F488242

General Info

Members Datasets Scaffolds Average Seq Length
1015 367 2030 304

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100321998|Ga0307416_1003219982
Length 326
Sequence MPEAAPARGGVQTMKNKELRDLIDHARTFSKPYRVEDGNKFRLKDIDPGDTGDLSKDDRERASEALEEGVQAIATLQDKLYAQDRWAVLLVFQAIDAAGKDSAVKHVMSGVNPQGVQVYSFKSPSSEDLDHDYLWRCMKALPERGRIGIFNRSYYEEVVVVRVHPEFLAKQKVPGELLKSKDLWKDRYRDIRHFESYLARNGTLVRKFFLHVSKKEQEKRFRERLDKPEKNWKFSAADLAERDHWKDYQKYYEEMIQKTATPEAPWYVIPADNKWFTRIVVAAAIVDGLAGLNLEYPRISKSQAKEIETAKRALGGNGKTKSARRR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
205 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
217 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
227 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
228 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
235 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
267 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
346 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 2.17
Rhizosphere 97.04
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100321998 3300032002 Bacteria 1549
2 JGI24035J26624_1001943 3300002126 Bacteria 1921
3 JGI25406J46586_10033511 3300003203 Bacteria 1895
4 JGI26141J51220_1001030 3300003503 Bacteria 1645
5 JGI25404J52841_10003836 3300003659 Bacteria 3006
6 JGI25405J52794_10000327 3300003911 Bacteria 6573
7 JGI25405J52794_10002164 3300003911 Bacteria 3343
8 Ga0065704_10011588 3300005289 Unclassified 1852
9 Ga0065704_10104604 3300005289 Bacteria 2135
10 Ga0065704_10166490 3300005289 Bacteria 1319
11 Ga0065704_10178402 3300005289 Bacteria 1251
12 Ga0065712_10004996 3300005290 Bacteria 5613
13 Ga0065712_10009277 3300005290 Bacteria 2272
14 Ga0065712_10072457 3300005290 Bacteria 4747
15 Ga0065715_10000102 3300005293 Bacteria 4266
16 Ga0065715_10001915 3300005293 Bacteria 6112
17 Ga0065715_10007400 3300005293 Bacteria 2671
18 Ga0065715_10008071 3300005293 Bacteria 3701
19 Ga0065715_10025665 3300005293 Bacteria 1228
20 Ga0065715_10242050 3300005293 Bacteria 1176
21 Ga0065707_10023907 3300005295 Bacteria 1365
22 Ga0065707_10087272 3300005295 Bacteria 5095
23 Ga0065707_10136438 3300005295 Bacteria 1829
24 Ga0065707_10144159 3300005295 Unclassified 1734
25 Ga0065707_10171614 3300005295 Bacteria 1480
26 Ga0065707_10183828 3300005295 Bacteria 1401
27 Ga0070658_10390419 3300005327 Bacteria 1195
28 Ga0070658_10470938 3300005327 Bacteria 1083
29 Ga0070676_10181148 3300005328 Bacteria 1370
30 Ga0070683_100006594 3300005329 Bacteria 9751
31 Ga0070683_100014913 3300005329 Bacteria 6811
32 Ga0070690_100003035 3300005330 Bacteria 9112
33 Ga0070690_100068396 3300005330 Bacteria 2303
34 Ga0070690_100142019 3300005330 Bacteria 1630
35 Ga0070670_100022322 3300005331 Bacteria 5447
36 Ga0070670_100046745 3300005331 Bacteria 3723
37 Ga0070670_100199255 3300005331 Bacteria 1739
38 Ga0068869_100014075 3300005334 Bacteria 5338
39 Ga0068869_100018594 3300005334 Bacteria 4732
40 Ga0068869_100116461 3300005334 Unclassified 2039
41 Ga0068869_100329156 3300005334 Bacteria 1241
42 Ga0070666_10001804 3300005335 Bacteria 13026
43 Ga0070666_10009524 3300005335 Bacteria 6058
44 Ga0070666_10076600 3300005335 Bacteria 2282
45 Ga0070666_10078708 3300005335 Bacteria 2251
46 Ga0070666_10137811 3300005335 Bacteria 1699
47 Ga0070680_100124681 3300005336 Bacteria 2151
48 Ga0070682_100026582 3300005337 Bacteria 3466
49 Ga0070682_100170186 3300005337 Bacteria 1513
50 Ga0070682_100205240 3300005337 Bacteria 1393
51 Ga0068868_100009359 3300005338 Bacteria 7043
52 Ga0068868_100018018 3300005338 Bacteria 5271
53 Ga0068868_100021316 3300005338 Bacteria 4880
54 Ga0070660_100043632 3300005339 Bacteria 3428
55 Ga0070660_100189382 3300005339 Bacteria 1666
56 Ga0070689_100005260 3300005340 Bacteria 8815
57 Ga0070689_100016132 3300005340 Bacteria 5463
58 Ga0070689_100022095 3300005340 Bacteria 4747
59 Ga0070689_100058316 3300005340 Bacteria 2998
60 Ga0070689_100081381 3300005340 Bacteria 2543
61 Ga0070689_100096823 3300005340 Bacteria 2333
62 Ga0070687_100037825 3300005343 Bacteria 2415
63 Ga0070661_100041581 3300005344 Bacteria 3354
64 Ga0070661_100062416 3300005344 Bacteria 2735
65 Ga0070669_100004248 3300005353 Bacteria 10350
66 Ga0070669_100013683 3300005353 Bacteria 5768
67 Ga0070669_100044894 3300005353 Bacteria 3220
68 Ga0070669_100052942 3300005353 Bacteria 2970
69 Ga0070669_100086043 3300005353 Bacteria 2348
70 Ga0070669_100119716 3300005353 Bacteria 2007
71 Ga0070669_100124567 3300005353 Bacteria 1970
72 Ga0070669_100427312 3300005353 Bacteria 1088
73 Ga0070675_100002738 3300005354 Bacteria 13254
74 Ga0070675_100004561 3300005354 Bacteria 10575
75 Ga0070675_100057304 3300005354 Bacteria 3212
76 Ga0070675_100138907 3300005354 Bacteria 2075
77 Ga0070675_100308744 3300005354 Bacteria 1395
78 Ga0070675_100672631 3300005354 Bacteria 942
79 Ga0070671_100005355 3300005355 Bacteria 10230
80 Ga0070671_100101697 3300005355 Bacteria 2411
81 Ga0070671_100121131 3300005355 Bacteria 2202
82 Ga0070671_100134800 3300005355 Bacteria 2081
83 Ga0070674_100000122 3300005356 Bacteria 35444
84 Ga0070674_100129827 3300005356 Bacteria 1877
85 Ga0070673_100054289 3300005364 Bacteria 3151
86 Ga0070673_100234695 3300005364 Bacteria 1592
87 Ga0070673_100306254 3300005364 Bacteria 1400
88 Ga0070673_100307438 3300005364 Bacteria 1397
89 Ga0070688_100002210 3300005365 Bacteria 9819
90 Ga0070688_100005913 3300005365 Bacteria 6482
91 Ga0070688_100012206 3300005365 Bacteria 4807
92 Ga0070688_100169087 3300005365 Bacteria 1507
93 Ga0070688_100233690 3300005365 Bacteria 1302
94 Ga0070659_100058405 3300005366 Unclassified 3044
95 Ga0070667_100008496 3300005367 Bacteria 8513
96 Ga0070667_100040173 3300005367 Bacteria 3923
97 Ga0070667_100198013 3300005367 Bacteria 1782
98 Ga0070667_100306190 3300005367 Bacteria 1431
99 Ga0070709_10022454 3300005434 Bacteria 3691
100 Ga0070709_10221972 3300005434 Bacteria 1348
101 Ga0070714_100059610 3300005435 Bacteria 3273
102 Ga0070714_100108498 3300005435 Bacteria 2455
103 Ga0070713_100016764 3300005436 Bacteria 5516
104 Ga0070713_100118649 3300005436 Bacteria 2317
105 Ga0070710_10045125 3300005437 Bacteria 2449
106 Ga0070701_10057222 3300005438 Bacteria 2043
107 Ga0070701_10075320 3300005438 Bacteria 1814
108 Ga0070711_100067112 3300005439 Bacteria 2516
109 Ga0070705_100142967 3300005440 Bacteria 1577
110 Ga0070705_100144756 3300005440 Bacteria 1569
111 Ga0070700_100000043 3300005441 Bacteria 98943
112 Ga0070700_100022199 3300005441 Bacteria 3699
113 Ga0070700_100041375 3300005441 Unclassified 2825
114 Ga0070694_100003779 3300005444 Bacteria 9033
115 Ga0070694_100015478 3300005444 Bacteria 4792
116 Ga0070694_100045196 3300005444 Bacteria 2951
117 Ga0070694_100188518 3300005444 Bacteria 1530
118 Ga0070708_100018830 3300005445 Bacteria 5783
119 Ga0070708_100094569 3300005445 Bacteria 2727
120 Ga0070708_100098114 3300005445 Bacteria 2679
121 Ga0070708_100123694 3300005445 Bacteria 2389
122 Ga0070708_100258957 3300005445 Bacteria 1635
123 Ga0070708_100263073 3300005445 Bacteria 1622
124 Ga0070663_100298025 3300005455 Unclassified 1290
125 Ga0070678_100033848 3300005456 Bacteria 3552
126 Ga0070678_100074661 3300005456 Bacteria 2549
127 Ga0070678_100117326 3300005456 Bacteria 2093
128 Ga0070662_100011205 3300005457 Bacteria 5908
129 Ga0070662_100025501 3300005457 Bacteria 4083
130 Ga0070662_100182394 3300005457 Bacteria 1655
131 Ga0070662_100209655 3300005457 Bacteria 1550
132 Ga0070681_10030117 3300005458 Bacteria 5445
133 Ga0068867_100037979 3300005459 Bacteria 3503
134 Ga0070685_10031236 3300005466 Bacteria 2974
135 Ga0070685_10048790 3300005466 Bacteria 2440
136 Ga0070706_100000310 3300005467 Bacteria 59185
137 Ga0070706_100000311 3300005467 Bacteria 59149
138 Ga0070706_100001614 3300005467 Bacteria 23507
139 Ga0070706_100067456 3300005467 Bacteria 3309
140 Ga0070706_100121495 3300005467 Bacteria 2435
141 Ga0070707_100030224 3300005468 Bacteria 5156
142 Ga0070707_100085504 3300005468 Bacteria 3049
143 Ga0070707_100333677 3300005468 Bacteria 1473
144 Ga0070707_100533575 3300005468 Bacteria 1136
145 Ga0070698_100005478 3300005471 Bacteria 13858
146 Ga0070698_100013525 3300005471 Bacteria 8640
147 Ga0070698_100325454 3300005471 Bacteria 1468
148 Ga0070699_100000002 3300005518 Bacteria 423451
149 Ga0070699_100044215 3300005518 Bacteria 3857
150 Ga0070699_100256481 3300005518 Bacteria 1563
151 Ga0070699_100322330 3300005518 Bacteria 1389
152 Ga0070679_100028888 3300005530 Bacteria 5470
153 Ga0070684_100030129 3300005535 Unclassified 4608
154 Ga0070684_100038324 3300005535 Unclassified 4117
155 Ga0070684_100042262 3300005535 Bacteria 3934
156 Ga0070684_100052987 3300005535 Bacteria 3529
157 Ga0070697_100038935 3300005536 Bacteria 3842
158 Ga0070697_100081621 3300005536 Bacteria 2664
159 Ga0070697_100307896 3300005536 Bacteria 1362
160 Ga0070672_100082421 3300005543 Bacteria 2580
161 Ga0070686_100001466 3300005544 Bacteria 13318
162 Ga0070686_100007767 3300005544 Bacteria 5996
163 Ga0070686_100029357 3300005544 Bacteria 3344
164 Ga0070686_100036497 3300005544 Bacteria 3044
165 Ga0070686_100179386 3300005544 Bacteria 1503
166 Ga0070695_100009608 3300005545 Bacteria 5761
167 Ga0070695_100015279 3300005545 Bacteria 4634
168 Ga0070695_100056876 3300005545 Bacteria 2526
169 Ga0070695_100265758 3300005545 Bacteria 1255
170 Ga0070696_100004327 3300005546 Bacteria 9469
171 Ga0070696_100070981 3300005546 Bacteria 2450
172 Ga0070693_100010794 3300005547 Bacteria 4584
173 Ga0070693_100119549 3300005547 Bacteria 1632
174 Ga0070665_100021395 3300005548 Bacteria 6505
175 Ga0070665_100062635 3300005548 Bacteria 3729
176 Ga0070665_100079349 3300005548 Unclassified 3288
177 Ga0070665_100100793 3300005548 Bacteria 2892
178 Ga0070665_100104461 3300005548 Bacteria 2835
179 Ga0070665_100171465 3300005548 Bacteria 2171
180 Ga0070704_100050449 3300005549 Bacteria 2925
181 Ga0070704_100074796 3300005549 Bacteria 2472
182 Ga0070704_100090595 3300005549 Unclassified 2278
183 Ga0070704_100166580 3300005549 Bacteria 1748
184 Ga0070704_100169136 3300005549 Bacteria 1736
185 Ga0068855_100280940 3300005563 Bacteria 1849
186 Ga0068855_100296945 3300005563 Bacteria 1790
187 Ga0070664_100018303 3300005564 Bacteria 5751
188 Ga0070664_100046409 3300005564 Unclassified 3669
189 Ga0070664_100061639 3300005564 Bacteria 3197
190 Ga0070664_100095107 3300005564 Unclassified 2584
191 Ga0070664_100199731 3300005564 Bacteria 1784
192 Ga0070664_100390992 3300005564 Bacteria 1271
193 Ga0068857_100064666 3300005577 Bacteria 3253
194 Ga0068857_100183746 3300005577 Bacteria 1903
195 Ga0068854_100002078 3300005578 Bacteria 12273
196 Ga0068856_100065762 3300005614 Bacteria 3583
197 Ga0070702_100021076 3300005615 Bacteria 3424
198 Ga0070702_100034941 3300005615 Bacteria 2774
199 Ga0068852_100138454 3300005616 Bacteria 2250
200 Ga0068852_100414169 3300005616 Bacteria 1328
201 Ga0068859_100001473 3300005617 Bacteria 23952
202 Ga0068859_100003215 3300005617 Bacteria 16632
203 Ga0068859_100017294 3300005617 Bacteria 7242
204 Ga0068859_100027547 3300005617 Bacteria 5699
205 Ga0068864_100002723 3300005618 Bacteria 14551
206 Ga0068864_100009706 3300005618 Bacteria 7941
207 Ga0068864_100094637 3300005618 Bacteria 2641
208 Ga0068866_10000073 3300005718 Bacteria 40174
209 Ga0068866_10003289 3300005718 Bacteria 6639
210 Ga0068866_10165483 3300005718 Bacteria 1293
211 Ga0068861_100004136 3300005719 Bacteria 9728
212 Ga0068861_100080226 3300005719 Bacteria 2553
213 Ga0068861_100145891 3300005719 Bacteria 1937
214 Ga0068861_100321719 3300005719 Bacteria 1347
215 Ga0068870_10118884 3300005840 Bacteria 1519
216 Ga0068870_10132856 3300005840 Bacteria 1448
217 Ga0068870_10318821 3300005840 Bacteria 987
218 Ga0068863_100008815 3300005841 Bacteria 9849
219 Ga0068863_100009135 3300005841 Bacteria 9681
220 Ga0068863_100025321 3300005841 Bacteria 5657
221 Ga0068863_100088103 3300005841 Bacteria 2941
222 Ga0068863_100249339 3300005841 Bacteria 1715
223 Ga0068858_100002330 3300005842 Bacteria 19198
224 Ga0068858_100019795 3300005842 Bacteria 6291
225 Ga0068858_100113490 3300005842 Bacteria 2531
226 Ga0068858_100143909 3300005842 Bacteria 2239
227 Ga0068860_100011824 3300005843 Bacteria 8602
228 Ga0068860_100019147 3300005843 Bacteria 6647
229 Ga0068860_100078242 3300005843 Bacteria 3145
230 Ga0068860_100104248 3300005843 Bacteria 2707
231 Ga0068860_100117933 3300005843 Bacteria 2540
232 Ga0068860_100177492 3300005843 Bacteria 2059
233 Ga0068860_100203571 3300005843 Bacteria 1919
234 Ga0068860_100503844 3300005843 Bacteria 1209
235 Ga0068862_100002633 3300005844 Bacteria 15808
236 Ga0068862_100002896 3300005844 Bacteria 15009
237 Ga0068862_100005095 3300005844 Bacteria 11057
238 Ga0068862_100005648 3300005844 Bacteria 10444
239 Ga0068862_100032698 3300005844 Bacteria 4394
240 Ga0068862_100134795 3300005844 Bacteria 2188
241 Ga0068862_100315749 3300005844 Bacteria 1441
242 Ga0081455_10000205 3300005937 Bacteria 75563
243 Ga0081455_10000697 3300005937 Bacteria 43576
244 Ga0081455_10004011 3300005937 Bacteria 16703
245 Ga0081455_10004935 3300005937 Bacteria 14743
246 Ga0081455_10009637 3300005937 Bacteria 9915
247 Ga0081455_10030644 3300005937 Bacteria 4883
248 Ga0081455_10039658 3300005937 Bacteria 4159
249 Ga0081455_10042813 3300005937 Bacteria 3967
250 Ga0081455_10095892 3300005937 Bacteria 2393
251 Ga0081538_10011611 3300005981 Bacteria 7122
252 Ga0081538_10086711 3300005981 Bacteria 1638
253 Ga0081540_1000428 3300005983 Bacteria 41555
254 Ga0081540_1024375 3300005983 Bacteria 3513
255 Ga0081539_10012756 3300005985 Bacteria 6425
256 Ga0081539_10013451 3300005985 Bacteria 6163
257 Ga0070717_10000528 3300006028 Bacteria 24188
258 Ga0070717_10090143 3300006028 Bacteria 2587
259 Ga0070715_10191408 3300006163 Bacteria 1033
260 Ga0070716_100021031 3300006173 Bacteria 3433
261 Ga0070712_100010045 3300006175 Bacteria 5966
262 Ga0070712_100024539 3300006175 Bacteria 3997
263 Ga0070712_100052067 3300006175 Bacteria 2854
264 Ga0070712_100151982 3300006175 Bacteria 1778
265 Ga0097621_100002501 3300006237 Bacteria 12597
266 Ga0097621_100006752 3300006237 Bacteria 8150
267 Ga0097621_100041175 3300006237 Bacteria 3717
268 Ga0097621_100093424 3300006237 Bacteria 2521
269 Ga0097621_100117035 3300006237 Bacteria 2257
270 Ga0097621_100160920 3300006237 Bacteria 1930
271 Ga0097621_100306419 3300006237 Bacteria 1404
272 Ga0068871_100001736 3300006358 Bacteria 14689
273 Ga0068871_100016602 3300006358 Bacteria 5550
274 Ga0068871_100021546 3300006358 Bacteria 4956
275 Ga0068871_100101900 3300006358 Bacteria 2406
276 Ga0068871_100131919 3300006358 Bacteria 2119
277 Ga0068871_100135307 3300006358 Bacteria 2093
278 Ga0068871_100277361 3300006358 Bacteria 1466
279 Ga0068871_100287136 3300006358 Bacteria 1441
280 Ga0075428_100003680 3300006844 Bacteria 16819
281 Ga0075428_100004733 3300006844 Bacteria 15072
282 Ga0075428_100011733 3300006844 Bacteria 9755
283 Ga0075428_100015523 3300006844 Bacteria 8443
284 Ga0075428_100049757 3300006844 Bacteria 4599
285 Ga0075428_100087402 3300006844 Bacteria 3400
286 Ga0075428_100105283 3300006844 Bacteria 3077
287 Ga0075428_100109634 3300006844 Bacteria 3007
288 Ga0075428_100199787 3300006844 Bacteria 2162
289 Ga0075428_100444163 3300006844 Bacteria 1389
290 Ga0075430_100044600 3300006846 Bacteria 3748
291 Ga0075430_100136080 3300006846 Bacteria 2047
292 Ga0075431_100021379 3300006847 Bacteria 6616
293 Ga0075431_100068290 3300006847 Bacteria 3668
294 Ga0075431_100082831 3300006847 Bacteria 3312
295 Ga0075431_100115604 3300006847 Bacteria 2770
296 Ga0075431_100464119 3300006847 Bacteria 1261
297 Ga0075433_10001227 3300006852 Bacteria 18708
298 Ga0075433_10002325 3300006852 Bacteria 14474
299 Ga0075433_10007520 3300006852 Bacteria 8649
300 Ga0075433_10011668 3300006852 Bacteria 7077
301 Ga0075433_10015000 3300006852 Bacteria 6344
302 Ga0075433_10028687 3300006852 Bacteria 4734
303 Ga0075433_10035868 3300006852 Bacteria 4268
304 Ga0075433_10059759 3300006852 Bacteria 3335
305 Ga0075433_10087299 3300006852 Bacteria 2755
306 Ga0075433_10095626 3300006852 Bacteria 2629
307 Ga0075433_10113074 3300006852 Bacteria 2408
308 Ga0075433_10137324 3300006852 Bacteria 2173
309 Ga0075433_10260137 3300006852 Bacteria 1539
310 Ga0075434_100005591 3300006871 Bacteria 11451
311 Ga0075434_100007303 3300006871 Bacteria 10225
312 Ga0075434_100012942 3300006871 Bacteria 7925
313 Ga0075434_100036820 3300006871 Bacteria 4840
314 Ga0075434_100077740 3300006871 Bacteria 3313
315 Ga0075434_100087498 3300006871 Bacteria 3116
316 Ga0075434_100111432 3300006871 Bacteria 2747
317 Ga0075434_100123554 3300006871 Bacteria 2605
318 Ga0075434_100124246 3300006871 Unclassified 2597
319 Ga0075434_100128185 3300006871 Bacteria 2555
320 Ga0075434_100132880 3300006871 Bacteria 2508
321 Ga0075434_100263174 3300006871 Bacteria 1744
322 Ga0075434_100375325 3300006871 Bacteria 1443
323 Ga0075434_100643008 3300006871 Bacteria 1079
324 Ga0075429_100010116 3300006880 Bacteria 8173
325 Ga0075429_100046152 3300006880 Bacteria 3791
326 Ga0075429_100065469 3300006880 Bacteria 3164
327 Ga0075429_100089110 3300006880 Bacteria 2689
328 Ga0075429_100121715 3300006880 Bacteria 2281
329 Ga0068865_100015309 3300006881 Bacteria 4890
330 Ga0068865_100109328 3300006881 Bacteria 2037
331 Ga0075436_100005254 3300006914 Bacteria 8913
332 Ga0075436_100136314 3300006914 Bacteria 1723
333 Ga0097620_100001473 3300006931 Bacteria 23952
334 Ga0097620_100003215 3300006931 Bacteria 16632
335 Ga0097620_100017291 3300006931 Bacteria 7242
336 Ga0097620_100027551 3300006931 Bacteria 5699
337 Ga0075435_100003924 3300007076 Bacteria 10162
338 Ga0075435_100024263 3300007076 Bacteria 4704
339 Ga0075435_100039301 3300007076 Bacteria 3775
340 Ga0075435_100048587 3300007076 Bacteria 3409
341 Ga0075435_100189734 3300007076 Bacteria 1739
342 Ga0075435_100226492 3300007076 Bacteria 1588
343 Ga0099794_10000411 3300007265 Bacteria 14409
344 Ga0105240_10047694 3300009093 Bacteria 5419
345 Ga0111539_10000087 3300009094 Bacteria 95344
346 Ga0111539_10002567 3300009094 Bacteria 24035
347 Ga0111539_10012364 3300009094 Bacteria 10699
348 Ga0111539_10015412 3300009094 Bacteria 9511
349 Ga0111539_10025001 3300009094 Bacteria 7319
350 Ga0111539_10042856 3300009094 Bacteria 5430
351 Ga0111539_10069513 3300009094 Bacteria 4158
352 Ga0111539_10072816 3300009094 Bacteria 4052
353 Ga0111539_10153694 3300009094 Bacteria 2693
354 Ga0111539_10199718 3300009094 Bacteria 2332
355 Ga0111539_10331546 3300009094 Bacteria 1771
356 Ga0111539_10447875 3300009094 Bacteria 1503
357 Ga0105245_10008735 3300009098 Bacteria 8833
358 Ga0105245_10177738 3300009098 Bacteria 2031
359 Ga0105245_10284062 3300009098 Bacteria 1618
360 Ga0105245_10337248 3300009098 Bacteria 1490
361 Ga0105247_10017632 3300009101 Bacteria 4283
362 Ga0105247_10139465 3300009101 Bacteria 1587
363 Ga0105247_10162657 3300009101 Bacteria 1479
364 Ga0114129_10001658 3300009147 Bacteria 30299
365 Ga0114129_10015207 3300009147 Bacteria 10954
366 Ga0114129_10015709 3300009147 Bacteria 10764
367 Ga0114129_10020195 3300009147 Bacteria 9481
368 Ga0114129_10030692 3300009147 Bacteria 7603
369 Ga0114129_10062828 3300009147 Bacteria 5187
370 Ga0114129_10212831 3300009147 Bacteria 2612
371 Ga0114129_10265349 3300009147 Bacteria 2299
372 Ga0114129_10384487 3300009147 Bacteria 1853
373 Ga0114129_10440549 3300009147 Bacteria 1710
374 Ga0114129_10485835 3300009147 Bacteria 1615
375 Ga0114129_10506967 3300009147 Bacteria 1575
376 Ga0114129_10535238 3300009147 Bacteria 1526
377 Ga0114129_10591062 3300009147 Bacteria 1439
378 Ga0114129_10709575 3300009147 Bacteria 1292
379 Ga0114129_10727104 3300009147 Bacteria 1273
380 Ga0105243_10003122 3300009148 Bacteria 13611
381 Ga0105243_10318353 3300009148 Bacteria 1416
382 Ga0105241_10006983 3300009174 Bacteria 8308
383 Ga0105241_10034408 3300009174 Unclassified 3806
384 Ga0105241_10524452 3300009174 Bacteria 1060
385 Ga0105242_10004237 3300009176 Bacteria 11182
386 Ga0105242_10017396 3300009176 Bacteria 5603
387 Ga0105242_10031757 3300009176 Bacteria 4222
388 Ga0105242_10083830 3300009176 Bacteria 2670
389 Ga0105242_10382866 3300009176 Bacteria 1308
390 Ga0105248_10001280 3300009177 Bacteria 28065
391 Ga0105248_10002058 3300009177 Bacteria 22276
392 Ga0105248_10043301 3300009177 Bacteria 5048
393 Ga0105248_10067717 3300009177 Bacteria 4008
394 Ga0105248_10106249 3300009177 Bacteria 3165
395 Ga0105248_10141931 3300009177 Bacteria 2710
396 Ga0105248_10290820 3300009177 Bacteria 1840
397 Ga0105248_10495992 3300009177 Bacteria 1377
398 Ga0105238_10018246 3300009551 Bacteria 7137
399 Ga0105249_10005403 3300009553 Bacteria 11029
400 Ga0105249_10007413 3300009553 Bacteria 9570
401 Ga0105249_10021595 3300009553 Bacteria 5764
402 Ga0105249_10022148 3300009553 Bacteria 5690
403 Ga0105249_10077632 3300009553 Bacteria 3080
404 Ga0105249_10096784 3300009553 Bacteria 2770
405 Ga0105249_10184114 3300009553 Bacteria 2034
406 Ga0105249_10257799 3300009553 Bacteria 1731
407 Ga0105249_10501230 3300009553 Bacteria 1259
408 Ga0105239_10046060 3300010375 Bacteria 4779
409 Ga0105239_10209454 3300010375 Bacteria 2185
410 Ga0105239_10247321 3300010375 Bacteria 2003
411 Ga0105239_10272061 3300010375 Bacteria 1905
412 Ga0105239_10810058 3300010375 Bacteria 1073
413 Ga0105246_10005380 3300011119 Bacteria 7794
414 Ga0105246_10369586 3300011119 Bacteria 1181
415 Ga0157369_10107478 3300013105 Bacteria 2968
416 Ga0157374_10101779 3300013296 Bacteria 2754
417 Ga0157378_10001855 3300013297 Bacteria 18973
418 Ga0157378_10008833 3300013297 Bacteria 8768
419 Ga0157378_10014305 3300013297 Bacteria 6947
420 Ga0157378_10022320 3300013297 Bacteria 5571
421 Ga0157378_10034677 3300013297 Bacteria 4463
422 Ga0157378_10051153 3300013297 Bacteria 3676
423 Ga0157378_10052975 3300013297 Bacteria 3611
424 Ga0157378_10096517 3300013297 Bacteria 2694
425 Ga0157378_10196855 3300013297 Bacteria 1904
426 Ga0157378_10242391 3300013297 Bacteria 1722
427 Ga0157378_10316522 3300013297 Bacteria 1515
428 Ga0157378_10393643 3300013297 Bacteria 1363
429 Ga0157378_10504167 3300013297 Bacteria 1209
430 Ga0163162_10000988 3300013306 Bacteria 26458
431 Ga0163162_10027666 3300013306 Bacteria 5608
432 Ga0163162_10079434 3300013306 Bacteria 3347
433 Ga0163162_10095363 3300013306 Bacteria 3062
434 Ga0163162_10101597 3300013306 Bacteria 2968
435 Ga0163162_10381019 3300013306 Bacteria 1544
436 Ga0163162_10482573 3300013306 Bacteria 1371
437 Ga0163162_10765194 3300013306 Bacteria 1084
438 Ga0163162_10781259 3300013306 Bacteria 1073
439 Ga0157372_10041631 3300013307 Bacteria 5080
440 Ga0157372_10209212 3300013307 Bacteria 2260
441 Ga0157372_10473588 3300013307 Bacteria 1460
442 Ga0157375_10006805 3300013308 Bacteria 9952
443 Ga0157375_10009723 3300013308 Bacteria 8453
444 Ga0157375_10010666 3300013308 Bacteria 8092
445 Ga0157375_10048697 3300013308 Bacteria 4147
446 Ga0157375_10254480 3300013308 Bacteria 1917
447 Ga0157375_10388537 3300013308 Bacteria 1562
448 Ga0157375_10539929 3300013308 Unclassified 1328
449 Ga0163163_10012746 3300014325 Bacteria 7669
450 Ga0163163_10013377 3300014325 Bacteria 7512
451 Ga0163163_10013386 3300014325 Bacteria 7509
452 Ga0163163_10037589 3300014325 Bacteria 4711
453 Ga0163163_10547397 3300014325 Bacteria 1220
454 Ga0157380_10033771 3300014326 Bacteria 3942
455 Ga0157380_10034747 3300014326 Bacteria 3890
456 Ga0157380_10109760 3300014326 Bacteria 2315
457 Ga0157380_10688461 3300014326 Bacteria 1025
458 Ga0182008_10011030 3300014497 Bacteria 4819
459 Ga0157377_10068292 3300014745 Bacteria 2048
460 Ga0157377_10112105 3300014745 Bacteria 1641
461 Ga0157377_10179726 3300014745 Bacteria 1330
462 Ga0157379_10000689 3300014968 Bacteria 27401
463 Ga0157379_10001916 3300014968 Bacteria 17215
464 Ga0157379_10046052 3300014968 Unclassified 3893
465 Ga0157379_10124467 3300014968 Bacteria 2319
466 Ga0157376_10004478 3300014969 Bacteria 9728
467 Ga0157376_10037231 3300014969 Bacteria 3947
468 Ga0157376_10296481 3300014969 Bacteria 1529
469 Ga0182007_10024760 3300015262 Bacteria 2096
470 Ga0163161_10002314 3300017792 Bacteria 13646
471 Ga0163161_10264253 3300017792 Bacteria 1345
472 Ga0213872_10010873 3300021361 Bacteria 4319
473 Ga0213875_10000006 3300021388 Bacteria 579005
474 Ga0213871_10010248 3300021441 Bacteria 2122
475 Ga0209148_1000547 3300025254 Bacteria 35927
476 Ga0207666_1000646 3300025271 Bacteria 4171
477 Ga0209455_1000802 3300025272 Bacteria 17299
478 Ga0207673_1000456 3300025290 Bacteria 4245
479 Ga0209050_1003721 3300025298 Bacteria 10975
480 Ga0209050_1006712 3300025298 Bacteria 6727
481 Ga0207697_10000548 3300025315 Bacteria 21265
482 Ga0207697_10003100 3300025315 Bacteria 8318
483 Ga0207697_10003918 3300025315 Bacteria 7248
484 Ga0207697_10008466 3300025315 Bacteria 4497
485 Ga0207692_10007113 3300025898 Bacteria 4573
486 Ga0207642_10011063 3300025899 Bacteria 3205
487 Ga0207642_10113932 3300025899 Bacteria 1382
488 Ga0207710_10047576 3300025900 Bacteria 1918
489 Ga0207688_10026661 3300025901 Bacteria 3179
490 Ga0207680_10002407 3300025903 Bacteria 8720
491 Ga0207680_10058493 3300025903 Bacteria 2336
492 Ga0207680_10160345 3300025903 Bacteria 1507
493 Ga0207647_10003932 3300025904 Bacteria 11094
494 Ga0207647_10007760 3300025904 Bacteria 7724
495 Ga0207685_10055494 3300025905 Bacteria 1547
496 Ga0207699_10023884 3300025906 Bacteria 3334
497 Ga0207645_10012075 3300025907 Bacteria 5872
498 Ga0207645_10021874 3300025907 Bacteria 4166
499 Ga0207643_10013787 3300025908 Bacteria 4386
500 Ga0207643_10067467 3300025908 Unclassified 2053
501 Ga0207684_10000086 3300025910 Bacteria 173807
502 Ga0207684_10000337 3300025910 Bacteria 65590
503 Ga0207684_10002800 3300025910 Bacteria 17338
504 Ga0207684_10114960 3300025910 Bacteria 2304
505 Ga0207684_10230735 3300025910 Bacteria 1597
506 Ga0207654_10047585 3300025911 Bacteria 2451
507 Ga0207707_10120482 3300025912 Bacteria 2294
508 Ga0207695_10032175 3300025913 Bacteria 5743
509 Ga0207693_10013570 3300025915 Bacteria 6566
510 Ga0207693_10035487 3300025915 Bacteria 3931
511 Ga0207693_10087395 3300025915 Bacteria 2443
512 Ga0207663_10430678 3300025916 Bacteria 1014
513 Ga0207662_10001428 3300025918 Bacteria 11575
514 Ga0207662_10024321 3300025918 Bacteria 3485
515 Ga0207657_10030052 3300025919 Unclassified 4936
516 Ga0207657_10070141 3300025919 Bacteria 2971
517 Ga0207657_10240199 3300025919 Unclassified 1446
518 Ga0207649_10039109 3300025920 Bacteria 2874
519 Ga0207652_10017742 3300025921 Bacteria 5829
520 Ga0207646_10012133 3300025922 Bacteria 8292
521 Ga0207646_10024264 3300025922 Bacteria 5557
522 Ga0207646_10070684 3300025922 Bacteria 3118
523 Ga0207646_10100749 3300025922 Bacteria 2589
524 Ga0207646_10160910 3300025922 Bacteria 2026
525 Ga0207646_10161635 3300025922 Bacteria 2021
526 Ga0207646_10190270 3300025922 Bacteria 1853
527 Ga0207681_10004508 3300025923 Bacteria 8579
528 Ga0207681_10040361 3300025923 Bacteria 3105
529 Ga0207681_10165054 3300025923 Bacteria 1673
530 Ga0207681_10169739 3300025923 Bacteria 1653
531 Ga0207681_10179551 3300025923 Bacteria 1611
532 Ga0207681_10268345 3300025923 Bacteria 1339
533 Ga0207694_10017404 3300025924 Bacteria 5433
534 Ga0207650_10036451 3300025925 Bacteria 3579
535 Ga0207659_10021637 3300025926 Bacteria 4273
536 Ga0207659_10033547 3300025926 Unclassified 3534
537 Ga0207659_10034514 3300025926 Bacteria 3489
538 Ga0207659_10058221 3300025926 Bacteria 2773
539 Ga0207700_10061633 3300025928 Bacteria 2846
540 Ga0207644_10060422 3300025931 Bacteria 2742
541 Ga0207644_10175712 3300025931 Bacteria 1675
542 Ga0207644_10186802 3300025931 Bacteria 1628
543 Ga0207644_10199869 3300025931 Bacteria 1576
544 Ga0207690_10279220 3300025932 Bacteria 1300
545 Ga0207706_10000287 3300025933 Bacteria 54995
546 Ga0207706_10041405 3300025933 Bacteria 4083
547 Ga0207706_10068725 3300025933 Bacteria 3116
548 Ga0207706_10114474 3300025933 Bacteria 2372
549 Ga0207686_10000059 3300025934 Bacteria 100547
550 Ga0207686_10076376 3300025934 Bacteria 2172
551 Ga0207686_10185659 3300025934 Bacteria 1478
552 Ga0207709_10203240 3300025935 Bacteria 1416
553 Ga0207670_10007618 3300025936 Bacteria 6056
554 Ga0207670_10017779 3300025936 Bacteria 4306
555 Ga0207670_10024238 3300025936 Bacteria 3790
556 Ga0207670_10221012 3300025936 Bacteria 1450
557 Ga0207669_10009729 3300025937 Bacteria 4594
558 Ga0207669_10091326 3300025937 Bacteria 1983
559 Ga0207665_10014378 3300025939 Bacteria 5212
560 Ga0207665_10198634 3300025939 Bacteria 1460
561 Ga0207691_10031065 3300025940 Bacteria 4989
562 Ga0207691_10036088 3300025940 Bacteria 4581
563 Ga0207691_10100925 3300025940 Bacteria 2575
564 Ga0207711_10003040 3300025941 Bacteria 14662
565 Ga0207711_10007067 3300025941 Bacteria 9406
566 Ga0207711_10024620 3300025941 Bacteria 5046
567 Ga0207711_10081869 3300025941 Bacteria 2821
568 Ga0207711_10130052 3300025941 Bacteria 2256
569 Ga0207711_10188776 3300025941 Bacteria 1877
570 Ga0207711_10247019 3300025941 Bacteria 1637
571 Ga0207711_10290549 3300025941 Bacteria 1507
572 Ga0207689_10010368 3300025942 Bacteria 8029
573 Ga0207689_10157512 3300025942 Unclassified 1872
574 Ga0207661_10007741 3300025944 Bacteria 7650
575 Ga0207661_10034230 3300025944 Bacteria 3949
576 Ga0207661_10334108 3300025944 Bacteria 1364
577 Ga0207679_10061617 3300025945 Bacteria 2793
578 Ga0207679_10160713 3300025945 Bacteria 1839
579 Ga0207667_10178327 3300025949 Bacteria 2182
580 Ga0207651_10015769 3300025960 Bacteria 4403
581 Ga0207651_10029853 3300025960 Bacteria 3462
582 Ga0207651_10139984 3300025960 Bacteria 1867
583 Ga0207712_10010753 3300025961 Bacteria 5818
584 Ga0207712_10043066 3300025961 Bacteria 3112
585 Ga0207712_10045118 3300025961 Unclassified 3051
586 Ga0207712_10046342 3300025961 Bacteria 3014
587 Ga0207712_10070680 3300025961 Bacteria 2508
588 Ga0207712_10130740 3300025961 Bacteria 1913
589 Ga0207712_10167827 3300025961 Bacteria 1713
590 Ga0207712_10169594 3300025961 Bacteria 1704
591 Ga0207668_10270804 3300025972 Bacteria 1388
592 Ga0207658_10032331 3300025986 Bacteria 3723
593 Ga0207658_10032823 3300025986 Bacteria 3699
594 Ga0207658_10062876 3300025986 Bacteria 2780
595 Ga0207677_10019298 3300026023 Bacteria 4115
596 Ga0207677_10145427 3300026023 Bacteria 1821
597 Ga0207703_10003330 3300026035 Bacteria 13492
598 Ga0207703_10024290 3300026035 Bacteria 4769
599 Ga0207703_10054587 3300026035 Bacteria 3250
600 Ga0207703_10102803 3300026035 Bacteria 2425
601 Ga0207703_10180150 3300026035 Bacteria 1864
602 Ga0207678_10003161 3300026067 Bacteria 14887
603 Ga0207678_10321585 3300026067 Bacteria 1331
604 Ga0207708_10000060 3300026075 Bacteria 93846
605 Ga0207708_10019784 3300026075 Bacteria 5076
606 Ga0207708_10030176 3300026075 Bacteria 4112
607 Ga0207708_10059892 3300026075 Unclassified 2907
608 Ga0207702_10018653 3300026078 Bacteria 5739
609 Ga0207641_10005762 3300026088 Bacteria 10520
610 Ga0207641_10014112 3300026088 Bacteria 6549
611 Ga0207641_10035053 3300026088 Bacteria 4178
612 Ga0207641_10056970 3300026088 Bacteria 3323
613 Ga0207641_10092979 3300026088 Unclassified 2642
614 Ga0207641_10355353 3300026088 Bacteria 1397
615 Ga0207648_10000067 3300026089 Bacteria 98265
616 Ga0207648_10002858 3300026089 Bacteria 18270
617 Ga0207676_10009861 3300026095 Bacteria 6795
618 Ga0207676_10031048 3300026095 Bacteria 4015
619 Ga0207676_10122821 3300026095 Unclassified 2193
620 Ga0207676_10295554 3300026095 Bacteria 1477
621 Ga0207676_10631421 3300026095 Bacteria 1032
622 Ga0207674_10006686 3300026116 Bacteria 13546
623 Ga0207674_10076666 3300026116 Bacteria 3350
624 Ga0207674_10222334 3300026116 Unclassified 1836
625 Ga0207675_100001765 3300026118 Bacteria 21613
626 Ga0207675_100044553 3300026118 Bacteria 4146
627 Ga0207675_100088762 3300026118 Unclassified 2904
628 Ga0207675_100094620 3300026118 Bacteria 2811
629 Ga0207675_100182837 3300026118 Bacteria 2008
630 Ga0207675_100184586 3300026118 Bacteria 1999
631 Ga0207683_10004090 3300026121 Bacteria 12595
632 Ga0207683_10077881 3300026121 Bacteria 2937
633 Ga0207683_10109374 3300026121 Bacteria 2474
634 Ga0207698_10113188 3300026142 Bacteria 2279
635 Ga0207698_10551332 3300026142 Bacteria 1130
636 Ga0209982_1001382 3300027552 Bacteria 3302
637 Ga0210002_1021252 3300027617 Bacteria 1048
638 Ga0209983_1000491 3300027665 Bacteria 8513
639 Ga0209588_1000993 3300027671 Bacteria 7288
640 Ga0209971_1000114 3300027682 Bacteria 23450
641 Ga0209971_1001616 3300027682 Bacteria 5562
642 Ga0209966_1000688 3300027695 Bacteria 7334
643 Ga0209998_10000110 3300027717 Bacteria 32520
644 Ga0209998_10034054 3300027717 Bacteria 1138
645 Ga0209974_10006113 3300027876 Bacteria 4217
646 Ga0209974_10006349 3300027876 Bacteria 4129
647 Ga0209974_10012819 3300027876 Bacteria 2800
648 Ga0207428_10000173 3300027907 Bacteria 90064
649 Ga0207428_10005369 3300027907 Bacteria 11958
650 Ga0207428_10057730 3300027907 Bacteria 3081
651 Ga0207428_10125393 3300027907 Bacteria 1967
652 Ga0207428_10135928 3300027907 Bacteria 1879
653 Ga0268266_10060664 3300028379 Bacteria 3260
654 Ga0268266_10061427 3300028379 Bacteria 3241
655 Ga0268266_10085607 3300028379 Unclassified 2754
656 Ga0268266_10095275 3300028379 Bacteria 2614
657 Ga0268265_10003810 3300028380 Bacteria 10685
658 Ga0268265_10006355 3300028380 Bacteria 8011
659 Ga0268265_10024859 3300028380 Bacteria 4244
660 Ga0268265_10128099 3300028380 Bacteria 2104
661 Ga0268265_10141641 3300028380 Bacteria 2014
662 Ga0268264_10025788 3300028381 Bacteria 4800
663 Ga0268264_10030465 3300028381 Bacteria 4422
664 Ga0268264_10067838 3300028381 Bacteria 3012
665 Ga0268264_10078049 3300028381 Bacteria 2822
666 Ga0268264_10125697 3300028381 Bacteria 2266
667 Ga0268264_10480527 3300028381 Bacteria 1208
668 Ga0265337_1005118 3300028556 Bacteria 5276
669 Ga0265323_10000133 3300028653 Bacteria 42373
670 Ga0265336_10001001 3300028666 Bacteria 13896
671 Ga0265338_10000642 3300028800 Bacteria 60505
672 Ga0265338_10000660 3300028800 Bacteria 59683
673 Ga0265338_10000709 3300028800 Bacteria 56924
674 Ga0265338_10003614 3300028800 Bacteria 21576
675 Ga0265324_10047871 3300029957 Bacteria 1470
676 Ga0265332_10002292 3300031238 Bacteria 9787
677 Ga0265328_10003091 3300031239 Bacteria 7430
678 Ga0265320_10000411 3300031240 Bacteria 34030
679 Ga0265320_10000566 3300031240 Bacteria 28582
680 Ga0265320_10048305 3300031240 Bacteria 2078
681 Ga0265329_10014294 3300031242 Bacteria 2805
682 Ga0265331_10000051 3300031250 Bacteria 181262
683 Ga0265316_10000030 3300031344 Bacteria 162620
684 Ga0265316_10046152 3300031344 Bacteria 3454
685 Ga0307408_100060896 3300031548 Bacteria 2753
686 Ga0307408_100328115 3300031548 Bacteria 1291
687 Ga0307408_100329791 3300031548 Bacteria 1288
688 Ga0316575_10006694 3300031665 Bacteria 4158
689 Ga0316579_10054024 3300031691 Bacteria 1882
690 Ga0265314_10000563 3300031711 Bacteria 47395
691 Ga0265314_10135231 3300031711 Bacteria 1532
692 Ga0265342_10002980 3300031712 Bacteria 14215
693 Ga0316578_10000111 3300031728 Bacteria 19537
694 Ga0316578_10060309 3300031728 Bacteria 2233
695 Ga0316578_10150364 3300031728 Bacteria 1402
696 Ga0307405_10046774 3300031731 Bacteria 2661
697 Ga0307410_10028564 3300031852 Bacteria 3541
698 Ga0307412_10157106 3300031911 Bacteria 1685
699 Ga0307412_10206731 3300031911 Bacteria 1495
700 Ga0307409_100010053 3300031995 Bacteria 5854
701 Ga0307416_100010614 3300032002 Bacteria 6095
702 Ga0307411_10174334 3300032005 Bacteria 1625
703 Ga0316585_10001163 3300032137 Bacteria 6850
704 Ga0316580_10007474 3300032139 Bacteria 3256
705 Ga0316592_1000881 3300033524 Bacteria 4552
706 Ga0316596_1026813 3300033541 Bacteria 1486
707 Ga0373930_0004496 3300034816 Bacteria 2274
708 Ga0373928_0000074 3300035084 Bacteria 17490
709 Ga0373929_0000368 3300035085 Bacteria 8446
710 Ga0373944_0000282 3300035089 Bacteria 11257
711 Ga0373949_0008432 3300035090 Bacteria 2255
712 Ga0373951_0002694 3300035091 Bacteria 4451
713 Ga0373932_0000004 3300035112 Bacteria 412176
714 Ga0373945_0001282 3300035116 Bacteria 7627
715 Ga0373954_0000875 3300035118 Bacteria 11691
716 Ga0373956_0002979 3300035119 Bacteria 6861
717 Ga0373956_0008388 3300035119 Bacteria 4182
718 Ga0373957_0075651 3300035120 Bacteria 1323
719 Ga0373943_0105456 3300035170 Bacteria 1480
720 Ga0373946_0055703 3300035171 Bacteria 1668
721 Ga0373946_0064199 3300035171 Bacteria 1570
722 Ga0373955_0004251 3300035172 Bacteria 6324
723 Ga0373955_0101905 3300035172 Bacteria 1649
724 Ga0373961_0022421 3300035241 Bacteria 1690
725 Ga0373962_0000150 3300035242 Bacteria 14452
726 Ga0373962_0092613 3300035242 Bacteria 933
727 Ga0316574_0034233 3300035398 Bacteria 3096
728 Ga0316574_0034961 3300035398 Bacteria 3068
729 Ga0316574_0259948 3300035398 Bacteria 1108
730 Ga0373931_0000009 3300035691 Bacteria 349854
731 Ga0373935_0006198 3300035692 Bacteria 7118
732 Ga0373935_0053358 3300035692 Bacteria 2572
733 Ga0373927_0023515 3300035695 Bacteria 4036
734 Ga0373927_0035502 3300035695 Bacteria 3242
735 Ga0373933_0041248 3300035724 Bacteria 2724
736 Ga0373947_0020014 3300035725 Bacteria 3862
737 Ga0373947_0075886 3300035725 Bacteria 2071
738 Ga0373947_0217919 3300035725 Bacteria 1254
739 Ga0373937_0003172 3300036401 Bacteria 13763
740 Ga0373937_0016728 3300036401 Bacteria 6518
741 Ga0373937_0028032 3300036401 Bacteria 5095
742 Ga0373937_0419895 3300036401 Bacteria 1269
743 Ga0316582_0000260 3300036647 Bacteria 17777
744 Ga0316584_0005700 3300036712 Bacteria 8382
745 Ga0316584_0069095 3300036712 Bacteria 2648
746 Ga0373925_0016632 3300037068 Bacteria 5328
747 Ga0373925_0109521 3300037068 Bacteria 2132
748 Ga0395899_0063033 3300037312 Bacteria 2728
749 Ga0395900_0003244 3300037418 Bacteria 17611
750 Ga0395898_0002180 3300037466 Bacteria 23936
751 Ga0395898_0041735 3300037466 Bacteria 4530
752 Ga0395905_0006672 3300037471 Bacteria 11565
753 Ga0395905_0066560 3300037471 Bacteria 3374
754 Ga0395905_0330275 3300037471 Bacteria 1415
755 Ga0395901_0003824 3300038443 Bacteria 15174
756 Ga0395901_0086544 3300038443 Unclassified 3277
757 Ga0242420_002725 3300038996 Bacteria 2554
758 Ga0436365_0187223 3300039437 Bacteria 1605
759 Ga0436360_0027657 3300039438 Bacteria 1981
760 Ga0436360_0313550 3300039438 Bacteria 2938
761 Ga0436361_0130426 3300039447 Bacteria 1675
762 Ga0436361_0277088 3300039447 Bacteria 6404
763 Ga0439448_0014137 3300042005 Bacteria 2406
764 Ga0439435_0032402 3300042436 Bacteria 1426
765 Ga0439464_0029028 3300042439 Bacteria 1544
766 Ga0451577_0001837 3300042876 Bacteria 27069
767 Ga0451577_0006180 3300042876 Bacteria 12035
768 Ga0451577_0014249 3300042876 Bacteria 7411
769 Ga0451577_0119630 3300042876 Bacteria 2359
770 Ga0453683_0005967 3300044673 Bacteria 8396
771 Ga0453683_0007115 3300044673 Bacteria 7622
772 Ga0453683_0023791 3300044673 Bacteria 3901
773 Ga0453683_0051286 3300044673 Bacteria 2585
774 Ga0453683_0052211 3300044673 Bacteria 2559
775 Ga0453684_0002113 3300044712 Bacteria 50156
776 Ga0453684_0004388 3300044712 Bacteria 29866
777 Ga0453684_0004837 3300044712 Bacteria 27646
778 Ga0453684_0032268 3300044712 Bacteria 7336
779 Ga0453684_0109310 3300044712 Bacteria 3363
780 Ga0451576_0002497 3300045051 Bacteria 27315
781 Ga0451576_0152336 3300045051 Bacteria 2411
782 Ga0451576_0172891 3300045051 Bacteria 2255
783 Ga0451576_0272171 3300045051 Bacteria 1770
784 Ga0451576_0377202 3300045051 Bacteria 1486
785 Ga0451576_0412557 3300045051 Bacteria 1416
786 Ga0466967_0221199 3300045976 Bacteria 1799
787 Ga0495592_0084649 3300046454 Unclassified 2287
788 Ga0495629_0033190 3300046459 Bacteria 3652
789 Ga0495629_0105363 3300046459 Bacteria 1967
790 Ga0495641_0015794 3300046461 Bacteria 4006
791 Ga0495651_0137739 3300046462 Bacteria 1774
792 Ga0495651_0260520 3300046462 Bacteria 1180
793 Ga0495653_0002611 3300046463 Bacteria 14330
794 Ga0495580_0000861 3300046472 Bacteria 26227
795 Ga0495580_0006261 3300046472 Bacteria 9730
796 Ga0495580_0006893 3300046472 Bacteria 9179
797 Ga0495580_0129114 3300046472 Bacteria 1754
798 Ga0495662_0030376 3300046476 Bacteria 2608
799 Ga0495664_0000195 3300046477 Bacteria 29663
800 Ga0495664_0035309 3300046477 Bacteria 2943
801 Ga0495584_0043362 3300046491 Bacteria 2271
802 Ga0495618_0003416 3300046514 Bacteria 9883
803 Ga0495618_0065797 3300046514 Bacteria 2304
804 Ga0495618_0067541 3300046514 Bacteria 2273
805 Ga0495628_0000786 3300046516 Bacteria 29272
806 Ga0495628_0006854 3300046516 Bacteria 9904
807 Ga0495628_0299048 3300046516 Bacteria 1191
808 Ga0495630_0001698 3300046517 Bacteria 15378
809 Ga0495630_0005903 3300046517 Bacteria 8656
810 Ga0495630_0040804 3300046517 Bacteria 3468
811 Ga0495630_0353972 3300046517 Bacteria 1124
812 Ga0495648_0002300 3300046524 Bacteria 17789
813 Ga0495666_0001100 3300046526 Bacteria 12923
814 Ga0495666_0010292 3300046526 Bacteria 4664
815 Ga0495666_0036050 3300046526 Bacteria 2409
816 Ga0495652_0126890 3300046529 Bacteria 2025
817 Ga0495652_0141036 3300046529 Bacteria 1895
818 Ga0495652_0183638 3300046529 Unclassified 1602
819 Ga0495665_0080165 3300046531 Bacteria 1717
820 Ga0495640_0029864 3300046533 Bacteria 3907
821 Ga0495640_0143210 3300046533 Bacteria 1540
822 Ga0495640_0228468 3300046533 Bacteria 1171
823 Ga0495586_0015118 3300046535 Bacteria 4106
824 Ga0495586_0041046 3300046535 Bacteria 2492
825 Ga0495587_0000941 3300046536 Bacteria 19150
826 Ga0495645_0006369 3300046543 Bacteria 8190
827 Ga0495645_0022427 3300046543 Bacteria 4568
828 Ga0495645_0054498 3300046543 Unclassified 2905
829 Ga0495634_0004555 3300046642 Bacteria 10832
830 Ga0495634_0025293 3300046642 Bacteria 4156
831 Ga0495634_0230578 3300046642 Bacteria 1139
832 Ga0495635_0004455 3300046663 Bacteria 9705
833 Ga0495661_0005214 3300046665 Bacteria 9249
834 Ga0495588_0062002 3300046674 Bacteria 1938
835 Ga0495599_0007509 3300046678 Bacteria 6609
836 Ga0495599_0054697 3300046678 Bacteria 2500
837 Ga0495623_0018982 3300046679 Bacteria 4439
838 Ga0495623_0044233 3300046679 Unclassified 2830
839 Ga0495646_0005209 3300046680 Bacteria 8198
840 Ga0495658_0002187 3300046683 Bacteria 9890
841 Ga0495658_0110990 3300046683 Bacteria 1649
842 Ga0495658_0249069 3300046683 Bacteria 1117
843 Ga0495613_0003184 3300046689 Bacteria 12284
844 Ga0495613_0014245 3300046689 Bacteria 5901
845 Ga0495624_0050359 3300046690 Bacteria 2638
846 Ga0495624_0096689 3300046690 Bacteria 1819
847 Ga0495581_0005144 3300047315 Bacteria 7569
848 Ga0495581_0016169 3300047315 Bacteria 4338
849 Ga0495581_0111393 3300047315 Bacteria 1592
850 Ga0495604_0009806 3300047317 Bacteria 7576
851 Ga0495604_0046941 3300047317 Unclassified 3366
852 Ga0495636_0015594 3300047318 Bacteria 3028
853 Ga0495674_0006562 3300047319 Bacteria 11163
854 Ga0495674_0015770 3300047319 Bacteria 7052
855 Ga0495676_0015785 3300047321 Bacteria 6712
856 Ga0495680_0018934 3300047322 Bacteria 5830
857 Ga0495680_0046332 3300047322 Bacteria 3428
858 Ga0495675_0031241 3300047444 Bacteria 3400
859 Ga0495679_001933 3300047446 Bacteria 11069
860 Ga0495684_0009898 3300047471 Bacteria 7360
861 Ga0495684_0032446 3300047471 Bacteria 4010
862 Ga0495593_0000422 3300047673 Bacteria 23629
863 Ga0495602_0085184 3300048088 Unclassified 2642
864 Ga0495602_0166120 3300048088 Bacteria 1717
865 Ga0495614_0005975 3300048089 Bacteria 5483
866 Ga0496100_0192003 3300048903 Bacteria 1483
867 Ga0496100_0340270 3300048903 Bacteria 1131
868 Ga0496101_0021727 3300048904 Bacteria 4411
869 Ga0496101_0145590 3300048904 Bacteria 1809
870 Ga0496104_0129777 3300048907 Bacteria 2421
871 Ga0496104_0277710 3300048907 Bacteria 1588
872 Ga0496105_0103863 3300048908 Bacteria 2347
873 Ga0496107_0060266 3300048910 Unclassified 2747
874 Ga0496107_0106113 3300048910 Bacteria 2063
875 Ga0496109_0051100 3300048912 Bacteria 3765
876 Ga0496109_0122914 3300048912 Unclassified 2419
877 Ga0496109_0164603 3300048912 Bacteria 2079
878 Ga0496110_0067726 3300048913 Unclassified 3159
879 Ga0496111_0316754 3300048914 Bacteria 1155
880 Ga0496113_0058952 3300048916 Bacteria 2891
881 Ga0496114_0019752 3300048917 Bacteria 5462
882 Ga0496114_0145409 3300048917 Bacteria 2055
883 Ga0496115_0003213 3300048918 Bacteria 11736
884 Ga0496115_0003542 3300048918 Bacteria 11231
885 Ga0496115_0039282 3300048918 Bacteria 3758
886 Ga0496115_0155706 3300048918 Bacteria 1888
887 Ga0496115_0179126 3300048918 Bacteria 1753
888 Ga0501298_019024 3300049521 Bacteria 1269
889 Ga0501031_0000246 3300049568 Bacteria 30314
890 Ga0501033_0001544 3300049570 Bacteria 20334
891 Ga0501033_0023591 3300049570 Bacteria 4640
892 Ga0501033_0036582 3300049570 Bacteria 3678
893 Ga0501036_0076172 3300049572 Bacteria 2838
894 Ga0501036_0231765 3300049572 Bacteria 1550
895 Ga0501037_0053742 3300049573 Bacteria 2946
896 Ga0501038_0097989 3300049574 Bacteria 2445
897 Ga0501038_0335051 3300049574 Bacteria 1181
898 Ga0501039_0008640 3300049575 Bacteria 7760
899 Ga0501040_0002393 3300049576 Bacteria 12064
900 Ga0501040_0011340 3300049576 Bacteria 5833
901 Ga0501040_0038810 3300049576 Bacteria 3237
902 Ga0501041_0016543 3300049577 Bacteria 4386
903 Ga0501041_0055435 3300049577 Bacteria 2419
904 Ga0501042_0009482 3300049578 Bacteria 6489
905 Ga0501046_0218642 3300049580 Bacteria 1412
906 Ga0501048_0206074 3300049582 Bacteria 1395
907 Ga0501068_0010801 3300049584 Bacteria 5138
908 Ga0501070_0130716 3300049586 Bacteria 2074
909 Ga0501071_0053240 3300049587 Bacteria 2919
910 Ga0501071_0221308 3300049587 Bacteria 1424
911 Ga0501072_0025619 3300049588 Bacteria 4594
912 Ga0501073_0176815 3300049589 Bacteria 1477
913 Ga0501075_0013066 3300049591 Bacteria 5918
914 Ga0501075_0038792 3300049591 Bacteria 3562
915 Ga0501075_0055238 3300049591 Bacteria 2988
916 Ga0501075_0065302 3300049591 Bacteria 2746
917 Ga0501076_0004473 3300049592 Bacteria 9950
918 Ga0501076_0035495 3300049592 Bacteria 3901
919 Ga0501076_0039517 3300049592 Bacteria 3704
920 Ga0501076_0074577 3300049592 Bacteria 2718
921 Ga0501249_029657 3300049679 Bacteria 1217
922 Ga0501225_0029046 3300049705 Bacteria 1519
923 Ga0501079_0054382 3300049741 Bacteria 3087
924 Ga0501079_0195544 3300049741 Bacteria 1579
925 Ga0501079_0318073 3300049741 Bacteria 1218
926 Ga0501080_0048892 3300049742 Bacteria 3935
927 Ga0501080_0081506 3300049742 Bacteria 3006
928 Ga0501081_0016782 3300049743 Bacteria 4841
929 Ga0501035_0004068 3300049822 Bacteria 13909
930 Ga0501044_0000202 3300049823 Bacteria 75472
931 Ga0501044_0016475 3300049823 Bacteria 7932
932 Ga0501045_0019035 3300049824 Bacteria 4890
933 Ga0501045_0080375 3300049824 Bacteria 2403
934 nmdc:mga05p37_105122_c1 3300050507 Bacteria 3474
935 nmdc:mga05p37_109808_c1 3300050507 Bacteria 3393
936 nmdc:mga05p37_12204_c1 3300050507 Bacteria 10258
937 nmdc:mga05p37_142518_c1 3300050507 Bacteria 2935
938 nmdc:mga05p37_2749_c1 3300050507 Bacteria 20445
939 nmdc:mga05p37_276448_c1 3300050507 Unclassified 2005
940 nmdc:mga05p37_313499_c1 3300050507 Bacteria 1859
941 nmdc:mga05p37_412034_c1 3300050507 Bacteria 1575
942 nmdc:mga05p37_438076_c1 3300050507 Bacteria 1516
943 nmdc:mga05p37_488531_c1 3300050507 Bacteria 1416
944 nmdc:mga05p37_529319_c1 3300050507 Bacteria 1346
945 nmdc:mga05p37_67709_c1 3300050507 Bacteria 4392
946 nmdc:mga05p37_68007_c1 3300050507 Bacteria 2463
947 nmdc:mga05p37_9581_c1 3300050507 Bacteria 11471
948 nmdc:mga09592_20717_c1 3300050508 Bacteria 5411
949 nmdc:mga09592_207516_c1 3300050508 Bacteria 1697
950 nmdc:mga09592_61849_c1 3300050508 Bacteria 3167
951 nmdc:mga09592_95071_c1 3300050508 Bacteria 2549
952 nmdc:mga0qj67_118623_c1 3300050509 Bacteria 2139
953 nmdc:mga0qj67_16779_c1 3300050509 Bacteria 5561
954 nmdc:mga0qj67_95761_c1 3300050509 Bacteria 2389
955 nmdc:mga06r32_104631_c1 3300050510 Bacteria 2780
956 nmdc:mga06r32_170865_c1 3300050510 Bacteria 2158
957 nmdc:mga06r32_37003_c1 3300050510 Bacteria 4616
958 nmdc:mga06r32_41908_c1 3300050510 Bacteria 4351
959 nmdc:mga06r32_509599_c1 3300050510 Bacteria 1180
960 nmdc:mga08y16_114672_c1 3300050511 Bacteria 2805
961 nmdc:mga08y16_1199_c1 3300050511 Bacteria 25581
962 nmdc:mga08y16_123421_c1 3300050511 Bacteria 2695
963 nmdc:mga08y16_12797_c1 3300050511 Bacteria 8827
964 nmdc:mga08y16_13993_c1 3300050511 Bacteria 8445
965 nmdc:mga08y16_159704_c1 3300050511 Bacteria 2342
966 nmdc:mga08y16_64452_c1 3300050511 Bacteria 3826
967 nmdc:mga08y16_6485_c1 3300050511 Bacteria 12278
968 nmdc:mga0n895_118394_c1 3300050512 Bacteria 2669
969 nmdc:mga0n895_13124_c1 3300050512 Bacteria 7457
970 nmdc:mga0n895_148576_c1 3300050512 Bacteria 2373
971 nmdc:mga0n895_156979_c1 3300050512 Bacteria 2306
972 nmdc:mga0n895_183250_c1 3300050512 Bacteria 2125
973 nmdc:mga0n895_225832_c1 3300050512 Bacteria 1901
974 nmdc:mga0n895_26900_c1 3300050512 Bacteria 5458
975 nmdc:mga0n895_331010_c1 3300050512 Bacteria 1543
976 nmdc:mga0n895_428903_c1 3300050512 Bacteria 1336
977 nmdc:mga0n895_45185_c1 3300050512 Bacteria 4297
978 nmdc:mga0n895_544390_c1 3300050512 Unclassified 1167
979 nmdc:mga0n895_67680_c1 3300050512 Bacteria 3537
980 nmdc:mga0n895_98102_c1 3300050512 Bacteria 2937
981 nmdc:mga0rr50_128341_c1 3300050513 Bacteria 2027
982 nmdc:mga0rr50_128947_c1 3300050513 Bacteria 2023
983 nmdc:mga0rr50_33483_c1 3300050513 Bacteria 3671
984 nmdc:mga0rr50_41604_c1 3300050513 Bacteria 3350
985 nmdc:mga08x19_163756_c1 3300050514 Bacteria 1511
986 nmdc:mga08x19_166117_c1 3300050514 Bacteria 1501
987 nmdc:mga0a205_10348_c1 3300050515 Bacteria 8575
988 nmdc:mga0a205_188298_c1 3300050515 Bacteria 1956
989 nmdc:mga0a205_213390_c1 3300050515 Bacteria 1818
990 nmdc:mga0a205_2381_c1 3300050515 Bacteria 16567
991 nmdc:mga0a205_267124_c1 3300050515 Bacteria 1588
992 nmdc:mga0a205_308584_c1 3300050515 Bacteria 1454
993 nmdc:mga0a205_39831_c1 3300050515 Bacteria 4523
994 nmdc:mga0a205_398806_c1 3300050515 Bacteria 1239
995 nmdc:mga0a205_4045_c2 3300050515 Bacteria 2692
996 nmdc:mga0a205_58934_c1 3300050515 Bacteria 3709
997 nmdc:mga0a205_6612_c1 3300050515 Bacteria 10489
998 nmdc:mga0a205_72276_c1 3300050515 Unclassified 3332
999 nmdc:mga0a205_89364_c1 3300050515 Bacteria 2978
1000 Ga0495601_0015276 3300053077 Bacteria 4640
1001 Ga0495601_0085260 3300053077 Unclassified 2029
1002 Ga0495601_0172267 3300053077 Bacteria 1415
1003 Ga0495601_0360869 3300053077 Bacteria 944
1004 Ga0495619_0013780 3300053085 Bacteria 5101
1005 Ga0500616_0000003 3300053153 Bacteria 1220687
1006 Ga0500616_0004023 3300053153 Bacteria 10705
1007 Ga0501084_0024846 3300054114 Bacteria 5000
1008 Ga0501084_0043612 3300054114 Bacteria 3752
1009 Ga0501084_0366102 3300054114 Bacteria 1218
1010 Ga0501082_0018280 3300060353 Bacteria 6034
1011 Ga0501082_0056836 3300060353 Bacteria 3371
1012 Ga0501082_0112817 3300060353 Bacteria 2354
1013 Ga0501082_0280887 3300060353 Bacteria 1449
1014 Ga0530510_0051029 3300061734 Bacteria 2988
1015 Ga0530510_0117979 3300061734 Bacteria 1947
1016 Ga0307416_100321998
1017 JGI24035J26624_1001943
1018 JGI25406J46586_10033511
1019 JGI26141J51220_1001030
1020 JGI25404J52841_10003836
1021 JGI25405J52794_10000327
1022 JGI25405J52794_10002164
1023 Ga0065704_10011588
1024 Ga0065704_10104604
1025 Ga0065704_10166490
1026 Ga0065704_10178402
1027 Ga0065712_10004996
1028 Ga0065712_10009277
1029 Ga0065712_10072457
1030 Ga0065715_10000102
1031 Ga0065715_10001915
1032 Ga0065715_10007400
1033 Ga0065715_10008071
1034 Ga0065715_10025665
1035 Ga0065715_10242050
1036 Ga0065707_10023907
1037 Ga0065707_10087272
1038 Ga0065707_10136438
1039 Ga0065707_10144159
1040 Ga0065707_10171614
1041 Ga0065707_10183828
1042 Ga0070658_10390419
1043 Ga0070658_10470938
1044 Ga0070676_10181148
1045 Ga0070683_100006594
1046 Ga0070683_100014913
1047 Ga0070690_100003035
1048 Ga0070690_100068396
1049 Ga0070690_100142019
1050 Ga0070670_100022322
1051 Ga0070670_100046745
1052 Ga0070670_100199255
1053 Ga0068869_100014075
1054 Ga0068869_100018594
1055 Ga0068869_100116461
1056 Ga0068869_100329156
1057 Ga0070666_10001804
1058 Ga0070666_10009524
1059 Ga0070666_10076600
1060 Ga0070666_10078708
1061 Ga0070666_10137811
1062 Ga0070680_100124681
1063 Ga0070682_100026582
1064 Ga0070682_100170186
1065 Ga0070682_100205240
1066 Ga0068868_100009359
1067 Ga0068868_100018018
1068 Ga0068868_100021316
1069 Ga0070660_100043632
1070 Ga0070660_100189382
1071 Ga0070689_100005260
1072 Ga0070689_100016132
1073 Ga0070689_100022095
1074 Ga0070689_100058316
1075 Ga0070689_100081381
1076 Ga0070689_100096823
1077 Ga0070687_100037825
1078 Ga0070661_100041581
1079 Ga0070661_100062416
1080 Ga0070669_100004248
1081 Ga0070669_100013683
1082 Ga0070669_100044894
1083 Ga0070669_100052942
1084 Ga0070669_100086043
1085 Ga0070669_100119716
1086 Ga0070669_100124567
1087 Ga0070669_100427312
1088 Ga0070675_100002738
1089 Ga0070675_100004561
1090 Ga0070675_100057304
1091 Ga0070675_100138907
1092 Ga0070675_100308744
1093 Ga0070675_100672631
1094 Ga0070671_100005355
1095 Ga0070671_100101697
1096 Ga0070671_100121131
1097 Ga0070671_100134800
1098 Ga0070674_100000122
1099 Ga0070674_100129827
1100 Ga0070673_100054289
1101 Ga0070673_100234695
1102 Ga0070673_100306254
1103 Ga0070673_100307438
1104 Ga0070688_100002210
1105 Ga0070688_100005913
1106 Ga0070688_100012206
1107 Ga0070688_100169087
1108 Ga0070688_100233690
1109 Ga0070659_100058405
1110 Ga0070667_100008496
1111 Ga0070667_100040173
1112 Ga0070667_100198013
1113 Ga0070667_100306190
1114 Ga0070709_10022454
1115 Ga0070709_10221972
1116 Ga0070714_100059610
1117 Ga0070714_100108498
1118 Ga0070713_100016764
1119 Ga0070713_100118649
1120 Ga0070710_10045125
1121 Ga0070701_10057222
1122 Ga0070701_10075320
1123 Ga0070711_100067112
1124 Ga0070705_100142967
1125 Ga0070705_100144756
1126 Ga0070700_100000043
1127 Ga0070700_100022199
1128 Ga0070700_100041375
1129 Ga0070694_100003779
1130 Ga0070694_100015478
1131 Ga0070694_100045196
1132 Ga0070694_100188518
1133 Ga0070708_100018830
1134 Ga0070708_100094569
1135 Ga0070708_100098114
1136 Ga0070708_100123694
1137 Ga0070708_100258957
1138 Ga0070708_100263073
1139 Ga0070663_100298025
1140 Ga0070678_100033848
1141 Ga0070678_100074661
1142 Ga0070678_100117326
1143 Ga0070662_100011205
1144 Ga0070662_100025501
1145 Ga0070662_100182394
1146 Ga0070662_100209655
1147 Ga0070681_10030117
1148 Ga0068867_100037979
1149 Ga0070685_10031236
1150 Ga0070685_10048790
1151 Ga0070706_100000310
1152 Ga0070706_100000311
1153 Ga0070706_100001614
1154 Ga0070706_100067456
1155 Ga0070706_100121495
1156 Ga0070707_100030224
1157 Ga0070707_100085504
1158 Ga0070707_100333677
1159 Ga0070707_100533575
1160 Ga0070698_100005478
1161 Ga0070698_100013525
1162 Ga0070698_100325454
1163 Ga0070699_100000002
1164 Ga0070699_100044215
1165 Ga0070699_100256481
1166 Ga0070699_100322330
1167 Ga0070679_100028888
1168 Ga0070684_100030129
1169 Ga0070684_100038324
1170 Ga0070684_100042262
1171 Ga0070684_100052987
1172 Ga0070697_100038935
1173 Ga0070697_100081621
1174 Ga0070697_100307896
1175 Ga0070672_100082421
1176 Ga0070686_100001466
1177 Ga0070686_100007767
1178 Ga0070686_100029357
1179 Ga0070686_100036497
1180 Ga0070686_100179386
1181 Ga0070695_100009608
1182 Ga0070695_100015279
1183 Ga0070695_100056876
1184 Ga0070695_100265758
1185 Ga0070696_100004327
1186 Ga0070696_100070981
1187 Ga0070693_100010794
1188 Ga0070693_100119549
1189 Ga0070665_100021395
1190 Ga0070665_100062635
1191 Ga0070665_100079349
1192 Ga0070665_100100793
1193 Ga0070665_100104461
1194 Ga0070665_100171465
1195 Ga0070704_100050449
1196 Ga0070704_100074796
1197 Ga0070704_100090595
1198 Ga0070704_100166580
1199 Ga0070704_100169136
1200 Ga0068855_100280940
1201 Ga0068855_100296945
1202 Ga0070664_100018303
1203 Ga0070664_100046409
1204 Ga0070664_100061639
1205 Ga0070664_100095107
1206 Ga0070664_100199731
1207 Ga0070664_100390992
1208 Ga0068857_100064666
1209 Ga0068857_100183746
1210 Ga0068854_100002078
1211 Ga0068856_100065762
1212 Ga0070702_100021076
1213 Ga0070702_100034941
1214 Ga0068852_100138454
1215 Ga0068852_100414169
1216 Ga0068859_100001473
1217 Ga0068859_100003215
1218 Ga0068859_100017294
1219 Ga0068859_100027547
1220 Ga0068864_100002723
1221 Ga0068864_100009706
1222 Ga0068864_100094637
1223 Ga0068866_10000073
1224 Ga0068866_10003289
1225 Ga0068866_10165483
1226 Ga0068861_100004136
1227 Ga0068861_100080226
1228 Ga0068861_100145891
1229 Ga0068861_100321719
1230 Ga0068870_10118884
1231 Ga0068870_10132856
1232 Ga0068870_10318821
1233 Ga0068863_100008815
1234 Ga0068863_100009135
1235 Ga0068863_100025321
1236 Ga0068863_100088103
1237 Ga0068863_100249339
1238 Ga0068858_100002330
1239 Ga0068858_100019795
1240 Ga0068858_100113490
1241 Ga0068858_100143909
1242 Ga0068860_100011824
1243 Ga0068860_100019147
1244 Ga0068860_100078242
1245 Ga0068860_100104248
1246 Ga0068860_100117933
1247 Ga0068860_100177492
1248 Ga0068860_100203571
1249 Ga0068860_100503844
1250 Ga0068862_100002633
1251 Ga0068862_100002896
1252 Ga0068862_100005095
1253 Ga0068862_100005648
1254 Ga0068862_100032698
1255 Ga0068862_100134795
1256 Ga0068862_100315749
1257 Ga0081455_10000205
1258 Ga0081455_10000697
1259 Ga0081455_10004011
1260 Ga0081455_10004935
1261 Ga0081455_10009637
1262 Ga0081455_10030644
1263 Ga0081455_10039658
1264 Ga0081455_10042813
1265 Ga0081455_10095892
1266 Ga0081538_10011611
1267 Ga0081538_10086711
1268 Ga0081540_1000428
1269 Ga0081540_1024375
1270 Ga0081539_10012756
1271 Ga0081539_10013451
1272 Ga0070717_10000528
1273 Ga0070717_10090143
1274 Ga0070715_10191408
1275 Ga0070716_100021031
1276 Ga0070712_100010045
1277 Ga0070712_100024539
1278 Ga0070712_100052067
1279 Ga0070712_100151982
1280 Ga0097621_100002501
1281 Ga0097621_100006752
1282 Ga0097621_100041175
1283 Ga0097621_100093424
1284 Ga0097621_100117035
1285 Ga0097621_100160920
1286 Ga0097621_100306419
1287 Ga0068871_100001736
1288 Ga0068871_100016602
1289 Ga0068871_100021546
1290 Ga0068871_100101900
1291 Ga0068871_100131919
1292 Ga0068871_100135307
1293 Ga0068871_100277361
1294 Ga0068871_100287136
1295 Ga0075428_100003680
1296 Ga0075428_100004733
1297 Ga0075428_100011733
1298 Ga0075428_100015523
1299 Ga0075428_100049757
1300 Ga0075428_100087402
1301 Ga0075428_100105283
1302 Ga0075428_100109634
1303 Ga0075428_100199787
1304 Ga0075428_100444163
1305 Ga0075430_100044600
1306 Ga0075430_100136080
1307 Ga0075431_100021379
1308 Ga0075431_100068290
1309 Ga0075431_100082831
1310 Ga0075431_100115604
1311 Ga0075431_100464119
1312 Ga0075433_10001227
1313 Ga0075433_10002325
1314 Ga0075433_10007520
1315 Ga0075433_10011668
1316 Ga0075433_10015000
1317 Ga0075433_10028687
1318 Ga0075433_10035868
1319 Ga0075433_10059759
1320 Ga0075433_10087299
1321 Ga0075433_10095626
1322 Ga0075433_10113074
1323 Ga0075433_10137324
1324 Ga0075433_10260137
1325 Ga0075434_100005591
1326 Ga0075434_100007303
1327 Ga0075434_100012942
1328 Ga0075434_100036820
1329 Ga0075434_100077740
1330 Ga0075434_100087498
1331 Ga0075434_100111432
1332 Ga0075434_100123554
1333 Ga0075434_100124246
1334 Ga0075434_100128185
1335 Ga0075434_100132880
1336 Ga0075434_100263174
1337 Ga0075434_100375325
1338 Ga0075434_100643008
1339 Ga0075429_100010116
1340 Ga0075429_100046152
1341 Ga0075429_100065469
1342 Ga0075429_100089110
1343 Ga0075429_100121715
1344 Ga0068865_100015309
1345 Ga0068865_100109328
1346 Ga0075436_100005254
1347 Ga0075436_100136314
1348 Ga0097620_100001473
1349 Ga0097620_100003215
1350 Ga0097620_100017291
1351 Ga0097620_100027551
1352 Ga0075435_100003924
1353 Ga0075435_100024263
1354 Ga0075435_100039301
1355 Ga0075435_100048587
1356 Ga0075435_100189734
1357 Ga0075435_100226492
1358 Ga0099794_10000411
1359 Ga0105240_10047694
1360 Ga0111539_10000087
1361 Ga0111539_10002567
1362 Ga0111539_10012364
1363 Ga0111539_10015412
1364 Ga0111539_10025001
1365 Ga0111539_10042856
1366 Ga0111539_10069513
1367 Ga0111539_10072816
1368 Ga0111539_10153694
1369 Ga0111539_10199718
1370 Ga0111539_10331546
1371 Ga0111539_10447875
1372 Ga0105245_10008735
1373 Ga0105245_10177738
1374 Ga0105245_10284062
1375 Ga0105245_10337248
1376 Ga0105247_10017632
1377 Ga0105247_10139465
1378 Ga0105247_10162657
1379 Ga0114129_10001658
1380 Ga0114129_10015207
1381 Ga0114129_10015709
1382 Ga0114129_10020195
1383 Ga0114129_10030692
1384 Ga0114129_10062828
1385 Ga0114129_10212831
1386 Ga0114129_10265349
1387 Ga0114129_10384487
1388 Ga0114129_10440549
1389 Ga0114129_10485835
1390 Ga0114129_10506967
1391 Ga0114129_10535238
1392 Ga0114129_10591062
1393 Ga0114129_10709575
1394 Ga0114129_10727104
1395 Ga0105243_10003122
1396 Ga0105243_10318353
1397 Ga0105241_10006983
1398 Ga0105241_10034408
1399 Ga0105241_10524452
1400 Ga0105242_10004237
1401 Ga0105242_10017396
1402 Ga0105242_10031757
1403 Ga0105242_10083830
1404 Ga0105242_10382866
1405 Ga0105248_10001280
1406 Ga0105248_10002058
1407 Ga0105248_10043301
1408 Ga0105248_10067717
1409 Ga0105248_10106249
1410 Ga0105248_10141931
1411 Ga0105248_10290820
1412 Ga0105248_10495992
1413 Ga0105238_10018246
1414 Ga0105249_10005403
1415 Ga0105249_10007413
1416 Ga0105249_10021595
1417 Ga0105249_10022148
1418 Ga0105249_10077632
1419 Ga0105249_10096784
1420 Ga0105249_10184114
1421 Ga0105249_10257799
1422 Ga0105249_10501230
1423 Ga0105239_10046060
1424 Ga0105239_10209454
1425 Ga0105239_10247321
1426 Ga0105239_10272061
1427 Ga0105239_10810058
1428 Ga0105246_10005380
1429 Ga0105246_10369586
1430 Ga0157369_10107478
1431 Ga0157374_10101779
1432 Ga0157378_10001855
1433 Ga0157378_10008833
1434 Ga0157378_10014305
1435 Ga0157378_10022320
1436 Ga0157378_10034677
1437 Ga0157378_10051153
1438 Ga0157378_10052975
1439 Ga0157378_10096517
1440 Ga0157378_10196855
1441 Ga0157378_10242391
1442 Ga0157378_10316522
1443 Ga0157378_10393643
1444 Ga0157378_10504167
1445 Ga0163162_10000988
1446 Ga0163162_10027666
1447 Ga0163162_10079434
1448 Ga0163162_10095363
1449 Ga0163162_10101597
1450 Ga0163162_10381019
1451 Ga0163162_10482573
1452 Ga0163162_10765194
1453 Ga0163162_10781259
1454 Ga0157372_10041631
1455 Ga0157372_10209212
1456 Ga0157372_10473588
1457 Ga0157375_10006805
1458 Ga0157375_10009723
1459 Ga0157375_10010666
1460 Ga0157375_10048697
1461 Ga0157375_10254480
1462 Ga0157375_10388537
1463 Ga0157375_10539929
1464 Ga0163163_10012746
1465 Ga0163163_10013377
1466 Ga0163163_10013386
1467 Ga0163163_10037589
1468 Ga0163163_10547397
1469 Ga0157380_10033771
1470 Ga0157380_10034747
1471 Ga0157380_10109760
1472 Ga0157380_10688461
1473 Ga0182008_10011030
1474 Ga0157377_10068292
1475 Ga0157377_10112105
1476 Ga0157377_10179726
1477 Ga0157379_10000689
1478 Ga0157379_10001916
1479 Ga0157379_10046052
1480 Ga0157379_10124467
1481 Ga0157376_10004478
1482 Ga0157376_10037231
1483 Ga0157376_10296481
1484 Ga0182007_10024760
1485 Ga0163161_10002314
1486 Ga0163161_10264253
1487 Ga0213872_10010873
1488 Ga0213875_10000006
1489 Ga0213871_10010248
1490 Ga0209148_1000547
1491 Ga0207666_1000646
1492 Ga0209455_1000802
1493 Ga0207673_1000456
1494 Ga0209050_1003721
1495 Ga0209050_1006712
1496 Ga0207697_10000548
1497 Ga0207697_10003100
1498 Ga0207697_10003918
1499 Ga0207697_10008466
1500 Ga0207692_10007113
1501 Ga0207642_10011063
1502 Ga0207642_10113932
1503 Ga0207710_10047576
1504 Ga0207688_10026661
1505 Ga0207680_10002407
1506 Ga0207680_10058493
1507 Ga0207680_10160345
1508 Ga0207647_10003932
1509 Ga0207647_10007760
1510 Ga0207685_10055494
1511 Ga0207699_10023884
1512 Ga0207645_10012075
1513 Ga0207645_10021874
1514 Ga0207643_10013787
1515 Ga0207643_10067467
1516 Ga0207684_10000086
1517 Ga0207684_10000337
1518 Ga0207684_10002800
1519 Ga0207684_10114960
1520 Ga0207684_10230735
1521 Ga0207654_10047585
1522 Ga0207707_10120482
1523 Ga0207695_10032175
1524 Ga0207693_10013570
1525 Ga0207693_10035487
1526 Ga0207693_10087395
1527 Ga0207663_10430678
1528 Ga0207662_10001428
1529 Ga0207662_10024321
1530 Ga0207657_10030052
1531 Ga0207657_10070141
1532 Ga0207657_10240199
1533 Ga0207649_10039109
1534 Ga0207652_10017742
1535 Ga0207646_10012133
1536 Ga0207646_10024264
1537 Ga0207646_10070684
1538 Ga0207646_10100749
1539 Ga0207646_10160910
1540 Ga0207646_10161635
1541 Ga0207646_10190270
1542 Ga0207681_10004508
1543 Ga0207681_10040361
1544 Ga0207681_10165054
1545 Ga0207681_10169739
1546 Ga0207681_10179551
1547 Ga0207681_10268345
1548 Ga0207694_10017404
1549 Ga0207650_10036451
1550 Ga0207659_10021637
1551 Ga0207659_10033547
1552 Ga0207659_10034514
1553 Ga0207659_10058221
1554 Ga0207700_10061633
1555 Ga0207644_10060422
1556 Ga0207644_10175712
1557 Ga0207644_10186802
1558 Ga0207644_10199869
1559 Ga0207690_10279220
1560 Ga0207706_10000287
1561 Ga0207706_10041405
1562 Ga0207706_10068725
1563 Ga0207706_10114474
1564 Ga0207686_10000059
1565 Ga0207686_10076376
1566 Ga0207686_10185659
1567 Ga0207709_10203240
1568 Ga0207670_10007618
1569 Ga0207670_10017779
1570 Ga0207670_10024238
1571 Ga0207670_10221012
1572 Ga0207669_10009729
1573 Ga0207669_10091326
1574 Ga0207665_10014378
1575 Ga0207665_10198634
1576 Ga0207691_10031065
1577 Ga0207691_10036088
1578 Ga0207691_10100925
1579 Ga0207711_10003040
1580 Ga0207711_10007067
1581 Ga0207711_10024620
1582 Ga0207711_10081869
1583 Ga0207711_10130052
1584 Ga0207711_10188776
1585 Ga0207711_10247019
1586 Ga0207711_10290549
1587 Ga0207689_10010368
1588 Ga0207689_10157512
1589 Ga0207661_10007741
1590 Ga0207661_10034230
1591 Ga0207661_10334108
1592 Ga0207679_10061617
1593 Ga0207679_10160713
1594 Ga0207667_10178327
1595 Ga0207651_10015769
1596 Ga0207651_10029853
1597 Ga0207651_10139984
1598 Ga0207712_10010753
1599 Ga0207712_10043066
1600 Ga0207712_10045118
1601 Ga0207712_10046342
1602 Ga0207712_10070680
1603 Ga0207712_10130740
1604 Ga0207712_10167827
1605 Ga0207712_10169594
1606 Ga0207668_10270804
1607 Ga0207658_10032331
1608 Ga0207658_10032823
1609 Ga0207658_10062876
1610 Ga0207677_10019298
1611 Ga0207677_10145427
1612 Ga0207703_10003330
1613 Ga0207703_10024290
1614 Ga0207703_10054587
1615 Ga0207703_10102803
1616 Ga0207703_10180150
1617 Ga0207678_10003161
1618 Ga0207678_10321585
1619 Ga0207708_10000060
1620 Ga0207708_10019784
1621 Ga0207708_10030176
1622 Ga0207708_10059892
1623 Ga0207702_10018653
1624 Ga0207641_10005762
1625 Ga0207641_10014112
1626 Ga0207641_10035053
1627 Ga0207641_10056970
1628 Ga0207641_10092979
1629 Ga0207641_10355353
1630 Ga0207648_10000067
1631 Ga0207648_10002858
1632 Ga0207676_10009861
1633 Ga0207676_10031048
1634 Ga0207676_10122821
1635 Ga0207676_10295554
1636 Ga0207676_10631421
1637 Ga0207674_10006686
1638 Ga0207674_10076666
1639 Ga0207674_10222334
1640 Ga0207675_100001765
1641 Ga0207675_100044553
1642 Ga0207675_100088762
1643 Ga0207675_100094620
1644 Ga0207675_100182837
1645 Ga0207675_100184586
1646 Ga0207683_10004090
1647 Ga0207683_10077881
1648 Ga0207683_10109374
1649 Ga0207698_10113188
1650 Ga0207698_10551332
1651 Ga0209982_1001382
1652 Ga0210002_1021252
1653 Ga0209983_1000491
1654 Ga0209588_1000993
1655 Ga0209971_1000114
1656 Ga0209971_1001616
1657 Ga0209966_1000688
1658 Ga0209998_10000110
1659 Ga0209998_10034054
1660 Ga0209974_10006113
1661 Ga0209974_10006349
1662 Ga0209974_10012819
1663 Ga0207428_10000173
1664 Ga0207428_10005369
1665 Ga0207428_10057730
1666 Ga0207428_10125393
1667 Ga0207428_10135928
1668 Ga0268266_10060664
1669 Ga0268266_10061427
1670 Ga0268266_10085607
1671 Ga0268266_10095275
1672 Ga0268265_10003810
1673 Ga0268265_10006355
1674 Ga0268265_10024859
1675 Ga0268265_10128099
1676 Ga0268265_10141641
1677 Ga0268264_10025788
1678 Ga0268264_10030465
1679 Ga0268264_10067838
1680 Ga0268264_10078049
1681 Ga0268264_10125697
1682 Ga0268264_10480527
1683 Ga0265337_1005118
1684 Ga0265323_10000133
1685 Ga0265336_10001001
1686 Ga0265338_10000642
1687 Ga0265338_10000660
1688 Ga0265338_10000709
1689 Ga0265338_10003614
1690 Ga0265324_10047871
1691 Ga0265332_10002292
1692 Ga0265328_10003091
1693 Ga0265320_10000411
1694 Ga0265320_10000566
1695 Ga0265320_10048305
1696 Ga0265329_10014294
1697 Ga0265331_10000051
1698 Ga0265316_10000030
1699 Ga0265316_10046152
1700 Ga0307408_100060896
1701 Ga0307408_100328115
1702 Ga0307408_100329791
1703 Ga0316575_10006694
1704 Ga0316579_10054024
1705 Ga0265314_10000563
1706 Ga0265314_10135231
1707 Ga0265342_10002980
1708 Ga0316578_10000111
1709 Ga0316578_10060309
1710 Ga0316578_10150364
1711 Ga0307405_10046774
1712 Ga0307410_10028564
1713 Ga0307412_10157106
1714 Ga0307412_10206731
1715 Ga0307409_100010053
1716 Ga0307416_100010614
1717 Ga0307411_10174334
1718 Ga0316585_10001163
1719 Ga0316580_10007474
1720 Ga0316592_1000881
1721 Ga0316596_1026813
1722 Ga0373930_0004496
1723 Ga0373928_0000074
1724 Ga0373929_0000368
1725 Ga0373944_0000282
1726 Ga0373949_0008432
1727 Ga0373951_0002694
1728 Ga0373932_0000004
1729 Ga0373945_0001282
1730 Ga0373954_0000875
1731 Ga0373956_0002979
1732 Ga0373956_0008388
1733 Ga0373957_0075651
1734 Ga0373943_0105456
1735 Ga0373946_0055703
1736 Ga0373946_0064199
1737 Ga0373955_0004251
1738 Ga0373955_0101905
1739 Ga0373961_0022421
1740 Ga0373962_0000150
1741 Ga0373962_0092613
1742 Ga0316574_0034233
1743 Ga0316574_0034961
1744 Ga0316574_0259948
1745 Ga0373931_0000009
1746 Ga0373935_0006198
1747 Ga0373935_0053358
1748 Ga0373927_0023515
1749 Ga0373927_0035502
1750 Ga0373933_0041248
1751 Ga0373947_0020014
1752 Ga0373947_0075886
1753 Ga0373947_0217919
1754 Ga0373937_0003172
1755 Ga0373937_0016728
1756 Ga0373937_0028032
1757 Ga0373937_0419895
1758 Ga0316582_0000260
1759 Ga0316584_0005700
1760 Ga0316584_0069095
1761 Ga0373925_0016632
1762 Ga0373925_0109521
1763 Ga0395899_0063033
1764 Ga0395900_0003244
1765 Ga0395898_0002180
1766 Ga0395898_0041735
1767 Ga0395905_0006672
1768 Ga0395905_0066560
1769 Ga0395905_0330275
1770 Ga0395901_0003824
1771 Ga0395901_0086544
1772 Ga0242420_002725
1773 Ga0436365_0187223
1774 Ga0436360_0027657
1775 Ga0436360_0313550
1776 Ga0436361_0130426
1777 Ga0436361_0277088
1778 Ga0439448_0014137
1779 Ga0439435_0032402
1780 Ga0439464_0029028
1781 Ga0451577_0001837
1782 Ga0451577_0006180
1783 Ga0451577_0014249
1784 Ga0451577_0119630
1785 Ga0453683_0005967
1786 Ga0453683_0007115
1787 Ga0453683_0023791
1788 Ga0453683_0051286
1789 Ga0453683_0052211
1790 Ga0453684_0002113
1791 Ga0453684_0004388
1792 Ga0453684_0004837
1793 Ga0453684_0032268
1794 Ga0453684_0109310
1795 Ga0451576_0002497
1796 Ga0451576_0152336
1797 Ga0451576_0172891
1798 Ga0451576_0272171
1799 Ga0451576_0377202
1800 Ga0451576_0412557
1801 Ga0466967_0221199
1802 Ga0495592_0084649
1803 Ga0495629_0033190
1804 Ga0495629_0105363
1805 Ga0495641_0015794
1806 Ga0495651_0137739
1807 Ga0495651_0260520
1808 Ga0495653_0002611
1809 Ga0495580_0000861
1810 Ga0495580_0006261
1811 Ga0495580_0006893
1812 Ga0495580_0129114
1813 Ga0495662_0030376
1814 Ga0495664_0000195
1815 Ga0495664_0035309
1816 Ga0495584_0043362
1817 Ga0495618_0003416
1818 Ga0495618_0065797
1819 Ga0495618_0067541
1820 Ga0495628_0000786
1821 Ga0495628_0006854
1822 Ga0495628_0299048
1823 Ga0495630_0001698
1824 Ga0495630_0005903
1825 Ga0495630_0040804
1826 Ga0495630_0353972
1827 Ga0495648_0002300
1828 Ga0495666_0001100
1829 Ga0495666_0010292
1830 Ga0495666_0036050
1831 Ga0495652_0126890
1832 Ga0495652_0141036
1833 Ga0495652_0183638
1834 Ga0495665_0080165
1835 Ga0495640_0029864
1836 Ga0495640_0143210
1837 Ga0495640_0228468
1838 Ga0495586_0015118
1839 Ga0495586_0041046
1840 Ga0495587_0000941
1841 Ga0495645_0006369
1842 Ga0495645_0022427
1843 Ga0495645_0054498
1844 Ga0495634_0004555
1845 Ga0495634_0025293
1846 Ga0495634_0230578
1847 Ga0495635_0004455
1848 Ga0495661_0005214
1849 Ga0495588_0062002
1850 Ga0495599_0007509
1851 Ga0495599_0054697
1852 Ga0495623_0018982
1853 Ga0495623_0044233
1854 Ga0495646_0005209
1855 Ga0495658_0002187
1856 Ga0495658_0110990
1857 Ga0495658_0249069
1858 Ga0495613_0003184
1859 Ga0495613_0014245
1860 Ga0495624_0050359
1861 Ga0495624_0096689
1862 Ga0495581_0005144
1863 Ga0495581_0016169
1864 Ga0495581_0111393
1865 Ga0495604_0009806
1866 Ga0495604_0046941
1867 Ga0495636_0015594
1868 Ga0495674_0006562
1869 Ga0495674_0015770
1870 Ga0495676_0015785
1871 Ga0495680_0018934
1872 Ga0495680_0046332
1873 Ga0495675_0031241
1874 Ga0495679_001933
1875 Ga0495684_0009898
1876 Ga0495684_0032446
1877 Ga0495593_0000422
1878 Ga0495602_0085184
1879 Ga0495602_0166120
1880 Ga0495614_0005975
1881 Ga0496100_0192003
1882 Ga0496100_0340270
1883 Ga0496101_0021727
1884 Ga0496101_0145590
1885 Ga0496104_0129777
1886 Ga0496104_0277710
1887 Ga0496105_0103863
1888 Ga0496107_0060266
1889 Ga0496107_0106113
1890 Ga0496109_0051100
1891 Ga0496109_0122914
1892 Ga0496109_0164603
1893 Ga0496110_0067726
1894 Ga0496111_0316754
1895 Ga0496113_0058952
1896 Ga0496114_0019752
1897 Ga0496114_0145409
1898 Ga0496115_0003213
1899 Ga0496115_0003542
1900 Ga0496115_0039282
1901 Ga0496115_0155706
1902 Ga0496115_0179126
1903 Ga0501298_019024
1904 Ga0501031_0000246
1905 Ga0501033_0001544
1906 Ga0501033_0023591
1907 Ga0501033_0036582
1908 Ga0501036_0076172
1909 Ga0501036_0231765
1910 Ga0501037_0053742
1911 Ga0501038_0097989
1912 Ga0501038_0335051
1913 Ga0501039_0008640
1914 Ga0501040_0002393
1915 Ga0501040_0011340
1916 Ga0501040_0038810
1917 Ga0501041_0016543
1918 Ga0501041_0055435
1919 Ga0501042_0009482
1920 Ga0501046_0218642
1921 Ga0501048_0206074
1922 Ga0501068_0010801
1923 Ga0501070_0130716
1924 Ga0501071_0053240
1925 Ga0501071_0221308
1926 Ga0501072_0025619
1927 Ga0501073_0176815
1928 Ga0501075_0013066
1929 Ga0501075_0038792
1930 Ga0501075_0055238
1931 Ga0501075_0065302
1932 Ga0501076_0004473
1933 Ga0501076_0035495
1934 Ga0501076_0039517
1935 Ga0501076_0074577
1936 Ga0501249_029657
1937 Ga0501225_0029046
1938 Ga0501079_0054382
1939 Ga0501079_0195544
1940 Ga0501079_0318073
1941 Ga0501080_0048892
1942 Ga0501080_0081506
1943 Ga0501081_0016782
1944 Ga0501035_0004068
1945 Ga0501044_0000202
1946 Ga0501044_0016475
1947 Ga0501045_0019035
1948 Ga0501045_0080375
1949 nmdc:mga05p37_105122_c1
1950 nmdc:mga05p37_109808_c1
1951 nmdc:mga05p37_12204_c1
1952 nmdc:mga05p37_142518_c1
1953 nmdc:mga05p37_2749_c1
1954 nmdc:mga05p37_276448_c1
1955 nmdc:mga05p37_313499_c1
1956 nmdc:mga05p37_412034_c1
1957 nmdc:mga05p37_438076_c1
1958 nmdc:mga05p37_488531_c1
1959 nmdc:mga05p37_529319_c1
1960 nmdc:mga05p37_67709_c1
1961 nmdc:mga05p37_68007_c1
1962 nmdc:mga05p37_9581_c1
1963 nmdc:mga09592_20717_c1
1964 nmdc:mga09592_207516_c1
1965 nmdc:mga09592_61849_c1
1966 nmdc:mga09592_95071_c1
1967 nmdc:mga0qj67_118623_c1
1968 nmdc:mga0qj67_16779_c1
1969 nmdc:mga0qj67_95761_c1
1970 nmdc:mga06r32_104631_c1
1971 nmdc:mga06r32_170865_c1
1972 nmdc:mga06r32_37003_c1
1973 nmdc:mga06r32_41908_c1
1974 nmdc:mga06r32_509599_c1
1975 nmdc:mga08y16_114672_c1
1976 nmdc:mga08y16_1199_c1
1977 nmdc:mga08y16_123421_c1
1978 nmdc:mga08y16_12797_c1
1979 nmdc:mga08y16_13993_c1
1980 nmdc:mga08y16_159704_c1
1981 nmdc:mga08y16_64452_c1
1982 nmdc:mga08y16_6485_c1
1983 nmdc:mga0n895_118394_c1
1984 nmdc:mga0n895_13124_c1
1985 nmdc:mga0n895_148576_c1
1986 nmdc:mga0n895_156979_c1
1987 nmdc:mga0n895_183250_c1
1988 nmdc:mga0n895_225832_c1
1989 nmdc:mga0n895_26900_c1
1990 nmdc:mga0n895_331010_c1
1991 nmdc:mga0n895_428903_c1
1992 nmdc:mga0n895_45185_c1
1993 nmdc:mga0n895_544390_c1
1994 nmdc:mga0n895_67680_c1
1995 nmdc:mga0n895_98102_c1
1996 nmdc:mga0rr50_128341_c1
1997 nmdc:mga0rr50_128947_c1
1998 nmdc:mga0rr50_33483_c1
1999 nmdc:mga0rr50_41604_c1
2000 nmdc:mga08x19_163756_c1
2001 nmdc:mga08x19_166117_c1
2002 nmdc:mga0a205_10348_c1
2003 nmdc:mga0a205_188298_c1
2004 nmdc:mga0a205_213390_c1
2005 nmdc:mga0a205_2381_c1
2006 nmdc:mga0a205_267124_c1
2007 nmdc:mga0a205_308584_c1
2008 nmdc:mga0a205_39831_c1
2009 nmdc:mga0a205_398806_c1
2010 nmdc:mga0a205_4045_c2
2011 nmdc:mga0a205_58934_c1
2012 nmdc:mga0a205_6612_c1
2013 nmdc:mga0a205_72276_c1
2014 nmdc:mga0a205_89364_c1
2015 Ga0495601_0015276
2016 Ga0495601_0085260
2017 Ga0495601_0172267
2018 Ga0495601_0360869
2019 Ga0495619_0013780
2020 Ga0500616_0000003
2021 Ga0500616_0004023
2022 Ga0501084_0024846
2023 Ga0501084_0043612
2024 Ga0501084_0366102
2025 Ga0501082_0018280
2026 Ga0501082_0056836
2027 Ga0501082_0112817
2028 Ga0501082_0280887
2029 Ga0530510_0051029
2030 Ga0530510_0117979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

54

296

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9558 16 282
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9547 14 284
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9532 16 282
5o6m-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9516 17 284
5o6k-assembly1.cif.gz_D structure of polyphosphate kinase from meiothermus ruber n121d 0.9494 17 284
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9506 14 284 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9491 16 284 3.40.50.300
3rhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9313 13 296 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9279 16 284 3.40.50.300
3czpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.926 45 275 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9S6G7-F1-model_v4 Polyphosphate kinase 2 family protein 0.9852 10 301 GO:0006797
GO:0008976
AF-A0A5S4TB79-F1-model_v4 Polyphosphate kinase 2 family protein 0.9848 92 229 GO:0016301
AF-A0A6P0ZQI7-F1-model_v4 deleted 0.9824 42 301
AF-A0A2V5T7V4-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9811 89 191
AF-A0A1E3VL88-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.98 11 300 GO:0006754
GO:0006797
GO:0008976

Map