F488158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 271 | 1012 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10360617|Ga0065715_103606171 |
| Length | 224 |
| Sequence | VGVIDKTAAYRTLESELIAMNKLVILVFALLLSPMVARAQGGHEYSPLVEKTVNYKNWALPNLKTDKPDDLRALVAGKKLVMIVYFAPWCGNWRNEAPIAAKLYEKYKDQGFQVIGVSEYGSRDDVKAYFGEAGAPYPVVTESESRDDKQKTAHYGYRQLTGDGRNWGSPWNIFLEPSKLTATGDVLTEKAWVVNGELVEDEVDKFIASKVSLKTASVIEPCKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 202 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 205 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 206 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 230 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 232 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 238 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 239 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 240 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 241 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 245 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 248 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 250 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 257 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 259 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 260 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 98.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11831596 | 2162886012 | Bacteria | 875 |
| 2 | CNBas_1001844 | 3300000531 | Unclassified | 1142 |
| 3 | JGI24751J29686_10000044 | 3300002459 | Bacteria | 77576 |
| 4 | JGI25406J46586_10002885 | 3300003203 | Bacteria | 8106 |
| 5 | Ga0065704_10087916 | 3300005289 | Bacteria | 2983 |
| 6 | Ga0065704_10100713 | 3300005289 | Unclassified | 2264 |
| 7 | Ga0065704_10119347 | 3300005289 | Unclassified | 1801 |
| 8 | Ga0065704_10141261 | 3300005289 | Bacteria | 1513 |
| 9 | Ga0065704_10158725 | 3300005289 | Bacteria | 1371 |
| 10 | Ga0065712_10000123 | 3300005290 | Bacteria | 89338 |
| 11 | Ga0065712_10010968 | 3300005290 | Bacteria | 2359 |
| 12 | Ga0065712_10048272 | 3300005290 | Unclassified | 739 |
| 13 | Ga0065712_10109847 | 3300005290 | Bacteria | 1848 |
| 14 | Ga0065712_10146274 | 3300005290 | Bacteria | 1406 |
| 15 | Ga0065715_10017239 | 3300005293 | Bacteria | 1615 |
| 16 | Ga0065715_10068422 | 3300005293 | Unclassified | 721 |
| 17 | Ga0065715_10089361 | 3300005293 | Bacteria | 10882 |
| 18 | Ga0065715_10094370 | 3300005293 | Bacteria | 4350 |
| 19 | Ga0065715_10147747 | 3300005293 | Bacteria | 1767 |
| 20 | Ga0065715_10214062 | 3300005293 | Bacteria | 1301 |
| 21 | Ga0065715_10360617 | 3300005293 | Bacteria | 884 |
| 22 | Ga0065715_10586200 | 3300005293 | Bacteria | 717 |
| 23 | Ga0065707_10003187 | 3300005295 | Bacteria | 4287 |
| 24 | Ga0065707_10099533 | 3300005295 | Bacteria | 2989 |
| 25 | Ga0065707_10106281 | 3300005295 | Bacteria | 2603 |
| 26 | Ga0065707_10107559 | 3300005295 | Unclassified | 2549 |
| 27 | Ga0065707_10271768 | 3300005295 | Unclassified | 1070 |
| 28 | Ga0065707_10286549 | 3300005295 | Unclassified | 1034 |
| 29 | Ga0065707_10294977 | 3300005295 | Unclassified | 1016 |
| 30 | Ga0070676_10259573 | 3300005328 | Bacteria | 1163 |
| 31 | Ga0070676_10267149 | 3300005328 | Unclassified | 1148 |
| 32 | Ga0070676_10776551 | 3300005328 | Unclassified | 705 |
| 33 | Ga0070683_100539584 | 3300005329 | Unclassified | 1115 |
| 34 | Ga0070690_100085278 | 3300005330 | Bacteria | 2072 |
| 35 | Ga0070690_100119691 | 3300005330 | Bacteria | 1766 |
| 36 | Ga0070690_100128731 | 3300005330 | Bacteria | 1707 |
| 37 | Ga0070690_100142793 | 3300005330 | Unclassified | 1626 |
| 38 | Ga0070690_100241144 | 3300005330 | Unclassified | 1275 |
| 39 | Ga0070690_100431157 | 3300005330 | Bacteria | 974 |
| 40 | Ga0070670_100000144 | 3300005331 | Bacteria | 66583 |
| 41 | Ga0070670_100016819 | 3300005331 | Bacteria | 6277 |
| 42 | Ga0070670_100046457 | 3300005331 | Bacteria | 3734 |
| 43 | Ga0070670_100132631 | 3300005331 | Unclassified | 2152 |
| 44 | Ga0070670_100253954 | 3300005331 | Bacteria | 1532 |
| 45 | Ga0070670_100292051 | 3300005331 | Unclassified | 1425 |
| 46 | Ga0070670_100872126 | 3300005331 | Bacteria | 815 |
| 47 | Ga0070677_10077455 | 3300005333 | Bacteria | 1414 |
| 48 | Ga0068869_100026023 | 3300005334 | Bacteria | 4069 |
| 49 | Ga0068869_100053422 | 3300005334 | Bacteria | 2937 |
| 50 | Ga0068869_100108174 | 3300005334 | Bacteria | 2112 |
| 51 | Ga0068869_100556540 | 3300005334 | Unclassified | 964 |
| 52 | Ga0068869_100720234 | 3300005334 | Unclassified | 852 |
| 53 | Ga0068869_100744021 | 3300005334 | Unclassified | 839 |
| 54 | Ga0068869_100762964 | 3300005334 | Bacteria | 829 |
| 55 | Ga0068869_101067821 | 3300005334 | Unclassified | 705 |
| 56 | Ga0070666_10058851 | 3300005335 | Bacteria | 2599 |
| 57 | Ga0070666_10077869 | 3300005335 | Bacteria | 2263 |
| 58 | Ga0070680_100000624 | 3300005336 | Bacteria | 24592 |
| 59 | Ga0070682_100000405 | 3300005337 | Bacteria | 28330 |
| 60 | Ga0070682_100003448 | 3300005337 | Bacteria | 8754 |
| 61 | Ga0070682_100011524 | 3300005337 | Bacteria | 5055 |
| 62 | Ga0070682_100702342 | 3300005337 | Bacteria | 811 |
| 63 | Ga0068868_100012130 | 3300005338 | Bacteria | 6293 |
| 64 | Ga0068868_100022784 | 3300005338 | Bacteria | 4733 |
| 65 | Ga0068868_100087038 | 3300005338 | Bacteria | 2512 |
| 66 | Ga0068868_100346800 | 3300005338 | Bacteria | 1271 |
| 67 | Ga0068868_100349530 | 3300005338 | Bacteria | 1266 |
| 68 | Ga0068868_100432309 | 3300005338 | Bacteria | 1142 |
| 69 | Ga0070660_100185064 | 3300005339 | Unclassified | 1686 |
| 70 | Ga0070689_100001209 | 3300005340 | Bacteria | 16353 |
| 71 | Ga0070689_100137948 | 3300005340 | Unclassified | 1959 |
| 72 | Ga0070689_100205479 | 3300005340 | Bacteria | 1610 |
| 73 | Ga0070691_10469824 | 3300005341 | Bacteria | 722 |
| 74 | Ga0070687_100012833 | 3300005343 | Unclassified | 3714 |
| 75 | Ga0070687_100012923 | 3300005343 | Bacteria | 3704 |
| 76 | Ga0070687_100181944 | 3300005343 | Bacteria | 1260 |
| 77 | Ga0070687_100232675 | 3300005343 | Unclassified | 1135 |
| 78 | Ga0070687_100281004 | 3300005343 | Bacteria | 1048 |
| 79 | Ga0070687_100629167 | 3300005343 | Bacteria | 741 |
| 80 | Ga0070687_100759905 | 3300005343 | Bacteria | 683 |
| 81 | Ga0070661_100177215 | 3300005344 | Bacteria | 1621 |
| 82 | Ga0070661_100846179 | 3300005344 | Bacteria | 753 |
| 83 | Ga0070692_10001749 | 3300005345 | Bacteria | 8102 |
| 84 | Ga0070692_10009660 | 3300005345 | Bacteria | 4361 |
| 85 | Ga0070692_10063808 | 3300005345 | Bacteria | 1947 |
| 86 | Ga0070692_10229614 | 3300005345 | Bacteria | 1101 |
| 87 | Ga0070692_10279775 | 3300005345 | Unclassified | 1011 |
| 88 | Ga0070668_100001433 | 3300005347 | Bacteria | 17215 |
| 89 | Ga0070668_101151423 | 3300005347 | Unclassified | 701 |
| 90 | Ga0070669_100001869 | 3300005353 | Bacteria | 15165 |
| 91 | Ga0070669_100036875 | 3300005353 | Bacteria | 3544 |
| 92 | Ga0070669_100064092 | 3300005353 | Bacteria | 2706 |
| 93 | Ga0070669_100186423 | 3300005353 | Bacteria | 1626 |
| 94 | Ga0070669_100308450 | 3300005353 | Bacteria | 1275 |
| 95 | Ga0070669_100389284 | 3300005353 | Unclassified | 1138 |
| 96 | Ga0070675_100159298 | 3300005354 | Bacteria | 1940 |
| 97 | Ga0070671_100003832 | 3300005355 | Bacteria | 11813 |
| 98 | Ga0070671_100085327 | 3300005355 | Bacteria | 2641 |
| 99 | Ga0070671_100225165 | 3300005355 | Bacteria | 1591 |
| 100 | Ga0070671_100339530 | 3300005355 | Bacteria | 1281 |
| 101 | Ga0070674_100792502 | 3300005356 | Bacteria | 818 |
| 102 | Ga0070673_100081375 | 3300005364 | Unclassified | 2626 |
| 103 | Ga0070673_100130152 | 3300005364 | Bacteria | 2110 |
| 104 | Ga0070673_100236121 | 3300005364 | Bacteria | 1588 |
| 105 | Ga0070673_100245695 | 3300005364 | Unclassified | 1558 |
| 106 | Ga0070673_100448507 | 3300005364 | Bacteria | 1160 |
| 107 | Ga0070673_100527543 | 3300005364 | Bacteria | 1071 |
| 108 | Ga0070673_100691062 | 3300005364 | Unclassified | 936 |
| 109 | Ga0070673_101107574 | 3300005364 | Unclassified | 740 |
| 110 | Ga0070688_100327451 | 3300005365 | Unclassified | 1115 |
| 111 | Ga0070688_100790993 | 3300005365 | Unclassified | 741 |
| 112 | Ga0070659_100016910 | 3300005366 | Bacteria | 5482 |
| 113 | Ga0070659_100167007 | 3300005366 | Bacteria | 1801 |
| 114 | Ga0070667_100550020 | 3300005367 | Bacteria | 1061 |
| 115 | Ga0070667_100677013 | 3300005367 | Unclassified | 953 |
| 116 | Ga0070667_100808510 | 3300005367 | Bacteria | 870 |
| 117 | Ga0070703_10000117 | 3300005406 | Bacteria | 41424 |
| 118 | Ga0070703_10021983 | 3300005406 | Bacteria | 1868 |
| 119 | Ga0070703_10036845 | 3300005406 | Bacteria | 1505 |
| 120 | Ga0070703_10047071 | 3300005406 | Unclassified | 1365 |
| 121 | Ga0070701_10036020 | 3300005438 | Bacteria | 2490 |
| 122 | Ga0070701_10040733 | 3300005438 | Bacteria | 2363 |
| 123 | Ga0070701_10200044 | 3300005438 | Unclassified | 1180 |
| 124 | Ga0070705_100007202 | 3300005440 | Bacteria | 5472 |
| 125 | Ga0070705_100056427 | 3300005440 | Bacteria | 2313 |
| 126 | Ga0070705_100067535 | 3300005440 | Bacteria | 2148 |
| 127 | Ga0070705_100117059 | 3300005440 | Bacteria | 1714 |
| 128 | Ga0070705_100119594 | 3300005440 | Bacteria | 1698 |
| 129 | Ga0070700_100000062 | 3300005441 | Bacteria | 79866 |
| 130 | Ga0070700_100007690 | 3300005441 | Bacteria | 5834 |
| 131 | Ga0070700_100010600 | 3300005441 | Bacteria | 5091 |
| 132 | Ga0070700_100122307 | 3300005441 | Unclassified | 1746 |
| 133 | Ga0070700_100166334 | 3300005441 | Unclassified | 1523 |
| 134 | Ga0070700_100426070 | 3300005441 | Bacteria | 1004 |
| 135 | Ga0070694_100002065 | 3300005444 | Bacteria | 11915 |
| 136 | Ga0070694_100004696 | 3300005444 | Bacteria | 8221 |
| 137 | Ga0070694_100007085 | 3300005444 | Bacteria | 6824 |
| 138 | Ga0070694_100009483 | 3300005444 | Bacteria | 5971 |
| 139 | Ga0070694_100026789 | 3300005444 | Unclassified | 3739 |
| 140 | Ga0070694_100056456 | 3300005444 | Unclassified | 2667 |
| 141 | Ga0070694_100116800 | 3300005444 | Bacteria | 1909 |
| 142 | Ga0070694_100127480 | 3300005444 | Bacteria | 1834 |
| 143 | Ga0070694_100162633 | 3300005444 | Bacteria | 1639 |
| 144 | Ga0070694_100206996 | 3300005444 | Bacteria | 1465 |
| 145 | Ga0070694_100340587 | 3300005444 | Bacteria | 1159 |
| 146 | Ga0070694_100341338 | 3300005444 | Unclassified | 1158 |
| 147 | Ga0070694_100540898 | 3300005444 | Unclassified | 932 |
| 148 | Ga0070694_100561943 | 3300005444 | Unclassified | 915 |
| 149 | Ga0070694_100764636 | 3300005444 | Bacteria | 790 |
| 150 | Ga0070694_100863718 | 3300005444 | Bacteria | 745 |
| 151 | Ga0070708_100001183 | 3300005445 | Bacteria | 20061 |
| 152 | Ga0070708_100016622 | 3300005445 | Bacteria | 6111 |
| 153 | Ga0070708_100045673 | 3300005445 | Bacteria | 3861 |
| 154 | Ga0070708_100077547 | 3300005445 | Bacteria | 3003 |
| 155 | Ga0070708_100188259 | 3300005445 | Unclassified | 1930 |
| 156 | Ga0070708_100682779 | 3300005445 | Unclassified | 967 |
| 157 | Ga0070708_101367246 | 3300005445 | Unclassified | 661 |
| 158 | Ga0070663_100440258 | 3300005455 | Bacteria | 1072 |
| 159 | Ga0070663_100449565 | 3300005455 | Unclassified | 1062 |
| 160 | Ga0070678_100159223 | 3300005456 | Bacteria | 1827 |
| 161 | Ga0070662_100021490 | 3300005457 | Bacteria | 4407 |
| 162 | Ga0070662_100280603 | 3300005457 | Bacteria | 1348 |
| 163 | Ga0070662_100386373 | 3300005457 | Bacteria | 1153 |
| 164 | Ga0070662_100389585 | 3300005457 | Bacteria | 1148 |
| 165 | Ga0070662_100537709 | 3300005457 | Unclassified | 978 |
| 166 | Ga0070681_10007691 | 3300005458 | Bacteria | 10538 |
| 167 | Ga0070681_10020025 | 3300005458 | Bacteria | 6703 |
| 168 | Ga0070681_10025119 | 3300005458 | Bacteria | 5995 |
| 169 | Ga0070681_10072851 | 3300005458 | Bacteria | 3397 |
| 170 | Ga0068867_100012727 | 3300005459 | Bacteria | 5953 |
| 171 | Ga0068867_100072287 | 3300005459 | Bacteria | 2581 |
| 172 | Ga0068867_100160907 | 3300005459 | Bacteria | 1770 |
| 173 | Ga0070685_10133495 | 3300005466 | Bacteria | 1555 |
| 174 | Ga0070685_10807272 | 3300005466 | Bacteria | 692 |
| 175 | Ga0070706_100014834 | 3300005467 | Bacteria | 7201 |
| 176 | Ga0070706_100043332 | 3300005467 | Bacteria | 4158 |
| 177 | Ga0070706_100044179 | 3300005467 | Bacteria | 4116 |
| 178 | Ga0070706_100199596 | 3300005467 | Bacteria | 1869 |
| 179 | Ga0070706_100274933 | 3300005467 | Bacteria | 1572 |
| 180 | Ga0070706_100377280 | 3300005467 | Bacteria | 1321 |
| 181 | Ga0070707_100000349 | 3300005468 | Bacteria | 45434 |
| 182 | Ga0070707_100011592 | 3300005468 | Bacteria | 8224 |
| 183 | Ga0070707_100018277 | 3300005468 | Bacteria | 6597 |
| 184 | Ga0070707_100049224 | 3300005468 | Bacteria | 4039 |
| 185 | Ga0070707_100262783 | 3300005468 | Bacteria | 1679 |
| 186 | Ga0070707_100324760 | 3300005468 | Bacteria | 1495 |
| 187 | Ga0070707_100355400 | 3300005468 | Bacteria | 1423 |
| 188 | Ga0070707_100661499 | 3300005468 | Bacteria | 1007 |
| 189 | Ga0070707_100961995 | 3300005468 | Bacteria | 819 |
| 190 | Ga0070707_100995040 | 3300005468 | Unclassified | 804 |
| 191 | Ga0070698_100000126 | 3300005471 | Bacteria | 66495 |
| 192 | Ga0070698_100000214 | 3300005471 | Bacteria | 56486 |
| 193 | Ga0070698_100010112 | 3300005471 | Bacteria | 10078 |
| 194 | Ga0070698_100016175 | 3300005471 | Bacteria | 7877 |
| 195 | Ga0070698_100066657 | 3300005471 | Unclassified | 3622 |
| 196 | Ga0070698_100073161 | 3300005471 | Bacteria | 3434 |
| 197 | Ga0070698_100441906 | 3300005471 | Unclassified | 1236 |
| 198 | Ga0070698_100527919 | 3300005471 | Unclassified | 1119 |
| 199 | Ga0070698_100550075 | 3300005471 | Bacteria | 1094 |
| 200 | Ga0070699_100002296 | 3300005518 | Bacteria | 17204 |
| 201 | Ga0070699_100005850 | 3300005518 | Bacteria | 10747 |
| 202 | Ga0070699_100006980 | 3300005518 | Bacteria | 9815 |
| 203 | Ga0070699_100047578 | 3300005518 | Unclassified | 3711 |
| 204 | Ga0070699_100065301 | 3300005518 | Bacteria | 3158 |
| 205 | Ga0070699_100272927 | 3300005518 | Bacteria | 1514 |
| 206 | Ga0070699_100556037 | 3300005518 | Bacteria | 1045 |
| 207 | Ga0070699_100957260 | 3300005518 | Unclassified | 785 |
| 208 | Ga0070679_100000047 | 3300005530 | Bacteria | 90654 |
| 209 | Ga0070679_100912282 | 3300005530 | Unclassified | 822 |
| 210 | Ga0070684_100776426 | 3300005535 | Unclassified | 895 |
| 211 | Ga0070697_100000217 | 3300005536 | Bacteria | 47346 |
| 212 | Ga0070697_100000380 | 3300005536 | Bacteria | 34660 |
| 213 | Ga0070697_100044313 | 3300005536 | Unclassified | 3603 |
| 214 | Ga0070697_100167892 | 3300005536 | Bacteria | 1856 |
| 215 | Ga0070697_100297976 | 3300005536 | Unclassified | 1386 |
| 216 | Ga0070697_100379832 | 3300005536 | Bacteria | 1224 |
| 217 | Ga0070697_100392709 | 3300005536 | Bacteria | 1203 |
| 218 | Ga0068853_100150415 | 3300005539 | Bacteria | 2095 |
| 219 | Ga0068853_100405778 | 3300005539 | Bacteria | 1276 |
| 220 | Ga0068853_100453121 | 3300005539 | Bacteria | 1207 |
| 221 | Ga0068853_100488941 | 3300005539 | Bacteria | 1161 |
| 222 | Ga0068853_100706419 | 3300005539 | Bacteria | 962 |
| 223 | Ga0068853_100946251 | 3300005539 | Unclassified | 828 |
| 224 | Ga0070672_100270755 | 3300005543 | Bacteria | 1434 |
| 225 | Ga0070672_100809191 | 3300005543 | Unclassified | 825 |
| 226 | Ga0070672_100832642 | 3300005543 | Unclassified | 813 |
| 227 | Ga0070686_100000648 | 3300005544 | Bacteria | 20371 |
| 228 | Ga0070686_100009242 | 3300005544 | Bacteria | 5534 |
| 229 | Ga0070686_100020844 | 3300005544 | Bacteria | 3885 |
| 230 | Ga0070686_100095756 | 3300005544 | Bacteria | 1995 |
| 231 | Ga0070686_100833525 | 3300005544 | Bacteria | 746 |
| 232 | Ga0070686_100914422 | 3300005544 | Unclassified | 715 |
| 233 | Ga0070695_100039878 | 3300005545 | Bacteria | 2970 |
| 234 | Ga0070695_100045540 | 3300005545 | Unclassified | 2797 |
| 235 | Ga0070695_100103748 | 3300005545 | Bacteria | 1919 |
| 236 | Ga0070695_100275601 | 3300005545 | Bacteria | 1234 |
| 237 | Ga0070695_100396149 | 3300005545 | Bacteria | 1046 |
| 238 | Ga0070695_100435736 | 3300005545 | Bacteria | 1001 |
| 239 | Ga0070695_100465171 | 3300005545 | Bacteria | 972 |
| 240 | Ga0070695_100474366 | 3300005545 | Unclassified | 963 |
| 241 | Ga0070695_100723643 | 3300005545 | Unclassified | 792 |
| 242 | Ga0070696_100031651 | 3300005546 | Unclassified | 3627 |
| 243 | Ga0070696_100037727 | 3300005546 | Unclassified | 3333 |
| 244 | Ga0070696_100156761 | 3300005546 | Bacteria | 1675 |
| 245 | Ga0070696_100164135 | 3300005546 | Bacteria | 1638 |
| 246 | Ga0070696_100171861 | 3300005546 | Bacteria | 1602 |
| 247 | Ga0070696_100293413 | 3300005546 | Unclassified | 1243 |
| 248 | Ga0070696_100320826 | 3300005546 | Bacteria | 1192 |
| 249 | Ga0070696_100405273 | 3300005546 | Unclassified | 1068 |
| 250 | Ga0070696_100557848 | 3300005546 | Bacteria | 918 |
| 251 | Ga0070696_100587500 | 3300005546 | Unclassified | 896 |
| 252 | Ga0070693_100001695 | 3300005547 | Bacteria | 10006 |
| 253 | Ga0070693_100004426 | 3300005547 | Bacteria | 6641 |
| 254 | Ga0070693_100031014 | 3300005547 | Bacteria | 2927 |
| 255 | Ga0070665_100622772 | 3300005548 | Bacteria | 1092 |
| 256 | Ga0070665_100883143 | 3300005548 | Bacteria | 907 |
| 257 | Ga0070704_100003232 | 3300005549 | Bacteria | 9315 |
| 258 | Ga0070704_100050571 | 3300005549 | Bacteria | 2922 |
| 259 | Ga0070704_100102529 | 3300005549 | Bacteria | 2159 |
| 260 | Ga0070704_100126943 | 3300005549 | Bacteria | 1970 |
| 261 | Ga0070704_100282862 | 3300005549 | Bacteria | 1375 |
| 262 | Ga0070704_100316789 | 3300005549 | Bacteria | 1305 |
| 263 | Ga0070704_100347020 | 3300005549 | Unclassified | 1252 |
| 264 | Ga0070704_100442306 | 3300005549 | Unclassified | 1118 |
| 265 | Ga0070704_100612336 | 3300005549 | Unclassified | 958 |
| 266 | Ga0070704_100751961 | 3300005549 | Unclassified | 868 |
| 267 | Ga0070704_100817063 | 3300005549 | Unclassified | 834 |
| 268 | Ga0070664_100014957 | 3300005564 | Bacteria | 6332 |
| 269 | Ga0070664_100456518 | 3300005564 | Bacteria | 1174 |
| 270 | Ga0068857_100064025 | 3300005577 | Unclassified | 3269 |
| 271 | Ga0068857_100138045 | 3300005577 | Bacteria | 2202 |
| 272 | Ga0068857_100600591 | 3300005577 | Bacteria | 1040 |
| 273 | Ga0068857_100615014 | 3300005577 | Unclassified | 1028 |
| 274 | Ga0068857_100951970 | 3300005577 | Bacteria | 825 |
| 275 | Ga0068857_101149657 | 3300005577 | Bacteria | 751 |
| 276 | Ga0068854_100082457 | 3300005578 | Unclassified | 2377 |
| 277 | Ga0068854_100121292 | 3300005578 | Bacteria | 1985 |
| 278 | Ga0068854_100129147 | 3300005578 | Bacteria | 1928 |
| 279 | Ga0068854_100181278 | 3300005578 | Bacteria | 1645 |
| 280 | Ga0068854_100378895 | 3300005578 | Unclassified | 1165 |
| 281 | Ga0068856_100006841 | 3300005614 | Bacteria | 11155 |
| 282 | Ga0070702_100013605 | 3300005615 | Bacteria | 4112 |
| 283 | Ga0070702_100063061 | 3300005615 | Bacteria | 2162 |
| 284 | Ga0070702_100095456 | 3300005615 | Bacteria | 1813 |
| 285 | Ga0070702_100217094 | 3300005615 | Bacteria | 1276 |
| 286 | Ga0070702_100473090 | 3300005615 | Bacteria | 914 |
| 287 | Ga0068852_100131637 | 3300005616 | Bacteria | 2304 |
| 288 | Ga0068852_100331812 | 3300005616 | Bacteria | 1480 |
| 289 | Ga0068852_100707377 | 3300005616 | Bacteria | 1018 |
| 290 | Ga0068852_100912548 | 3300005616 | Bacteria | 896 |
| 291 | Ga0068859_100020309 | 3300005617 | Bacteria | 6668 |
| 292 | Ga0068859_100022806 | 3300005617 | Bacteria | 6276 |
| 293 | Ga0068859_100029886 | 3300005617 | Bacteria | 5467 |
| 294 | Ga0068859_100040540 | 3300005617 | Unclassified | 4674 |
| 295 | Ga0068859_100045155 | 3300005617 | Bacteria | 4427 |
| 296 | Ga0068859_100049851 | 3300005617 | Bacteria | 4205 |
| 297 | Ga0068859_100056736 | 3300005617 | Bacteria | 3943 |
| 298 | Ga0068859_100114087 | 3300005617 | Unclassified | 2765 |
| 299 | Ga0068859_100126246 | 3300005617 | Bacteria | 2628 |
| 300 | Ga0068859_100150795 | 3300005617 | Bacteria | 2400 |
| 301 | Ga0068859_100178192 | 3300005617 | Bacteria | 2208 |
| 302 | Ga0068859_100280931 | 3300005617 | Bacteria | 1757 |
| 303 | Ga0068859_100315592 | 3300005617 | Unclassified | 1657 |
| 304 | Ga0068859_100466912 | 3300005617 | Unclassified | 1358 |
| 305 | Ga0068859_101190759 | 3300005617 | Unclassified | 839 |
| 306 | Ga0068864_100064981 | 3300005618 | Bacteria | 3165 |
| 307 | Ga0068864_100098969 | 3300005618 | Bacteria | 2583 |
| 308 | Ga0068864_100122297 | 3300005618 | Bacteria | 2329 |
| 309 | Ga0068864_100124782 | 3300005618 | Bacteria | 2306 |
| 310 | Ga0068864_100151645 | 3300005618 | Bacteria | 2100 |
| 311 | Ga0068864_100167807 | 3300005618 | Bacteria | 1999 |
| 312 | Ga0068864_100239213 | 3300005618 | Unclassified | 1682 |
| 313 | Ga0068864_100264650 | 3300005618 | Unclassified | 1600 |
| 314 | Ga0068864_100322629 | 3300005618 | Bacteria | 1451 |
| 315 | Ga0068864_100443012 | 3300005618 | Bacteria | 1241 |
| 316 | Ga0068864_100482718 | 3300005618 | Bacteria | 1190 |
| 317 | Ga0068864_100483302 | 3300005618 | Unclassified | 1189 |
| 318 | Ga0068864_100610628 | 3300005618 | Unclassified | 1059 |
| 319 | Ga0068866_10031530 | 3300005718 | Bacteria | 2554 |
| 320 | Ga0068866_10076173 | 3300005718 | Bacteria | 1788 |
| 321 | Ga0068861_100006125 | 3300005719 | Bacteria | 8185 |
| 322 | Ga0068861_100023899 | 3300005719 | Bacteria | 4413 |
| 323 | Ga0068861_100034946 | 3300005719 | Bacteria | 3720 |
| 324 | Ga0068861_100089492 | 3300005719 | Bacteria | 2426 |
| 325 | Ga0068861_100130256 | 3300005719 | Unclassified | 2041 |
| 326 | Ga0068861_100223068 | 3300005719 | Unclassified | 1594 |
| 327 | Ga0068861_100312448 | 3300005719 | Bacteria | 1366 |
| 328 | Ga0068861_100698675 | 3300005719 | Unclassified | 942 |
| 329 | Ga0068851_10362742 | 3300005834 | Unclassified | 845 |
| 330 | Ga0068870_10017039 | 3300005840 | Bacteria | 3486 |
| 331 | Ga0068870_10051005 | 3300005840 | Bacteria | 2189 |
| 332 | Ga0068870_10150257 | 3300005840 | Bacteria | 1371 |
| 333 | Ga0068870_10245124 | 3300005840 | Unclassified | 1108 |
| 334 | Ga0068863_100026639 | 3300005841 | Bacteria | 5513 |
| 335 | Ga0068863_100091832 | 3300005841 | Unclassified | 2879 |
| 336 | Ga0068863_100133871 | 3300005841 | Bacteria | 2367 |
| 337 | Ga0068863_100163148 | 3300005841 | Unclassified | 2136 |
| 338 | Ga0068863_100276594 | 3300005841 | Unclassified | 1626 |
| 339 | Ga0068863_100499072 | 3300005841 | Bacteria | 1198 |
| 340 | Ga0068863_100592415 | 3300005841 | Bacteria | 1097 |
| 341 | Ga0068863_100595866 | 3300005841 | Bacteria | 1094 |
| 342 | Ga0068863_100750732 | 3300005841 | Bacteria | 972 |
| 343 | Ga0068858_100014545 | 3300005842 | Bacteria | 7415 |
| 344 | Ga0068858_100033321 | 3300005842 | Bacteria | 4782 |
| 345 | Ga0068858_100115266 | 3300005842 | Unclassified | 2510 |
| 346 | Ga0068858_100146758 | 3300005842 | Unclassified | 2216 |
| 347 | Ga0068858_100161681 | 3300005842 | Bacteria | 2108 |
| 348 | Ga0068858_100176608 | 3300005842 | Bacteria | 2015 |
| 349 | Ga0068858_100355061 | 3300005842 | Unclassified | 1404 |
| 350 | Ga0068858_100377009 | 3300005842 | Bacteria | 1361 |
| 351 | Ga0068858_100726763 | 3300005842 | Bacteria | 967 |
| 352 | Ga0068860_100022110 | 3300005843 | Bacteria | 6156 |
| 353 | Ga0068860_100035879 | 3300005843 | Unclassified | 4754 |
| 354 | Ga0068860_100055864 | 3300005843 | Bacteria | 3753 |
| 355 | Ga0068860_100153124 | 3300005843 | Unclassified | 2221 |
| 356 | Ga0068860_100226580 | 3300005843 | Bacteria | 1816 |
| 357 | Ga0068860_100340565 | 3300005843 | Bacteria | 1474 |
| 358 | Ga0068860_100710189 | 3300005843 | Bacteria | 1015 |
| 359 | Ga0068862_100063414 | 3300005844 | Bacteria | 3180 |
| 360 | Ga0068862_100070844 | 3300005844 | Unclassified | 3010 |
| 361 | Ga0068862_100076839 | 3300005844 | Bacteria | 2890 |
| 362 | Ga0068862_100102217 | 3300005844 | Bacteria | 2509 |
| 363 | Ga0068862_100535118 | 3300005844 | Bacteria | 1117 |
| 364 | Ga0068862_100615184 | 3300005844 | Bacteria | 1044 |
| 365 | Ga0068862_100721625 | 3300005844 | Unclassified | 967 |
| 366 | Ga0081455_10463840 | 3300005937 | Bacteria | 862 |
| 367 | Ga0081540_1063214 | 3300005983 | Unclassified | 1753 |
| 368 | Ga0081539_10000422 | 3300005985 | Bacteria | 90043 |
| 369 | Ga0081539_10007568 | 3300005985 | Bacteria | 9824 |
| 370 | Ga0075432_10071248 | 3300006058 | Unclassified | 1249 |
| 371 | Ga0070715_10000002 | 3300006163 | Bacteria | 389554 |
| 372 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 373 | Ga0070716_100142786 | 3300006173 | Unclassified | 1529 |
| 374 | Ga0070716_100166330 | 3300006173 | Bacteria | 1434 |
| 375 | Ga0070716_100591540 | 3300006173 | Bacteria | 833 |
| 376 | Ga0070716_100815578 | 3300006173 | Unclassified | 724 |
| 377 | Ga0097621_100010916 | 3300006237 | Bacteria | 6668 |
| 378 | Ga0097621_100218321 | 3300006237 | Bacteria | 1661 |
| 379 | Ga0068871_100106369 | 3300006358 | Bacteria | 2355 |
| 380 | Ga0068871_100133507 | 3300006358 | Bacteria | 2106 |
| 381 | Ga0068871_100919660 | 3300006358 | Bacteria | 811 |
| 382 | Ga0075428_100052364 | 3300006844 | Bacteria | 4474 |
| 383 | Ga0075428_100140028 | 3300006844 | Bacteria | 2631 |
| 384 | Ga0075428_100294946 | 3300006844 | Bacteria | 1744 |
| 385 | Ga0075428_100354918 | 3300006844 | Bacteria | 1573 |
| 386 | Ga0075430_100101202 | 3300006846 | Bacteria | 2406 |
| 387 | Ga0075431_100093711 | 3300006847 | Bacteria | 3099 |
| 388 | Ga0075431_100789153 | 3300006847 | Bacteria | 923 |
| 389 | Ga0075433_10042512 | 3300006852 | Bacteria | 3943 |
| 390 | Ga0075433_10066356 | 3300006852 | Bacteria | 3166 |
| 391 | Ga0075433_10073659 | 3300006852 | Unclassified | 3004 |
| 392 | Ga0075433_10111034 | 3300006852 | Bacteria | 2432 |
| 393 | Ga0075433_10119161 | 3300006852 | Unclassified | 2343 |
| 394 | Ga0075433_10592137 | 3300006852 | Bacteria | 974 |
| 395 | Ga0075433_10673275 | 3300006852 | Bacteria | 907 |
| 396 | Ga0075434_100105261 | 3300006871 | Bacteria | 2832 |
| 397 | Ga0075434_100106497 | 3300006871 | Unclassified | 2813 |
| 398 | Ga0075434_100179512 | 3300006871 | Bacteria | 2137 |
| 399 | Ga0075434_100208089 | 3300006871 | Bacteria | 1977 |
| 400 | Ga0075434_100252352 | 3300006871 | Bacteria | 1783 |
| 401 | Ga0075434_100603563 | 3300006871 | Bacteria | 1117 |
| 402 | Ga0075429_100108511 | 3300006880 | Bacteria | 2426 |
| 403 | Ga0075429_100333883 | 3300006880 | Bacteria | 1327 |
| 404 | Ga0075429_100547152 | 3300006880 | Bacteria | 1014 |
| 405 | Ga0075436_100000028 | 3300006914 | Bacteria | 97815 |
| 406 | Ga0075436_100022320 | 3300006914 | Bacteria | 4347 |
| 407 | Ga0097620_100020310 | 3300006931 | Bacteria | 6668 |
| 408 | Ga0097620_100022804 | 3300006931 | Bacteria | 6276 |
| 409 | Ga0097620_100029886 | 3300006931 | Bacteria | 5467 |
| 410 | Ga0097620_100040539 | 3300006931 | Unclassified | 4674 |
| 411 | Ga0097620_100045156 | 3300006931 | Bacteria | 4427 |
| 412 | Ga0097620_100049850 | 3300006931 | Bacteria | 4205 |
| 413 | Ga0097620_100056736 | 3300006931 | Bacteria | 3943 |
| 414 | Ga0097620_100114088 | 3300006931 | Unclassified | 2765 |
| 415 | Ga0097620_100126241 | 3300006931 | Bacteria | 2628 |
| 416 | Ga0097620_100150795 | 3300006931 | Bacteria | 2400 |
| 417 | Ga0097620_100178175 | 3300006931 | Bacteria | 2208 |
| 418 | Ga0097620_100280938 | 3300006931 | Bacteria | 1757 |
| 419 | Ga0097620_100315570 | 3300006931 | Unclassified | 1657 |
| 420 | Ga0097620_100466931 | 3300006931 | Unclassified | 1358 |
| 421 | Ga0097620_101191116 | 3300006931 | Unclassified | 839 |
| 422 | Ga0075435_100021741 | 3300007076 | Unclassified | 4940 |
| 423 | Ga0075435_100426004 | 3300007076 | Bacteria | 1143 |
| 424 | Ga0099794_10004171 | 3300007265 | Bacteria | 5636 |
| 425 | Ga0099795_10058360 | 3300007788 | Bacteria | 1425 |
| 426 | Ga0105251_10167242 | 3300009011 | Unclassified | 991 |
| 427 | Ga0105240_10176724 | 3300009093 | Bacteria | 2523 |
| 428 | Ga0111539_10001877 | 3300009094 | Bacteria | 27899 |
| 429 | Ga0111539_10005687 | 3300009094 | Bacteria | 16134 |
| 430 | Ga0111539_10006549 | 3300009094 | Bacteria | 15010 |
| 431 | Ga0111539_10125960 | 3300009094 | Bacteria | 3001 |
| 432 | Ga0111539_10150037 | 3300009094 | Bacteria | 2729 |
| 433 | Ga0111539_10389665 | 3300009094 | Unclassified | 1622 |
| 434 | Ga0111539_10723326 | 3300009094 | Unclassified | 1159 |
| 435 | Ga0111539_11179587 | 3300009094 | Unclassified | 889 |
| 436 | Ga0105245_10427013 | 3300009098 | Unclassified | 1329 |
| 437 | Ga0105245_10724165 | 3300009098 | Unclassified | 1029 |
| 438 | Ga0105245_10868491 | 3300009098 | Bacteria | 943 |
| 439 | Ga0105245_10985689 | 3300009098 | Bacteria | 887 |
| 440 | Ga0105245_11261122 | 3300009098 | Bacteria | 788 |
| 441 | Ga0105247_10003373 | 3300009101 | Bacteria | 10451 |
| 442 | Ga0105247_10102872 | 3300009101 | Bacteria | 1828 |
| 443 | Ga0105247_10117094 | 3300009101 | Bacteria | 1722 |
| 444 | Ga0105247_10130714 | 3300009101 | Bacteria | 1636 |
| 445 | Ga0105247_10165925 | 3300009101 | Bacteria | 1465 |
| 446 | Ga0105247_10472538 | 3300009101 | Unclassified | 908 |
| 447 | Ga0114129_10010658 | 3300009147 | Bacteria | 13107 |
| 448 | Ga0114129_10049988 | 3300009147 | Bacteria | 5873 |
| 449 | Ga0114129_10071582 | 3300009147 | Unclassified | 4835 |
| 450 | Ga0114129_10149045 | 3300009147 | Bacteria | 3202 |
| 451 | Ga0114129_10200232 | 3300009147 | Bacteria | 2705 |
| 452 | Ga0114129_10210011 | 3300009147 | Bacteria | 2632 |
| 453 | Ga0114129_10240502 | 3300009147 | Bacteria | 2434 |
| 454 | Ga0114129_10279643 | 3300009147 | Bacteria | 2230 |
| 455 | Ga0114129_10589249 | 3300009147 | Bacteria | 1442 |
| 456 | Ga0114129_10873829 | 3300009147 | Unclassified | 1141 |
| 457 | Ga0114129_10876941 | 3300009147 | Unclassified | 1139 |
| 458 | Ga0105243_10000015 | 3300009148 | Bacteria | 251115 |
| 459 | Ga0105243_10012901 | 3300009148 | Bacteria | 6314 |
| 460 | Ga0105243_10014515 | 3300009148 | Bacteria | 5959 |
| 461 | Ga0105243_10055616 | 3300009148 | Unclassified | 3144 |
| 462 | Ga0105243_10066347 | 3300009148 | Bacteria | 2902 |
| 463 | Ga0105243_10092878 | 3300009148 | Bacteria | 2489 |
| 464 | Ga0105243_10197930 | 3300009148 | Unclassified | 1760 |
| 465 | Ga0105243_10267282 | 3300009148 | Bacteria | 1534 |
| 466 | Ga0105243_10422313 | 3300009148 | Bacteria | 1244 |
| 467 | Ga0105243_10434797 | 3300009148 | Unclassified | 1227 |
| 468 | Ga0105243_10735466 | 3300009148 | Bacteria | 966 |
| 469 | Ga0105243_11115138 | 3300009148 | Unclassified | 798 |
| 470 | Ga0105243_11257944 | 3300009148 | Unclassified | 755 |
| 471 | Ga0105241_10045407 | 3300009174 | Bacteria | 3333 |
| 472 | Ga0105241_10105290 | 3300009174 | Bacteria | 2249 |
| 473 | Ga0105241_10503279 | 3300009174 | Unclassified | 1080 |
| 474 | Ga0105241_10513392 | 3300009174 | Bacteria | 1070 |
| 475 | Ga0105241_10592148 | 3300009174 | Unclassified | 1001 |
| 476 | Ga0105241_10921539 | 3300009174 | Unclassified | 813 |
| 477 | Ga0105241_11443259 | 3300009174 | Bacteria | 660 |
| 478 | Ga0105242_10000028 | 3300009176 | Bacteria | 106293 |
| 479 | Ga0105242_10008738 | 3300009176 | Bacteria | 7773 |
| 480 | Ga0105242_10032609 | 3300009176 | Bacteria | 4166 |
| 481 | Ga0105242_10040362 | 3300009176 | Bacteria | 3761 |
| 482 | Ga0105242_10150891 | 3300009176 | Bacteria | 2026 |
| 483 | Ga0105242_10293396 | 3300009176 | Bacteria | 1481 |
| 484 | Ga0105242_10390455 | 3300009176 | Bacteria | 1296 |
| 485 | Ga0105242_10391601 | 3300009176 | Bacteria | 1294 |
| 486 | Ga0105242_10408433 | 3300009176 | Bacteria | 1269 |
| 487 | Ga0105242_10527510 | 3300009176 | Bacteria | 1128 |
| 488 | Ga0105248_10009861 | 3300009177 | Bacteria | 10521 |
| 489 | Ga0105248_10025944 | 3300009177 | Bacteria | 6517 |
| 490 | Ga0105248_10059640 | 3300009177 | Bacteria | 4286 |
| 491 | Ga0105248_10117472 | 3300009177 | Bacteria | 3000 |
| 492 | Ga0105248_10129580 | 3300009177 | Bacteria | 2846 |
| 493 | Ga0105248_10205134 | 3300009177 | Bacteria | 2221 |
| 494 | Ga0105248_10466434 | 3300009177 | Bacteria | 1423 |
| 495 | Ga0105248_10489232 | 3300009177 | Bacteria | 1387 |
| 496 | Ga0105248_10804707 | 3300009177 | Unclassified | 1061 |
| 497 | Ga0105248_10870785 | 3300009177 | Bacteria | 1017 |
| 498 | Ga0105248_11424512 | 3300009177 | Bacteria | 784 |
| 499 | Ga0105237_10000903 | 3300009545 | Bacteria | 39910 |
| 500 | Ga0105237_10101023 | 3300009545 | Bacteria | 2876 |
| 501 | Ga0105237_10490011 | 3300009545 | Bacteria | 1236 |
| 502 | Ga0105238_10005940 | 3300009551 | Bacteria | 12097 |
| 503 | Ga0105238_10013120 | 3300009551 | Bacteria | 8362 |
| 504 | Ga0105249_10000136 | 3300009553 | Bacteria | 96659 |
| 505 | Ga0105249_10011401 | 3300009553 | Bacteria | 7806 |
| 506 | Ga0105249_10043269 | 3300009553 | Bacteria | 4096 |
| 507 | Ga0105249_10066800 | 3300009553 | Bacteria | 3311 |
| 508 | Ga0105249_10234405 | 3300009553 | Bacteria | 1811 |
| 509 | Ga0105249_10324364 | 3300009553 | Bacteria | 1552 |
| 510 | Ga0105249_10406408 | 3300009553 | Unclassified | 1393 |
| 511 | Ga0105249_10624820 | 3300009553 | Bacteria | 1133 |
| 512 | Ga0105249_10783920 | 3300009553 | Bacteria | 1016 |
| 513 | Ga0105239_10095554 | 3300010375 | Bacteria | 3283 |
| 514 | Ga0105239_10109014 | 3300010375 | Bacteria | 3068 |
| 515 | Ga0105239_10334780 | 3300010375 | Bacteria | 1708 |
| 516 | Ga0105239_10542069 | 3300010375 | Unclassified | 1325 |
| 517 | Ga0105239_10669845 | 3300010375 | Bacteria | 1185 |
| 518 | Ga0105239_11401104 | 3300010375 | Bacteria | 807 |
| 519 | Ga0105246_10020265 | 3300011119 | Unclassified | 4263 |
| 520 | Ga0105246_10057398 | 3300011119 | Bacteria | 2693 |
| 521 | Ga0105246_10102185 | 3300011119 | Bacteria | 2090 |
| 522 | Ga0105246_10364491 | 3300011119 | Bacteria | 1188 |
| 523 | Ga0105246_10766682 | 3300011119 | Unclassified | 852 |
| 524 | Ga0157373_10010134 | 3300013100 | Bacteria | 6945 |
| 525 | Ga0157373_10418838 | 3300013100 | Bacteria | 961 |
| 526 | Ga0157371_10511310 | 3300013102 | Unclassified | 888 |
| 527 | Ga0157374_10022394 | 3300013296 | Bacteria | 5637 |
| 528 | Ga0157374_10052804 | 3300013296 | Bacteria | 3787 |
| 529 | Ga0157378_10003478 | 3300013297 | Bacteria | 13980 |
| 530 | Ga0157378_10009116 | 3300013297 | Bacteria | 8636 |
| 531 | Ga0157378_10014880 | 3300013297 | Bacteria | 6807 |
| 532 | Ga0157378_10017810 | 3300013297 | Bacteria | 6237 |
| 533 | Ga0157378_10029842 | 3300013297 | Unclassified | 4816 |
| 534 | Ga0157378_10067110 | 3300013297 | Bacteria | 3214 |
| 535 | Ga0157378_10088050 | 3300013297 | Bacteria | 2817 |
| 536 | Ga0157378_10099596 | 3300013297 | Bacteria | 2652 |
| 537 | Ga0157378_10127387 | 3300013297 | Bacteria | 2353 |
| 538 | Ga0157378_10127853 | 3300013297 | Bacteria | 2349 |
| 539 | Ga0157378_10225211 | 3300013297 | Unclassified | 1784 |
| 540 | Ga0157378_10240225 | 3300013297 | Bacteria | 1730 |
| 541 | Ga0157378_10529931 | 3300013297 | Bacteria | 1180 |
| 542 | Ga0157378_11115083 | 3300013297 | Unclassified | 826 |
| 543 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 544 | Ga0163162_10020922 | 3300013306 | Bacteria | 6435 |
| 545 | Ga0163162_10022132 | 3300013306 | Bacteria | 6265 |
| 546 | Ga0163162_10094875 | 3300013306 | Bacteria | 3070 |
| 547 | Ga0163162_10119313 | 3300013306 | Bacteria | 2740 |
| 548 | Ga0163162_10137921 | 3300013306 | Unclassified | 2550 |
| 549 | Ga0163162_10221403 | 3300013306 | Bacteria | 2022 |
| 550 | Ga0163162_10323460 | 3300013306 | Bacteria | 1675 |
| 551 | Ga0163162_10335240 | 3300013306 | Bacteria | 1645 |
| 552 | Ga0163162_10374622 | 3300013306 | Unclassified | 1557 |
| 553 | Ga0163162_10803230 | 3300013306 | Bacteria | 1058 |
| 554 | Ga0157372_10010237 | 3300013307 | Bacteria | 9957 |
| 555 | Ga0157372_10176650 | 3300013307 | Bacteria | 2472 |
| 556 | Ga0157372_10429643 | 3300013307 | Bacteria | 1539 |
| 557 | Ga0157375_10010051 | 3300013308 | Bacteria | 8320 |
| 558 | Ga0157375_10035989 | 3300013308 | Bacteria | 4731 |
| 559 | Ga0157375_10035990 | 3300013308 | Bacteria | 4731 |
| 560 | Ga0157375_10125642 | 3300013308 | Bacteria | 2679 |
| 561 | Ga0157375_10625156 | 3300013308 | Bacteria | 1235 |
| 562 | Ga0157375_11467363 | 3300013308 | Bacteria | 804 |
| 563 | Ga0157375_11841562 | 3300013308 | Unclassified | 718 |
| 564 | Ga0163163_10001208 | 3300014325 | Bacteria | 21839 |
| 565 | Ga0163163_10005816 | 3300014325 | Bacteria | 10718 |
| 566 | Ga0163163_10009856 | 3300014325 | Bacteria | 8562 |
| 567 | Ga0163163_10040627 | 3300014325 | Unclassified | 4543 |
| 568 | Ga0163163_10044834 | 3300014325 | Bacteria | 4339 |
| 569 | Ga0163163_10050659 | 3300014325 | Unclassified | 4089 |
| 570 | Ga0163163_10060630 | 3300014325 | Bacteria | 3747 |
| 571 | Ga0163163_10125892 | 3300014325 | Bacteria | 2600 |
| 572 | Ga0163163_10199147 | 3300014325 | Bacteria | 2051 |
| 573 | Ga0163163_10271820 | 3300014325 | Bacteria | 1746 |
| 574 | Ga0163163_10612970 | 3300014325 | Unclassified | 1152 |
| 575 | Ga0163163_10870422 | 3300014325 | Unclassified | 964 |
| 576 | Ga0157380_10000283 | 3300014326 | Bacteria | 30521 |
| 577 | Ga0157380_10005686 | 3300014326 | Bacteria | 8720 |
| 578 | Ga0157380_10006247 | 3300014326 | Bacteria | 8366 |
| 579 | Ga0157380_10012283 | 3300014326 | Bacteria | 6208 |
| 580 | Ga0157380_10023647 | 3300014326 | Bacteria | 4638 |
| 581 | Ga0157380_10133196 | 3300014326 | Bacteria | 2124 |
| 582 | Ga0157380_10146960 | 3300014326 | Bacteria | 2032 |
| 583 | Ga0157380_10174950 | 3300014326 | Bacteria | 1880 |
| 584 | Ga0157380_10944655 | 3300014326 | Unclassified | 892 |
| 585 | Ga0157380_11117106 | 3300014326 | Unclassified | 828 |
| 586 | Ga0157377_10070675 | 3300014745 | Bacteria | 2017 |
| 587 | Ga0157377_10122821 | 3300014745 | Unclassified | 1576 |
| 588 | Ga0157379_10151703 | 3300014968 | Unclassified | 2090 |
| 589 | Ga0157379_10201694 | 3300014968 | Bacteria | 1799 |
| 590 | Ga0157379_10326075 | 3300014968 | Bacteria | 1402 |
| 591 | Ga0157379_11081104 | 3300014968 | Bacteria | 768 |
| 592 | Ga0157376_10072525 | 3300014969 | Bacteria | 2929 |
| 593 | Ga0157376_10084445 | 3300014969 | Bacteria | 2734 |
| 594 | Ga0163161_10011523 | 3300017792 | Bacteria | 6135 |
| 595 | Ga0163161_10317381 | 3300017792 | Bacteria | 1231 |
| 596 | Ga0163161_10353702 | 3300017792 | Unclassified | 1168 |
| 597 | Ga0213875_10292036 | 3300021388 | Unclassified | 771 |
| 598 | Ga0207697_10008507 | 3300025315 | Unclassified | 4484 |
| 599 | Ga0207697_10047072 | 3300025315 | Bacteria | 1778 |
| 600 | Ga0207653_10000342 | 3300025885 | Bacteria | 24007 |
| 601 | Ga0207653_10047542 | 3300025885 | Unclassified | 1421 |
| 602 | Ga0207653_10140400 | 3300025885 | Bacteria | 883 |
| 603 | Ga0207682_10058435 | 3300025893 | Bacteria | 1610 |
| 604 | Ga0207642_10013304 | 3300025899 | Bacteria | 3000 |
| 605 | Ga0207710_10000927 | 3300025900 | Bacteria | 15620 |
| 606 | Ga0207710_10185716 | 3300025900 | Bacteria | 1022 |
| 607 | Ga0207647_10007102 | 3300025904 | Bacteria | 8121 |
| 608 | Ga0207647_10240161 | 3300025904 | Bacteria | 1040 |
| 609 | Ga0207685_10000002 | 3300025905 | Bacteria | 438088 |
| 610 | Ga0207645_10091469 | 3300025907 | Unclassified | 1956 |
| 611 | Ga0207643_10000595 | 3300025908 | Bacteria | 22930 |
| 612 | Ga0207643_10029946 | 3300025908 | Bacteria | 3028 |
| 613 | Ga0207643_10338456 | 3300025908 | Unclassified | 943 |
| 614 | Ga0207684_10000314 | 3300025910 | Bacteria | 68706 |
| 615 | Ga0207684_10007903 | 3300025910 | Bacteria | 9510 |
| 616 | Ga0207684_10008012 | 3300025910 | Bacteria | 9437 |
| 617 | Ga0207684_10174676 | 3300025910 | Bacteria | 1852 |
| 618 | Ga0207684_10197959 | 3300025910 | Bacteria | 1733 |
| 619 | Ga0207654_10030444 | 3300025911 | Bacteria | 2962 |
| 620 | Ga0207654_10065174 | 3300025911 | Unclassified | 2144 |
| 621 | Ga0207654_10113646 | 3300025911 | Unclassified | 1689 |
| 622 | Ga0207654_10122934 | 3300025911 | Bacteria | 1632 |
| 623 | Ga0207654_10225858 | 3300025911 | Bacteria | 1244 |
| 624 | Ga0207654_10455917 | 3300025911 | Bacteria | 897 |
| 625 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 626 | Ga0207707_10032652 | 3300025912 | Unclassified | 4557 |
| 627 | Ga0207707_10285501 | 3300025912 | Bacteria | 1428 |
| 628 | Ga0207695_10066767 | 3300025913 | Bacteria | 3692 |
| 629 | Ga0207671_10160785 | 3300025914 | Unclassified | 1739 |
| 630 | Ga0207671_10438007 | 3300025914 | Bacteria | 1040 |
| 631 | Ga0207671_10796205 | 3300025914 | Unclassified | 750 |
| 632 | Ga0207660_10002802 | 3300025917 | Bacteria | 11428 |
| 633 | Ga0207660_10818039 | 3300025917 | Unclassified | 760 |
| 634 | Ga0207662_10002563 | 3300025918 | Bacteria | 9154 |
| 635 | Ga0207662_10072803 | 3300025918 | Bacteria | 2083 |
| 636 | Ga0207662_10094642 | 3300025918 | Unclassified | 1843 |
| 637 | Ga0207662_10118564 | 3300025918 | Unclassified | 1657 |
| 638 | Ga0207662_10135164 | 3300025918 | Bacteria | 1558 |
| 639 | Ga0207652_10001029 | 3300025921 | Bacteria | 25565 |
| 640 | Ga0207646_10000199 | 3300025922 | Bacteria | 81584 |
| 641 | Ga0207646_10012482 | 3300025922 | Bacteria | 8162 |
| 642 | Ga0207646_10072002 | 3300025922 | Bacteria | 3087 |
| 643 | Ga0207646_10076563 | 3300025922 | Bacteria | 2990 |
| 644 | Ga0207646_10237233 | 3300025922 | Bacteria | 1648 |
| 645 | Ga0207646_10914361 | 3300025922 | Unclassified | 778 |
| 646 | Ga0207681_10000407 | 3300025923 | Bacteria | 29960 |
| 647 | Ga0207681_10009399 | 3300025923 | Bacteria | 5973 |
| 648 | Ga0207681_10046565 | 3300025923 | Bacteria | 2917 |
| 649 | Ga0207681_10144120 | 3300025923 | Bacteria | 1778 |
| 650 | Ga0207681_10261458 | 3300025923 | Unclassified | 1355 |
| 651 | Ga0207681_10350999 | 3300025923 | Unclassified | 1181 |
| 652 | Ga0207681_10788517 | 3300025923 | Unclassified | 793 |
| 653 | Ga0207694_10000938 | 3300025924 | Bacteria | 25703 |
| 654 | Ga0207694_10026046 | 3300025924 | Bacteria | 4447 |
| 655 | Ga0207650_10000047 | 3300025925 | Bacteria | 175675 |
| 656 | Ga0207650_10000517 | 3300025925 | Bacteria | 31837 |
| 657 | Ga0207650_10143185 | 3300025925 | Bacteria | 1881 |
| 658 | Ga0207650_10146613 | 3300025925 | Bacteria | 1859 |
| 659 | Ga0207650_10238573 | 3300025925 | Bacteria | 1469 |
| 660 | Ga0207650_10960879 | 3300025925 | Bacteria | 726 |
| 661 | Ga0207659_10063331 | 3300025926 | Bacteria | 2673 |
| 662 | Ga0207659_10855579 | 3300025926 | Unclassified | 782 |
| 663 | Ga0207687_10325776 | 3300025927 | Bacteria | 1245 |
| 664 | Ga0207687_10493327 | 3300025927 | Bacteria | 1021 |
| 665 | Ga0207687_10913768 | 3300025927 | Unclassified | 751 |
| 666 | Ga0207644_10011207 | 3300025931 | Bacteria | 5926 |
| 667 | Ga0207644_10021315 | 3300025931 | Bacteria | 4413 |
| 668 | Ga0207644_10320690 | 3300025931 | Bacteria | 1253 |
| 669 | Ga0207644_10526847 | 3300025931 | Bacteria | 977 |
| 670 | Ga0207690_10013277 | 3300025932 | Bacteria | 4946 |
| 671 | Ga0207690_10808606 | 3300025932 | Unclassified | 775 |
| 672 | Ga0207706_10123297 | 3300025933 | Bacteria | 2280 |
| 673 | Ga0207706_10141782 | 3300025933 | Bacteria | 2114 |
| 674 | Ga0207706_10242791 | 3300025933 | Bacteria | 1574 |
| 675 | Ga0207706_10423200 | 3300025933 | Bacteria | 1154 |
| 676 | Ga0207686_10000031 | 3300025934 | Bacteria | 158735 |
| 677 | Ga0207686_10000381 | 3300025934 | Bacteria | 30953 |
| 678 | Ga0207686_10069084 | 3300025934 | Bacteria | 2265 |
| 679 | Ga0207686_10367006 | 3300025934 | Bacteria | 1088 |
| 680 | Ga0207709_10000009 | 3300025935 | Bacteria | 619238 |
| 681 | Ga0207709_10008224 | 3300025935 | Bacteria | 5778 |
| 682 | Ga0207709_10074255 | 3300025935 | Bacteria | 2169 |
| 683 | Ga0207709_10090719 | 3300025935 | Bacteria | 1997 |
| 684 | Ga0207709_10102046 | 3300025935 | Bacteria | 1898 |
| 685 | Ga0207709_10271435 | 3300025935 | Bacteria | 1248 |
| 686 | Ga0207709_10366874 | 3300025935 | Bacteria | 1092 |
| 687 | Ga0207709_10488021 | 3300025935 | Bacteria | 959 |
| 688 | Ga0207709_10609559 | 3300025935 | Unclassified | 865 |
| 689 | Ga0207670_10000162 | 3300025936 | Bacteria | 44279 |
| 690 | Ga0207670_10036079 | 3300025936 | Bacteria | 3212 |
| 691 | Ga0207670_10308976 | 3300025936 | Unclassified | 1240 |
| 692 | Ga0207670_10415949 | 3300025936 | Bacteria | 1078 |
| 693 | Ga0207670_10734591 | 3300025936 | Unclassified | 819 |
| 694 | Ga0207669_10051011 | 3300025937 | Bacteria | 2477 |
| 695 | Ga0207665_10000016 | 3300025939 | Bacteria | 132853 |
| 696 | Ga0207665_10071790 | 3300025939 | Bacteria | 2363 |
| 697 | Ga0207665_10186956 | 3300025939 | Unclassified | 1503 |
| 698 | Ga0207665_10201259 | 3300025939 | Bacteria | 1451 |
| 699 | Ga0207691_10007252 | 3300025940 | Unclassified | 10692 |
| 700 | Ga0207691_10300598 | 3300025940 | Unclassified | 1379 |
| 701 | Ga0207711_10013606 | 3300025941 | Bacteria | 6759 |
| 702 | Ga0207711_10023587 | 3300025941 | Bacteria | 5151 |
| 703 | Ga0207711_10062117 | 3300025941 | Unclassified | 3222 |
| 704 | Ga0207711_10103335 | 3300025941 | Bacteria | 2523 |
| 705 | Ga0207711_10266561 | 3300025941 | Bacteria | 1575 |
| 706 | Ga0207711_10331757 | 3300025941 | Bacteria | 1407 |
| 707 | Ga0207711_10366906 | 3300025941 | Bacteria | 1335 |
| 708 | Ga0207711_10732150 | 3300025941 | Bacteria | 922 |
| 709 | Ga0207711_10771806 | 3300025941 | Bacteria | 896 |
| 710 | Ga0207711_10846212 | 3300025941 | Bacteria | 851 |
| 711 | Ga0207689_10001827 | 3300025942 | Bacteria | 20116 |
| 712 | Ga0207689_10002806 | 3300025942 | Bacteria | 16095 |
| 713 | Ga0207689_10071917 | 3300025942 | Bacteria | 2841 |
| 714 | Ga0207689_10083245 | 3300025942 | Bacteria | 2631 |
| 715 | Ga0207689_10090588 | 3300025942 | Bacteria | 2513 |
| 716 | Ga0207689_10104862 | 3300025942 | Bacteria | 2323 |
| 717 | Ga0207689_10120891 | 3300025942 | Bacteria | 2154 |
| 718 | Ga0207689_10163621 | 3300025942 | Bacteria | 1833 |
| 719 | Ga0207689_10173036 | 3300025942 | Bacteria | 1780 |
| 720 | Ga0207689_10255676 | 3300025942 | Unclassified | 1449 |
| 721 | Ga0207689_10326790 | 3300025942 | Bacteria | 1273 |
| 722 | Ga0207689_10519742 | 3300025942 | Unclassified | 998 |
| 723 | Ga0207679_10032627 | 3300025945 | Bacteria | 3658 |
| 724 | Ga0207679_10165235 | 3300025945 | Unclassified | 1816 |
| 725 | Ga0207679_10495974 | 3300025945 | Unclassified | 1089 |
| 726 | Ga0207667_10279566 | 3300025949 | Bacteria | 1706 |
| 727 | Ga0207667_10312336 | 3300025949 | Bacteria | 1605 |
| 728 | Ga0207651_10096351 | 3300025960 | Bacteria | 2182 |
| 729 | Ga0207651_10119147 | 3300025960 | Bacteria | 1998 |
| 730 | Ga0207651_10134655 | 3300025960 | Bacteria | 1898 |
| 731 | Ga0207651_10192477 | 3300025960 | Unclassified | 1628 |
| 732 | Ga0207651_10276718 | 3300025960 | Bacteria | 1385 |
| 733 | Ga0207651_10661408 | 3300025960 | Unclassified | 918 |
| 734 | Ga0207651_10821546 | 3300025960 | Viruses | 825 |
| 735 | Ga0207712_10000092 | 3300025961 | Bacteria | 103502 |
| 736 | Ga0207712_10005073 | 3300025961 | Bacteria | 8330 |
| 737 | Ga0207712_10016894 | 3300025961 | Unclassified | 4732 |
| 738 | Ga0207712_10037262 | 3300025961 | Bacteria | 3316 |
| 739 | Ga0207712_10105243 | 3300025961 | Unclassified | 2105 |
| 740 | Ga0207712_10195886 | 3300025961 | Bacteria | 1598 |
| 741 | Ga0207712_10352094 | 3300025961 | Bacteria | 1225 |
| 742 | Ga0207712_10723660 | 3300025961 | Bacteria | 870 |
| 743 | Ga0207668_10002111 | 3300025972 | Bacteria | 11601 |
| 744 | Ga0207640_10014816 | 3300025981 | Bacteria | 4497 |
| 745 | Ga0207640_10035631 | 3300025981 | Bacteria | 3116 |
| 746 | Ga0207640_10100247 | 3300025981 | Bacteria | 2029 |
| 747 | Ga0207640_10137699 | 3300025981 | Bacteria | 1775 |
| 748 | Ga0207640_10389470 | 3300025981 | Unclassified | 1132 |
| 749 | Ga0207658_10234953 | 3300025986 | Bacteria | 1549 |
| 750 | Ga0207677_10674697 | 3300026023 | Bacteria | 914 |
| 751 | Ga0207677_11103331 | 3300026023 | Bacteria | 723 |
| 752 | Ga0207703_10015611 | 3300026035 | Bacteria | 5925 |
| 753 | Ga0207703_10042431 | 3300026035 | Bacteria | 3649 |
| 754 | Ga0207703_10045746 | 3300026035 | Bacteria | 3522 |
| 755 | Ga0207703_10081772 | 3300026035 | Bacteria | 2693 |
| 756 | Ga0207703_10125571 | 3300026035 | Bacteria | 2208 |
| 757 | Ga0207703_10129429 | 3300026035 | Unclassified | 2178 |
| 758 | Ga0207703_10165919 | 3300026035 | Unclassified | 1938 |
| 759 | Ga0207703_10374853 | 3300026035 | Bacteria | 1315 |
| 760 | Ga0207703_10401040 | 3300026035 | Bacteria | 1272 |
| 761 | Ga0207639_10440794 | 3300026041 | Bacteria | 1181 |
| 762 | Ga0207639_10614019 | 3300026041 | Bacteria | 1004 |
| 763 | Ga0207708_10000246 | 3300026075 | Bacteria | 42577 |
| 764 | Ga0207708_10007047 | 3300026075 | Bacteria | 8307 |
| 765 | Ga0207708_10008389 | 3300026075 | Bacteria | 7648 |
| 766 | Ga0207708_10024106 | 3300026075 | Bacteria | 4601 |
| 767 | Ga0207708_10041981 | 3300026075 | Bacteria | 3487 |
| 768 | Ga0207708_10069713 | 3300026075 | Bacteria | 2692 |
| 769 | Ga0207708_10092804 | 3300026075 | Bacteria | 2330 |
| 770 | Ga0207708_10096882 | 3300026075 | Bacteria | 2280 |
| 771 | Ga0207708_10219950 | 3300026075 | Bacteria | 1521 |
| 772 | Ga0207708_10883393 | 3300026075 | Bacteria | 773 |
| 773 | Ga0207708_11022617 | 3300026075 | Unclassified | 719 |
| 774 | Ga0207641_10022808 | 3300026088 | Bacteria | 5154 |
| 775 | Ga0207641_10075438 | 3300026088 | Bacteria | 2912 |
| 776 | Ga0207641_10173552 | 3300026088 | Unclassified | 1970 |
| 777 | Ga0207641_10242088 | 3300026088 | Bacteria | 1681 |
| 778 | Ga0207641_10437633 | 3300026088 | Bacteria | 1262 |
| 779 | Ga0207641_10530339 | 3300026088 | Bacteria | 1146 |
| 780 | Ga0207648_10009860 | 3300026089 | Bacteria | 9108 |
| 781 | Ga0207648_10029342 | 3300026089 | Bacteria | 4878 |
| 782 | Ga0207648_10072970 | 3300026089 | Unclassified | 2991 |
| 783 | Ga0207648_10270326 | 3300026089 | Bacteria | 1518 |
| 784 | Ga0207648_10406731 | 3300026089 | Bacteria | 1234 |
| 785 | Ga0207648_10647435 | 3300026089 | Unclassified | 976 |
| 786 | Ga0207648_11157929 | 3300026089 | Unclassified | 726 |
| 787 | Ga0207676_10003037 | 3300026095 | Bacteria | 11982 |
| 788 | Ga0207676_10008551 | 3300026095 | Bacteria | 7275 |
| 789 | Ga0207676_10029779 | 3300026095 | Bacteria | 4090 |
| 790 | Ga0207676_10120854 | 3300026095 | Unclassified | 2209 |
| 791 | Ga0207676_10246216 | 3300026095 | Bacteria | 1607 |
| 792 | Ga0207676_10275852 | 3300026095 | Unclassified | 1524 |
| 793 | Ga0207676_10300850 | 3300026095 | Bacteria | 1465 |
| 794 | Ga0207676_10312591 | 3300026095 | Bacteria | 1439 |
| 795 | Ga0207676_10528675 | 3300026095 | Bacteria | 1124 |
| 796 | Ga0207676_10787841 | 3300026095 | Unclassified | 927 |
| 797 | Ga0207674_10019731 | 3300026116 | Bacteria | 7296 |
| 798 | Ga0207674_10100220 | 3300026116 | Unclassified | 2878 |
| 799 | Ga0207674_10110002 | 3300026116 | Bacteria | 2731 |
| 800 | Ga0207674_10124154 | 3300026116 | Bacteria | 2547 |
| 801 | Ga0207674_10182682 | 3300026116 | Unclassified | 2048 |
| 802 | Ga0207674_10222075 | 3300026116 | Unclassified | 1838 |
| 803 | Ga0207674_10328590 | 3300026116 | Unclassified | 1479 |
| 804 | Ga0207674_10582220 | 3300026116 | Bacteria | 1081 |
| 805 | Ga0207674_10605508 | 3300026116 | Bacteria | 1058 |
| 806 | Ga0207675_100009521 | 3300026118 | Bacteria | 9088 |
| 807 | Ga0207675_100037618 | 3300026118 | Bacteria | 4513 |
| 808 | Ga0207675_100038139 | 3300026118 | Bacteria | 4484 |
| 809 | Ga0207675_100097066 | 3300026118 | Bacteria | 2775 |
| 810 | Ga0207675_100113146 | 3300026118 | Bacteria | 2562 |
| 811 | Ga0207675_100184169 | 3300026118 | Bacteria | 2001 |
| 812 | Ga0207675_100229512 | 3300026118 | Bacteria | 1791 |
| 813 | Ga0207675_100254800 | 3300026118 | Bacteria | 1699 |
| 814 | Ga0207675_100258880 | 3300026118 | Bacteria | 1686 |
| 815 | Ga0207675_100269991 | 3300026118 | Bacteria | 1651 |
| 816 | Ga0207675_100959419 | 3300026118 | Unclassified | 873 |
| 817 | Ga0207683_10080211 | 3300026121 | Bacteria | 2895 |
| 818 | Ga0207683_10206396 | 3300026121 | Unclassified | 1787 |
| 819 | Ga0207683_10418297 | 3300026121 | Bacteria | 1234 |
| 820 | Ga0207683_10433747 | 3300026121 | Bacteria | 1211 |
| 821 | Ga0207698_10356844 | 3300026142 | Bacteria | 1383 |
| 822 | Ga0207698_10607455 | 3300026142 | Unclassified | 1079 |
| 823 | Ga0207698_10767282 | 3300026142 | Unclassified | 964 |
| 824 | Ga0207428_10002219 | 3300027907 | Bacteria | 19493 |
| 825 | Ga0207428_10013301 | 3300027907 | Bacteria | 7194 |
| 826 | Ga0207428_10069112 | 3300027907 | Bacteria | 2777 |
| 827 | Ga0207428_10296088 | 3300027907 | Unclassified | 1198 |
| 828 | Ga0268266_10765376 | 3300028379 | Bacteria | 932 |
| 829 | Ga0268265_10122619 | 3300028380 | Bacteria | 2144 |
| 830 | Ga0268265_10199819 | 3300028380 | Bacteria | 1733 |
| 831 | Ga0268265_10218442 | 3300028380 | Bacteria | 1666 |
| 832 | Ga0268265_10295444 | 3300028380 | Unclassified | 1456 |
| 833 | Ga0268265_10481059 | 3300028380 | Bacteria | 1166 |
| 834 | Ga0268265_10508919 | 3300028380 | Bacteria | 1136 |
| 835 | Ga0268264_10110750 | 3300028381 | Bacteria | 2404 |
| 836 | Ga0268264_10110935 | 3300028381 | Bacteria | 2402 |
| 837 | Ga0268264_10117790 | 3300028381 | Bacteria | 2336 |
| 838 | Ga0268264_10129367 | 3300028381 | Unclassified | 2236 |
| 839 | Ga0268264_10158615 | 3300028381 | Bacteria | 2036 |
| 840 | Ga0268264_10171380 | 3300028381 | Bacteria | 1963 |
| 841 | Ga0268264_10196724 | 3300028381 | Bacteria | 1841 |
| 842 | Ga0268264_10389432 | 3300028381 | Bacteria | 1337 |
| 843 | Ga0268264_10560060 | 3300028381 | Bacteria | 1122 |
| 844 | Ga0307513_10453815 | 3300031456 | Unclassified | 1006 |
| 845 | Ga0307408_100112541 | 3300031548 | Unclassified | 2093 |
| 846 | Ga0307408_100509753 | 3300031548 | Bacteria | 1055 |
| 847 | Ga0307405_10016049 | 3300031731 | Unclassified | 4074 |
| 848 | Ga0307413_10711986 | 3300031824 | Bacteria | 835 |
| 849 | Ga0307410_10031517 | 3300031852 | Unclassified | 3403 |
| 850 | Ga0307410_10206176 | 3300031852 | Bacteria | 1504 |
| 851 | Ga0307410_10873844 | 3300031852 | Unclassified | 769 |
| 852 | Ga0307406_10098864 | 3300031901 | Unclassified | 1982 |
| 853 | Ga0307406_10871705 | 3300031901 | Bacteria | 765 |
| 854 | Ga0307407_10042041 | 3300031903 | Bacteria | 2560 |
| 855 | Ga0307412_10021603 | 3300031911 | Unclassified | 3935 |
| 856 | Ga0307412_10101083 | 3300031911 | Unclassified | 2039 |
| 857 | Ga0307412_10277657 | 3300031911 | Bacteria | 1314 |
| 858 | Ga0307409_100295642 | 3300031995 | Unclassified | 1504 |
| 859 | Ga0307416_100035493 | 3300032002 | Unclassified | 3809 |
| 860 | Ga0307416_100100284 | 3300032002 | Bacteria | 2518 |
| 861 | Ga0307416_100165479 | 3300032002 | Bacteria | 2050 |
| 862 | Ga0307414_10039672 | 3300032004 | Unclassified | 3173 |
| 863 | Ga0307414_10186038 | 3300032004 | Bacteria | 1676 |
| 864 | Ga0307415_100025864 | 3300032126 | Bacteria | 3693 |
| 865 | Ga0307415_100074212 | 3300032126 | Bacteria | 2403 |
| 866 | Ga0373949_0077918 | 3300035090 | Bacteria | 879 |
| 867 | Ga0373951_0000456 | 3300035091 | Bacteria | 11829 |
| 868 | Ga0373941_0005444 | 3300035115 | Bacteria | 2997 |
| 869 | Ga0373931_0013124 | 3300035691 | Bacteria | 4029 |
| 870 | Ga0373931_0103930 | 3300035691 | Bacteria | 1602 |
| 871 | Ga0395900_0345971 | 3300037418 | Bacteria | 1461 |
| 872 | Ga0395898_0084385 | 3300037466 | Bacteria | 3062 |
| 873 | Ga0395905_0998662 | 3300037471 | Bacteria | 740 |
| 874 | Ga0395901_0371842 | 3300038443 | Bacteria | 1472 |
| 875 | Ga0242422_01462 | 3300038699 | Unclassified | 1632 |
| 876 | Ga0242420_014220 | 3300038996 | Unclassified | 1364 |
| 877 | Ga0439439_0097744 | 3300041406 | Bacteria | 806 |
| 878 | Ga0439431_0084883 | 3300041997 | Bacteria | 857 |
| 879 | Ga0439455_0011346 | 3300042012 | Bacteria | 1977 |
| 880 | Ga0439458_0010133 | 3300042157 | Bacteria | 2098 |
| 881 | Ga0439434_0013509 | 3300042435 | Unclassified | 2425 |
| 882 | Ga0439464_0056276 | 3300042439 | Bacteria | 1145 |
| 883 | Ga0453683_0117074 | 3300044673 | Bacteria | 1677 |
| 884 | Ga0451576_0565285 | 3300045051 | Unclassified | 1195 |
| 885 | Ga0451576_1074163 | 3300045051 | Bacteria | 843 |
| 886 | Ga0451576_1169985 | 3300045051 | Unclassified | 804 |
| 887 | Ga0451576_1215512 | 3300045051 | Bacteria | 787 |
| 888 | Ga0495639_0097569 | 3300046475 | Bacteria | 1385 |
| 889 | Ga0495586_0194213 | 3300046535 | Bacteria | 1150 |
| 890 | Ga0495621_0000007 | 3300046539 | Bacteria | 43743 |
| 891 | Ga0495621_0005112 | 3300046539 | Bacteria | 3747 |
| 892 | Ga0495659_0019215 | 3300046664 | Bacteria | 2285 |
| 893 | Ga0495613_0018185 | 3300046689 | Bacteria | 5240 |
| 894 | Ga0495674_0438464 | 3300047319 | Bacteria | 1051 |
| 895 | Ga0495672_0008903 | 3300047320 | Bacteria | 7335 |
| 896 | Ga0495680_0050097 | 3300047322 | Bacteria | 3267 |
| 897 | Ga0495677_0063226 | 3300047445 | Bacteria | 1375 |
| 898 | Ga0496100_1083949 | 3300048903 | Bacteria | 631 |
| 899 | Ga0496102_0010003 | 3300048905 | Bacteria | 8156 |
| 900 | Ga0496106_0612599 | 3300048909 | Bacteria | 872 |
| 901 | Ga0496107_0063454 | 3300048910 | Bacteria | 2677 |
| 902 | Ga0496108_0082717 | 3300048911 | Bacteria | 2723 |
| 903 | Ga0496108_0445103 | 3300048911 | Bacteria | 1132 |
| 904 | Ga0496110_0208063 | 3300048913 | Bacteria | 1778 |
| 905 | Ga0496110_0458932 | 3300048913 | Unclassified | 1161 |
| 906 | Ga0496110_0544706 | 3300048913 | Bacteria | 1055 |
| 907 | Ga0496112_0113304 | 3300048915 | Bacteria | 2683 |
| 908 | Ga0496112_0353446 | 3300048915 | Bacteria | 1412 |
| 909 | Ga0496112_0686872 | 3300048915 | Bacteria | 952 |
| 910 | Ga0496113_0064526 | 3300048916 | Unclassified | 2769 |
| 911 | Ga0496113_0134251 | 3300048916 | Bacteria | 1944 |
| 912 | Ga0496113_0317784 | 3300048916 | Bacteria | 1248 |
| 913 | Ga0501291_021658 | 3300049514 | Bacteria | 1026 |
| 914 | Ga0501292_011788 | 3300049515 | Bacteria | 1327 |
| 915 | Ga0501293_008273 | 3300049516 | Bacteria | 872 |
| 916 | Ga0501298_022136 | 3300049521 | Bacteria | 1195 |
| 917 | Ga0501299_002870 | 3300049522 | Bacteria | 2437 |
| 918 | Ga0501299_010131 | 3300049522 | Unclassified | 1569 |
| 919 | Ga0501299_050322 | 3300049522 | Bacteria | 859 |
| 920 | Ga0501038_0007240 | 3300049574 | Bacteria | 10248 |
| 921 | Ga0501039_0382406 | 3300049575 | Bacteria | 1106 |
| 922 | Ga0501072_0235266 | 3300049588 | Bacteria | 1459 |
| 923 | Ga0501072_0857907 | 3300049588 | Unclassified | 710 |
| 924 | Ga0501202_003380 | 3300049652 | Bacteria | 2730 |
| 925 | Ga0501202_011961 | 3300049652 | Bacteria | 1632 |
| 926 | Ga0501206_024900 | 3300049653 | Bacteria | 869 |
| 927 | Ga0501207_003570 | 3300049654 | Unclassified | 2078 |
| 928 | Ga0501216_001897 | 3300049660 | Unclassified | 2898 |
| 929 | Ga0501216_002824 | 3300049660 | Bacteria | 2494 |
| 930 | Ga0501217_000772 | 3300049661 | Bacteria | 5565 |
| 931 | Ga0501217_003056 | 3300049661 | Unclassified | 3352 |
| 932 | Ga0501217_091789 | 3300049661 | Bacteria | 853 |
| 933 | Ga0501223_005173 | 3300049663 | Bacteria | 2752 |
| 934 | Ga0501223_005210 | 3300049663 | Bacteria | 2742 |
| 935 | Ga0501223_011979 | 3300049663 | Unclassified | 1739 |
| 936 | Ga0501224_001375 | 3300049664 | Unclassified | 3220 |
| 937 | Ga0501227_084161 | 3300049665 | Bacteria | 836 |
| 938 | Ga0501230_000985 | 3300049667 | Bacteria | 3229 |
| 939 | Ga0501230_066605 | 3300049667 | Bacteria | 736 |
| 940 | Ga0501233_003750 | 3300049668 | Bacteria | 2748 |
| 941 | Ga0501233_007716 | 3300049668 | Bacteria | 2055 |
| 942 | Ga0501233_008092 | 3300049668 | Bacteria | 2019 |
| 943 | Ga0501233_043158 | 3300049668 | Bacteria | 1067 |
| 944 | Ga0501235_003719 | 3300049669 | Unclassified | 3294 |
| 945 | Ga0501235_004036 | 3300049669 | Unclassified | 3177 |
| 946 | Ga0501235_009688 | 3300049669 | Bacteria | 2106 |
| 947 | Ga0501235_018171 | 3300049669 | Bacteria | 1557 |
| 948 | Ga0501235_033090 | 3300049669 | Bacteria | 1170 |
| 949 | Ga0501243_004127 | 3300049675 | Unclassified | 2171 |
| 950 | Ga0501243_007641 | 3300049675 | Bacteria | 1655 |
| 951 | Ga0501249_013306 | 3300049679 | Bacteria | 1748 |
| 952 | Ga0501249_014692 | 3300049679 | Unclassified | 1669 |
| 953 | Ga0501249_035677 | 3300049679 | Bacteria | 1119 |
| 954 | Ga0501249_089058 | 3300049679 | Unclassified | 730 |
| 955 | Ga0501257_011404 | 3300049686 | Unclassified | 2029 |
| 956 | Ga0501257_011905 | 3300049686 | Bacteria | 1988 |
| 957 | Ga0501259_013009 | 3300049688 | Unclassified | 1394 |
| 958 | Ga0501225_0004958 | 3300049705 | Unclassified | 3933 |
| 959 | Ga0501225_0007957 | 3300049705 | Bacteria | 3055 |
| 960 | Ga0501225_0093622 | 3300049705 | Unclassified | 872 |
| 961 | Ga0501234_007226 | 3300049707 | Unclassified | 1739 |
| 962 | Ga0501234_010505 | 3300049707 | Unclassified | 1443 |
| 963 | Ga0501245_020593 | 3300049708 | Bacteria | 1030 |
| 964 | Ga0501079_0917730 | 3300049741 | Bacteria | 690 |
| 965 | Ga0501081_0215047 | 3300049743 | Bacteria | 1397 |
| 966 | Ga0501081_0497792 | 3300049743 | Bacteria | 908 |
| 967 | Ga0501267_009689 | 3300049764 | Unclassified | 965 |
| 968 | Ga0501268_024751 | 3300049765 | Bacteria | 1051 |
| 969 | Ga0501283_001080 | 3300049779 | Bacteria | 3591 |
| 970 | Ga0501212_024371 | 3300049851 | Bacteria | 952 |
| 971 | Ga0501212_024512 | 3300049851 | Bacteria | 949 |
| 972 | Ga0501212_043988 | 3300049851 | Bacteria | 744 |
| 973 | Ga0501226_000589 | 3300049853 | Bacteria | 5006 |
| 974 | nmdc:mga05p37_136097_c1 | 3300050507 | Bacteria | 3012 |
| 975 | nmdc:mga05p37_192430_c1 | 3300050507 | Bacteria | 2475 |
| 976 | nmdc:mga05p37_205646_c1 | 3300050507 | Bacteria | 2381 |
| 977 | nmdc:mga05p37_213946_c1 | 3300050507 | Bacteria | 2329 |
| 978 | nmdc:mga05p37_507149_c1 | 3300050507 | Unclassified | 1383 |
| 979 | nmdc:mga05p37_621407_c1 | 3300050507 | Unclassified | 1216 |
| 980 | nmdc:mga05p37_97921_c1 | 3300050507 | Bacteria | 3613 |
| 981 | nmdc:mga09592_206209_c1 | 3300050508 | Unclassified | 1703 |
| 982 | nmdc:mga09592_26548_c1 | 3300050508 | Unclassified | 4799 |
| 983 | nmdc:mga09592_324285_c1 | 3300050508 | Unclassified | 1334 |
| 984 | nmdc:mga09592_95776_c1 | 3300050508 | Bacteria | 2539 |
| 985 | nmdc:mga0qj67_115701_c1 | 3300050509 | Bacteria | 2167 |
| 986 | nmdc:mga0qj67_204259_c1 | 3300050509 | Bacteria | 1605 |
| 987 | nmdc:mga08y16_100599_c1 | 3300050511 | Bacteria | 3010 |
| 988 | nmdc:mga08y16_233036_c1 | 3300050511 | Bacteria | 1904 |
| 989 | nmdc:mga08y16_697458_c1 | 3300050511 | Unclassified | 1015 |
| 990 | nmdc:mga08y16_8582_c1 | 3300050511 | Bacteria | 10707 |
| 991 | nmdc:mga0n895_253264_c1 | 3300050512 | Bacteria | 1787 |
| 992 | nmdc:mga0n895_264806_c1 | 3300050512 | Bacteria | 1744 |
| 993 | nmdc:mga0n895_266812_c1 | 3300050512 | Bacteria | 1737 |
| 994 | nmdc:mga0n895_434117_c1 | 3300050512 | Bacteria | 1327 |
| 995 | nmdc:mga0n895_76060_c1 | 3300050512 | Unclassified | 3338 |
| 996 | nmdc:mga0rr50_115016_c1 | 3300050513 | Bacteria | 2134 |
| 997 | nmdc:mga0rr50_1432_c1 | 3300050513 | Bacteria | 13118 |
| 998 | nmdc:mga0rr50_153545_c1 | 3300050513 | Bacteria | 1863 |
| 999 | nmdc:mga0rr50_188637_c1 | 3300050513 | Bacteria | 1688 |
| 1000 | nmdc:mga0rr50_545386_c1 | 3300050513 | Unclassified | 987 |
| 1001 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 1002 | nmdc:mga08x19_4099_c1 | 3300050514 | Bacteria | 8644 |
| 1003 | nmdc:mga0a205_284960_c1 | 3300050515 | Bacteria | 1527 |
| 1004 | nmdc:mga0a205_333661_c1 | 3300050515 | Bacteria | 1386 |
| 1005 | nmdc:mga0a205_418409_c1 | 3300050515 | Bacteria | 1202 |
| 1006 | nmdc:mga0a205_42897_c1 | 3300050515 | Bacteria | 4360 |
| 1007 | nmdc:mga0a205_44029_c1 | 3300050515 | Bacteria | 4302 |
| 1008 | nmdc:mga0a205_44167_c1 | 3300050515 | Bacteria | 3958 |
| 1009 | nmdc:mga0a205_81896_c1 | 3300050515 | Bacteria | 3118 |
| 1010 | Ga0495655_0004099 | 3300053083 | Unclassified | 2467 |
| 1011 | Ga0501084_0167175 | 3300054114 | Bacteria | 1856 |
| 1012 | Ga0530510_0435040 | 3300061734 | Bacteria | 991 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025936 | Ga0207670_10734591 | Ga0207670_107345912 | 177 |
| 2 | 3300049708 | Ga0501245_020593 | Ga0501245_020593_130_705 | 187 |
| 3 | 3300005330 | Ga0070690_100241144 | Ga0070690_1002411442 | 188 |
| 4 | 3300005293 | Ga0065715_10094370 | Ga0065715_100943702 | 190 |
| 5 | 3300005459 | Ga0068867_100160907 | Ga0068867_1001609072 | 190 |
| 6 | 3300005536 | Ga0070697_100297976 | Ga0070697_1002979761 | 190 |
| 7 | 3300005618 | Ga0068864_100064981 | Ga0068864_1000649813 | 190 |
| 8 | 3300025931 | Ga0207644_10320690 | Ga0207644_103206902 | 190 |
| 9 | 3300048903 | Ga0496100_1083949 | Ga0496100_1083949_27_605 | 190 |
| 10 | 3300061734 | Ga0530510_0435040 | Ga0530510_0435040_23_601 | 190 |
| 11 | 3300005577 | Ga0068857_100064025 | Ga0068857_1000640253 | 191 |
| 12 | 3300026116 | Ga0207674_10100220 | Ga0207674_101002203 | 191 |
| 13 | 3300006914 | Ga0075436_100000028 | Ga0075436_10000002876 | 192 |
| 14 | 3300050513 | nmdc:mga0rr50_1432_c1 | nmdc:mga0rr50_1432_c1_6532_7140 | 192 |
| 15 | 3300050514 | nmdc:mga08x19_3_c1 | nmdc:mga08x19_3_c1_411762_412370 | 192 |
| 16 | 3300005290 | Ga0065712_10109847 | Ga0065712_101098472 | 195 |
| 17 | 3300005293 | Ga0065715_10147747 | Ga0065715_101477471 | 195 |
| 18 | 3300005364 | Ga0070673_100691062 | Ga0070673_1006910622 | 195 |
| 19 | 3300005468 | Ga0070707_100355400 | Ga0070707_1003554001 | 195 |
| 20 | 3300005549 | Ga0070704_100442306 | Ga0070704_1004423062 | 195 |
| 21 | 3300005618 | Ga0068864_100322629 | Ga0068864_1003226291 | 195 |
| 22 | 3300006880 | Ga0075429_100333883 | Ga0075429_1003338832 | 195 |
| 23 | 3300009094 | Ga0111539_10005687 | Ga0111539_100056873 | 195 |
| 24 | 3300009147 | Ga0114129_10049988 | Ga0114129_100499884 | 195 |
| 25 | 3300009147 | Ga0114129_10589249 | Ga0114129_105892492 | 195 |
| 26 | 3300025960 | Ga0207651_10661408 | Ga0207651_106614082 | 195 |
| 27 | 3300026095 | Ga0207676_10528675 | Ga0207676_105286752 | 195 |
| 28 | 3300050511 | nmdc:mga08y16_100599_c1 | nmdc:mga08y16_100599_c1_1210_1815 | 195 |
| 29 | 3300005549 | Ga0070704_100612336 | Ga0070704_1006123361 | 196 |
| 30 | 3300006880 | Ga0075429_100108511 | Ga0075429_1001085111 | 196 |
| 31 | 3300009147 | Ga0114129_10240502 | Ga0114129_102405022 | 196 |
| 32 | 3300025942 | Ga0207689_10255676 | Ga0207689_102556763 | 196 |
| 33 | 3300050507 | nmdc:mga05p37_621407_c1 | nmdc:mga05p37_621407_c1_173_868 | 196 |
| 34 | 3300050508 | nmdc:mga09592_324285_c1 | nmdc:mga09592_324285_c1_121_816 | 196 |
| 35 | 3300005333 | Ga0070677_10077455 | Ga0070677_100774552 | 197 |
| 36 | 3300005347 | Ga0070668_101151423 | Ga0070668_1011514231 | 197 |
| 37 | 3300005364 | Ga0070673_100130152 | Ga0070673_1001301522 | 197 |
| 38 | 3300005441 | Ga0070700_100122307 | Ga0070700_1001223072 | 197 |
| 39 | 3300005444 | Ga0070694_100127480 | Ga0070694_1001274802 | 197 |
| 40 | 3300005456 | Ga0070678_100159223 | Ga0070678_1001592232 | 197 |
| 41 | 3300005457 | Ga0070662_100280603 | Ga0070662_1002806032 | 197 |
| 42 | 3300005546 | Ga0070696_100164135 | Ga0070696_1001641352 | 197 |
| 43 | 3300005578 | Ga0068854_100121292 | Ga0068854_1001212922 | 197 |
| 44 | 3300005617 | Ga0068859_100029886 | Ga0068859_1000298864 | 197 |
| 45 | 3300005719 | Ga0068861_100034946 | Ga0068861_1000349463 | 197 |
| 46 | 3300005844 | Ga0068862_100063414 | Ga0068862_1000634142 | 197 |
| 47 | 3300006931 | Ga0097620_100029886 | Ga0097620_1000298863 | 197 |
| 48 | 3300009553 | Ga0105249_10066800 | Ga0105249_100668003 | 197 |
| 49 | 3300013297 | Ga0157378_10099596 | Ga0157378_100995963 | 197 |
| 50 | 3300013306 | Ga0163162_10374622 | Ga0163162_103746222 | 197 |
| 51 | 3300013308 | Ga0157375_10035989 | Ga0157375_100359892 | 197 |
| 52 | 3300014326 | Ga0157380_10006247 | Ga0157380_100062477 | 197 |
| 53 | 3300021388 | Ga0213875_10292036 | Ga0213875_102920361 | 197 |
| 54 | 3300025893 | Ga0207682_10058435 | Ga0207682_100584352 | 197 |
| 55 | 3300025923 | Ga0207681_10261458 | Ga0207681_102614582 | 197 |
| 56 | 3300025933 | Ga0207706_10123297 | Ga0207706_101232972 | 197 |
| 57 | 3300025961 | Ga0207712_10037262 | Ga0207712_100372623 | 197 |
| 58 | 3300025981 | Ga0207640_10014816 | Ga0207640_100148163 | 197 |
| 59 | 3300026075 | Ga0207708_10069713 | Ga0207708_100697132 | 197 |
| 60 | 3300026075 | Ga0207708_10096882 | Ga0207708_100968823 | 197 |
| 61 | 3300026118 | Ga0207675_100229512 | Ga0207675_1002295122 | 197 |
| 62 | 3300026121 | Ga0207683_10080211 | Ga0207683_100802113 | 197 |
| 63 | 3300028380 | Ga0268265_10122619 | Ga0268265_101226192 | 197 |
| 64 | 3300006847 | Ga0075431_100093711 | Ga0075431_1000937113 | 198 |
| 65 | 3300009147 | Ga0114129_10149045 | Ga0114129_101490452 | 198 |
| 66 | 3300031548 | Ga0307408_100509753 | Ga0307408_1005097532 | 198 |
| 67 | 3300037418 | Ga0395900_0345971 | Ga0395900_0345971_230_838 | 198 |
| 68 | 3300049663 | Ga0501223_005173 | Ga0501223_005173_490_1122 | 198 |
| 69 | 3300050507 | nmdc:mga05p37_136097_c1 | nmdc:mga05p37_136097_c1_2175_2786 | 198 |
| 70 | 3300050508 | nmdc:mga09592_95776_c1 | nmdc:mga09592_95776_c1_1665_2276 | 198 |
| 71 | 3300050509 | nmdc:mga0qj67_204259_c1 | nmdc:mga0qj67_204259_c1_645_1256 | 198 |
| 72 | 3300005295 | Ga0065707_10107559 | Ga0065707_101075592 | 199 |
| 73 | 3300005331 | Ga0070670_100253954 | Ga0070670_1002539542 | 199 |
| 74 | 3300005334 | Ga0068869_100108174 | Ga0068869_1001081742 | 199 |
| 75 | 3300005335 | Ga0070666_10077869 | Ga0070666_100778692 | 199 |
| 76 | 3300005338 | Ga0068868_100012130 | Ga0068868_1000121305 | 199 |
| 77 | 3300005354 | Ga0070675_100159298 | Ga0070675_1001592982 | 199 |
| 78 | 3300005355 | Ga0070671_100225165 | Ga0070671_1002251652 | 199 |
| 79 | 3300005365 | Ga0070688_100327451 | Ga0070688_1003274512 | 199 |
| 80 | 3300005367 | Ga0070667_100808510 | Ga0070667_1008085102 | 199 |
| 81 | 3300005445 | Ga0070708_100188259 | Ga0070708_1001882592 | 199 |
| 82 | 3300005445 | Ga0070708_101367246 | Ga0070708_1013672461 | 199 |
| 83 | 3300005455 | Ga0070663_100440258 | Ga0070663_1004402582 | 199 |
| 84 | 3300005468 | Ga0070707_100000349 | Ga0070707_10000034927 | 199 |
| 85 | 3300005468 | Ga0070707_100011592 | Ga0070707_1000115924 | 199 |
| 86 | 3300005468 | Ga0070707_100262783 | Ga0070707_1002627832 | 199 |
| 87 | 3300005471 | Ga0070698_100000214 | Ga0070698_10000021447 | 199 |
| 88 | 3300005471 | Ga0070698_100441906 | Ga0070698_1004419062 | 199 |
| 89 | 3300005548 | Ga0070665_100883143 | Ga0070665_1008831432 | 199 |
| 90 | 3300005549 | Ga0070704_100003232 | Ga0070704_1000032327 | 199 |
| 91 | 3300005549 | Ga0070704_100050571 | Ga0070704_1000505713 | 199 |
| 92 | 3300005577 | Ga0068857_100951970 | Ga0068857_1009519701 | 199 |
| 93 | 3300005578 | Ga0068854_100181278 | Ga0068854_1001812782 | 199 |
| 94 | 3300005616 | Ga0068852_100707377 | Ga0068852_1007073771 | 199 |
| 95 | 3300005617 | Ga0068859_100126246 | Ga0068859_1001262462 | 199 |
| 96 | 3300005617 | Ga0068859_100178192 | Ga0068859_1001781922 | 199 |
| 97 | 3300005617 | Ga0068859_101190759 | Ga0068859_1011907591 | 199 |
| 98 | 3300005618 | Ga0068864_100483302 | Ga0068864_1004833021 | 199 |
| 99 | 3300005718 | Ga0068866_10076173 | Ga0068866_100761732 | 199 |
| 100 | 3300005840 | Ga0068870_10051005 | Ga0068870_100510052 | 199 |
| 101 | 3300005840 | Ga0068870_10150257 | Ga0068870_101502572 | 199 |
| 102 | 3300005843 | Ga0068860_100153124 | Ga0068860_1001531243 | 199 |
| 103 | 3300006173 | Ga0070716_100142786 | Ga0070716_1001427862 | 199 |
| 104 | 3300006173 | Ga0070716_100815578 | Ga0070716_1008155781 | 199 |
| 105 | 3300006358 | Ga0068871_100133507 | Ga0068871_1001335071 | 199 |
| 106 | 3300006358 | Ga0068871_100919660 | Ga0068871_1009196601 | 199 |
| 107 | 3300006931 | Ga0097620_100126241 | Ga0097620_1001262412 | 199 |
| 108 | 3300006931 | Ga0097620_100178175 | Ga0097620_1001781752 | 199 |
| 109 | 3300006931 | Ga0097620_101191116 | Ga0097620_1011911161 | 199 |
| 110 | 3300007265 | Ga0099794_10004171 | Ga0099794_100041715 | 199 |
| 111 | 3300009148 | Ga0105243_10092878 | Ga0105243_100928782 | 199 |
| 112 | 3300009176 | Ga0105242_10032609 | Ga0105242_100326093 | 199 |
| 113 | 3300009177 | Ga0105248_10009861 | Ga0105248_100098612 | 199 |
| 114 | 3300009177 | Ga0105248_10129580 | Ga0105248_101295802 | 199 |
| 115 | 3300009545 | Ga0105237_10490011 | Ga0105237_104900112 | 199 |
| 116 | 3300013296 | Ga0157374_10022394 | Ga0157374_100223941 | 199 |
| 117 | 3300013297 | Ga0157378_10017810 | Ga0157378_100178106 | 199 |
| 118 | 3300013297 | Ga0157378_10127853 | Ga0157378_101278532 | 199 |
| 119 | 3300013297 | Ga0157378_10240225 | Ga0157378_102402252 | 199 |
| 120 | 3300013308 | Ga0157375_10125642 | Ga0157375_101256423 | 199 |
| 121 | 3300014325 | Ga0163163_10001208 | Ga0163163_100012089 | 199 |
| 122 | 3300014325 | Ga0163163_10060630 | Ga0163163_100606303 | 199 |
| 123 | 3300014968 | Ga0157379_10151703 | Ga0157379_101517033 | 199 |
| 124 | 3300014969 | Ga0157376_10072525 | Ga0157376_100725252 | 199 |
| 125 | 3300025908 | Ga0207643_10029946 | Ga0207643_100299462 | 199 |
| 126 | 3300025910 | Ga0207684_10007903 | Ga0207684_100079039 | 199 |
| 127 | 3300025914 | Ga0207671_10438007 | Ga0207671_104380072 | 199 |
| 128 | 3300025917 | Ga0207660_10818039 | Ga0207660_108180391 | 199 |
| 129 | 3300025922 | Ga0207646_10000199 | Ga0207646_1000019957 | 199 |
| 130 | 3300025922 | Ga0207646_10012482 | Ga0207646_100124826 | 199 |
| 131 | 3300025925 | Ga0207650_10143185 | Ga0207650_101431852 | 199 |
| 132 | 3300025926 | Ga0207659_10063331 | Ga0207659_100633312 | 199 |
| 133 | 3300025931 | Ga0207644_10021315 | Ga0207644_100213154 | 199 |
| 134 | 3300025935 | Ga0207709_10074255 | Ga0207709_100742552 | 199 |
| 135 | 3300025936 | Ga0207670_10308976 | Ga0207670_103089761 | 199 |
| 136 | 3300025939 | Ga0207665_10186956 | Ga0207665_101869562 | 199 |
| 137 | 3300025941 | Ga0207711_10013606 | Ga0207711_100136063 | 199 |
| 138 | 3300025942 | Ga0207689_10120891 | Ga0207689_101208912 | 199 |
| 139 | 3300025960 | Ga0207651_10821546 | Ga0207651_108215462 | 199 |
| 140 | 3300025981 | Ga0207640_10137699 | Ga0207640_101376992 | 199 |
| 141 | 3300025986 | Ga0207658_10234953 | Ga0207658_102349532 | 199 |
| 142 | 3300026035 | Ga0207703_10401040 | Ga0207703_104010402 | 199 |
| 143 | 3300026088 | Ga0207641_10075438 | Ga0207641_100754382 | 199 |
| 144 | 3300026089 | Ga0207648_10406731 | Ga0207648_104067312 | 199 |
| 145 | 3300026095 | Ga0207676_10008551 | Ga0207676_100085515 | 199 |
| 146 | 3300026116 | Ga0207674_10328590 | Ga0207674_103285902 | 199 |
| 147 | 3300026116 | Ga0207674_10582220 | Ga0207674_105822202 | 199 |
| 148 | 3300026121 | Ga0207683_10433747 | Ga0207683_104337472 | 199 |
| 149 | 3300028379 | Ga0268266_10765376 | Ga0268266_107653762 | 199 |
| 150 | 3300028381 | Ga0268264_10129367 | Ga0268264_101293673 | 199 |
| 151 | 3300041997 | Ga0439431_0084883 | Ga0439431_0084883_172_786 | 199 |
| 152 | 3300046475 | Ga0495639_0097569 | Ga0495639_0097569_576_1199 | 199 |
| 153 | 3300046535 | Ga0495586_0194213 | Ga0495586_0194213_145_768 | 199 |
| 154 | 3300046689 | Ga0495613_0018185 | Ga0495613_0018185_31_654 | 199 |
| 155 | 3300047319 | Ga0495674_0438464 | Ga0495674_0438464_37_645 | 199 |
| 156 | 3300047322 | Ga0495680_0050097 | Ga0495680_0050097_2631_3254 | 199 |
| 157 | 3300049575 | Ga0501039_0382406 | Ga0501039_0382406_47_655 | 199 |
| 158 | 3300049588 | Ga0501072_0235266 | Ga0501072_0235266_536_1144 | 199 |
| 159 | 3300049741 | Ga0501079_0917730 | Ga0501079_0917730_51_659 | 199 |
| 160 | 3300049743 | Ga0501081_0215047 | Ga0501081_0215047_308_916 | 199 |
| 161 | 3300049743 | Ga0501081_0497792 | Ga0501081_0497792_219_833 | 199 |
| 162 | 3300053083 | Ga0495655_0004099 | Ga0495655_0004099_1064_1672 | 199 |
| 163 | 3300054114 | Ga0501084_0167175 | Ga0501084_0167175_1026_1634 | 199 |
| 164 | 3300005289 | Ga0065704_10158725 | Ga0065704_101587252 | 200 |
| 165 | 3300005295 | Ga0065707_10099533 | Ga0065707_100995332 | 200 |
| 166 | 3300005295 | Ga0065707_10294977 | Ga0065707_102949772 | 200 |
| 167 | 3300005328 | Ga0070676_10776551 | Ga0070676_107765511 | 200 |
| 168 | 3300005330 | Ga0070690_100142793 | Ga0070690_1001427932 | 200 |
| 169 | 3300005331 | Ga0070670_100872126 | Ga0070670_1008721261 | 200 |
| 170 | 3300005337 | Ga0070682_100702342 | Ga0070682_1007023421 | 200 |
| 171 | 3300005338 | Ga0068868_100432309 | Ga0068868_1004323091 | 200 |
| 172 | 3300005343 | Ga0070687_100232675 | Ga0070687_1002326752 | 200 |
| 173 | 3300005345 | Ga0070692_10001749 | Ga0070692_100017495 | 200 |
| 174 | 3300005364 | Ga0070673_100448507 | Ga0070673_1004485071 | 200 |
| 175 | 3300005406 | Ga0070703_10000117 | Ga0070703_1000011727 | 200 |
| 176 | 3300005406 | Ga0070703_10036845 | Ga0070703_100368451 | 200 |
| 177 | 3300005440 | Ga0070705_100117059 | Ga0070705_1001170592 | 200 |
| 178 | 3300005440 | Ga0070705_100119594 | Ga0070705_1001195942 | 200 |
| 179 | 3300005441 | Ga0070700_100007690 | Ga0070700_1000076902 | 200 |
| 180 | 3300005444 | Ga0070694_100007085 | Ga0070694_1000070857 | 200 |
| 181 | 3300005444 | Ga0070694_100340587 | Ga0070694_1003405871 | 200 |
| 182 | 3300005444 | Ga0070694_100764636 | Ga0070694_1007646362 | 200 |
| 183 | 3300005445 | Ga0070708_100016622 | Ga0070708_1000166226 | 200 |
| 184 | 3300005445 | Ga0070708_100045673 | Ga0070708_1000456733 | 200 |
| 185 | 3300005445 | Ga0070708_100077547 | Ga0070708_1000775472 | 200 |
| 186 | 3300005466 | Ga0070685_10133495 | Ga0070685_101334952 | 200 |
| 187 | 3300005467 | Ga0070706_100043332 | Ga0070706_1000433322 | 200 |
| 188 | 3300005467 | Ga0070706_100199596 | Ga0070706_1001995962 | 200 |
| 189 | 3300005468 | Ga0070707_100018277 | Ga0070707_1000182776 | 200 |
| 190 | 3300005468 | Ga0070707_100661499 | Ga0070707_1006614992 | 200 |
| 191 | 3300005468 | Ga0070707_100961995 | Ga0070707_1009619951 | 200 |
| 192 | 3300005518 | Ga0070699_100272927 | Ga0070699_1002729271 | 200 |
| 193 | 3300005543 | Ga0070672_100270755 | Ga0070672_1002707552 | 200 |
| 194 | 3300005544 | Ga0070686_100020844 | Ga0070686_1000208444 | 200 |
| 195 | 3300005544 | Ga0070686_100095756 | Ga0070686_1000957562 | 200 |
| 196 | 3300005545 | Ga0070695_100474366 | Ga0070695_1004743662 | 200 |
| 197 | 3300005549 | Ga0070704_100102529 | Ga0070704_1001025292 | 200 |
| 198 | 3300005617 | Ga0068859_100020309 | Ga0068859_1000203096 | 200 |
| 199 | 3300005617 | Ga0068859_100045155 | Ga0068859_1000451552 | 200 |
| 200 | 3300005618 | Ga0068864_100124782 | Ga0068864_1001247823 | 200 |
| 201 | 3300005618 | Ga0068864_100167807 | Ga0068864_1001678072 | 200 |
| 202 | 3300005618 | Ga0068864_100482718 | Ga0068864_1004827181 | 200 |
| 203 | 3300005718 | Ga0068866_10031530 | Ga0068866_100315302 | 200 |
| 204 | 3300005841 | Ga0068863_100595866 | Ga0068863_1005958662 | 200 |
| 205 | 3300005842 | Ga0068858_100033321 | Ga0068858_1000333214 | 200 |
| 206 | 3300005842 | Ga0068858_100115266 | Ga0068858_1001152663 | 200 |
| 207 | 3300006173 | Ga0070716_100166330 | Ga0070716_1001663302 | 200 |
| 208 | 3300006844 | Ga0075428_100052364 | Ga0075428_1000523645 | 200 |
| 209 | 3300006871 | Ga0075434_100208089 | Ga0075434_1002080893 | 200 |
| 210 | 3300006931 | Ga0097620_100020310 | Ga0097620_1000203106 | 200 |
| 211 | 3300006931 | Ga0097620_100045156 | Ga0097620_1000451562 | 200 |
| 212 | 3300007076 | Ga0075435_100426004 | Ga0075435_1004260042 | 200 |
| 213 | 3300009094 | Ga0111539_10006549 | Ga0111539_1000654914 | 200 |
| 214 | 3300009094 | Ga0111539_10389665 | Ga0111539_103896652 | 200 |
| 215 | 3300009148 | Ga0105243_10000015 | Ga0105243_1000001588 | 200 |
| 216 | 3300009176 | Ga0105242_10000028 | Ga0105242_1000002823 | 200 |
| 217 | 3300009176 | Ga0105242_10008738 | Ga0105242_100087383 | 200 |
| 218 | 3300009176 | Ga0105242_10408433 | Ga0105242_104084332 | 200 |
| 219 | 3300009177 | Ga0105248_10059640 | Ga0105248_100596402 | 200 |
| 220 | 3300009177 | Ga0105248_10489232 | Ga0105248_104892322 | 200 |
| 221 | 3300009177 | Ga0105248_11424512 | Ga0105248_114245121 | 200 |
| 222 | 3300011119 | Ga0105246_10102185 | Ga0105246_101021852 | 200 |
| 223 | 3300013297 | Ga0157378_10014880 | Ga0157378_100148807 | 200 |
| 224 | 3300013297 | Ga0157378_10067110 | Ga0157378_100671102 | 200 |
| 225 | 3300013297 | Ga0157378_10088050 | Ga0157378_100880502 | 200 |
| 226 | 3300013297 | Ga0157378_10127387 | Ga0157378_101273872 | 200 |
| 227 | 3300013306 | Ga0163162_10137921 | Ga0163162_101379212 | 200 |
| 228 | 3300014745 | Ga0157377_10122821 | Ga0157377_101228212 | 200 |
| 229 | 3300017792 | Ga0163161_10011523 | Ga0163161_100115235 | 200 |
| 230 | 3300017792 | Ga0163161_10317381 | Ga0163161_103173811 | 200 |
| 231 | 3300025885 | Ga0207653_10000342 | Ga0207653_100003425 | 200 |
| 232 | 3300025885 | Ga0207653_10140400 | Ga0207653_101404001 | 200 |
| 233 | 3300025899 | Ga0207642_10013304 | Ga0207642_100133041 | 200 |
| 234 | 3300025910 | Ga0207684_10197959 | Ga0207684_101979592 | 200 |
| 235 | 3300025918 | Ga0207662_10118564 | Ga0207662_101185642 | 200 |
| 236 | 3300025922 | Ga0207646_10237233 | Ga0207646_102372332 | 200 |
| 237 | 3300025927 | Ga0207687_10493327 | Ga0207687_104933272 | 200 |
| 238 | 3300025934 | Ga0207686_10000031 | Ga0207686_1000003131 | 200 |
| 239 | 3300025934 | Ga0207686_10000381 | Ga0207686_100003812 | 200 |
| 240 | 3300025935 | Ga0207709_10000009 | Ga0207709_10000009206 | 200 |
| 241 | 3300025939 | Ga0207665_10201259 | Ga0207665_102012592 | 200 |
| 242 | 3300025941 | Ga0207711_10331757 | Ga0207711_103317572 | 200 |
| 243 | 3300025941 | Ga0207711_10732150 | Ga0207711_107321501 | 200 |
| 244 | 3300025942 | Ga0207689_10163621 | Ga0207689_101636212 | 200 |
| 245 | 3300025960 | Ga0207651_10096351 | Ga0207651_100963512 | 200 |
| 246 | 3300025961 | Ga0207712_10723660 | Ga0207712_107236601 | 200 |
| 247 | 3300025981 | Ga0207640_10035631 | Ga0207640_100356313 | 200 |
| 248 | 3300026035 | Ga0207703_10045746 | Ga0207703_100457464 | 200 |
| 249 | 3300026035 | Ga0207703_10165919 | Ga0207703_101659192 | 200 |
| 250 | 3300026075 | Ga0207708_10007047 | Ga0207708_100070474 | 200 |
| 251 | 3300026075 | Ga0207708_10092804 | Ga0207708_100928042 | 200 |
| 252 | 3300026088 | Ga0207641_10530339 | Ga0207641_105303392 | 200 |
| 253 | 3300026095 | Ga0207676_10300850 | Ga0207676_103008502 | 200 |
| 254 | 3300026118 | Ga0207675_100959419 | Ga0207675_1009594191 | 200 |
| 255 | 3300027907 | Ga0207428_10002219 | Ga0207428_100022197 | 200 |
| 256 | 3300028380 | Ga0268265_10218442 | Ga0268265_102184421 | 200 |
| 257 | 3300044673 | Ga0453683_0117074 | Ga0453683_0117074_929_1540 | 200 |
| 258 | 3300045051 | Ga0451576_0565285 | Ga0451576_0565285_420_1031 | 200 |
| 259 | 3300046664 | Ga0495659_0019215 | Ga0495659_0019215_1202_1813 | 200 |
| 260 | 3300050511 | nmdc:mga08y16_697458_c1 | nmdc:mga08y16_697458_c1_98_709 | 200 |
| 261 | 3300050511 | nmdc:mga08y16_8582_c1 | nmdc:mga08y16_8582_c1_5902_6513 | 200 |
| 262 | 3300050513 | nmdc:mga0rr50_545386_c1 | nmdc:mga0rr50_545386_c1_71_688 | 200 |
| 263 | 3300050515 | nmdc:mga0a205_418409_c1 | nmdc:mga0a205_418409_c1_113_724 | 200 |
| 264 | 3300005331 | Ga0070670_100046457 | Ga0070670_1000464573 | 201 |
| 265 | 3300005353 | Ga0070669_100064092 | Ga0070669_1000640922 | 201 |
| 266 | 3300005364 | Ga0070673_100527543 | Ga0070673_1005275432 | 201 |
| 267 | 3300005445 | Ga0070708_100682779 | Ga0070708_1006827792 | 201 |
| 268 | 3300005466 | Ga0070685_10807272 | Ga0070685_108072721 | 201 |
| 269 | 3300005468 | Ga0070707_100049224 | Ga0070707_1000492241 | 201 |
| 270 | 3300005468 | Ga0070707_100995040 | Ga0070707_1009950401 | 201 |
| 271 | 3300005471 | Ga0070698_100527919 | Ga0070698_1005279191 | 201 |
| 272 | 3300005518 | Ga0070699_100065301 | Ga0070699_1000653014 | 201 |
| 273 | 3300005536 | Ga0070697_100167892 | Ga0070697_1001678922 | 201 |
| 274 | 3300005539 | Ga0068853_100453121 | Ga0068853_1004531212 | 201 |
| 275 | 3300005546 | Ga0070696_100405273 | Ga0070696_1004052732 | 201 |
| 276 | 3300005546 | Ga0070696_100587500 | Ga0070696_1005875001 | 201 |
| 277 | 3300005549 | Ga0070704_100817063 | Ga0070704_1008170632 | 201 |
| 278 | 3300005577 | Ga0068857_100600591 | Ga0068857_1006005911 | 201 |
| 279 | 3300005578 | Ga0068854_100129147 | Ga0068854_1001291472 | 201 |
| 280 | 3300005841 | Ga0068863_100499072 | Ga0068863_1004990722 | 201 |
| 281 | 3300005844 | Ga0068862_100721625 | Ga0068862_1007216252 | 201 |
| 282 | 3300006163 | Ga0070715_10000002 | Ga0070715_1000000275 | 201 |
| 283 | 3300006173 | Ga0070716_100000001 | Ga0070716_10000000144 | 201 |
| 284 | 3300007788 | Ga0099795_10058360 | Ga0099795_100583601 | 201 |
| 285 | 3300009147 | Ga0114129_10876941 | Ga0114129_108769411 | 201 |
| 286 | 3300009176 | Ga0105242_10390455 | Ga0105242_103904552 | 201 |
| 287 | 3300009176 | Ga0105242_10391601 | Ga0105242_103916011 | 201 |
| 288 | 3300025315 | Ga0207697_10047072 | Ga0207697_100470722 | 201 |
| 289 | 3300025904 | Ga0207647_10240161 | Ga0207647_102401611 | 201 |
| 290 | 3300025905 | Ga0207685_10000002 | Ga0207685_10000002357 | 201 |
| 291 | 3300025922 | Ga0207646_10914361 | Ga0207646_109143612 | 201 |
| 292 | 3300025923 | Ga0207681_10009399 | Ga0207681_100093996 | 201 |
| 293 | 3300025927 | Ga0207687_10325776 | Ga0207687_103257762 | 201 |
| 294 | 3300025934 | Ga0207686_10367006 | Ga0207686_103670061 | 201 |
| 295 | 3300025939 | Ga0207665_10000016 | Ga0207665_1000001640 | 201 |
| 296 | 3300025939 | Ga0207665_10071790 | Ga0207665_100717902 | 201 |
| 297 | 3300026075 | Ga0207708_11022617 | Ga0207708_110226171 | 201 |
| 298 | 3300026088 | Ga0207641_10022808 | Ga0207641_100228083 | 201 |
| 299 | 3300026116 | Ga0207674_10605508 | Ga0207674_106055081 | 201 |
| 300 | 3300031852 | Ga0307410_10206176 | Ga0307410_102061762 | 201 |
| 301 | 3300032002 | Ga0307416_100165479 | Ga0307416_1001654791 | 201 |
| 302 | 3300041406 | Ga0439439_0097744 | Ga0439439_0097744_156_773 | 201 |
| 303 | 3300042439 | Ga0439464_0056276 | Ga0439464_0056276_450_1070 | 201 |
| 304 | 3300050507 | nmdc:mga05p37_507149_c1 | nmdc:mga05p37_507149_c1_718_1341 | 201 |
| 305 | 3300005289 | Ga0065704_10087916 | Ga0065704_100879161 | 202 |
| 306 | 3300005289 | Ga0065704_10141261 | Ga0065704_101412611 | 202 |
| 307 | 3300005293 | Ga0065715_10068422 | Ga0065715_100684221 | 202 |
| 308 | 3300005334 | Ga0068869_100556540 | Ga0068869_1005565402 | 202 |
| 309 | 3300005334 | Ga0068869_100744021 | Ga0068869_1007440212 | 202 |
| 310 | 3300005336 | Ga0070680_100000624 | Ga0070680_10000062421 | 202 |
| 311 | 3300005337 | Ga0070682_100003448 | Ga0070682_1000034484 | 202 |
| 312 | 3300005338 | Ga0068868_100349530 | Ga0068868_1003495302 | 202 |
| 313 | 3300005339 | Ga0070660_100185064 | Ga0070660_1001850642 | 202 |
| 314 | 3300005340 | Ga0070689_100137948 | Ga0070689_1001379482 | 202 |
| 315 | 3300005340 | Ga0070689_100205479 | Ga0070689_1002054792 | 202 |
| 316 | 3300005345 | Ga0070692_10009660 | Ga0070692_100096602 | 202 |
| 317 | 3300005347 | Ga0070668_100001433 | Ga0070668_1000014334 | 202 |
| 318 | 3300005353 | Ga0070669_100001869 | Ga0070669_10000186919 | 202 |
| 319 | 3300005353 | Ga0070669_100186423 | Ga0070669_1001864232 | 202 |
| 320 | 3300005364 | Ga0070673_100081375 | Ga0070673_1000813752 | 202 |
| 321 | 3300005366 | Ga0070659_100167007 | Ga0070659_1001670072 | 202 |
| 322 | 3300005367 | Ga0070667_100550020 | Ga0070667_1005500202 | 202 |
| 323 | 3300005406 | Ga0070703_10021983 | Ga0070703_100219832 | 202 |
| 324 | 3300005438 | Ga0070701_10200044 | Ga0070701_102000442 | 202 |
| 325 | 3300005440 | Ga0070705_100007202 | Ga0070705_1000072023 | 202 |
| 326 | 3300005440 | Ga0070705_100067535 | Ga0070705_1000675352 | 202 |
| 327 | 3300005444 | Ga0070694_100004696 | Ga0070694_1000046961 | 202 |
| 328 | 3300005444 | Ga0070694_100009483 | Ga0070694_1000094833 | 202 |
| 329 | 3300005444 | Ga0070694_100116800 | Ga0070694_1001168002 | 202 |
| 330 | 3300005444 | Ga0070694_100162633 | Ga0070694_1001626332 | 202 |
| 331 | 3300005444 | Ga0070694_100341338 | Ga0070694_1003413382 | 202 |
| 332 | 3300005444 | Ga0070694_100540898 | Ga0070694_1005408982 | 202 |
| 333 | 3300005457 | Ga0070662_100389585 | Ga0070662_1003895852 | 202 |
| 334 | 3300005458 | Ga0070681_10025119 | Ga0070681_100251196 | 202 |
| 335 | 3300005458 | Ga0070681_10072851 | Ga0070681_100728513 | 202 |
| 336 | 3300005459 | Ga0068867_100072287 | Ga0068867_1000722872 | 202 |
| 337 | 3300005467 | Ga0070706_100274933 | Ga0070706_1002749332 | 202 |
| 338 | 3300005467 | Ga0070706_100377280 | Ga0070706_1003772802 | 202 |
| 339 | 3300005471 | Ga0070698_100066657 | Ga0070698_1000666573 | 202 |
| 340 | 3300005471 | Ga0070698_100073161 | Ga0070698_1000731613 | 202 |
| 341 | 3300005518 | Ga0070699_100556037 | Ga0070699_1005560372 | 202 |
| 342 | 3300005530 | Ga0070679_100000047 | Ga0070679_10000004722 | 202 |
| 343 | 3300005536 | Ga0070697_100044313 | Ga0070697_1000443133 | 202 |
| 344 | 3300005536 | Ga0070697_100379832 | Ga0070697_1003798322 | 202 |
| 345 | 3300005536 | Ga0070697_100392709 | Ga0070697_1003927092 | 202 |
| 346 | 3300005539 | Ga0068853_100488941 | Ga0068853_1004889411 | 202 |
| 347 | 3300005539 | Ga0068853_100946251 | Ga0068853_1009462511 | 202 |
| 348 | 3300005543 | Ga0070672_100809191 | Ga0070672_1008091911 | 202 |
| 349 | 3300005543 | Ga0070672_100832642 | Ga0070672_1008326421 | 202 |
| 350 | 3300005545 | Ga0070695_100103748 | Ga0070695_1001037482 | 202 |
| 351 | 3300005545 | Ga0070695_100275601 | Ga0070695_1002756011 | 202 |
| 352 | 3300005545 | Ga0070695_100396149 | Ga0070695_1003961491 | 202 |
| 353 | 3300005545 | Ga0070695_100723643 | Ga0070695_1007236431 | 202 |
| 354 | 3300005546 | Ga0070696_100156761 | Ga0070696_1001567612 | 202 |
| 355 | 3300005547 | Ga0070693_100001695 | Ga0070693_1000016957 | 202 |
| 356 | 3300005547 | Ga0070693_100004426 | Ga0070693_1000044262 | 202 |
| 357 | 3300005549 | Ga0070704_100347020 | Ga0070704_1003470202 | 202 |
| 358 | 3300005549 | Ga0070704_100751961 | Ga0070704_1007519611 | 202 |
| 359 | 3300005577 | Ga0068857_100615014 | Ga0068857_1006150142 | 202 |
| 360 | 3300005614 | Ga0068856_100006841 | Ga0068856_10000684112 | 202 |
| 361 | 3300005615 | Ga0070702_100013605 | Ga0070702_1000136052 | 202 |
| 362 | 3300005617 | Ga0068859_100056736 | Ga0068859_1000567364 | 202 |
| 363 | 3300005719 | Ga0068861_100023899 | Ga0068861_1000238993 | 202 |
| 364 | 3300005719 | Ga0068861_100223068 | Ga0068861_1002230681 | 202 |
| 365 | 3300005841 | Ga0068863_100592415 | Ga0068863_1005924152 | 202 |
| 366 | 3300005842 | Ga0068858_100146758 | Ga0068858_1001467582 | 202 |
| 367 | 3300005844 | Ga0068862_100070844 | Ga0068862_1000708442 | 202 |
| 368 | 3300006173 | Ga0070716_100591540 | Ga0070716_1005915401 | 202 |
| 369 | 3300006844 | Ga0075428_100294946 | Ga0075428_1002949462 | 202 |
| 370 | 3300006852 | Ga0075433_10066356 | Ga0075433_100663562 | 202 |
| 371 | 3300006852 | Ga0075433_10111034 | Ga0075433_101110342 | 202 |
| 372 | 3300006852 | Ga0075433_10592137 | Ga0075433_105921371 | 202 |
| 373 | 3300006871 | Ga0075434_100252352 | Ga0075434_1002523522 | 202 |
| 374 | 3300006931 | Ga0097620_100056736 | Ga0097620_1000567364 | 202 |
| 375 | 3300009098 | Ga0105245_10724165 | Ga0105245_107241651 | 202 |
| 376 | 3300009098 | Ga0105245_10868491 | Ga0105245_108684911 | 202 |
| 377 | 3300009101 | Ga0105247_10472538 | Ga0105247_104725381 | 202 |
| 378 | 3300009147 | Ga0114129_10010658 | Ga0114129_100106589 | 202 |
| 379 | 3300009147 | Ga0114129_10279643 | Ga0114129_102796431 | 202 |
| 380 | 3300009147 | Ga0114129_10873829 | Ga0114129_108738292 | 202 |
| 381 | 3300009148 | Ga0105243_10055616 | Ga0105243_100556163 | 202 |
| 382 | 3300009148 | Ga0105243_10066347 | Ga0105243_100663473 | 202 |
| 383 | 3300009148 | Ga0105243_10434797 | Ga0105243_104347972 | 202 |
| 384 | 3300009148 | Ga0105243_11115138 | Ga0105243_111151381 | 202 |
| 385 | 3300009174 | Ga0105241_10513392 | Ga0105241_105133922 | 202 |
| 386 | 3300009174 | Ga0105241_10921539 | Ga0105241_109215391 | 202 |
| 387 | 3300009545 | Ga0105237_10000903 | Ga0105237_1000090324 | 202 |
| 388 | 3300009545 | Ga0105237_10101023 | Ga0105237_101010233 | 202 |
| 389 | 3300009551 | Ga0105238_10005940 | Ga0105238_1000594010 | 202 |
| 390 | 3300009553 | Ga0105249_10000136 | Ga0105249_1000013657 | 202 |
| 391 | 3300009553 | Ga0105249_10234405 | Ga0105249_102344052 | 202 |
| 392 | 3300009553 | Ga0105249_10324364 | Ga0105249_103243642 | 202 |
| 393 | 3300009553 | Ga0105249_10406408 | Ga0105249_104064082 | 202 |
| 394 | 3300009553 | Ga0105249_10783920 | Ga0105249_107839202 | 202 |
| 395 | 3300010375 | Ga0105239_10334780 | Ga0105239_103347802 | 202 |
| 396 | 3300010375 | Ga0105239_10542069 | Ga0105239_105420691 | 202 |
| 397 | 3300010375 | Ga0105239_10669845 | Ga0105239_106698451 | 202 |
| 398 | 3300013297 | Ga0157378_10529931 | Ga0157378_105299311 | 202 |
| 399 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001429 | 202 |
| 400 | 3300013306 | Ga0163162_10022132 | Ga0163162_100221322 | 202 |
| 401 | 3300013306 | Ga0163162_10094875 | Ga0163162_100948752 | 202 |
| 402 | 3300013306 | Ga0163162_10119313 | Ga0163162_101193132 | 202 |
| 403 | 3300013307 | Ga0157372_10176650 | Ga0157372_101766502 | 202 |
| 404 | 3300013307 | Ga0157372_10429643 | Ga0157372_104296432 | 202 |
| 405 | 3300013308 | Ga0157375_10010051 | Ga0157375_100100516 | 202 |
| 406 | 3300014326 | Ga0157380_10000283 | Ga0157380_1000028321 | 202 |
| 407 | 3300014326 | Ga0157380_10012283 | Ga0157380_100122832 | 202 |
| 408 | 3300014326 | Ga0157380_10023647 | Ga0157380_100236472 | 202 |
| 409 | 3300014326 | Ga0157380_11117106 | Ga0157380_111171062 | 202 |
| 410 | 3300014968 | Ga0157379_10201694 | Ga0157379_102016942 | 202 |
| 411 | 3300014968 | Ga0157379_10326075 | Ga0157379_103260752 | 202 |
| 412 | 3300025885 | Ga0207653_10047542 | Ga0207653_100475422 | 202 |
| 413 | 3300025911 | Ga0207654_10113646 | Ga0207654_101136462 | 202 |
| 414 | 3300025911 | Ga0207654_10122934 | Ga0207654_101229341 | 202 |
| 415 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006291 | 202 |
| 416 | 3300025912 | Ga0207707_10285501 | Ga0207707_102855012 | 202 |
| 417 | 3300025914 | Ga0207671_10796205 | Ga0207671_107962051 | 202 |
| 418 | 3300025917 | Ga0207660_10002802 | Ga0207660_100028025 | 202 |
| 419 | 3300025921 | Ga0207652_10001029 | Ga0207652_1000102913 | 202 |
| 420 | 3300025923 | Ga0207681_10000407 | Ga0207681_1000040715 | 202 |
| 421 | 3300025923 | Ga0207681_10144120 | Ga0207681_101441202 | 202 |
| 422 | 3300025923 | Ga0207681_10350999 | Ga0207681_103509992 | 202 |
| 423 | 3300025924 | Ga0207694_10000938 | Ga0207694_1000093814 | 202 |
| 424 | 3300025925 | Ga0207650_10000517 | Ga0207650_100005172 | 202 |
| 425 | 3300025927 | Ga0207687_10913768 | Ga0207687_109137681 | 202 |
| 426 | 3300025933 | Ga0207706_10242791 | Ga0207706_102427912 | 202 |
| 427 | 3300025933 | Ga0207706_10423200 | Ga0207706_104232002 | 202 |
| 428 | 3300025935 | Ga0207709_10090719 | Ga0207709_100907192 | 202 |
| 429 | 3300025936 | Ga0207670_10036079 | Ga0207670_100360793 | 202 |
| 430 | 3300025940 | Ga0207691_10300598 | Ga0207691_103005982 | 202 |
| 431 | 3300025942 | Ga0207689_10083245 | Ga0207689_100832452 | 202 |
| 432 | 3300025942 | Ga0207689_10173036 | Ga0207689_101730361 | 202 |
| 433 | 3300025942 | Ga0207689_10326790 | Ga0207689_103267902 | 202 |
| 434 | 3300025949 | Ga0207667_10312336 | Ga0207667_103123362 | 202 |
| 435 | 3300025960 | Ga0207651_10119147 | Ga0207651_101191473 | 202 |
| 436 | 3300025961 | Ga0207712_10000092 | Ga0207712_1000009257 | 202 |
| 437 | 3300025961 | Ga0207712_10105243 | Ga0207712_101052432 | 202 |
| 438 | 3300025961 | Ga0207712_10195886 | Ga0207712_101958862 | 202 |
| 439 | 3300025972 | Ga0207668_10002111 | Ga0207668_100021114 | 202 |
| 440 | 3300026023 | Ga0207677_11103331 | Ga0207677_111033311 | 202 |
| 441 | 3300026035 | Ga0207703_10081772 | Ga0207703_100817722 | 202 |
| 442 | 3300026035 | Ga0207703_10129429 | Ga0207703_101294292 | 202 |
| 443 | 3300026075 | Ga0207708_10008389 | Ga0207708_100083892 | 202 |
| 444 | 3300026088 | Ga0207641_10437633 | Ga0207641_104376331 | 202 |
| 445 | 3300026089 | Ga0207648_10029342 | Ga0207648_100293424 | 202 |
| 446 | 3300026089 | Ga0207648_10647435 | Ga0207648_106474352 | 202 |
| 447 | 3300026116 | Ga0207674_10222075 | Ga0207674_102220752 | 202 |
| 448 | 3300026118 | Ga0207675_100037618 | Ga0207675_1000376185 | 202 |
| 449 | 3300026118 | Ga0207675_100038139 | Ga0207675_1000381393 | 202 |
| 450 | 3300026118 | Ga0207675_100113146 | Ga0207675_1001131461 | 202 |
| 451 | 3300026118 | Ga0207675_100258880 | Ga0207675_1002588802 | 202 |
| 452 | 3300026142 | Ga0207698_10767282 | Ga0207698_107672822 | 202 |
| 453 | 3300028380 | Ga0268265_10295444 | Ga0268265_102954442 | 202 |
| 454 | 3300028381 | Ga0268264_10389432 | Ga0268264_103894322 | 202 |
| 455 | 3300032126 | Ga0307415_100025864 | Ga0307415_1000258643 | 202 |
| 456 | 3300045051 | Ga0451576_1169985 | Ga0451576_1169985_140_760 | 202 |
| 457 | 3300048905 | Ga0496102_0010003 | Ga0496102_0010003_1045_1659 | 202 |
| 458 | 3300048911 | Ga0496108_0082717 | Ga0496108_0082717_693_1307 | 202 |
| 459 | 3300048911 | Ga0496108_0445103 | Ga0496108_0445103_167_787 | 202 |
| 460 | 3300048913 | Ga0496110_0544706 | Ga0496110_0544706_105_719 | 202 |
| 461 | 3300048916 | Ga0496113_0064526 | Ga0496113_0064526_1882_2505 | 202 |
| 462 | 3300049574 | Ga0501038_0007240 | Ga0501038_0007240_7215_7847 | 202 |
| 463 | 3300049588 | Ga0501072_0857907 | Ga0501072_0857907_68_700 | 202 |
| 464 | 3300050507 | nmdc:mga05p37_97921_c1 | nmdc:mga05p37_97921_c1_2836_3453 | 202 |
| 465 | 3300050508 | nmdc:mga09592_26548_c1 | nmdc:mga09592_26548_c1_1576_2190 | 202 |
| 466 | 3300050512 | nmdc:mga0n895_253264_c1 | nmdc:mga0n895_253264_c1_886_1500 | 202 |
| 467 | 3300050512 | nmdc:mga0n895_264806_c1 | nmdc:mga0n895_264806_c1_267_881 | 202 |
| 468 | 3300050513 | nmdc:mga0rr50_115016_c1 | nmdc:mga0rr50_115016_c1_236_850 | 202 |
| 469 | 3300050513 | nmdc:mga0rr50_188637_c1 | nmdc:mga0rr50_188637_c1_738_1355 | 202 |
| 470 | 3300050515 | nmdc:mga0a205_44029_c1 | nmdc:mga0a205_44029_c1_1343_1957 | 202 |
| 471 | 3300050515 | nmdc:mga0a205_44167_c1 | nmdc:mga0a205_44167_c1_158_772 | 202 |
| 472 | 3300002459 | JGI24751J29686_10000044 | JGI24751J29686_1000004446 | 203 |
| 473 | 3300003203 | JGI25406J46586_10002885 | JGI25406J46586_100028852 | 203 |
| 474 | 3300005289 | Ga0065704_10100713 | Ga0065704_101007132 | 203 |
| 475 | 3300005290 | Ga0065712_10000123 | Ga0065712_1000012315 | 203 |
| 476 | 3300005290 | Ga0065712_10146274 | Ga0065712_101462742 | 203 |
| 477 | 3300005293 | Ga0065715_10089361 | Ga0065715_100893612 | 203 |
| 478 | 3300005293 | Ga0065715_10360617 | Ga0065715_103606171 | 203 |
| 479 | 3300005295 | Ga0065707_10003187 | Ga0065707_100031872 | 203 |
| 480 | 3300005295 | Ga0065707_10106281 | Ga0065707_101062811 | 203 |
| 481 | 3300005295 | Ga0065707_10271768 | Ga0065707_102717681 | 203 |
| 482 | 3300005295 | Ga0065707_10286549 | Ga0065707_102865491 | 203 |
| 483 | 3300005328 | Ga0070676_10259573 | Ga0070676_102595731 | 203 |
| 484 | 3300005329 | Ga0070683_100539584 | Ga0070683_1005395841 | 203 |
| 485 | 3300005330 | Ga0070690_100128731 | Ga0070690_1001287312 | 203 |
| 486 | 3300005331 | Ga0070670_100000144 | Ga0070670_10000014440 | 203 |
| 487 | 3300005331 | Ga0070670_100132631 | Ga0070670_1001326312 | 203 |
| 488 | 3300005334 | Ga0068869_100026023 | Ga0068869_1000260232 | 203 |
| 489 | 3300005334 | Ga0068869_100053422 | Ga0068869_1000534223 | 203 |
| 490 | 3300005334 | Ga0068869_100720234 | Ga0068869_1007202341 | 203 |
| 491 | 3300005334 | Ga0068869_101067821 | Ga0068869_1010678211 | 203 |
| 492 | 3300005335 | Ga0070666_10058851 | Ga0070666_100588513 | 203 |
| 493 | 3300005337 | Ga0070682_100000405 | Ga0070682_10000040525 | 203 |
| 494 | 3300005337 | Ga0070682_100011524 | Ga0070682_1000115245 | 203 |
| 495 | 3300005338 | Ga0068868_100087038 | Ga0068868_1000870383 | 203 |
| 496 | 3300005338 | Ga0068868_100346800 | Ga0068868_1003468001 | 203 |
| 497 | 3300005341 | Ga0070691_10469824 | Ga0070691_104698241 | 203 |
| 498 | 3300005343 | Ga0070687_100181944 | Ga0070687_1001819441 | 203 |
| 499 | 3300005343 | Ga0070687_100281004 | Ga0070687_1002810042 | 203 |
| 500 | 3300005343 | Ga0070687_100629167 | Ga0070687_1006291671 | 203 |
| 501 | 3300005344 | Ga0070661_100177215 | Ga0070661_1001772152 | 203 |
| 502 | 3300005344 | Ga0070661_100846179 | Ga0070661_1008461791 | 203 |
| 503 | 3300005345 | Ga0070692_10279775 | Ga0070692_102797751 | 203 |
| 504 | 3300005353 | Ga0070669_100308450 | Ga0070669_1003084502 | 203 |
| 505 | 3300005353 | Ga0070669_100389284 | Ga0070669_1003892842 | 203 |
| 506 | 3300005355 | Ga0070671_100003832 | Ga0070671_1000038325 | 203 |
| 507 | 3300005355 | Ga0070671_100085327 | Ga0070671_1000853272 | 203 |
| 508 | 3300005355 | Ga0070671_100339530 | Ga0070671_1003395301 | 203 |
| 509 | 3300005356 | Ga0070674_100792502 | Ga0070674_1007925021 | 203 |
| 510 | 3300005364 | Ga0070673_101107574 | Ga0070673_1011075741 | 203 |
| 511 | 3300005365 | Ga0070688_100790993 | Ga0070688_1007909931 | 203 |
| 512 | 3300005366 | Ga0070659_100016910 | Ga0070659_1000169102 | 203 |
| 513 | 3300005367 | Ga0070667_100677013 | Ga0070667_1006770132 | 203 |
| 514 | 3300005438 | Ga0070701_10036020 | Ga0070701_100360202 | 203 |
| 515 | 3300005438 | Ga0070701_10040733 | Ga0070701_100407332 | 203 |
| 516 | 3300005441 | Ga0070700_100166334 | Ga0070700_1001663342 | 203 |
| 517 | 3300005441 | Ga0070700_100426070 | Ga0070700_1004260702 | 203 |
| 518 | 3300005444 | Ga0070694_100056456 | Ga0070694_1000564563 | 203 |
| 519 | 3300005444 | Ga0070694_100206996 | Ga0070694_1002069962 | 203 |
| 520 | 3300005444 | Ga0070694_100561943 | Ga0070694_1005619431 | 203 |
| 521 | 3300005444 | Ga0070694_100863718 | Ga0070694_1008637181 | 203 |
| 522 | 3300005445 | Ga0070708_100001183 | Ga0070708_10000118316 | 203 |
| 523 | 3300005455 | Ga0070663_100449565 | Ga0070663_1004495652 | 203 |
| 524 | 3300005457 | Ga0070662_100021490 | Ga0070662_1000214904 | 203 |
| 525 | 3300005457 | Ga0070662_100386373 | Ga0070662_1003863732 | 203 |
| 526 | 3300005457 | Ga0070662_100537709 | Ga0070662_1005377091 | 203 |
| 527 | 3300005458 | Ga0070681_10007691 | Ga0070681_100076916 | 203 |
| 528 | 3300005459 | Ga0068867_100012727 | Ga0068867_1000127273 | 203 |
| 529 | 3300005467 | Ga0070706_100014834 | Ga0070706_1000148343 | 203 |
| 530 | 3300005467 | Ga0070706_100044179 | Ga0070706_1000441793 | 203 |
| 531 | 3300005468 | Ga0070707_100324760 | Ga0070707_1003247602 | 203 |
| 532 | 3300005471 | Ga0070698_100000126 | Ga0070698_10000012628 | 203 |
| 533 | 3300005471 | Ga0070698_100010112 | Ga0070698_1000101126 | 203 |
| 534 | 3300005471 | Ga0070698_100016175 | Ga0070698_1000161753 | 203 |
| 535 | 3300005471 | Ga0070698_100550075 | Ga0070698_1005500751 | 203 |
| 536 | 3300005518 | Ga0070699_100005850 | Ga0070699_1000058505 | 203 |
| 537 | 3300005518 | Ga0070699_100006980 | Ga0070699_1000069806 | 203 |
| 538 | 3300005518 | Ga0070699_100957260 | Ga0070699_1009572601 | 203 |
| 539 | 3300005530 | Ga0070679_100912282 | Ga0070679_1009122821 | 203 |
| 540 | 3300005535 | Ga0070684_100776426 | Ga0070684_1007764261 | 203 |
| 541 | 3300005536 | Ga0070697_100000217 | Ga0070697_10000021718 | 203 |
| 542 | 3300005536 | Ga0070697_100000380 | Ga0070697_1000003804 | 203 |
| 543 | 3300005539 | Ga0068853_100150415 | Ga0068853_1001504152 | 203 |
| 544 | 3300005539 | Ga0068853_100706419 | Ga0068853_1007064191 | 203 |
| 545 | 3300005544 | Ga0070686_100000648 | Ga0070686_10000064810 | 203 |
| 546 | 3300005544 | Ga0070686_100833525 | Ga0070686_1008335251 | 203 |
| 547 | 3300005544 | Ga0070686_100914422 | Ga0070686_1009144221 | 203 |
| 548 | 3300005545 | Ga0070695_100039878 | Ga0070695_1000398783 | 203 |
| 549 | 3300005545 | Ga0070695_100045540 | Ga0070695_1000455402 | 203 |
| 550 | 3300005545 | Ga0070695_100435736 | Ga0070695_1004357361 | 203 |
| 551 | 3300005545 | Ga0070695_100465171 | Ga0070695_1004651712 | 203 |
| 552 | 3300005546 | Ga0070696_100037727 | Ga0070696_1000377273 | 203 |
| 553 | 3300005546 | Ga0070696_100293413 | Ga0070696_1002934133 | 203 |
| 554 | 3300005546 | Ga0070696_100320826 | Ga0070696_1003208262 | 203 |
| 555 | 3300005546 | Ga0070696_100557848 | Ga0070696_1005578481 | 203 |
| 556 | 3300005548 | Ga0070665_100622772 | Ga0070665_1006227721 | 203 |
| 557 | 3300005549 | Ga0070704_100282862 | Ga0070704_1002828622 | 203 |
| 558 | 3300005564 | Ga0070664_100014957 | Ga0070664_1000149572 | 203 |
| 559 | 3300005577 | Ga0068857_100138045 | Ga0068857_1001380453 | 203 |
| 560 | 3300005577 | Ga0068857_101149657 | Ga0068857_1011496571 | 203 |
| 561 | 3300005578 | Ga0068854_100378895 | Ga0068854_1003788951 | 203 |
| 562 | 3300005615 | Ga0070702_100063061 | Ga0070702_1000630612 | 203 |
| 563 | 3300005615 | Ga0070702_100095456 | Ga0070702_1000954561 | 203 |
| 564 | 3300005616 | Ga0068852_100131637 | Ga0068852_1001316372 | 203 |
| 565 | 3300005616 | Ga0068852_100331812 | Ga0068852_1003318122 | 203 |
| 566 | 3300005617 | Ga0068859_100022806 | Ga0068859_1000228065 | 203 |
| 567 | 3300005617 | Ga0068859_100114087 | Ga0068859_1001140871 | 203 |
| 568 | 3300005617 | Ga0068859_100280931 | Ga0068859_1002809312 | 203 |
| 569 | 3300005617 | Ga0068859_100315592 | Ga0068859_1003155921 | 203 |
| 570 | 3300005617 | Ga0068859_100466912 | Ga0068859_1004669122 | 203 |
| 571 | 3300005618 | Ga0068864_100098969 | Ga0068864_1000989693 | 203 |
| 572 | 3300005618 | Ga0068864_100122297 | Ga0068864_1001222972 | 203 |
| 573 | 3300005618 | Ga0068864_100151645 | Ga0068864_1001516451 | 203 |
| 574 | 3300005618 | Ga0068864_100264650 | Ga0068864_1002646502 | 203 |
| 575 | 3300005618 | Ga0068864_100443012 | Ga0068864_1004430121 | 203 |
| 576 | 3300005618 | Ga0068864_100610628 | Ga0068864_1006106281 | 203 |
| 577 | 3300005719 | Ga0068861_100089492 | Ga0068861_1000894922 | 203 |
| 578 | 3300005719 | Ga0068861_100698675 | Ga0068861_1006986752 | 203 |
| 579 | 3300005834 | Ga0068851_10362742 | Ga0068851_103627422 | 203 |
| 580 | 3300005841 | Ga0068863_100026639 | Ga0068863_1000266396 | 203 |
| 581 | 3300005841 | Ga0068863_100133871 | Ga0068863_1001338712 | 203 |
| 582 | 3300005841 | Ga0068863_100163148 | Ga0068863_1001631482 | 203 |
| 583 | 3300005841 | Ga0068863_100750732 | Ga0068863_1007507322 | 203 |
| 584 | 3300005842 | Ga0068858_100014545 | Ga0068858_1000145454 | 203 |
| 585 | 3300005842 | Ga0068858_100176608 | Ga0068858_1001766082 | 203 |
| 586 | 3300005842 | Ga0068858_100726763 | Ga0068858_1007267632 | 203 |
| 587 | 3300005843 | Ga0068860_100035879 | Ga0068860_1000358792 | 203 |
| 588 | 3300005843 | Ga0068860_100055864 | Ga0068860_1000558642 | 203 |
| 589 | 3300005843 | Ga0068860_100710189 | Ga0068860_1007101892 | 203 |
| 590 | 3300005844 | Ga0068862_100102217 | Ga0068862_1001022172 | 203 |
| 591 | 3300005983 | Ga0081540_1063214 | Ga0081540_10632142 | 203 |
| 592 | 3300005985 | Ga0081539_10000422 | Ga0081539_1000042263 | 203 |
| 593 | 3300005985 | Ga0081539_10007568 | Ga0081539_100075684 | 203 |
| 594 | 3300006237 | Ga0097621_100010916 | Ga0097621_1000109163 | 203 |
| 595 | 3300006237 | Ga0097621_100218321 | Ga0097621_1002183212 | 203 |
| 596 | 3300006358 | Ga0068871_100106369 | Ga0068871_1001063693 | 203 |
| 597 | 3300006844 | Ga0075428_100140028 | Ga0075428_1001400281 | 203 |
| 598 | 3300006846 | Ga0075430_100101202 | Ga0075430_1001012022 | 203 |
| 599 | 3300006847 | Ga0075431_100789153 | Ga0075431_1007891532 | 203 |
| 600 | 3300006852 | Ga0075433_10073659 | Ga0075433_100736593 | 203 |
| 601 | 3300006852 | Ga0075433_10119161 | Ga0075433_101191612 | 203 |
| 602 | 3300006871 | Ga0075434_100105261 | Ga0075434_1001052613 | 203 |
| 603 | 3300006871 | Ga0075434_100106497 | Ga0075434_1001064973 | 203 |
| 604 | 3300006871 | Ga0075434_100179512 | Ga0075434_1001795122 | 203 |
| 605 | 3300006871 | Ga0075434_100603563 | Ga0075434_1006035632 | 203 |
| 606 | 3300006880 | Ga0075429_100547152 | Ga0075429_1005471521 | 203 |
| 607 | 3300006914 | Ga0075436_100022320 | Ga0075436_1000223204 | 203 |
| 608 | 3300006931 | Ga0097620_100022804 | Ga0097620_1000228043 | 203 |
| 609 | 3300006931 | Ga0097620_100114088 | Ga0097620_1001140883 | 203 |
| 610 | 3300006931 | Ga0097620_100280938 | Ga0097620_1002809382 | 203 |
| 611 | 3300006931 | Ga0097620_100315570 | Ga0097620_1003155701 | 203 |
| 612 | 3300006931 | Ga0097620_100466931 | Ga0097620_1004669312 | 203 |
| 613 | 3300007076 | Ga0075435_100021741 | Ga0075435_1000217412 | 203 |
| 614 | 3300009011 | Ga0105251_10167242 | Ga0105251_101672422 | 203 |
| 615 | 3300009093 | Ga0105240_10176724 | Ga0105240_101767242 | 203 |
| 616 | 3300009094 | Ga0111539_10001877 | Ga0111539_1000187710 | 203 |
| 617 | 3300009094 | Ga0111539_10125960 | Ga0111539_101259603 | 203 |
| 618 | 3300009094 | Ga0111539_10150037 | Ga0111539_101500373 | 203 |
| 619 | 3300009098 | Ga0105245_10985689 | Ga0105245_109856891 | 203 |
| 620 | 3300009101 | Ga0105247_10003373 | Ga0105247_100033735 | 203 |
| 621 | 3300009101 | Ga0105247_10130714 | Ga0105247_101307142 | 203 |
| 622 | 3300009147 | Ga0114129_10071582 | Ga0114129_100715822 | 203 |
| 623 | 3300009147 | Ga0114129_10200232 | Ga0114129_102002322 | 203 |
| 624 | 3300009148 | Ga0105243_10012901 | Ga0105243_100129014 | 203 |
| 625 | 3300009148 | Ga0105243_10014515 | Ga0105243_100145156 | 203 |
| 626 | 3300009148 | Ga0105243_10267282 | Ga0105243_102672822 | 203 |
| 627 | 3300009148 | Ga0105243_10735466 | Ga0105243_107354662 | 203 |
| 628 | 3300009174 | Ga0105241_10105290 | Ga0105241_101052902 | 203 |
| 629 | 3300009174 | Ga0105241_10503279 | Ga0105241_105032792 | 203 |
| 630 | 3300009174 | Ga0105241_10592148 | Ga0105241_105921481 | 203 |
| 631 | 3300009174 | Ga0105241_11443259 | Ga0105241_114432591 | 203 |
| 632 | 3300009176 | Ga0105242_10040362 | Ga0105242_100403623 | 203 |
| 633 | 3300009176 | Ga0105242_10293396 | Ga0105242_102933962 | 203 |
| 634 | 3300009177 | Ga0105248_10205134 | Ga0105248_102051342 | 203 |
| 635 | 3300009177 | Ga0105248_10466434 | Ga0105248_104664342 | 203 |
| 636 | 3300009551 | Ga0105238_10013120 | Ga0105238_100131207 | 203 |
| 637 | 3300009553 | Ga0105249_10043269 | Ga0105249_100432692 | 203 |
| 638 | 3300009553 | Ga0105249_10624820 | Ga0105249_106248202 | 203 |
| 639 | 3300010375 | Ga0105239_10095554 | Ga0105239_100955543 | 203 |
| 640 | 3300010375 | Ga0105239_11401104 | Ga0105239_114011041 | 203 |
| 641 | 3300011119 | Ga0105246_10020265 | Ga0105246_100202652 | 203 |
| 642 | 3300011119 | Ga0105246_10364491 | Ga0105246_103644912 | 203 |
| 643 | 3300011119 | Ga0105246_10766682 | Ga0105246_107666821 | 203 |
| 644 | 3300013296 | Ga0157374_10052804 | Ga0157374_100528042 | 203 |
| 645 | 3300013297 | Ga0157378_10003478 | Ga0157378_1000347810 | 203 |
| 646 | 3300013297 | Ga0157378_10225211 | Ga0157378_102252112 | 203 |
| 647 | 3300013297 | Ga0157378_11115083 | Ga0157378_111150831 | 203 |
| 648 | 3300013306 | Ga0163162_10020922 | Ga0163162_100209223 | 203 |
| 649 | 3300013306 | Ga0163162_10221403 | Ga0163162_102214032 | 203 |
| 650 | 3300013307 | Ga0157372_10010237 | Ga0157372_100102372 | 203 |
| 651 | 3300013308 | Ga0157375_10035990 | Ga0157375_100359902 | 203 |
| 652 | 3300013308 | Ga0157375_10625156 | Ga0157375_106251562 | 203 |
| 653 | 3300013308 | Ga0157375_11467363 | Ga0157375_114673632 | 203 |
| 654 | 3300014325 | Ga0163163_10005816 | Ga0163163_100058168 | 203 |
| 655 | 3300014325 | Ga0163163_10009856 | Ga0163163_100098561 | 203 |
| 656 | 3300014325 | Ga0163163_10040627 | Ga0163163_100406274 | 203 |
| 657 | 3300014325 | Ga0163163_10044834 | Ga0163163_100448341 | 203 |
| 658 | 3300014325 | Ga0163163_10050659 | Ga0163163_100506592 | 203 |
| 659 | 3300014325 | Ga0163163_10125892 | Ga0163163_101258922 | 203 |
| 660 | 3300014325 | Ga0163163_10199147 | Ga0163163_101991473 | 203 |
| 661 | 3300014325 | Ga0163163_10271820 | Ga0163163_102718201 | 203 |
| 662 | 3300014325 | Ga0163163_10870422 | Ga0163163_108704221 | 203 |
| 663 | 3300014326 | Ga0157380_10133196 | Ga0157380_101331962 | 203 |
| 664 | 3300014326 | Ga0157380_10944655 | Ga0157380_109446552 | 203 |
| 665 | 3300014745 | Ga0157377_10070675 | Ga0157377_100706752 | 203 |
| 666 | 3300014969 | Ga0157376_10084445 | Ga0157376_100844452 | 203 |
| 667 | 3300025315 | Ga0207697_10008507 | Ga0207697_100085072 | 203 |
| 668 | 3300025900 | Ga0207710_10000927 | Ga0207710_100009275 | 203 |
| 669 | 3300025904 | Ga0207647_10007102 | Ga0207647_100071025 | 203 |
| 670 | 3300025907 | Ga0207645_10091469 | Ga0207645_100914692 | 203 |
| 671 | 3300025908 | Ga0207643_10338456 | Ga0207643_103384562 | 203 |
| 672 | 3300025910 | Ga0207684_10000314 | Ga0207684_1000031414 | 203 |
| 673 | 3300025910 | Ga0207684_10008012 | Ga0207684_100080125 | 203 |
| 674 | 3300025910 | Ga0207684_10174676 | Ga0207684_101746762 | 203 |
| 675 | 3300025911 | Ga0207654_10065174 | Ga0207654_100651742 | 203 |
| 676 | 3300025911 | Ga0207654_10455917 | Ga0207654_104559172 | 203 |
| 677 | 3300025913 | Ga0207695_10066767 | Ga0207695_100667672 | 203 |
| 678 | 3300025918 | Ga0207662_10002563 | Ga0207662_100025637 | 203 |
| 679 | 3300025918 | Ga0207662_10094642 | Ga0207662_100946422 | 203 |
| 680 | 3300025922 | Ga0207646_10072002 | Ga0207646_100720022 | 203 |
| 681 | 3300025923 | Ga0207681_10788517 | Ga0207681_107885172 | 203 |
| 682 | 3300025924 | Ga0207694_10026046 | Ga0207694_100260463 | 203 |
| 683 | 3300025925 | Ga0207650_10000047 | Ga0207650_1000004771 | 203 |
| 684 | 3300025925 | Ga0207650_10238573 | Ga0207650_102385731 | 203 |
| 685 | 3300025926 | Ga0207659_10855579 | Ga0207659_108555791 | 203 |
| 686 | 3300025931 | Ga0207644_10011207 | Ga0207644_100112075 | 203 |
| 687 | 3300025931 | Ga0207644_10526847 | Ga0207644_105268471 | 203 |
| 688 | 3300025932 | Ga0207690_10013277 | Ga0207690_100132773 | 203 |
| 689 | 3300025932 | Ga0207690_10808606 | Ga0207690_108086061 | 203 |
| 690 | 3300025933 | Ga0207706_10141782 | Ga0207706_101417822 | 203 |
| 691 | 3300025934 | Ga0207686_10069084 | Ga0207686_100690842 | 203 |
| 692 | 3300025935 | Ga0207709_10008224 | Ga0207709_100082242 | 203 |
| 693 | 3300025935 | Ga0207709_10102046 | Ga0207709_101020462 | 203 |
| 694 | 3300025935 | Ga0207709_10271435 | Ga0207709_102714352 | 203 |
| 695 | 3300025936 | Ga0207670_10415949 | Ga0207670_104159491 | 203 |
| 696 | 3300025937 | Ga0207669_10051011 | Ga0207669_100510112 | 203 |
| 697 | 3300025940 | Ga0207691_10007252 | Ga0207691_100072522 | 203 |
| 698 | 3300025941 | Ga0207711_10062117 | Ga0207711_100621173 | 203 |
| 699 | 3300025941 | Ga0207711_10103335 | Ga0207711_101033352 | 203 |
| 700 | 3300025941 | Ga0207711_10846212 | Ga0207711_108462122 | 203 |
| 701 | 3300025942 | Ga0207689_10001827 | Ga0207689_1000182710 | 203 |
| 702 | 3300025942 | Ga0207689_10002806 | Ga0207689_100028061 | 203 |
| 703 | 3300025942 | Ga0207689_10104862 | Ga0207689_101048622 | 203 |
| 704 | 3300025945 | Ga0207679_10032627 | Ga0207679_100326271 | 203 |
| 705 | 3300025945 | Ga0207679_10165235 | Ga0207679_101652352 | 203 |
| 706 | 3300025949 | Ga0207667_10279566 | Ga0207667_102795662 | 203 |
| 707 | 3300025960 | Ga0207651_10134655 | Ga0207651_101346552 | 203 |
| 708 | 3300025960 | Ga0207651_10276718 | Ga0207651_102767181 | 203 |
| 709 | 3300025961 | Ga0207712_10005073 | Ga0207712_100050737 | 203 |
| 710 | 3300025961 | Ga0207712_10352094 | Ga0207712_103520942 | 203 |
| 711 | 3300025981 | Ga0207640_10389470 | Ga0207640_103894702 | 203 |
| 712 | 3300026023 | Ga0207677_10674697 | Ga0207677_106746971 | 203 |
| 713 | 3300026035 | Ga0207703_10015611 | Ga0207703_100156115 | 203 |
| 714 | 3300026075 | Ga0207708_10041981 | Ga0207708_100419813 | 203 |
| 715 | 3300026075 | Ga0207708_10219950 | Ga0207708_102199501 | 203 |
| 716 | 3300026088 | Ga0207641_10242088 | Ga0207641_102420882 | 203 |
| 717 | 3300026089 | Ga0207648_10009860 | Ga0207648_100098608 | 203 |
| 718 | 3300026089 | Ga0207648_10072970 | Ga0207648_100729702 | 203 |
| 719 | 3300026089 | Ga0207648_10270326 | Ga0207648_102703262 | 203 |
| 720 | 3300026089 | Ga0207648_11157929 | Ga0207648_111579291 | 203 |
| 721 | 3300026095 | Ga0207676_10029779 | Ga0207676_100297794 | 203 |
| 722 | 3300026095 | Ga0207676_10246216 | Ga0207676_102462162 | 203 |
| 723 | 3300026095 | Ga0207676_10275852 | Ga0207676_102758521 | 203 |
| 724 | 3300026095 | Ga0207676_10312591 | Ga0207676_103125912 | 203 |
| 725 | 3300026116 | Ga0207674_10019731 | Ga0207674_100197316 | 203 |
| 726 | 3300026116 | Ga0207674_10110002 | Ga0207674_101100023 | 203 |
| 727 | 3300026118 | Ga0207675_100009521 | Ga0207675_1000095217 | 203 |
| 728 | 3300026118 | Ga0207675_100254800 | Ga0207675_1002548002 | 203 |
| 729 | 3300026121 | Ga0207683_10206396 | Ga0207683_102063962 | 203 |
| 730 | 3300026121 | Ga0207683_10418297 | Ga0207683_104182971 | 203 |
| 731 | 3300026142 | Ga0207698_10356844 | Ga0207698_103568442 | 203 |
| 732 | 3300027907 | Ga0207428_10013301 | Ga0207428_100133013 | 203 |
| 733 | 3300028381 | Ga0268264_10110750 | Ga0268264_101107503 | 203 |
| 734 | 3300028381 | Ga0268264_10110935 | Ga0268264_101109352 | 203 |
| 735 | 3300028381 | Ga0268264_10158615 | Ga0268264_101586152 | 203 |
| 736 | 3300028381 | Ga0268264_10196724 | Ga0268264_101967241 | 203 |
| 737 | 3300031456 | Ga0307513_10453815 | Ga0307513_104538151 | 203 |
| 738 | 3300031852 | Ga0307410_10873844 | Ga0307410_108738441 | 203 |
| 739 | 3300031901 | Ga0307406_10871705 | Ga0307406_108717052 | 203 |
| 740 | 3300031911 | Ga0307412_10101083 | Ga0307412_101010832 | 203 |
| 741 | 3300031911 | Ga0307412_10277657 | Ga0307412_102776571 | 203 |
| 742 | 3300032002 | Ga0307416_100100284 | Ga0307416_1001002842 | 203 |
| 743 | 3300032004 | Ga0307414_10186038 | Ga0307414_101860382 | 203 |
| 744 | 3300038443 | Ga0395901_0371842 | Ga0395901_0371842_79_699 | 203 |
| 745 | 3300042435 | Ga0439434_0013509 | Ga0439434_0013509_759_1379 | 203 |
| 746 | 3300045051 | Ga0451576_1074163 | Ga0451576_1074163_110_739 | 203 |
| 747 | 3300045051 | Ga0451576_1215512 | Ga0451576_1215512_31_753 | 203 |
| 748 | 3300046539 | Ga0495621_0000007 | Ga0495621_0000007_5039_5662 | 203 |
| 749 | 3300046539 | Ga0495621_0005112 | Ga0495621_0005112_832_1452 | 203 |
| 750 | 3300047320 | Ga0495672_0008903 | Ga0495672_0008903_6513_7133 | 203 |
| 751 | 3300047445 | Ga0495677_0063226 | Ga0495677_0063226_320_943 | 203 |
| 752 | 3300048909 | Ga0496106_0612599 | Ga0496106_0612599_130_750 | 203 |
| 753 | 3300048913 | Ga0496110_0208063 | Ga0496110_0208063_661_1281 | 203 |
| 754 | 3300048913 | Ga0496110_0458932 | Ga0496110_0458932_91_720 | 203 |
| 755 | 3300048915 | Ga0496112_0353446 | Ga0496112_0353446_268_903 | 203 |
| 756 | 3300048915 | Ga0496112_0686872 | Ga0496112_0686872_84_719 | 203 |
| 757 | 3300048916 | Ga0496113_0317784 | Ga0496113_0317784_449_1078 | 203 |
| 758 | 3300049514 | Ga0501291_021658 | Ga0501291_021658_286_921 | 203 |
| 759 | 3300049515 | Ga0501292_011788 | Ga0501292_011788_241_867 | 203 |
| 760 | 3300049516 | Ga0501293_008273 | Ga0501293_008273_183_809 | 203 |
| 761 | 3300049521 | Ga0501298_022136 | Ga0501298_022136_441_1076 | 203 |
| 762 | 3300049522 | Ga0501299_002870 | Ga0501299_002870_62_697 | 203 |
| 763 | 3300049522 | Ga0501299_010131 | Ga0501299_010131_246_869 | 203 |
| 764 | 3300049522 | Ga0501299_050322 | Ga0501299_050322_47_673 | 203 |
| 765 | 3300049652 | Ga0501202_003380 | Ga0501202_003380_566_1201 | 203 |
| 766 | 3300049652 | Ga0501202_011961 | Ga0501202_011961_720_1346 | 203 |
| 767 | 3300049660 | Ga0501216_002824 | Ga0501216_002824_518_1144 | 203 |
| 768 | 3300049661 | Ga0501217_003056 | Ga0501217_003056_2007_2633 | 203 |
| 769 | 3300049661 | Ga0501217_091789 | Ga0501217_091789_167_802 | 203 |
| 770 | 3300049663 | Ga0501223_011979 | Ga0501223_011979_1063_1689 | 203 |
| 771 | 3300049667 | Ga0501230_066605 | Ga0501230_066605_11_637 | 203 |
| 772 | 3300049668 | Ga0501233_007716 | Ga0501233_007716_906_1532 | 203 |
| 773 | 3300049668 | Ga0501233_008092 | Ga0501233_008092_637_1272 | 203 |
| 774 | 3300049668 | Ga0501233_043158 | Ga0501233_043158_414_1037 | 203 |
| 775 | 3300049669 | Ga0501235_003719 | Ga0501235_003719_1318_1956 | 203 |
| 776 | 3300049669 | Ga0501235_009688 | Ga0501235_009688_708_1331 | 203 |
| 777 | 3300049669 | Ga0501235_018171 | Ga0501235_018171_781_1407 | 203 |
| 778 | 3300049669 | Ga0501235_033090 | Ga0501235_033090_441_1076 | 203 |
| 779 | 3300049675 | Ga0501243_007641 | Ga0501243_007641_166_792 | 203 |
| 780 | 3300049679 | Ga0501249_013306 | Ga0501249_013306_498_1124 | 203 |
| 781 | 3300049679 | Ga0501249_014692 | Ga0501249_014692_963_1601 | 203 |
| 782 | 3300049679 | Ga0501249_089058 | Ga0501249_089058_69_692 | 203 |
| 783 | 3300049686 | Ga0501257_011905 | Ga0501257_011905_608_1234 | 203 |
| 784 | 3300049705 | Ga0501225_0007957 | Ga0501225_0007957_2234_2869 | 203 |
| 785 | 3300049705 | Ga0501225_0093622 | Ga0501225_0093622_29_667 | 203 |
| 786 | 3300049707 | Ga0501234_007226 | Ga0501234_007226_1047_1673 | 203 |
| 787 | 3300049765 | Ga0501268_024751 | Ga0501268_024751_98_736 | 203 |
| 788 | 3300049779 | Ga0501283_001080 | Ga0501283_001080_1058_1693 | 203 |
| 789 | 3300049851 | Ga0501212_024371 | Ga0501212_024371_153_788 | 203 |
| 790 | 3300049851 | Ga0501212_024512 | Ga0501212_024512_197_820 | 203 |
| 791 | 3300050507 | nmdc:mga05p37_213946_c1 | nmdc:mga05p37_213946_c1_589_1215 | 203 |
| 792 | 3300050508 | nmdc:mga09592_206209_c1 | nmdc:mga09592_206209_c1_137_757 | 203 |
| 793 | 3300050509 | nmdc:mga0qj67_115701_c1 | nmdc:mga0qj67_115701_c1_585_1205 | 203 |
| 794 | 3300050511 | nmdc:mga08y16_233036_c1 | nmdc:mga08y16_233036_c1_609_1235 | 203 |
| 795 | 3300050512 | nmdc:mga0n895_434117_c1 | nmdc:mga0n895_434117_c1_212_847 | 203 |
| 796 | 3300050512 | nmdc:mga0n895_76060_c1 | nmdc:mga0n895_76060_c1_1030_1659 | 203 |
| 797 | 3300050513 | nmdc:mga0rr50_153545_c1 | nmdc:mga0rr50_153545_c1_195_815 | 203 |
| 798 | 3300050514 | nmdc:mga08x19_4099_c1 | nmdc:mga08x19_4099_c1_4541_5170 | 203 |
| 799 | 3300050515 | nmdc:mga0a205_284960_c1 | nmdc:mga0a205_284960_c1_159_788 | 203 |
| 800 | 3300050515 | nmdc:mga0a205_333661_c1 | nmdc:mga0a205_333661_c1_86_706 | 203 |
| 801 | 3300050515 | nmdc:mga0a205_81896_c1 | nmdc:mga0a205_81896_c1_2346_2969 | 203 |
| 802 | 3300000531 | CNBas_1001844 | CNBas_10018442 | 204 |
| 803 | 3300005290 | Ga0065712_10010968 | Ga0065712_100109682 | 204 |
| 804 | 3300005290 | Ga0065712_10048272 | Ga0065712_100482721 | 204 |
| 805 | 3300005293 | Ga0065715_10017239 | Ga0065715_100172392 | 204 |
| 806 | 3300005293 | Ga0065715_10586200 | Ga0065715_105862001 | 204 |
| 807 | 3300005331 | Ga0070670_100292051 | Ga0070670_1002920512 | 204 |
| 808 | 3300005334 | Ga0068869_100762964 | Ga0068869_1007629641 | 204 |
| 809 | 3300005343 | Ga0070687_100759905 | Ga0070687_1007599051 | 204 |
| 810 | 3300005345 | Ga0070692_10229614 | Ga0070692_102296141 | 204 |
| 811 | 3300005364 | Ga0070673_100236121 | Ga0070673_1002361212 | 204 |
| 812 | 3300005364 | Ga0070673_100245695 | Ga0070673_1002456952 | 204 |
| 813 | 3300005406 | Ga0070703_10047071 | Ga0070703_100470711 | 204 |
| 814 | 3300005440 | Ga0070705_100056427 | Ga0070705_1000564272 | 204 |
| 815 | 3300005441 | Ga0070700_100000062 | Ga0070700_10000006218 | 204 |
| 816 | 3300005444 | Ga0070694_100002065 | Ga0070694_1000020657 | 204 |
| 817 | 3300005458 | Ga0070681_10020025 | Ga0070681_100200255 | 204 |
| 818 | 3300005518 | Ga0070699_100002296 | Ga0070699_1000022968 | 204 |
| 819 | 3300005518 | Ga0070699_100047578 | Ga0070699_1000475783 | 204 |
| 820 | 3300005539 | Ga0068853_100405778 | Ga0068853_1004057782 | 204 |
| 821 | 3300005546 | Ga0070696_100031651 | Ga0070696_1000316513 | 204 |
| 822 | 3300005546 | Ga0070696_100171861 | Ga0070696_1001718612 | 204 |
| 823 | 3300005547 | Ga0070693_100031014 | Ga0070693_1000310142 | 204 |
| 824 | 3300005564 | Ga0070664_100456518 | Ga0070664_1004565182 | 204 |
| 825 | 3300005615 | Ga0070702_100217094 | Ga0070702_1002170942 | 204 |
| 826 | 3300005615 | Ga0070702_100473090 | Ga0070702_1004730901 | 204 |
| 827 | 3300005616 | Ga0068852_100912548 | Ga0068852_1009125482 | 204 |
| 828 | 3300005617 | Ga0068859_100040540 | Ga0068859_1000405403 | 204 |
| 829 | 3300005617 | Ga0068859_100049851 | Ga0068859_1000498512 | 204 |
| 830 | 3300005617 | Ga0068859_100150795 | Ga0068859_1001507951 | 204 |
| 831 | 3300005618 | Ga0068864_100239213 | Ga0068864_1002392132 | 204 |
| 832 | 3300005719 | Ga0068861_100130256 | Ga0068861_1001302562 | 204 |
| 833 | 3300005841 | Ga0068863_100276594 | Ga0068863_1002765941 | 204 |
| 834 | 3300005842 | Ga0068858_100161681 | Ga0068858_1001616812 | 204 |
| 835 | 3300005842 | Ga0068858_100355061 | Ga0068858_1003550612 | 204 |
| 836 | 3300005842 | Ga0068858_100377009 | Ga0068858_1003770092 | 204 |
| 837 | 3300005843 | Ga0068860_100340565 | Ga0068860_1003405652 | 204 |
| 838 | 3300005844 | Ga0068862_100535118 | Ga0068862_1005351182 | 204 |
| 839 | 3300005844 | Ga0068862_100615184 | Ga0068862_1006151842 | 204 |
| 840 | 3300006058 | Ga0075432_10071248 | Ga0075432_100712482 | 204 |
| 841 | 3300006852 | Ga0075433_10042512 | Ga0075433_100425122 | 204 |
| 842 | 3300006852 | Ga0075433_10673275 | Ga0075433_106732752 | 204 |
| 843 | 3300006931 | Ga0097620_100040539 | Ga0097620_1000405393 | 204 |
| 844 | 3300006931 | Ga0097620_100049850 | Ga0097620_1000498502 | 204 |
| 845 | 3300006931 | Ga0097620_100150795 | Ga0097620_1001507951 | 204 |
| 846 | 3300009094 | Ga0111539_10723326 | Ga0111539_107233262 | 204 |
| 847 | 3300009098 | Ga0105245_10427013 | Ga0105245_104270132 | 204 |
| 848 | 3300009101 | Ga0105247_10102872 | Ga0105247_101028722 | 204 |
| 849 | 3300009101 | Ga0105247_10117094 | Ga0105247_101170942 | 204 |
| 850 | 3300009101 | Ga0105247_10165925 | Ga0105247_101659252 | 204 |
| 851 | 3300009147 | Ga0114129_10210011 | Ga0114129_102100112 | 204 |
| 852 | 3300009148 | Ga0105243_10197930 | Ga0105243_101979302 | 204 |
| 853 | 3300009148 | Ga0105243_11257944 | Ga0105243_112579441 | 204 |
| 854 | 3300009174 | Ga0105241_10045407 | Ga0105241_100454074 | 204 |
| 855 | 3300009176 | Ga0105242_10527510 | Ga0105242_105275101 | 204 |
| 856 | 3300009177 | Ga0105248_10025944 | Ga0105248_100259447 | 204 |
| 857 | 3300009177 | Ga0105248_10117472 | Ga0105248_101174722 | 204 |
| 858 | 3300009177 | Ga0105248_10804707 | Ga0105248_108047071 | 204 |
| 859 | 3300009177 | Ga0105248_10870785 | Ga0105248_108707851 | 204 |
| 860 | 3300010375 | Ga0105239_10109014 | Ga0105239_101090142 | 204 |
| 861 | 3300013100 | Ga0157373_10010134 | Ga0157373_100101345 | 204 |
| 862 | 3300013100 | Ga0157373_10418838 | Ga0157373_104188382 | 204 |
| 863 | 3300013306 | Ga0163162_10803230 | Ga0163162_108032302 | 204 |
| 864 | 3300013308 | Ga0157375_11841562 | Ga0157375_118415621 | 204 |
| 865 | 3300014325 | Ga0163163_10612970 | Ga0163163_106129702 | 204 |
| 866 | 3300014968 | Ga0157379_11081104 | Ga0157379_110811041 | 204 |
| 867 | 3300025900 | Ga0207710_10185716 | Ga0207710_101857162 | 204 |
| 868 | 3300025911 | Ga0207654_10030444 | Ga0207654_100304442 | 204 |
| 869 | 3300025911 | Ga0207654_10225858 | Ga0207654_102258582 | 204 |
| 870 | 3300025912 | Ga0207707_10032652 | Ga0207707_100326524 | 204 |
| 871 | 3300025914 | Ga0207671_10160785 | Ga0207671_101607851 | 204 |
| 872 | 3300025918 | Ga0207662_10072803 | Ga0207662_100728032 | 204 |
| 873 | 3300025922 | Ga0207646_10076563 | Ga0207646_100765633 | 204 |
| 874 | 3300025925 | Ga0207650_10146613 | Ga0207650_101466132 | 204 |
| 875 | 3300025935 | Ga0207709_10366874 | Ga0207709_103668742 | 204 |
| 876 | 3300025935 | Ga0207709_10488021 | Ga0207709_104880212 | 204 |
| 877 | 3300025935 | Ga0207709_10609559 | Ga0207709_106095592 | 204 |
| 878 | 3300025941 | Ga0207711_10023587 | Ga0207711_100235872 | 204 |
| 879 | 3300025941 | Ga0207711_10266561 | Ga0207711_102665612 | 204 |
| 880 | 3300025941 | Ga0207711_10366906 | Ga0207711_103669062 | 204 |
| 881 | 3300025942 | Ga0207689_10090588 | Ga0207689_100905882 | 204 |
| 882 | 3300025942 | Ga0207689_10519742 | Ga0207689_105197422 | 204 |
| 883 | 3300025945 | Ga0207679_10495974 | Ga0207679_104959741 | 204 |
| 884 | 3300025960 | Ga0207651_10192477 | Ga0207651_101924772 | 204 |
| 885 | 3300026035 | Ga0207703_10125571 | Ga0207703_101255712 | 204 |
| 886 | 3300026035 | Ga0207703_10374853 | Ga0207703_103748532 | 204 |
| 887 | 3300026041 | Ga0207639_10440794 | Ga0207639_104407942 | 204 |
| 888 | 3300026041 | Ga0207639_10614019 | Ga0207639_106140192 | 204 |
| 889 | 3300026075 | Ga0207708_10000246 | Ga0207708_1000024618 | 204 |
| 890 | 3300026088 | Ga0207641_10173552 | Ga0207641_101735522 | 204 |
| 891 | 3300026095 | Ga0207676_10120854 | Ga0207676_101208543 | 204 |
| 892 | 3300026095 | Ga0207676_10787841 | Ga0207676_107878412 | 204 |
| 893 | 3300026116 | Ga0207674_10182682 | Ga0207674_101826822 | 204 |
| 894 | 3300026118 | Ga0207675_100184169 | Ga0207675_1001841692 | 204 |
| 895 | 3300026142 | Ga0207698_10607455 | Ga0207698_106074552 | 204 |
| 896 | 3300027907 | Ga0207428_10296088 | Ga0207428_102960881 | 204 |
| 897 | 3300028380 | Ga0268265_10481059 | Ga0268265_104810592 | 204 |
| 898 | 3300028380 | Ga0268265_10508919 | Ga0268265_105089191 | 204 |
| 899 | 3300028381 | Ga0268264_10117790 | Ga0268264_101177901 | 204 |
| 900 | 3300031548 | Ga0307408_100112541 | Ga0307408_1001125413 | 204 |
| 901 | 3300031731 | Ga0307405_10016049 | Ga0307405_100160493 | 204 |
| 902 | 3300031824 | Ga0307413_10711986 | Ga0307413_107119862 | 204 |
| 903 | 3300031852 | Ga0307410_10031517 | Ga0307410_100315172 | 204 |
| 904 | 3300031901 | Ga0307406_10098864 | Ga0307406_100988642 | 204 |
| 905 | 3300031903 | Ga0307407_10042041 | Ga0307407_100420412 | 204 |
| 906 | 3300031911 | Ga0307412_10021603 | Ga0307412_100216034 | 204 |
| 907 | 3300031995 | Ga0307409_100295642 | Ga0307409_1002956422 | 204 |
| 908 | 3300032002 | Ga0307416_100035493 | Ga0307416_1000354932 | 204 |
| 909 | 3300032004 | Ga0307414_10039672 | Ga0307414_100396722 | 204 |
| 910 | 3300032126 | Ga0307415_100074212 | Ga0307415_1000742122 | 204 |
| 911 | 3300035090 | Ga0373949_0077918 | Ga0373949_0077918_69_692 | 204 |
| 912 | 3300035091 | Ga0373951_0000456 | Ga0373951_0000456_7761_8387 | 204 |
| 913 | 3300035115 | Ga0373941_0005444 | Ga0373941_0005444_2199_2822 | 204 |
| 914 | 3300035691 | Ga0373931_0013124 | Ga0373931_0013124_255_878 | 204 |
| 915 | 3300035691 | Ga0373931_0103930 | Ga0373931_0103930_564_1190 | 204 |
| 916 | 3300037466 | Ga0395898_0084385 | Ga0395898_0084385_509_1132 | 204 |
| 917 | 3300037471 | Ga0395905_0998662 | Ga0395905_0998662_83_706 | 204 |
| 918 | 3300038699 | Ga0242422_01462 | Ga0242422_01462_587_1213 | 204 |
| 919 | 3300038996 | Ga0242420_014220 | Ga0242420_014220_249_875 | 204 |
| 920 | 3300042012 | Ga0439455_0011346 | Ga0439455_0011346_749_1372 | 204 |
| 921 | 3300042157 | Ga0439458_0010133 | Ga0439458_0010133_622_1245 | 204 |
| 922 | 3300048910 | Ga0496107_0063454 | Ga0496107_0063454_848_1483 | 204 |
| 923 | 3300048915 | Ga0496112_0113304 | Ga0496112_0113304_100_723 | 204 |
| 924 | 3300048916 | Ga0496113_0134251 | Ga0496113_0134251_294_917 | 204 |
| 925 | 3300049653 | Ga0501206_024900 | Ga0501206_024900_113_736 | 204 |
| 926 | 3300049654 | Ga0501207_003570 | Ga0501207_003570_1014_1637 | 204 |
| 927 | 3300049660 | Ga0501216_001897 | Ga0501216_001897_408_1031 | 204 |
| 928 | 3300049661 | Ga0501217_000772 | Ga0501217_000772_1708_2331 | 204 |
| 929 | 3300049663 | Ga0501223_005210 | Ga0501223_005210_1359_1982 | 204 |
| 930 | 3300049664 | Ga0501224_001375 | Ga0501224_001375_2405_3028 | 204 |
| 931 | 3300049665 | Ga0501227_084161 | Ga0501227_084161_152_775 | 204 |
| 932 | 3300049667 | Ga0501230_000985 | Ga0501230_000985_1379_2002 | 204 |
| 933 | 3300049668 | Ga0501233_003750 | Ga0501233_003750_942_1565 | 204 |
| 934 | 3300049669 | Ga0501235_004036 | Ga0501235_004036_1351_1974 | 204 |
| 935 | 3300049675 | Ga0501243_004127 | Ga0501243_004127_673_1296 | 204 |
| 936 | 3300049679 | Ga0501249_035677 | Ga0501249_035677_131_754 | 204 |
| 937 | 3300049686 | Ga0501257_011404 | Ga0501257_011404_1095_1718 | 204 |
| 938 | 3300049688 | Ga0501259_013009 | Ga0501259_013009_422_1045 | 204 |
| 939 | 3300049705 | Ga0501225_0004958 | Ga0501225_0004958_2602_3225 | 204 |
| 940 | 3300049707 | Ga0501234_010505 | Ga0501234_010505_177_800 | 204 |
| 941 | 3300049764 | Ga0501267_009689 | Ga0501267_009689_84_707 | 204 |
| 942 | 3300049851 | Ga0501212_043988 | Ga0501212_043988_53_676 | 204 |
| 943 | 3300049853 | Ga0501226_000589 | Ga0501226_000589_1571_2194 | 204 |
| 944 | 3300050507 | nmdc:mga05p37_192430_c1 | nmdc:mga05p37_192430_c1_14_637 | 204 |
| 945 | 3300050507 | nmdc:mga05p37_205646_c1 | nmdc:mga05p37_205646_c1_1562_2185 | 204 |
| 946 | 3300050512 | nmdc:mga0n895_266812_c1 | nmdc:mga0n895_266812_c1_30_653 | 204 |
| 947 | 3300050515 | nmdc:mga0a205_42897_c1 | nmdc:mga0a205_42897_c1_139_765 | 204 |
| 948 | 3300005330 | Ga0070690_100431157 | Ga0070690_1004311571 | 205 |
| 949 | 3300005331 | Ga0070670_100016819 | Ga0070670_1000168194 | 205 |
| 950 | 3300005340 | Ga0070689_100001209 | Ga0070689_1000012097 | 205 |
| 951 | 3300005719 | Ga0068861_100312448 | Ga0068861_1003124482 | 205 |
| 952 | 3300005840 | Ga0068870_10017039 | Ga0068870_100170392 | 205 |
| 953 | 3300005841 | Ga0068863_100091832 | Ga0068863_1000918321 | 205 |
| 954 | 3300005843 | Ga0068860_100226580 | Ga0068860_1002265802 | 205 |
| 955 | 3300009148 | Ga0105243_10422313 | Ga0105243_104223132 | 205 |
| 956 | 3300011119 | Ga0105246_10057398 | Ga0105246_100573982 | 205 |
| 957 | 3300014326 | Ga0157380_10174950 | Ga0157380_101749502 | 205 |
| 958 | 3300025908 | Ga0207643_10000595 | Ga0207643_100005954 | 205 |
| 959 | 3300025925 | Ga0207650_10960879 | Ga0207650_109608791 | 205 |
| 960 | 3300025936 | Ga0207670_10000162 | Ga0207670_100001627 | 205 |
| 961 | 3300025941 | Ga0207711_10771806 | Ga0207711_107718061 | 205 |
| 962 | 3300026095 | Ga0207676_10003037 | Ga0207676_100030377 | 205 |
| 963 | 3300026116 | Ga0207674_10124154 | Ga0207674_101241543 | 205 |
| 964 | 3300026118 | Ga0207675_100269991 | Ga0207675_1002699912 | 205 |
| 965 | 3300028381 | Ga0268264_10560060 | Ga0268264_105600602 | 205 |
| 966 | 3300005328 | Ga0070676_10267149 | Ga0070676_102671491 | 206 |
| 967 | 3300005937 | Ga0081455_10463840 | Ga0081455_104638401 | 206 |
| 968 | 2162886012 | MBSR1b_contig_11831596 | MBSR1b_0369.00006710 | 207 |
| 969 | 3300005289 | Ga0065704_10119347 | Ga0065704_101193472 | 207 |
| 970 | 3300005293 | Ga0065715_10214062 | Ga0065715_102140622 | 207 |
| 971 | 3300005330 | Ga0070690_100085278 | Ga0070690_1000852782 | 207 |
| 972 | 3300005330 | Ga0070690_100119691 | Ga0070690_1001196912 | 207 |
| 973 | 3300005338 | Ga0068868_100022784 | Ga0068868_1000227845 | 207 |
| 974 | 3300005343 | Ga0070687_100012833 | Ga0070687_1000128333 | 207 |
| 975 | 3300005343 | Ga0070687_100012923 | Ga0070687_1000129232 | 207 |
| 976 | 3300005345 | Ga0070692_10063808 | Ga0070692_100638082 | 207 |
| 977 | 3300005353 | Ga0070669_100036875 | Ga0070669_1000368752 | 207 |
| 978 | 3300005441 | Ga0070700_100010600 | Ga0070700_1000106004 | 207 |
| 979 | 3300005444 | Ga0070694_100026789 | Ga0070694_1000267892 | 207 |
| 980 | 3300005544 | Ga0070686_100009242 | Ga0070686_1000092422 | 207 |
| 981 | 3300005549 | Ga0070704_100126943 | Ga0070704_1001269432 | 207 |
| 982 | 3300005549 | Ga0070704_100316789 | Ga0070704_1003167892 | 207 |
| 983 | 3300005578 | Ga0068854_100082457 | Ga0068854_1000824571 | 207 |
| 984 | 3300005719 | Ga0068861_100006125 | Ga0068861_1000061255 | 207 |
| 985 | 3300005840 | Ga0068870_10245124 | Ga0068870_102451241 | 207 |
| 986 | 3300005843 | Ga0068860_100022110 | Ga0068860_1000221105 | 207 |
| 987 | 3300005844 | Ga0068862_100076839 | Ga0068862_1000768393 | 207 |
| 988 | 3300006844 | Ga0075428_100354918 | Ga0075428_1003549182 | 207 |
| 989 | 3300009094 | Ga0111539_11179587 | Ga0111539_111795871 | 207 |
| 990 | 3300009098 | Ga0105245_11261122 | Ga0105245_112611221 | 207 |
| 991 | 3300009176 | Ga0105242_10150891 | Ga0105242_101508912 | 207 |
| 992 | 3300009553 | Ga0105249_10011401 | Ga0105249_100114016 | 207 |
| 993 | 3300013102 | Ga0157371_10511310 | Ga0157371_105113101 | 207 |
| 994 | 3300013297 | Ga0157378_10009116 | Ga0157378_100091168 | 207 |
| 995 | 3300013297 | Ga0157378_10029842 | Ga0157378_100298424 | 207 |
| 996 | 3300013306 | Ga0163162_10323460 | Ga0163162_103234601 | 207 |
| 997 | 3300013306 | Ga0163162_10335240 | Ga0163162_103352402 | 207 |
| 998 | 3300014326 | Ga0157380_10005686 | Ga0157380_100056863 | 207 |
| 999 | 3300014326 | Ga0157380_10146960 | Ga0157380_101469602 | 207 |
| 1000 | 3300017792 | Ga0163161_10353702 | Ga0163161_103537022 | 207 |
| 1001 | 3300025918 | Ga0207662_10135164 | Ga0207662_101351642 | 207 |
| 1002 | 3300025923 | Ga0207681_10046565 | Ga0207681_100465651 | 207 |
| 1003 | 3300025942 | Ga0207689_10071917 | Ga0207689_100719173 | 207 |
| 1004 | 3300025961 | Ga0207712_10016894 | Ga0207712_100168941 | 207 |
| 1005 | 3300025981 | Ga0207640_10100247 | Ga0207640_101002472 | 207 |
| 1006 | 3300026035 | Ga0207703_10042431 | Ga0207703_100424313 | 207 |
| 1007 | 3300026075 | Ga0207708_10024106 | Ga0207708_100241062 | 207 |
| 1008 | 3300026075 | Ga0207708_10883393 | Ga0207708_108833931 | 207 |
| 1009 | 3300026118 | Ga0207675_100097066 | Ga0207675_1000970662 | 207 |
| 1010 | 3300027907 | Ga0207428_10069112 | Ga0207428_100691122 | 207 |
| 1011 | 3300028380 | Ga0268265_10199819 | Ga0268265_101998191 | 207 |
| 1012 | 3300028381 | Ga0268264_10171380 | Ga0268264_101713802 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7luj-assembly3.cif.gz_C | burkholderia pseudomallei disulfide bond forming protein a (dsba) liganded with fragment 4-methoxy-n-phenylbenzenesulfonamide | 0.8855 | 59 | 100 |
| 1st9-assembly2.cif.gz_B | crystal structure of a soluble domain of resa in the oxidised form | 0.8181 | 39 | 195 |
| 2h1b-assembly2.cif.gz_B | resa e80q | 0.8056 | 33 | 195 |
| 2h1g-assembly1.cif.gz_A | resa c74a/c77a | 0.8053 | 39 | 195 |
| 2h1a-assembly1.cif.gz_A | resa c74a variant | 0.8045 | 39 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5vyoC00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8684 | 58 | 100 | 3.40.30.10 |
| 3apoA02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8133 | 55 | 100 | 3.40.30.10 |
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8015 | 40 | 196 | 3.40.30.10 |
| af_O06392_67_205_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8006 | 41 | 194 | 3.40.30.10 |
| af_B2RYB1_652_773_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7968 | 58 | 100 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8P7L8-F1-model_v4 | Thioredoxin domain-containing protein | 0.9584 | 41 | 205 |
GO:0016209
GO:0016491 |
| AF-A0A2V8P7L8-F1-model_v4 | Thioredoxin domain-containing protein | 0.947 | 41 | 205 |
GO:0016209
GO:0016491 |
| AF-A0A7V9SMR1-F1-model_v4 | TlpA family protein disulfide reductase | 0.8884 | 18 | 207 |
GO:0016209
GO:0016491 |
| AF-A0A2W4S4J2-F1-model_v4 | Thiol:disulfide interchange protein | 0.8682 | 39 | 194 |
GO:0016020
GO:0016491 GO:0017004 |
| AF-A0A5B3GEP1-F1-model_v4 | AhpC/TSA family protein | 0.8675 | 39 | 160 |
GO:0016491
GO:0017004 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar