207660_10679457 | Ga0207660_106794571 | 186 |
| 909 | 3300025919 | Ga0207657_10000967 | Ga0207657_1000096722 | 186 |
| 910 | 3300025919 | Ga0207657_10001126 | Ga0207657_1000112616 | 186 |
| 911 | 3300025919 | Ga0207657_10012659 | Ga0207657_100126592 | 186 |
| 912 | 3300025919 | Ga0207657_10061779 | Ga0207657_100617791 | 186 |
| 913 | 3300025919 | Ga0207657_10072164 | Ga0207657_100721643 | 186 |
| 914 | 3300025919 | Ga0207657_10148115 | Ga0207657_101481152 | 186 |
| 915 | 3300025920 | Ga0207649_10002455 | Ga0207649_100024557 | 186 |
| 916 | 3300025920 | Ga0207649_10008201 | Ga0207649_100082016 | 186 |
| 917 | 3300025920 | Ga0207649_10010946 | Ga0207649_100109462 | 186 |
| 918 | 3300025921 | Ga0207652_10009099 | Ga0207652_100090998 | 186 |
| 919 | 3300025921 | Ga0207652_10098654 | Ga0207652_100986541 | 186 |
| 920 | 3300025921 | Ga0207652_10914487 | Ga0207652_109144871 | 186 |
| 921 | 3300025923 | Ga0207681_10038557 | Ga0207681_100385574 | 186 |
| 922 | 3300025924 | Ga0207694_10009032 | Ga0207694_100090327 | 186 |
| 923 | 3300025924 | Ga0207694_10025337 | Ga0207694_100253376 | 186 |
| 924 | 3300025926 | Ga0207659_10005193 | Ga0207659_100051936 | 186 |
| 925 | 3300025929 | Ga0207664_10017700 | Ga0207664_100177002 | 186 |
| 926 | 3300025929 | Ga0207664_10063613 | Ga0207664_100636134 | 186 |
| 927 | 3300025931 | Ga0207644_10001357 | Ga0207644_1000135716 | 186 |
| 928 | 3300025931 | Ga0207644_10008526 | Ga0207644_100085264 | 186 |
| 929 | 3300025931 | Ga0207644_10014361 | Ga0207644_100143616 | 186 |
| 930 | 3300025932 | Ga0207690_10000438 | Ga0207690_1000043816 | 186 |
| 931 | 3300025932 | Ga0207690_10013514 | Ga0207690_100135146 | 186 |
| 932 | 3300025932 | Ga0207690_10098419 | Ga0207690_100984193 | 186 |
| 933 | 3300025933 | Ga0207706_10000024 | Ga0207706_10000024122 | 186 |
| 934 | 3300025940 | Ga0207691_10000144 | Ga0207691_1000014423 | 186 |
| 935 | 3300025940 | Ga0207691_10008753 | Ga0207691_100087534 | 186 |
| 936 | 3300025940 | Ga0207691_10094234 | Ga0207691_100942343 | 186 |
| 937 | 3300025941 | Ga0207711_10102642 | Ga0207711_101026422 | 186 |
| 938 | 3300025942 | Ga0207689_10141071 | Ga0207689_101410712 | 186 |
| 939 | 3300025944 | Ga0207661_10259481 | Ga0207661_102594813 | 186 |
| 940 | 3300025945 | Ga0207679_10001794 | Ga0207679_100017947 | 186 |
| 941 | 3300025945 | Ga0207679_10097694 | Ga0207679_100976942 | 186 |
| 942 | 3300025945 | Ga0207679_10343364 | Ga0207679_103433642 | 186 |
| 943 | 3300025949 | Ga0207667_10000980 | Ga0207667_100009807 | 186 |
| 944 | 3300025949 | Ga0207667_10007573 | Ga0207667_100075733 | 186 |
| 945 | 3300025949 | Ga0207667_10046426 | Ga0207667_100464262 | 186 |
| 946 | 3300025949 | Ga0207667_10318087 | Ga0207667_103180872 | 186 |
| 947 | 3300025949 | Ga0207667_10406588 | Ga0207667_104065882 | 186 |
| 948 | 3300025960 | Ga0207651_10007030 | Ga0207651_100070307 | 186 |
| 949 | 3300025960 | Ga0207651_10011598 | Ga0207651_100115985 | 186 |
| 950 | 3300025972 | Ga0207668_10004592 | Ga0207668_100045926 | 186 |
| 951 | 3300025972 | Ga0207668_10061869 | Ga0207668_100618693 | 186 |
| 952 | 3300025981 | Ga0207640_10010488 | Ga0207640_100104881 | 186 |
| 953 | 3300025981 | Ga0207640_10298455 | Ga0207640_102984551 | 186 |
| 954 | 3300025981 | Ga0207640_10329236 | Ga0207640_103292362 | 186 |
| 955 | 3300025986 | Ga0207658_10008828 | Ga0207658_100088284 | 186 |
| 956 | 3300025986 | Ga0207658_10055769 | Ga0207658_100557693 | 186 |
| 957 | 3300026023 | Ga0207677_10001890 | Ga0207677_100018908 | 186 |
| 958 | 3300026035 | Ga0207703_10048950 | Ga0207703_100489505 | 186 |
| 959 | 3300026035 | Ga0207703_10167918 | Ga0207703_101679182 | 186 |
| 960 | 3300026041 | Ga0207639_10006632 | Ga0207639_100066327 | 186 |
| 961 | 3300026041 | Ga0207639_10017248 | Ga0207639_100172483 | 186 |
| 962 | 3300026041 | Ga0207639_10085831 | Ga0207639_100858312 | 186 |
| 963 | 3300026041 | Ga0207639_10844219 | Ga0207639_108442191 | 186 |
| 964 | 3300026067 | Ga0207678_10003863 | Ga0207678_100038636 | 186 |
| 965 | 3300026067 | Ga0207678_10009576 | Ga0207678_100095763 | 186 |
| 966 | 3300026067 | Ga0207678_10039015 | Ga0207678_100390153 | 186 |
| 967 | 3300026078 | Ga0207702_10002130 | Ga0207702_100021306 | 186 |
| 968 | 3300026078 | Ga0207702_10004791 | Ga0207702_100047913 | 186 |
| 969 | 3300026078 | Ga0207702_10077972 | Ga0207702_100779722 | 186 |
| 970 | 3300026078 | Ga0207702_10926893 | Ga0207702_109268931 | 186 |
| 971 | 3300026088 | Ga0207641_10032926 | Ga0207641_100329266 | 186 |
| 972 | 3300026088 | Ga0207641_10207146 | Ga0207641_102071462 | 186 |
| 973 | 3300026089 | Ga0207648_10001220 | Ga0207648_100012204 | 186 |
| 974 | 3300026089 | Ga0207648_10091378 | Ga0207648_100913783 | 186 |
| 975 | 3300026095 | Ga0207676_10007930 | Ga0207676_100079306 | 186 |
| 976 | 3300026095 | Ga0207676_10092852 | Ga0207676_100928523 | 186 |
| 977 | 3300026116 | Ga0207674_10000520 | Ga0207674_1000052020 | 186 |
| 978 | 3300026116 | Ga0207674_10000883 | Ga0207674_100008836 | 186 |
| 979 | 3300026118 | Ga0207675_100401530 | Ga0207675_1004015302 | 186 |
| 980 | 3300026121 | Ga0207683_10000180 | Ga0207683_1000018025 | 186 |
| 981 | 3300026142 | Ga0207698_10000855 | Ga0207698_100008559 | 186 |
| 982 | 3300026142 | Ga0207698_10007717 | Ga0207698_100077176 | 186 |
| 983 | 3300026142 | Ga0207698_10011203 | Ga0207698_100112032 | 186 |
| 984 | 3300026142 | Ga0207698_10017392 | Ga0207698_100173923 | 186 |
| 985 | 3300027876 | Ga0209974_10003824 | Ga0209974_100038242 | 186 |
| 986 | 3300028379 | Ga0268266_10004772 | Ga0268266_100047729 | 186 |
| 987 | 3300028379 | Ga0268266_10431608 | Ga0268266_104316081 | 186 |
| 988 | 3300028379 | Ga0268266_10619159 | Ga0268266_106191592 | 186 |
| 989 | 3300028380 | Ga0268265_10233736 | Ga0268265_102337362 | 186 |
| 990 | 3300028381 | Ga0268264_10040910 | Ga0268264_100409104 | 186 |
| 991 | 3300028381 | Ga0268264_10333460 | Ga0268264_103334601 | 186 |
| 992 | 3300031548 | Ga0307408_100015307 | Ga0307408_1000153072 | 186 |
| 993 | 3300031852 | Ga0307410_10048707 | Ga0307410_100487071 | 186 |
| 994 | 3300031901 | Ga0307406_10001453 | Ga0307406_100014532 | 186 |
| 995 | 3300031911 | Ga0307412_10012749 | Ga0307412_100127495 | 186 |
| 996 | 3300031995 | Ga0307409_100037174 | Ga0307409_1000371742 | 186 |
| 997 | 3300032002 | Ga0307416_100007436 | Ga0307416_1000074362 | 186 |
| 998 | 3300032004 | Ga0307414_10058726 | Ga0307414_100587262 | 186 |
| 999 | 3300032005 | Ga0307411_10000456 | Ga0307411_100004563 | 186 |
| 1000 | 3300032126 | Ga0307415_100004617 | Ga0307415_1000046178 | 186 |
| 1001 | 3300037418 | Ga0395900_0231738 | Ga0395900_0231738_365_1069 | 186 |
| 1002 | 3300037471 | Ga0395905_0166081 | Ga0395905_0166081_23_727 | 186 |
| 1003 | 3300038443 | Ga0395901_0570279 | Ga0395901_0570279_319_1023 | 186 |
| 1004 | 3300042876 | Ga0451577_0390999 | Ga0451577_0390999_452_1180 | 186 |
| 1005 | 3300044712 | Ga0453684_0343504 | Ga0453684_0343504_606_1334 | 186 |
| 1006 | 3300048903 | Ga0496100_0471830 | Ga0496100_0471830_20_742 | 186 |
| 1007 | 3300048904 | Ga0496101_0005725 | Ga0496101_0005725_6405_7127 | 186 |
| 1008 | 3300048905 | Ga0496102_0036172 | Ga0496102_0036172_637_1359 | 186 |
| 1009 | 3300048906 | Ga0496103_0020619 | Ga0496103_0020619_426_1148 | 186 |
| 1010 | 3300048909 | Ga0496106_0000575 | Ga0496106_0000575_5609_6331 | 186 |
| 1011 | 3300048910 | Ga0496107_0009688 | Ga0496107_0009688_5495_6217 | 186 |
| 1012 | 3300048911 | Ga0496108_0252379 | Ga0496108_0252379_177_950 | 186 |
| 1013 | 3300048912 | Ga0496109_0421054 | Ga0496109_0421054_17_721 | 186 |
| 1014 | 3300048914 | Ga0496111_0510037 | Ga0496111_0510037_117_830 | 186 |
| 1015 | 3300048916 | Ga0496113_0026989 | Ga0496113_0026989_799_1503 | 186 |
| 1016 | 3300053153 | Ga0500616_0100211 | Ga0500616_0100211_357_1127 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7unw-assembly1.cif.gz_X | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9664 | 4 | 185 |
| 6spg-assembly1.cif.gz_V | pseudomonas aeruginosa 70s ribosome from a clinical isolate | 0.9584 | 4 | 185 |
| 6dnc-assembly1.cif.gz_Z | e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon | 0.9564 | 3 | 96 |
| 6ysi-assembly1.cif.gz_R | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9532 | 3 | 96 |
| 6ogg-assembly1.cif.gz_v | 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). | 0.9504 | 3 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4JPA3_178_267_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9282 | 102 | 184 | 2.170.120.20 |
| af_P9WHB5_5_98_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.9107 | 2 | 96 | 2.40.240.10 |
| af_A0A1D6GLR4_38_141_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.9044 | 7 | 91 | 2.40.240.10 |
| af_K7MM89_88_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9042 | 97 | 185 | 2.170.120.20 |
| af_P9WHB5_5_98_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.9018 | 2 | 96 | 2.40.240.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354Z455-F1-model_v4 | 50S ribosomal protein L25 | 0.9885 | 1 | 102 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2H9U0J8-F1-model_v4 | Large ribosomal subunit protein bL25 | 0.9795 | 3 | 96 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-J9FQC0-F1-model_v4 | Ribosomal 5S rRNA E-loop binding protein Ctc/L25/TL5 | 0.9791 | 27 | 110 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A4D6Y4G8-F1-model_v4 | Large ribosomal subunit protein bL25 | 0.9758 | 3 | 96 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A3D0Q5D6-F1-model_v4 | 50S ribosomal protein L25 | 0.9736 | 4 | 112 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar