F488158

General Info

Members Datasets Scaffolds Average Seq Length
1012 271 1012 206

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10360617|Ga0065715_103606171
Length 224
Sequence VGVIDKTAAYRTLESELIAMNKLVILVFALLLSPMVARAQGGHEYSPLVEKTVNYKNWALPNLKTDKPDDLRALVAGKKLVMIVYFAPWCGNWRNEAPIAAKLYEKYKDQGFQVIGVSEYGSRDDVKAYFGEAGAPYPVVTESESRDDKQKTAHYGYRQLTGDGRNWGSPWNIFLEPSKLTATGDVLTEKAWVVNGELVEDEVDKFIASKVSLKTASVIEPCKN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
202 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
237 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
238 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
239 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
240 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
243 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
244 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
245 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
259 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
260 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11831596 2162886012 Bacteria 875
2 CNBas_1001844 3300000531 Unclassified 1142
3 JGI24751J29686_10000044 3300002459 Bacteria 77576
4 JGI25406J46586_10002885 3300003203 Bacteria 8106
5 Ga0065704_10087916 3300005289 Bacteria 2983
6 Ga0065704_10100713 3300005289 Unclassified 2264
7 Ga0065704_10119347 3300005289 Unclassified 1801
8 Ga0065704_10141261 3300005289 Bacteria 1513
9 Ga0065704_10158725 3300005289 Bacteria 1371
10 Ga0065712_10000123 3300005290 Bacteria 89338
11 Ga0065712_10010968 3300005290 Bacteria 2359
12 Ga0065712_10048272 3300005290 Unclassified 739
13 Ga0065712_10109847 3300005290 Bacteria 1848
14 Ga0065712_10146274 3300005290 Bacteria 1406
15 Ga0065715_10017239 3300005293 Bacteria 1615
16 Ga0065715_10068422 3300005293 Unclassified 721
17 Ga0065715_10089361 3300005293 Bacteria 10882
18 Ga0065715_10094370 3300005293 Bacteria 4350
19 Ga0065715_10147747 3300005293 Bacteria 1767
20 Ga0065715_10214062 3300005293 Bacteria 1301
21 Ga0065715_10360617 3300005293 Bacteria 884
22 Ga0065715_10586200 3300005293 Bacteria 717
23 Ga0065707_10003187 3300005295 Bacteria 4287
24 Ga0065707_10099533 3300005295 Bacteria 2989
25 Ga0065707_10106281 3300005295 Bacteria 2603
26 Ga0065707_10107559 3300005295 Unclassified 2549
27 Ga0065707_10271768 3300005295 Unclassified 1070
28 Ga0065707_10286549 3300005295 Unclassified 1034
29 Ga0065707_10294977 3300005295 Unclassified 1016
30 Ga0070676_10259573 3300005328 Bacteria 1163
31 Ga0070676_10267149 3300005328 Unclassified 1148
32 Ga0070676_10776551 3300005328 Unclassified 705
33 Ga0070683_100539584 3300005329 Unclassified 1115
34 Ga0070690_100085278 3300005330 Bacteria 2072
35 Ga0070690_100119691 3300005330 Bacteria 1766
36 Ga0070690_100128731 3300005330 Bacteria 1707
37 Ga0070690_100142793 3300005330 Unclassified 1626
38 Ga0070690_100241144 3300005330 Unclassified 1275
39 Ga0070690_100431157 3300005330 Bacteria 974
40 Ga0070670_100000144 3300005331 Bacteria 66583
41 Ga0070670_100016819 3300005331 Bacteria 6277
42 Ga0070670_100046457 3300005331 Bacteria 3734
43 Ga0070670_100132631 3300005331 Unclassified 2152
44 Ga0070670_100253954 3300005331 Bacteria 1532
45 Ga0070670_100292051 3300005331 Unclassified 1425
46 Ga0070670_100872126 3300005331 Bacteria 815
47 Ga0070677_10077455 3300005333 Bacteria 1414
48 Ga0068869_100026023 3300005334 Bacteria 4069
49 Ga0068869_100053422 3300005334 Bacteria 2937
50 Ga0068869_100108174 3300005334 Bacteria 2112
51 Ga0068869_100556540 3300005334 Unclassified 964
52 Ga0068869_100720234 3300005334 Unclassified 852
53 Ga0068869_100744021 3300005334 Unclassified 839
54 Ga0068869_100762964 3300005334 Bacteria 829
55 Ga0068869_101067821 3300005334 Unclassified 705
56 Ga0070666_10058851 3300005335 Bacteria 2599
57 Ga0070666_10077869 3300005335 Bacteria 2263
58 Ga0070680_100000624 3300005336 Bacteria 24592
59 Ga0070682_100000405 3300005337 Bacteria 28330
60 Ga0070682_100003448 3300005337 Bacteria 8754
61 Ga0070682_100011524 3300005337 Bacteria 5055
62 Ga0070682_100702342 3300005337 Bacteria 811
63 Ga0068868_100012130 3300005338 Bacteria 6293
64 Ga0068868_100022784 3300005338 Bacteria 4733
65 Ga0068868_100087038 3300005338 Bacteria 2512
66 Ga0068868_100346800 3300005338 Bacteria 1271
67 Ga0068868_100349530 3300005338 Bacteria 1266
68 Ga0068868_100432309 3300005338 Bacteria 1142
69 Ga0070660_100185064 3300005339 Unclassified 1686
70 Ga0070689_100001209 3300005340 Bacteria 16353
71 Ga0070689_100137948 3300005340 Unclassified 1959
72 Ga0070689_100205479 3300005340 Bacteria 1610
73 Ga0070691_10469824 3300005341 Bacteria 722
74 Ga0070687_100012833 3300005343 Unclassified 3714
75 Ga0070687_100012923 3300005343 Bacteria 3704
76 Ga0070687_100181944 3300005343 Bacteria 1260
77 Ga0070687_100232675 3300005343 Unclassified 1135
78 Ga0070687_100281004 3300005343 Bacteria 1048
79 Ga0070687_100629167 3300005343 Bacteria 741
80 Ga0070687_100759905 3300005343 Bacteria 683
81 Ga0070661_100177215 3300005344 Bacteria 1621
82 Ga0070661_100846179 3300005344 Bacteria 753
83 Ga0070692_10001749 3300005345 Bacteria 8102
84 Ga0070692_10009660 3300005345 Bacteria 4361
85 Ga0070692_10063808 3300005345 Bacteria 1947
86 Ga0070692_10229614 3300005345 Bacteria 1101
87 Ga0070692_10279775 3300005345 Unclassified 1011
88 Ga0070668_100001433 3300005347 Bacteria 17215
89 Ga0070668_101151423 3300005347 Unclassified 701
90 Ga0070669_100001869 3300005353 Bacteria 15165
91 Ga0070669_100036875 3300005353 Bacteria 3544
92 Ga0070669_100064092 3300005353 Bacteria 2706
93 Ga0070669_100186423 3300005353 Bacteria 1626
94 Ga0070669_100308450 3300005353 Bacteria 1275
95 Ga0070669_100389284 3300005353 Unclassified 1138
96 Ga0070675_100159298 3300005354 Bacteria 1940
97 Ga0070671_100003832 3300005355 Bacteria 11813
98 Ga0070671_100085327 3300005355 Bacteria 2641
99 Ga0070671_100225165 3300005355 Bacteria 1591
100 Ga0070671_100339530 3300005355 Bacteria 1281
101 Ga0070674_100792502 3300005356 Bacteria 818
102 Ga0070673_100081375 3300005364 Unclassified 2626
103 Ga0070673_100130152 3300005364 Bacteria 2110
104 Ga0070673_100236121 3300005364 Bacteria 1588
105 Ga0070673_100245695 3300005364 Unclassified 1558
106 Ga0070673_100448507 3300005364 Bacteria 1160
107 Ga0070673_100527543 3300005364 Bacteria 1071
108 Ga0070673_100691062 3300005364 Unclassified 936
109 Ga0070673_101107574 3300005364 Unclassified 740
110 Ga0070688_100327451 3300005365 Unclassified 1115
111 Ga0070688_100790993 3300005365 Unclassified 741
112 Ga0070659_100016910 3300005366 Bacteria 5482
113 Ga0070659_100167007 3300005366 Bacteria 1801
114 Ga0070667_100550020 3300005367 Bacteria 1061
115 Ga0070667_100677013 3300005367 Unclassified 953
116 Ga0070667_100808510 3300005367 Bacteria 870
117 Ga0070703_10000117 3300005406 Bacteria 41424
118 Ga0070703_10021983 3300005406 Bacteria 1868
119 Ga0070703_10036845 3300005406 Bacteria 1505
120 Ga0070703_10047071 3300005406 Unclassified 1365
121 Ga0070701_10036020 3300005438 Bacteria 2490
122 Ga0070701_10040733 3300005438 Bacteria 2363
123 Ga0070701_10200044 3300005438 Unclassified 1180
124 Ga0070705_100007202 3300005440 Bacteria 5472
125 Ga0070705_100056427 3300005440 Bacteria 2313
126 Ga0070705_100067535 3300005440 Bacteria 2148
127 Ga0070705_100117059 3300005440 Bacteria 1714
128 Ga0070705_100119594 3300005440 Bacteria 1698
129 Ga0070700_100000062 3300005441 Bacteria 79866
130 Ga0070700_100007690 3300005441 Bacteria 5834
131 Ga0070700_100010600 3300005441 Bacteria 5091
132 Ga0070700_100122307 3300005441 Unclassified 1746
133 Ga0070700_100166334 3300005441 Unclassified 1523
134 Ga0070700_100426070 3300005441 Bacteria 1004
135 Ga0070694_100002065 3300005444 Bacteria 11915
136 Ga0070694_100004696 3300005444 Bacteria 8221
137 Ga0070694_100007085 3300005444 Bacteria 6824
138 Ga0070694_100009483 3300005444 Bacteria 5971
139 Ga0070694_100026789 3300005444 Unclassified 3739
140 Ga0070694_100056456 3300005444 Unclassified 2667
141 Ga0070694_100116800 3300005444 Bacteria 1909
142 Ga0070694_100127480 3300005444 Bacteria 1834
143 Ga0070694_100162633 3300005444 Bacteria 1639
144 Ga0070694_100206996 3300005444 Bacteria 1465
145 Ga0070694_100340587 3300005444 Bacteria 1159
146 Ga0070694_100341338 3300005444 Unclassified 1158
147 Ga0070694_100540898 3300005444 Unclassified 932
148 Ga0070694_100561943 3300005444 Unclassified 915
149 Ga0070694_100764636 3300005444 Bacteria 790
150 Ga0070694_100863718 3300005444 Bacteria 745
151 Ga0070708_100001183 3300005445 Bacteria 20061
152 Ga0070708_100016622 3300005445 Bacteria 6111
153 Ga0070708_100045673 3300005445 Bacteria 3861
154 Ga0070708_100077547 3300005445 Bacteria 3003
155 Ga0070708_100188259 3300005445 Unclassified 1930
156 Ga0070708_100682779 3300005445 Unclassified 967
157 Ga0070708_101367246 3300005445 Unclassified 661
158 Ga0070663_100440258 3300005455 Bacteria 1072
159 Ga0070663_100449565 3300005455 Unclassified 1062
160 Ga0070678_100159223 3300005456 Bacteria 1827
161 Ga0070662_100021490 3300005457 Bacteria 4407
162 Ga0070662_100280603 3300005457 Bacteria 1348
163 Ga0070662_100386373 3300005457 Bacteria 1153
164 Ga0070662_100389585 3300005457 Bacteria 1148
165 Ga0070662_100537709 3300005457 Unclassified 978
166 Ga0070681_10007691 3300005458 Bacteria 10538
167 Ga0070681_10020025 3300005458 Bacteria 6703
168 Ga0070681_10025119 3300005458 Bacteria 5995
169 Ga0070681_10072851 3300005458 Bacteria 3397
170 Ga0068867_100012727 3300005459 Bacteria 5953
171 Ga0068867_100072287 3300005459 Bacteria 2581
172 Ga0068867_100160907 3300005459 Bacteria 1770
173 Ga0070685_10133495 3300005466 Bacteria 1555
174 Ga0070685_10807272 3300005466 Bacteria 692
175 Ga0070706_100014834 3300005467 Bacteria 7201
176 Ga0070706_100043332 3300005467 Bacteria 4158
177 Ga0070706_100044179 3300005467 Bacteria 4116
178 Ga0070706_100199596 3300005467 Bacteria 1869
179 Ga0070706_100274933 3300005467 Bacteria 1572
180 Ga0070706_100377280 3300005467 Bacteria 1321
181 Ga0070707_100000349 3300005468 Bacteria 45434
182 Ga0070707_100011592 3300005468 Bacteria 8224
183 Ga0070707_100018277 3300005468 Bacteria 6597
184 Ga0070707_100049224 3300005468 Bacteria 4039
185 Ga0070707_100262783 3300005468 Bacteria 1679
186 Ga0070707_100324760 3300005468 Bacteria 1495
187 Ga0070707_100355400 3300005468 Bacteria 1423
188 Ga0070707_100661499 3300005468 Bacteria 1007
189 Ga0070707_100961995 3300005468 Bacteria 819
190 Ga0070707_100995040 3300005468 Unclassified 804
191 Ga0070698_100000126 3300005471 Bacteria 66495
192 Ga0070698_100000214 3300005471 Bacteria 56486
193 Ga0070698_100010112 3300005471 Bacteria 10078
194 Ga0070698_100016175 3300005471 Bacteria 7877
195 Ga0070698_100066657 3300005471 Unclassified 3622
196 Ga0070698_100073161 3300005471 Bacteria 3434
197 Ga0070698_100441906 3300005471 Unclassified 1236
198 Ga0070698_100527919 3300005471 Unclassified 1119
199 Ga0070698_100550075 3300005471 Bacteria 1094
200 Ga0070699_100002296 3300005518 Bacteria 17204
201 Ga0070699_100005850 3300005518 Bacteria 10747
202 Ga0070699_100006980 3300005518 Bacteria 9815
203 Ga0070699_100047578 3300005518 Unclassified 3711
204 Ga0070699_100065301 3300005518 Bacteria 3158
205 Ga0070699_100272927 3300005518 Bacteria 1514
206 Ga0070699_100556037 3300005518 Bacteria 1045
207 Ga0070699_100957260 3300005518 Unclassified 785
208 Ga0070679_100000047 3300005530 Bacteria 90654
209 Ga0070679_100912282 3300005530 Unclassified 822
210 Ga0070684_100776426 3300005535 Unclassified 895
211 Ga0070697_100000217 3300005536 Bacteria 47346
212 Ga0070697_100000380 3300005536 Bacteria 34660
213 Ga0070697_100044313 3300005536 Unclassified 3603
214 Ga0070697_100167892 3300005536 Bacteria 1856
215 Ga0070697_100297976 3300005536 Unclassified 1386
216 Ga0070697_100379832 3300005536 Bacteria 1224
217 Ga0070697_100392709 3300005536 Bacteria 1203
218 Ga0068853_100150415 3300005539 Bacteria 2095
219 Ga0068853_100405778 3300005539 Bacteria 1276
220 Ga0068853_100453121 3300005539 Bacteria 1207
221 Ga0068853_100488941 3300005539 Bacteria 1161
222 Ga0068853_100706419 3300005539 Bacteria 962
223 Ga0068853_100946251 3300005539 Unclassified 828
224 Ga0070672_100270755 3300005543 Bacteria 1434
225 Ga0070672_100809191 3300005543 Unclassified 825
226 Ga0070672_100832642 3300005543 Unclassified 813
227 Ga0070686_100000648 3300005544 Bacteria 20371
228 Ga0070686_100009242 3300005544 Bacteria 5534
229 Ga0070686_100020844 3300005544 Bacteria 3885
230 Ga0070686_100095756 3300005544 Bacteria 1995
231 Ga0070686_100833525 3300005544 Bacteria 746
232 Ga0070686_100914422 3300005544 Unclassified 715
233 Ga0070695_100039878 3300005545 Bacteria 2970
234 Ga0070695_100045540 3300005545 Unclassified 2797
235 Ga0070695_100103748 3300005545 Bacteria 1919
236 Ga0070695_100275601 3300005545 Bacteria 1234
237 Ga0070695_100396149 3300005545 Bacteria 1046
238 Ga0070695_100435736 3300005545 Bacteria 1001
239 Ga0070695_100465171 3300005545 Bacteria 972
240 Ga0070695_100474366 3300005545 Unclassified 963
241 Ga0070695_100723643 3300005545 Unclassified 792
242 Ga0070696_100031651 3300005546 Unclassified 3627
243 Ga0070696_100037727 3300005546 Unclassified 3333
244 Ga0070696_100156761 3300005546 Bacteria 1675
245 Ga0070696_100164135 3300005546 Bacteria 1638
246 Ga0070696_100171861 3300005546 Bacteria 1602
247 Ga0070696_100293413 3300005546 Unclassified 1243
248 Ga0070696_100320826 3300005546 Bacteria 1192
249 Ga0070696_100405273 3300005546 Unclassified 1068
250 Ga0070696_100557848 3300005546 Bacteria 918
251 Ga0070696_100587500 3300005546 Unclassified 896
252 Ga0070693_100001695 3300005547 Bacteria 10006
253 Ga0070693_100004426 3300005547 Bacteria 6641
254 Ga0070693_100031014 3300005547 Bacteria 2927
255 Ga0070665_100622772 3300005548 Bacteria 1092
256 Ga0070665_100883143 3300005548 Bacteria 907
257 Ga0070704_100003232 3300005549 Bacteria 9315
258 Ga0070704_100050571 3300005549 Bacteria 2922
259 Ga0070704_100102529 3300005549 Bacteria 2159
260 Ga0070704_100126943 3300005549 Bacteria 1970
261 Ga0070704_100282862 3300005549 Bacteria 1375
262 Ga0070704_100316789 3300005549 Bacteria 1305
263 Ga0070704_100347020 3300005549 Unclassified 1252
264 Ga0070704_100442306 3300005549 Unclassified 1118
265 Ga0070704_100612336 3300005549 Unclassified 958
266 Ga0070704_100751961 3300005549 Unclassified 868
267 Ga0070704_100817063 3300005549 Unclassified 834
268 Ga0070664_100014957 3300005564 Bacteria 6332
269 Ga0070664_100456518 3300005564 Bacteria 1174
270 Ga0068857_100064025 3300005577 Unclassified 3269
271 Ga0068857_100138045 3300005577 Bacteria 2202
272 Ga0068857_100600591 3300005577 Bacteria 1040
273 Ga0068857_100615014 3300005577 Unclassified 1028
274 Ga0068857_100951970 3300005577 Bacteria 825
275 Ga0068857_101149657 3300005577 Bacteria 751
276 Ga0068854_100082457 3300005578 Unclassified 2377
277 Ga0068854_100121292 3300005578 Bacteria 1985
278 Ga0068854_100129147 3300005578 Bacteria 1928
279 Ga0068854_100181278 3300005578 Bacteria 1645
280 Ga0068854_100378895 3300005578 Unclassified 1165
281 Ga0068856_100006841 3300005614 Bacteria 11155
282 Ga0070702_100013605 3300005615 Bacteria 4112
283 Ga0070702_100063061 3300005615 Bacteria 2162
284 Ga0070702_100095456 3300005615 Bacteria 1813
285 Ga0070702_100217094 3300005615 Bacteria 1276
286 Ga0070702_100473090 3300005615 Bacteria 914
287 Ga0068852_100131637 3300005616 Bacteria 2304
288 Ga0068852_100331812 3300005616 Bacteria 1480
289 Ga0068852_100707377 3300005616 Bacteria 1018
290 Ga0068852_100912548 3300005616 Bacteria 896
291 Ga0068859_100020309 3300005617 Bacteria 6668
292 Ga0068859_100022806 3300005617 Bacteria 6276
293 Ga0068859_100029886 3300005617 Bacteria 5467
294 Ga0068859_100040540 3300005617 Unclassified 4674
295 Ga0068859_100045155 3300005617 Bacteria 4427
296 Ga0068859_100049851 3300005617 Bacteria 4205
297 Ga0068859_100056736 3300005617 Bacteria 3943
298 Ga0068859_100114087 3300005617 Unclassified 2765
299 Ga0068859_100126246 3300005617 Bacteria 2628
300 Ga0068859_100150795 3300005617 Bacteria 2400
301 Ga0068859_100178192 3300005617 Bacteria 2208
302 Ga0068859_100280931 3300005617 Bacteria 1757
303 Ga0068859_100315592 3300005617 Unclassified 1657
304 Ga0068859_100466912 3300005617 Unclassified 1358
305 Ga0068859_101190759 3300005617 Unclassified 839
306 Ga0068864_100064981 3300005618 Bacteria 3165
307 Ga0068864_100098969 3300005618 Bacteria 2583
308 Ga0068864_100122297 3300005618 Bacteria 2329
309 Ga0068864_100124782 3300005618 Bacteria 2306
310 Ga0068864_100151645 3300005618 Bacteria 2100
311 Ga0068864_100167807 3300005618 Bacteria 1999
312 Ga0068864_100239213 3300005618 Unclassified 1682
313 Ga0068864_100264650 3300005618 Unclassified 1600
314 Ga0068864_100322629 3300005618 Bacteria 1451
315 Ga0068864_100443012 3300005618 Bacteria 1241
316 Ga0068864_100482718 3300005618 Bacteria 1190
317 Ga0068864_100483302 3300005618 Unclassified 1189
318 Ga0068864_100610628 3300005618 Unclassified 1059
319 Ga0068866_10031530 3300005718 Bacteria 2554
320 Ga0068866_10076173 3300005718 Bacteria 1788
321 Ga0068861_100006125 3300005719 Bacteria 8185
322 Ga0068861_100023899 3300005719 Bacteria 4413
323 Ga0068861_100034946 3300005719 Bacteria 3720
324 Ga0068861_100089492 3300005719 Bacteria 2426
325 Ga0068861_100130256 3300005719 Unclassified 2041
326 Ga0068861_100223068 3300005719 Unclassified 1594
327 Ga0068861_100312448 3300005719 Bacteria 1366
328 Ga0068861_100698675 3300005719 Unclassified 942
329 Ga0068851_10362742 3300005834 Unclassified 845
330 Ga0068870_10017039 3300005840 Bacteria 3486
331 Ga0068870_10051005 3300005840 Bacteria 2189
332 Ga0068870_10150257 3300005840 Bacteria 1371
333 Ga0068870_10245124 3300005840 Unclassified 1108
334 Ga0068863_100026639 3300005841 Bacteria 5513
335 Ga0068863_100091832 3300005841 Unclassified 2879
336 Ga0068863_100133871 3300005841 Bacteria 2367
337 Ga0068863_100163148 3300005841 Unclassified 2136
338 Ga0068863_100276594 3300005841 Unclassified 1626
339 Ga0068863_100499072 3300005841 Bacteria 1198
340 Ga0068863_100592415 3300005841 Bacteria 1097
341 Ga0068863_100595866 3300005841 Bacteria 1094
342 Ga0068863_100750732 3300005841 Bacteria 972
343 Ga0068858_100014545 3300005842 Bacteria 7415
344 Ga0068858_100033321 3300005842 Bacteria 4782
345 Ga0068858_100115266 3300005842 Unclassified 2510
346 Ga0068858_100146758 3300005842 Unclassified 2216
347 Ga0068858_100161681 3300005842 Bacteria 2108
348 Ga0068858_100176608 3300005842 Bacteria 2015
349 Ga0068858_100355061 3300005842 Unclassified 1404
350 Ga0068858_100377009 3300005842 Bacteria 1361
351 Ga0068858_100726763 3300005842 Bacteria 967
352 Ga0068860_100022110 3300005843 Bacteria 6156
353 Ga0068860_100035879 3300005843 Unclassified 4754
354 Ga0068860_100055864 3300005843 Bacteria 3753
355 Ga0068860_100153124 3300005843 Unclassified 2221
356 Ga0068860_100226580 3300005843 Bacteria 1816
357 Ga0068860_100340565 3300005843 Bacteria 1474
358 Ga0068860_100710189 3300005843 Bacteria 1015
359 Ga0068862_100063414 3300005844 Bacteria 3180
360 Ga0068862_100070844 3300005844 Unclassified 3010
361 Ga0068862_100076839 3300005844 Bacteria 2890
362 Ga0068862_100102217 3300005844 Bacteria 2509
363 Ga0068862_100535118 3300005844 Bacteria 1117
364 Ga0068862_100615184 3300005844 Bacteria 1044
365 Ga0068862_100721625 3300005844 Unclassified 967
366 Ga0081455_10463840 3300005937 Bacteria 862
367 Ga0081540_1063214 3300005983 Unclassified 1753
368 Ga0081539_10000422 3300005985 Bacteria 90043
369 Ga0081539_10007568 3300005985 Bacteria 9824
370 Ga0075432_10071248 3300006058 Unclassified 1249
371 Ga0070715_10000002 3300006163 Bacteria 389554
372 Ga0070716_100000001 3300006173 Bacteria 400668
373 Ga0070716_100142786 3300006173 Unclassified 1529
374 Ga0070716_100166330 3300006173 Bacteria 1434
375 Ga0070716_100591540 3300006173 Bacteria 833
376 Ga0070716_100815578 3300006173 Unclassified 724
377 Ga0097621_100010916 3300006237 Bacteria 6668
378 Ga0097621_100218321 3300006237 Bacteria 1661
379 Ga0068871_100106369 3300006358 Bacteria 2355
380 Ga0068871_100133507 3300006358 Bacteria 2106
381 Ga0068871_100919660 3300006358 Bacteria 811
382 Ga0075428_100052364 3300006844 Bacteria 4474
383 Ga0075428_100140028 3300006844 Bacteria 2631
384 Ga0075428_100294946 3300006844 Bacteria 1744
385 Ga0075428_100354918 3300006844 Bacteria 1573
386 Ga0075430_100101202 3300006846 Bacteria 2406
387 Ga0075431_100093711 3300006847 Bacteria 3099
388 Ga0075431_100789153 3300006847 Bacteria 923
389 Ga0075433_10042512 3300006852 Bacteria 3943
390 Ga0075433_10066356 3300006852 Bacteria 3166
391 Ga0075433_10073659 3300006852 Unclassified 3004
392 Ga0075433_10111034 3300006852 Bacteria 2432
393 Ga0075433_10119161 3300006852 Unclassified 2343
394 Ga0075433_10592137 3300006852 Bacteria 974
395 Ga0075433_10673275 3300006852 Bacteria 907
396 Ga0075434_100105261 3300006871 Bacteria 2832
397 Ga0075434_100106497 3300006871 Unclassified 2813
398 Ga0075434_100179512 3300006871 Bacteria 2137
399 Ga0075434_100208089 3300006871 Bacteria 1977
400 Ga0075434_100252352 3300006871 Bacteria 1783
401 Ga0075434_100603563 3300006871 Bacteria 1117
402 Ga0075429_100108511 3300006880 Bacteria 2426
403 Ga0075429_100333883 3300006880 Bacteria 1327
404 Ga0075429_100547152 3300006880 Bacteria 1014
405 Ga0075436_100000028 3300006914 Bacteria 97815
406 Ga0075436_100022320 3300006914 Bacteria 4347
407 Ga0097620_100020310 3300006931 Bacteria 6668
408 Ga0097620_100022804 3300006931 Bacteria 6276
409 Ga0097620_100029886 3300006931 Bacteria 5467
410 Ga0097620_100040539 3300006931 Unclassified 4674
411 Ga0097620_100045156 3300006931 Bacteria 4427
412 Ga0097620_100049850 3300006931 Bacteria 4205
413 Ga0097620_100056736 3300006931 Bacteria 3943
414 Ga0097620_100114088 3300006931 Unclassified 2765
415 Ga0097620_100126241 3300006931 Bacteria 2628
416 Ga0097620_100150795 3300006931 Bacteria 2400
417 Ga0097620_100178175 3300006931 Bacteria 2208
418 Ga0097620_100280938 3300006931 Bacteria 1757
419 Ga0097620_100315570 3300006931 Unclassified 1657
420 Ga0097620_100466931 3300006931 Unclassified 1358
421 Ga0097620_101191116 3300006931 Unclassified 839
422 Ga0075435_100021741 3300007076 Unclassified 4940
423 Ga0075435_100426004 3300007076 Bacteria 1143
424 Ga0099794_10004171 3300007265 Bacteria 5636
425 Ga0099795_10058360 3300007788 Bacteria 1425
426 Ga0105251_10167242 3300009011 Unclassified 991
427 Ga0105240_10176724 3300009093 Bacteria 2523
428 Ga0111539_10001877 3300009094 Bacteria 27899
429 Ga0111539_10005687 3300009094 Bacteria 16134
430 Ga0111539_10006549 3300009094 Bacteria 15010
431 Ga0111539_10125960 3300009094 Bacteria 3001
432 Ga0111539_10150037 3300009094 Bacteria 2729
433 Ga0111539_10389665 3300009094 Unclassified 1622
434 Ga0111539_10723326 3300009094 Unclassified 1159
435 Ga0111539_11179587 3300009094 Unclassified 889
436 Ga0105245_10427013 3300009098 Unclassified 1329
437 Ga0105245_10724165 3300009098 Unclassified 1029
438 Ga0105245_10868491 3300009098 Bacteria 943
439 Ga0105245_10985689 3300009098 Bacteria 887
440 Ga0105245_11261122 3300009098 Bacteria 788
441 Ga0105247_10003373 3300009101 Bacteria 10451
442 Ga0105247_10102872 3300009101 Bacteria 1828
443 Ga0105247_10117094 3300009101 Bacteria 1722
444 Ga0105247_10130714 3300009101 Bacteria 1636
445 Ga0105247_10165925 3300009101 Bacteria 1465
446 Ga0105247_10472538 3300009101 Unclassified 908
447 Ga0114129_10010658 3300009147 Bacteria 13107
448 Ga0114129_10049988 3300009147 Bacteria 5873
449 Ga0114129_10071582 3300009147 Unclassified 4835
450 Ga0114129_10149045 3300009147 Bacteria 3202
451 Ga0114129_10200232 3300009147 Bacteria 2705
452 Ga0114129_10210011 3300009147 Bacteria 2632
453 Ga0114129_10240502 3300009147 Bacteria 2434
454 Ga0114129_10279643 3300009147 Bacteria 2230
455 Ga0114129_10589249 3300009147 Bacteria 1442
456 Ga0114129_10873829 3300009147 Unclassified 1141
457 Ga0114129_10876941 3300009147 Unclassified 1139
458 Ga0105243_10000015 3300009148 Bacteria 251115
459 Ga0105243_10012901 3300009148 Bacteria 6314
460 Ga0105243_10014515 3300009148 Bacteria 5959
461 Ga0105243_10055616 3300009148 Unclassified 3144
462 Ga0105243_10066347 3300009148 Bacteria 2902
463 Ga0105243_10092878 3300009148 Bacteria 2489
464 Ga0105243_10197930 3300009148 Unclassified 1760
465 Ga0105243_10267282 3300009148 Bacteria 1534
466 Ga0105243_10422313 3300009148 Bacteria 1244
467 Ga0105243_10434797 3300009148 Unclassified 1227
468 Ga0105243_10735466 3300009148 Bacteria 966
469 Ga0105243_11115138 3300009148 Unclassified 798
470 Ga0105243_11257944 3300009148 Unclassified 755
471 Ga0105241_10045407 3300009174 Bacteria 3333
472 Ga0105241_10105290 3300009174 Bacteria 2249
473 Ga0105241_10503279 3300009174 Unclassified 1080
474 Ga0105241_10513392 3300009174 Bacteria 1070
475 Ga0105241_10592148 3300009174 Unclassified 1001
476 Ga0105241_10921539 3300009174 Unclassified 813
477 Ga0105241_11443259 3300009174 Bacteria 660
478 Ga0105242_10000028 3300009176 Bacteria 106293
479 Ga0105242_10008738 3300009176 Bacteria 7773
480 Ga0105242_10032609 3300009176 Bacteria 4166
481 Ga0105242_10040362 3300009176 Bacteria 3761
482 Ga0105242_10150891 3300009176 Bacteria 2026
483 Ga0105242_10293396 3300009176 Bacteria 1481
484 Ga0105242_10390455 3300009176 Bacteria 1296
485 Ga0105242_10391601 3300009176 Bacteria 1294
486 Ga0105242_10408433 3300009176 Bacteria 1269
487 Ga0105242_10527510 3300009176 Bacteria 1128
488 Ga0105248_10009861 3300009177 Bacteria 10521
489 Ga0105248_10025944 3300009177 Bacteria 6517
490 Ga0105248_10059640 3300009177 Bacteria 4286
491 Ga0105248_10117472 3300009177 Bacteria 3000
492 Ga0105248_10129580 3300009177 Bacteria 2846
493 Ga0105248_10205134 3300009177 Bacteria 2221
494 Ga0105248_10466434 3300009177 Bacteria 1423
495 Ga0105248_10489232 3300009177 Bacteria 1387
496 Ga0105248_10804707 3300009177 Unclassified 1061
497 Ga0105248_10870785 3300009177 Bacteria 1017
498 Ga0105248_11424512 3300009177 Bacteria 784
499 Ga0105237_10000903 3300009545 Bacteria 39910
500 Ga0105237_10101023 3300009545 Bacteria 2876
501 Ga0105237_10490011 3300009545 Bacteria 1236
502 Ga0105238_10005940 3300009551 Bacteria 12097
503 Ga0105238_10013120 3300009551 Bacteria 8362
504 Ga0105249_10000136 3300009553 Bacteria 96659
505 Ga0105249_10011401 3300009553 Bacteria 7806
506 Ga0105249_10043269 3300009553 Bacteria 4096
507 Ga0105249_10066800 3300009553 Bacteria 3311
508 Ga0105249_10234405 3300009553 Bacteria 1811
509 Ga0105249_10324364 3300009553 Bacteria 1552
510 Ga0105249_10406408 3300009553 Unclassified 1393
511 Ga0105249_10624820 3300009553 Bacteria 1133
512 Ga0105249_10783920 3300009553 Bacteria 1016
513 Ga0105239_10095554 3300010375 Bacteria 3283
514 Ga0105239_10109014 3300010375 Bacteria 3068
515 Ga0105239_10334780 3300010375 Bacteria 1708
516 Ga0105239_10542069 3300010375 Unclassified 1325
517 Ga0105239_10669845 3300010375 Bacteria 1185
518 Ga0105239_11401104 3300010375 Bacteria 807
519 Ga0105246_10020265 3300011119 Unclassified 4263
520 Ga0105246_10057398 3300011119 Bacteria 2693
521 Ga0105246_10102185 3300011119 Bacteria 2090
522 Ga0105246_10364491 3300011119 Bacteria 1188
523 Ga0105246_10766682 3300011119 Unclassified 852
524 Ga0157373_10010134 3300013100 Bacteria 6945
525 Ga0157373_10418838 3300013100 Bacteria 961
526 Ga0157371_10511310 3300013102 Unclassified 888
527 Ga0157374_10022394 3300013296 Bacteria 5637
528 Ga0157374_10052804 3300013296 Bacteria 3787
529 Ga0157378_10003478 3300013297 Bacteria 13980
530 Ga0157378_10009116 3300013297 Bacteria 8636
531 Ga0157378_10014880 3300013297 Bacteria 6807
532 Ga0157378_10017810 3300013297 Bacteria 6237
533 Ga0157378_10029842 3300013297 Unclassified 4816
534 Ga0157378_10067110 3300013297 Bacteria 3214
535 Ga0157378_10088050 3300013297 Bacteria 2817
536 Ga0157378_10099596 3300013297 Bacteria 2652
537 Ga0157378_10127387 3300013297 Bacteria 2353
538 Ga0157378_10127853 3300013297 Bacteria 2349
539 Ga0157378_10225211 3300013297 Unclassified 1784
540 Ga0157378_10240225 3300013297 Bacteria 1730
541 Ga0157378_10529931 3300013297 Bacteria 1180
542 Ga0157378_11115083 3300013297 Unclassified 826
543 Ga0163162_10000001 3300013306 Bacteria 751833
544 Ga0163162_10020922 3300013306 Bacteria 6435
545 Ga0163162_10022132 3300013306 Bacteria 6265
546 Ga0163162_10094875 3300013306 Bacteria 3070
547 Ga0163162_10119313 3300013306 Bacteria 2740
548 Ga0163162_10137921 3300013306 Unclassified 2550
549 Ga0163162_10221403 3300013306 Bacteria 2022
550 Ga0163162_10323460 3300013306 Bacteria 1675
551 Ga0163162_10335240 3300013306 Bacteria 1645
552 Ga0163162_10374622 3300013306 Unclassified 1557
553 Ga0163162_10803230 3300013306 Bacteria 1058
554 Ga0157372_10010237 3300013307 Bacteria 9957
555 Ga0157372_10176650 3300013307 Bacteria 2472
556 Ga0157372_10429643 3300013307 Bacteria 1539
557 Ga0157375_10010051 3300013308 Bacteria 8320
558 Ga0157375_10035989 3300013308 Bacteria 4731
559 Ga0157375_10035990 3300013308 Bacteria 4731
560 Ga0157375_10125642 3300013308 Bacteria 2679
561 Ga0157375_10625156 3300013308 Bacteria 1235
562 Ga0157375_11467363 3300013308 Bacteria 804
563 Ga0157375_11841562 3300013308 Unclassified 718
564 Ga0163163_10001208 3300014325 Bacteria 21839
565 Ga0163163_10005816 3300014325 Bacteria 10718
566 Ga0163163_10009856 3300014325 Bacteria 8562
567 Ga0163163_10040627 3300014325 Unclassified 4543
568 Ga0163163_10044834 3300014325 Bacteria 4339
569 Ga0163163_10050659 3300014325 Unclassified 4089
570 Ga0163163_10060630 3300014325 Bacteria 3747
571 Ga0163163_10125892 3300014325 Bacteria 2600
572 Ga0163163_10199147 3300014325 Bacteria 2051
573 Ga0163163_10271820 3300014325 Bacteria 1746
574 Ga0163163_10612970 3300014325 Unclassified 1152
575 Ga0163163_10870422 3300014325 Unclassified 964
576 Ga0157380_10000283 3300014326 Bacteria 30521
577 Ga0157380_10005686 3300014326 Bacteria 8720
578 Ga0157380_10006247 3300014326 Bacteria 8366
579 Ga0157380_10012283 3300014326 Bacteria 6208
580 Ga0157380_10023647 3300014326 Bacteria 4638
581 Ga0157380_10133196 3300014326 Bacteria 2124
582 Ga0157380_10146960 3300014326 Bacteria 2032
583 Ga0157380_10174950 3300014326 Bacteria 1880
584 Ga0157380_10944655 3300014326 Unclassified 892
585 Ga0157380_11117106 3300014326 Unclassified 828
586 Ga0157377_10070675 3300014745 Bacteria 2017
587 Ga0157377_10122821 3300014745 Unclassified 1576
588 Ga0157379_10151703 3300014968 Unclassified 2090
589 Ga0157379_10201694 3300014968 Bacteria 1799
590 Ga0157379_10326075 3300014968 Bacteria 1402
591 Ga0157379_11081104 3300014968 Bacteria 768
592 Ga0157376_10072525 3300014969 Bacteria 2929
593 Ga0157376_10084445 3300014969 Bacteria 2734
594 Ga0163161_10011523 3300017792 Bacteria 6135
595 Ga0163161_10317381 3300017792 Bacteria 1231
596 Ga0163161_10353702 3300017792 Unclassified 1168
597 Ga0213875_10292036 3300021388 Unclassified 771
598 Ga0207697_10008507 3300025315 Unclassified 4484
599 Ga0207697_10047072 3300025315 Bacteria 1778
600 Ga0207653_10000342 3300025885 Bacteria 24007
601 Ga0207653_10047542 3300025885 Unclassified 1421
602 Ga0207653_10140400 3300025885 Bacteria 883
603 Ga0207682_10058435 3300025893 Bacteria 1610
604 Ga0207642_10013304 3300025899 Bacteria 3000
605 Ga0207710_10000927 3300025900 Bacteria 15620
606 Ga0207710_10185716 3300025900 Bacteria 1022
607 Ga0207647_10007102 3300025904 Bacteria 8121
608 Ga0207647_10240161 3300025904 Bacteria 1040
609 Ga0207685_10000002 3300025905 Bacteria 438088
610 Ga0207645_10091469 3300025907 Unclassified 1956
611 Ga0207643_10000595 3300025908 Bacteria 22930
612 Ga0207643_10029946 3300025908 Bacteria 3028
613 Ga0207643_10338456 3300025908 Unclassified 943
614 Ga0207684_10000314 3300025910 Bacteria 68706
615 Ga0207684_10007903 3300025910 Bacteria 9510
616 Ga0207684_10008012 3300025910 Bacteria 9437
617 Ga0207684_10174676 3300025910 Bacteria 1852
618 Ga0207684_10197959 3300025910 Bacteria 1733
619 Ga0207654_10030444 3300025911 Bacteria 2962
620 Ga0207654_10065174 3300025911 Unclassified 2144
621 Ga0207654_10113646 3300025911 Unclassified 1689
622 Ga0207654_10122934 3300025911 Bacteria 1632
623 Ga0207654_10225858 3300025911 Bacteria 1244
624 Ga0207654_10455917 3300025911 Bacteria 897
625 Ga0207707_10000006 3300025912 Bacteria 374131
626 Ga0207707_10032652 3300025912 Unclassified 4557
627 Ga0207707_10285501 3300025912 Bacteria 1428
628 Ga0207695_10066767 3300025913 Bacteria 3692
629 Ga0207671_10160785 3300025914 Unclassified 1739
630 Ga0207671_10438007 3300025914 Bacteria 1040
631 Ga0207671_10796205 3300025914 Unclassified 750
632 Ga0207660_10002802 3300025917 Bacteria 11428
633 Ga0207660_10818039 3300025917 Unclassified 760
634 Ga0207662_10002563 3300025918 Bacteria 9154
635 Ga0207662_10072803 3300025918 Bacteria 2083
636 Ga0207662_10094642 3300025918 Unclassified 1843
637 Ga0207662_10118564 3300025918 Unclassified 1657
638 Ga0207662_10135164 3300025918 Bacteria 1558
639 Ga0207652_10001029 3300025921 Bacteria 25565
640 Ga0207646_10000199 3300025922 Bacteria 81584
641 Ga0207646_10012482 3300025922 Bacteria 8162
642 Ga0207646_10072002 3300025922 Bacteria 3087
643 Ga0207646_10076563 3300025922 Bacteria 2990
644 Ga0207646_10237233 3300025922 Bacteria 1648
645 Ga0207646_10914361 3300025922 Unclassified 778
646 Ga0207681_10000407 3300025923 Bacteria 29960
647 Ga0207681_10009399 3300025923 Bacteria 5973
648 Ga0207681_10046565 3300025923 Bacteria 2917
649 Ga0207681_10144120 3300025923 Bacteria 1778
650 Ga0207681_10261458 3300025923 Unclassified 1355
651 Ga0207681_10350999 3300025923 Unclassified 1181
652 Ga0207681_10788517 3300025923 Unclassified 793
653 Ga0207694_10000938 3300025924 Bacteria 25703
654 Ga0207694_10026046 3300025924 Bacteria 4447
655 Ga0207650_10000047 3300025925 Bacteria 175675
656 Ga0207650_10000517 3300025925 Bacteria 31837
657 Ga0207650_10143185 3300025925 Bacteria 1881
658 Ga0207650_10146613 3300025925 Bacteria 1859
659 Ga0207650_10238573 3300025925 Bacteria 1469
660 Ga0207650_10960879 3300025925 Bacteria 726
661 Ga0207659_10063331 3300025926 Bacteria 2673
662 Ga0207659_10855579 3300025926 Unclassified 782
663 Ga0207687_10325776 3300025927 Bacteria 1245
664 Ga0207687_10493327 3300025927 Bacteria 1021
665 Ga0207687_10913768 3300025927 Unclassified 751
666 Ga0207644_10011207 3300025931 Bacteria 5926
667 Ga0207644_10021315 3300025931 Bacteria 4413
668 Ga0207644_10320690 3300025931 Bacteria 1253
669 Ga0207644_10526847 3300025931 Bacteria 977
670 Ga0207690_10013277 3300025932 Bacteria 4946
671 Ga0207690_10808606 3300025932 Unclassified 775
672 Ga0207706_10123297 3300025933 Bacteria 2280
673 Ga0207706_10141782 3300025933 Bacteria 2114
674 Ga0207706_10242791 3300025933 Bacteria 1574
675 Ga0207706_10423200 3300025933 Bacteria 1154
676 Ga0207686_10000031 3300025934 Bacteria 158735
677 Ga0207686_10000381 3300025934 Bacteria 30953
678 Ga0207686_10069084 3300025934 Bacteria 2265
679 Ga0207686_10367006 3300025934 Bacteria 1088
680 Ga0207709_10000009 3300025935 Bacteria 619238
681 Ga0207709_10008224 3300025935 Bacteria 5778
682 Ga0207709_10074255 3300025935 Bacteria 2169
683 Ga0207709_10090719 3300025935 Bacteria 1997
684 Ga0207709_10102046 3300025935 Bacteria 1898
685 Ga0207709_10271435 3300025935 Bacteria 1248
686 Ga0207709_10366874 3300025935 Bacteria 1092
687 Ga0207709_10488021 3300025935 Bacteria 959
688 Ga0207709_10609559 3300025935 Unclassified 865
689 Ga0207670_10000162 3300025936 Bacteria 44279
690 Ga0207670_10036079 3300025936 Bacteria 3212
691 Ga0207670_10308976 3300025936 Unclassified 1240
692 Ga0207670_10415949 3300025936 Bacteria 1078
693 Ga0207670_10734591 3300025936 Unclassified 819
694 Ga0207669_10051011 3300025937 Bacteria 2477
695 Ga0207665_10000016 3300025939 Bacteria 132853
696 Ga0207665_10071790 3300025939 Bacteria 2363
697 Ga0207665_10186956 3300025939 Unclassified 1503
698 Ga0207665_10201259 3300025939 Bacteria 1451
699 Ga0207691_10007252 3300025940 Unclassified 10692
700 Ga0207691_10300598 3300025940 Unclassified 1379
701 Ga0207711_10013606 3300025941 Bacteria 6759
702 Ga0207711_10023587 3300025941 Bacteria 5151
703 Ga0207711_10062117 3300025941 Unclassified 3222
704 Ga0207711_10103335 3300025941 Bacteria 2523
705 Ga0207711_10266561 3300025941 Bacteria 1575
706 Ga0207711_10331757 3300025941 Bacteria 1407
707 Ga0207711_10366906 3300025941 Bacteria 1335
708 Ga0207711_10732150 3300025941 Bacteria 922
709 Ga0207711_10771806 3300025941 Bacteria 896
710 Ga0207711_10846212 3300025941 Bacteria 851
711 Ga0207689_10001827 3300025942 Bacteria 20116
712 Ga0207689_10002806 3300025942 Bacteria 16095
713 Ga0207689_10071917 3300025942 Bacteria 2841
714 Ga0207689_10083245 3300025942 Bacteria 2631
715 Ga0207689_10090588 3300025942 Bacteria 2513
716 Ga0207689_10104862 3300025942 Bacteria 2323
717 Ga0207689_10120891 3300025942 Bacteria 2154
718 Ga0207689_10163621 3300025942 Bacteria 1833
719 Ga0207689_10173036 3300025942 Bacteria 1780
720 Ga0207689_10255676 3300025942 Unclassified 1449
721 Ga0207689_10326790 3300025942 Bacteria 1273
722 Ga0207689_10519742 3300025942 Unclassified 998
723 Ga0207679_10032627 3300025945 Bacteria 3658
724 Ga0207679_10165235 3300025945 Unclassified 1816
725 Ga0207679_10495974 3300025945 Unclassified 1089
726 Ga0207667_10279566 3300025949 Bacteria 1706
727 Ga0207667_10312336 3300025949 Bacteria 1605
728 Ga0207651_10096351 3300025960 Bacteria 2182
729 Ga0207651_10119147 3300025960 Bacteria 1998
730 Ga0207651_10134655 3300025960 Bacteria 1898
731 Ga0207651_10192477 3300025960 Unclassified 1628
732 Ga0207651_10276718 3300025960 Bacteria 1385
733 Ga0207651_10661408 3300025960 Unclassified 918
734 Ga0207651_10821546 3300025960 Viruses 825
735 Ga0207712_10000092 3300025961 Bacteria 103502
736 Ga0207712_10005073 3300025961 Bacteria 8330
737 Ga0207712_10016894 3300025961 Unclassified 4732
738 Ga0207712_10037262 3300025961 Bacteria 3316
739 Ga0207712_10105243 3300025961 Unclassified 2105
740 Ga0207712_10195886 3300025961 Bacteria 1598
741 Ga0207712_10352094 3300025961 Bacteria 1225
742 Ga0207712_10723660 3300025961 Bacteria 870
743 Ga0207668_10002111 3300025972 Bacteria 11601
744 Ga0207640_10014816 3300025981 Bacteria 4497
745 Ga0207640_10035631 3300025981 Bacteria 3116
746 Ga0207640_10100247 3300025981 Bacteria 2029
747 Ga0207640_10137699 3300025981 Bacteria 1775
748 Ga0207640_10389470 3300025981 Unclassified 1132
749 Ga0207658_10234953 3300025986 Bacteria 1549
750 Ga0207677_10674697 3300026023 Bacteria 914
751 Ga0207677_11103331 3300026023 Bacteria 723
752 Ga0207703_10015611 3300026035 Bacteria 5925
753 Ga0207703_10042431 3300026035 Bacteria 3649
754 Ga0207703_10045746 3300026035 Bacteria 3522
755 Ga0207703_10081772 3300026035 Bacteria 2693
756 Ga0207703_10125571 3300026035 Bacteria 2208
757 Ga0207703_10129429 3300026035 Unclassified 2178
758 Ga0207703_10165919 3300026035 Unclassified 1938
759 Ga0207703_10374853 3300026035 Bacteria 1315
760 Ga0207703_10401040 3300026035 Bacteria 1272
761 Ga0207639_10440794 3300026041 Bacteria 1181
762 Ga0207639_10614019 3300026041 Bacteria 1004
763 Ga0207708_10000246 3300026075 Bacteria 42577
764 Ga0207708_10007047 3300026075 Bacteria 8307
765 Ga0207708_10008389 3300026075 Bacteria 7648
766 Ga0207708_10024106 3300026075 Bacteria 4601
767 Ga0207708_10041981 3300026075 Bacteria 3487
768 Ga0207708_10069713 3300026075 Bacteria 2692
769 Ga0207708_10092804 3300026075 Bacteria 2330
770 Ga0207708_10096882 3300026075 Bacteria 2280
771 Ga0207708_10219950 3300026075 Bacteria 1521
772 Ga0207708_10883393 3300026075 Bacteria 773
773 Ga0207708_11022617 3300026075 Unclassified 719
774 Ga0207641_10022808 3300026088 Bacteria 5154
775 Ga0207641_10075438 3300026088 Bacteria 2912
776 Ga0207641_10173552 3300026088 Unclassified 1970
777 Ga0207641_10242088 3300026088 Bacteria 1681
778 Ga0207641_10437633 3300026088 Bacteria 1262
779 Ga0207641_10530339 3300026088 Bacteria 1146
780 Ga0207648_10009860 3300026089 Bacteria 9108
781 Ga0207648_10029342 3300026089 Bacteria 4878
782 Ga0207648_10072970 3300026089 Unclassified 2991
783 Ga0207648_10270326 3300026089 Bacteria 1518
784 Ga0207648_10406731 3300026089 Bacteria 1234
785 Ga0207648_10647435 3300026089 Unclassified 976
786 Ga0207648_11157929 3300026089 Unclassified 726
787 Ga0207676_10003037 3300026095 Bacteria 11982
788 Ga0207676_10008551 3300026095 Bacteria 7275
789 Ga0207676_10029779 3300026095 Bacteria 4090
790 Ga0207676_10120854 3300026095 Unclassified 2209
791 Ga0207676_10246216 3300026095 Bacteria 1607
792 Ga0207676_10275852 3300026095 Unclassified 1524
793 Ga0207676_10300850 3300026095 Bacteria 1465
794 Ga0207676_10312591 3300026095 Bacteria 1439
795 Ga0207676_10528675 3300026095 Bacteria 1124
796 Ga0207676_10787841 3300026095 Unclassified 927
797 Ga0207674_10019731 3300026116 Bacteria 7296
798 Ga0207674_10100220 3300026116 Unclassified 2878
799 Ga0207674_10110002 3300026116 Bacteria 2731
800 Ga0207674_10124154 3300026116 Bacteria 2547
801 Ga0207674_10182682 3300026116 Unclassified 2048
802 Ga0207674_10222075 3300026116 Unclassified 1838
803 Ga0207674_10328590 3300026116 Unclassified 1479
804 Ga0207674_10582220 3300026116 Bacteria 1081
805 Ga0207674_10605508 3300026116 Bacteria 1058
806 Ga0207675_100009521 3300026118 Bacteria 9088
807 Ga0207675_100037618 3300026118 Bacteria 4513
808 Ga0207675_100038139 3300026118 Bacteria 4484
809 Ga0207675_100097066 3300026118 Bacteria 2775
810 Ga0207675_100113146 3300026118 Bacteria 2562
811 Ga0207675_100184169 3300026118 Bacteria 2001
812 Ga0207675_100229512 3300026118 Bacteria 1791
813 Ga0207675_100254800 3300026118 Bacteria 1699
814 Ga0207675_100258880 3300026118 Bacteria 1686
815 Ga0207675_100269991 3300026118 Bacteria 1651
816 Ga0207675_100959419 3300026118 Unclassified 873
817 Ga0207683_10080211 3300026121 Bacteria 2895
818 Ga0207683_10206396 3300026121 Unclassified 1787
819 Ga0207683_10418297 3300026121 Bacteria 1234
820 Ga0207683_10433747 3300026121 Bacteria 1211
821 Ga0207698_10356844 3300026142 Bacteria 1383
822 Ga0207698_10607455 3300026142 Unclassified 1079
823 Ga0207698_10767282 3300026142 Unclassified 964
824 Ga0207428_10002219 3300027907 Bacteria 19493
825 Ga0207428_10013301 3300027907 Bacteria 7194
826 Ga0207428_10069112 3300027907 Bacteria 2777
827 Ga0207428_10296088 3300027907 Unclassified 1198
828 Ga0268266_10765376 3300028379 Bacteria 932
829 Ga0268265_10122619 3300028380 Bacteria 2144
830 Ga0268265_10199819 3300028380 Bacteria 1733
831 Ga0268265_10218442 3300028380 Bacteria 1666
832 Ga0268265_10295444 3300028380 Unclassified 1456
833 Ga0268265_10481059 3300028380 Bacteria 1166
834 Ga0268265_10508919 3300028380 Bacteria 1136
835 Ga0268264_10110750 3300028381 Bacteria 2404
836 Ga0268264_10110935 3300028381 Bacteria 2402
837 Ga0268264_10117790 3300028381 Bacteria 2336
838 Ga0268264_10129367 3300028381 Unclassified 2236
839 Ga0268264_10158615 3300028381 Bacteria 2036
840 Ga0268264_10171380 3300028381 Bacteria 1963
841 Ga0268264_10196724 3300028381 Bacteria 1841
842 Ga0268264_10389432 3300028381 Bacteria 1337
843 Ga0268264_10560060 3300028381 Bacteria 1122
844 Ga0307513_10453815 3300031456 Unclassified 1006
845 Ga0307408_100112541 3300031548 Unclassified 2093
846 Ga0307408_100509753 3300031548 Bacteria 1055
847 Ga0307405_10016049 3300031731 Unclassified 4074
848 Ga0307413_10711986 3300031824 Bacteria 835
849 Ga0307410_10031517 3300031852 Unclassified 3403
850 Ga0307410_10206176 3300031852 Bacteria 1504
851 Ga0307410_10873844 3300031852 Unclassified 769
852 Ga0307406_10098864 3300031901 Unclassified 1982
853 Ga0307406_10871705 3300031901 Bacteria 765
854 Ga0307407_10042041 3300031903 Bacteria 2560
855 Ga0307412_10021603 3300031911 Unclassified 3935
856 Ga0307412_10101083 3300031911 Unclassified 2039
857 Ga0307412_10277657 3300031911 Bacteria 1314
858 Ga0307409_100295642 3300031995 Unclassified 1504
859 Ga0307416_100035493 3300032002 Unclassified 3809
860 Ga0307416_100100284 3300032002 Bacteria 2518
861 Ga0307416_100165479 3300032002 Bacteria 2050
862 Ga0307414_10039672 3300032004 Unclassified 3173
863 Ga0307414_10186038 3300032004 Bacteria 1676
864 Ga0307415_100025864 3300032126 Bacteria 3693
865 Ga0307415_100074212 3300032126 Bacteria 2403
866 Ga0373949_0077918 3300035090 Bacteria 879
867 Ga0373951_0000456 3300035091 Bacteria 11829
868 Ga0373941_0005444 3300035115 Bacteria 2997
869 Ga0373931_0013124 3300035691 Bacteria 4029
870 Ga0373931_0103930 3300035691 Bacteria 1602
871 Ga0395900_0345971 3300037418 Bacteria 1461
872 Ga0395898_0084385 3300037466 Bacteria 3062
873 Ga0395905_0998662 3300037471 Bacteria 740
874 Ga0395901_0371842 3300038443 Bacteria 1472
875 Ga0242422_01462 3300038699 Unclassified 1632
876 Ga0242420_014220 3300038996 Unclassified 1364
877 Ga0439439_0097744 3300041406 Bacteria 806
878 Ga0439431_0084883 3300041997 Bacteria 857
879 Ga0439455_0011346 3300042012 Bacteria 1977
880 Ga0439458_0010133 3300042157 Bacteria 2098
881 Ga0439434_0013509 3300042435 Unclassified 2425
882 Ga0439464_0056276 3300042439 Bacteria 1145
883 Ga0453683_0117074 3300044673 Bacteria 1677
884 Ga0451576_0565285 3300045051 Unclassified 1195
885 Ga0451576_1074163 3300045051 Bacteria 843
886 Ga0451576_1169985 3300045051 Unclassified 804
887 Ga0451576_1215512 3300045051 Bacteria 787
888 Ga0495639_0097569 3300046475 Bacteria 1385
889 Ga0495586_0194213 3300046535 Bacteria 1150
890 Ga0495621_0000007 3300046539 Bacteria 43743
891 Ga0495621_0005112 3300046539 Bacteria 3747
892 Ga0495659_0019215 3300046664 Bacteria 2285
893 Ga0495613_0018185 3300046689 Bacteria 5240
894 Ga0495674_0438464 3300047319 Bacteria 1051
895 Ga0495672_0008903 3300047320 Bacteria 7335
896 Ga0495680_0050097 3300047322 Bacteria 3267
897 Ga0495677_0063226 3300047445 Bacteria 1375
898 Ga0496100_1083949 3300048903 Bacteria 631
899 Ga0496102_0010003 3300048905 Bacteria 8156
900 Ga0496106_0612599 3300048909 Bacteria 872
901 Ga0496107_0063454 3300048910 Bacteria 2677
902 Ga0496108_0082717 3300048911 Bacteria 2723
903 Ga0496108_0445103 3300048911 Bacteria 1132
904 Ga0496110_0208063 3300048913 Bacteria 1778
905 Ga0496110_0458932 3300048913 Unclassified 1161
906 Ga0496110_0544706 3300048913 Bacteria 1055
907 Ga0496112_0113304 3300048915 Bacteria 2683
908 Ga0496112_0353446 3300048915 Bacteria 1412
909 Ga0496112_0686872 3300048915 Bacteria 952
910 Ga0496113_0064526 3300048916 Unclassified 2769
911 Ga0496113_0134251 3300048916 Bacteria 1944
912 Ga0496113_0317784 3300048916 Bacteria 1248
913 Ga0501291_021658 3300049514 Bacteria 1026
914 Ga0501292_011788 3300049515 Bacteria 1327
915 Ga0501293_008273 3300049516 Bacteria 872
916 Ga0501298_022136 3300049521 Bacteria 1195
917 Ga0501299_002870 3300049522 Bacteria 2437
918 Ga0501299_010131 3300049522 Unclassified 1569
919 Ga0501299_050322 3300049522 Bacteria 859
920 Ga0501038_0007240 3300049574 Bacteria 10248
921 Ga0501039_0382406 3300049575 Bacteria 1106
922 Ga0501072_0235266 3300049588 Bacteria 1459
923 Ga0501072_0857907 3300049588 Unclassified 710
924 Ga0501202_003380 3300049652 Bacteria 2730
925 Ga0501202_011961 3300049652 Bacteria 1632
926 Ga0501206_024900 3300049653 Bacteria 869
927 Ga0501207_003570 3300049654 Unclassified 2078
928 Ga0501216_001897 3300049660 Unclassified 2898
929 Ga0501216_002824 3300049660 Bacteria 2494
930 Ga0501217_000772 3300049661 Bacteria 5565
931 Ga0501217_003056 3300049661 Unclassified 3352
932 Ga0501217_091789 3300049661 Bacteria 853
933 Ga0501223_005173 3300049663 Bacteria 2752
934 Ga0501223_005210 3300049663 Bacteria 2742
935 Ga0501223_011979 3300049663 Unclassified 1739
936 Ga0501224_001375 3300049664 Unclassified 3220
937 Ga0501227_084161 3300049665 Bacteria 836
938 Ga0501230_000985 3300049667 Bacteria 3229
939 Ga0501230_066605 3300049667 Bacteria 736
940 Ga0501233_003750 3300049668 Bacteria 2748
941 Ga0501233_007716 3300049668 Bacteria 2055
942 Ga0501233_008092 3300049668 Bacteria 2019
943 Ga0501233_043158 3300049668 Bacteria 1067
944 Ga0501235_003719 3300049669 Unclassified 3294
945 Ga0501235_004036 3300049669 Unclassified 3177
946 Ga0501235_009688 3300049669 Bacteria 2106
947 Ga0501235_018171 3300049669 Bacteria 1557
948 Ga0501235_033090 3300049669 Bacteria 1170
949 Ga0501243_004127 3300049675 Unclassified 2171
950 Ga0501243_007641 3300049675 Bacteria 1655
951 Ga0501249_013306 3300049679 Bacteria 1748
952 Ga0501249_014692 3300049679 Unclassified 1669
953 Ga0501249_035677 3300049679 Bacteria 1119
954 Ga0501249_089058 3300049679 Unclassified 730
955 Ga0501257_011404 3300049686 Unclassified 2029
956 Ga0501257_011905 3300049686 Bacteria 1988
957 Ga0501259_013009 3300049688 Unclassified 1394
958 Ga0501225_0004958 3300049705 Unclassified 3933
959 Ga0501225_0007957 3300049705 Bacteria 3055
960 Ga0501225_0093622 3300049705 Unclassified 872
961 Ga0501234_007226 3300049707 Unclassified 1739
962 Ga0501234_010505 3300049707 Unclassified 1443
963 Ga0501245_020593 3300049708 Bacteria 1030
964 Ga0501079_0917730 3300049741 Bacteria 690
965 Ga0501081_0215047 3300049743 Bacteria 1397
966 Ga0501081_0497792 3300049743 Bacteria 908
967 Ga0501267_009689 3300049764 Unclassified 965
968 Ga0501268_024751 3300049765 Bacteria 1051
969 Ga0501283_001080 3300049779 Bacteria 3591
970 Ga0501212_024371 3300049851 Bacteria 952
971 Ga0501212_024512 3300049851 Bacteria 949
972 Ga0501212_043988 3300049851 Bacteria 744
973 Ga0501226_000589 3300049853 Bacteria 5006
974 nmdc:mga05p37_136097_c1 3300050507 Bacteria 3012
975 nmdc:mga05p37_192430_c1 3300050507 Bacteria 2475
976 nmdc:mga05p37_205646_c1 3300050507 Bacteria 2381
977 nmdc:mga05p37_213946_c1 3300050507 Bacteria 2329
978 nmdc:mga05p37_507149_c1 3300050507 Unclassified 1383
979 nmdc:mga05p37_621407_c1 3300050507 Unclassified 1216
980 nmdc:mga05p37_97921_c1 3300050507 Bacteria 3613
981 nmdc:mga09592_206209_c1 3300050508 Unclassified 1703
982 nmdc:mga09592_26548_c1 3300050508 Unclassified 4799
983 nmdc:mga09592_324285_c1 3300050508 Unclassified 1334
984 nmdc:mga09592_95776_c1 3300050508 Bacteria 2539
985 nmdc:mga0qj67_115701_c1 3300050509 Bacteria 2167
986 nmdc:mga0qj67_204259_c1 3300050509 Bacteria 1605
987 nmdc:mga08y16_100599_c1 3300050511 Bacteria 3010
988 nmdc:mga08y16_233036_c1 3300050511 Bacteria 1904
989 nmdc:mga08y16_697458_c1 3300050511 Unclassified 1015
990 nmdc:mga08y16_8582_c1 3300050511 Bacteria 10707
991 nmdc:mga0n895_253264_c1 3300050512 Bacteria 1787
992 nmdc:mga0n895_264806_c1 3300050512 Bacteria 1744
993 nmdc:mga0n895_266812_c1 3300050512 Bacteria 1737
994 nmdc:mga0n895_434117_c1 3300050512 Bacteria 1327
995 nmdc:mga0n895_76060_c1 3300050512 Unclassified 3338
996 nmdc:mga0rr50_115016_c1 3300050513 Bacteria 2134
997 nmdc:mga0rr50_1432_c1 3300050513 Bacteria 13118
998 nmdc:mga0rr50_153545_c1 3300050513 Bacteria 1863
999 nmdc:mga0rr50_188637_c1 3300050513 Bacteria 1688
1000 nmdc:mga0rr50_545386_c1 3300050513 Unclassified 987
1001 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
1002 nmdc:mga08x19_4099_c1 3300050514 Bacteria 8644
1003 nmdc:mga0a205_284960_c1 3300050515 Bacteria 1527
1004 nmdc:mga0a205_333661_c1 3300050515 Bacteria 1386
1005 nmdc:mga0a205_418409_c1 3300050515 Bacteria 1202
1006 nmdc:mga0a205_42897_c1 3300050515 Bacteria 4360
1007 nmdc:mga0a205_44029_c1 3300050515 Bacteria 4302
1008 nmdc:mga0a205_44167_c1 3300050515 Bacteria 3958
1009 nmdc:mga0a205_81896_c1 3300050515 Bacteria 3118
1010 Ga0495655_0004099 3300053083 Unclassified 2467
1011 Ga0501084_0167175 3300054114 Bacteria 1856
1012 Ga0530510_0435040 3300061734 Bacteria 991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025936 Ga0207670_10734591 Ga0207670_107345912 177
2 3300049708 Ga0501245_020593 Ga0501245_020593_130_705 187
3 3300005330 Ga0070690_100241144 Ga0070690_1002411442 188
4 3300005293 Ga0065715_10094370 Ga0065715_100943702 190
5 3300005459 Ga0068867_100160907 Ga0068867_1001609072 190
6 3300005536 Ga0070697_100297976 Ga0070697_1002979761 190
7 3300005618 Ga0068864_100064981 Ga0068864_1000649813 190
8 3300025931 Ga0207644_10320690 Ga0207644_103206902 190
9 3300048903 Ga0496100_1083949 Ga0496100_1083949_27_605 190
10 3300061734 Ga0530510_0435040 Ga0530510_0435040_23_601 190
11 3300005577 Ga0068857_100064025 Ga0068857_1000640253 191
12 3300026116 Ga0207674_10100220 Ga0207674_101002203 191
13 3300006914 Ga0075436_100000028 Ga0075436_10000002876 192
14 3300050513 nmdc:mga0rr50_1432_c1 nmdc:mga0rr50_1432_c1_6532_7140 192
15 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_411762_412370 192
16 3300005290 Ga0065712_10109847 Ga0065712_101098472 195
17 3300005293 Ga0065715_10147747 Ga0065715_101477471 195
18 3300005364 Ga0070673_100691062 Ga0070673_1006910622 195
19 3300005468 Ga0070707_100355400 Ga0070707_1003554001 195
20 3300005549 Ga0070704_100442306 Ga0070704_1004423062 195
21 3300005618 Ga0068864_100322629 Ga0068864_1003226291 195
22 3300006880 Ga0075429_100333883 Ga0075429_1003338832 195
23 3300009094 Ga0111539_10005687 Ga0111539_100056873 195
24 3300009147 Ga0114129_10049988 Ga0114129_100499884 195
25 3300009147 Ga0114129_10589249 Ga0114129_105892492 195
26 3300025960 Ga0207651_10661408 Ga0207651_106614082 195
27 3300026095 Ga0207676_10528675 Ga0207676_105286752 195
28 3300050511 nmdc:mga08y16_100599_c1 nmdc:mga08y16_100599_c1_1210_1815 195
29 3300005549 Ga0070704_100612336 Ga0070704_1006123361 196
30 3300006880 Ga0075429_100108511 Ga0075429_1001085111 196
31 3300009147 Ga0114129_10240502 Ga0114129_102405022 196
32 3300025942 Ga0207689_10255676 Ga0207689_102556763 196
33 3300050507 nmdc:mga05p37_621407_c1 nmdc:mga05p37_621407_c1_173_868 196
34 3300050508 nmdc:mga09592_324285_c1 nmdc:mga09592_324285_c1_121_816 196
35 3300005333 Ga0070677_10077455 Ga0070677_100774552 197
36 3300005347 Ga0070668_101151423 Ga0070668_1011514231 197
37 3300005364 Ga0070673_100130152 Ga0070673_1001301522 197
38 3300005441 Ga0070700_100122307 Ga0070700_1001223072 197
39 3300005444 Ga0070694_100127480 Ga0070694_1001274802 197
40 3300005456 Ga0070678_100159223 Ga0070678_1001592232 197
41 3300005457 Ga0070662_100280603 Ga0070662_1002806032 197
42 3300005546 Ga0070696_100164135 Ga0070696_1001641352 197
43 3300005578 Ga0068854_100121292 Ga0068854_1001212922 197
44 3300005617 Ga0068859_100029886 Ga0068859_1000298864 197
45 3300005719 Ga0068861_100034946 Ga0068861_1000349463 197
46 3300005844 Ga0068862_100063414 Ga0068862_1000634142 197
47 3300006931 Ga0097620_100029886 Ga0097620_1000298863 197
48 3300009553 Ga0105249_10066800 Ga0105249_100668003 197
49 3300013297 Ga0157378_10099596 Ga0157378_100995963 197
50 3300013306 Ga0163162_10374622 Ga0163162_103746222 197
51 3300013308 Ga0157375_10035989 Ga0157375_100359892 197
52 3300014326 Ga0157380_10006247 Ga0157380_100062477 197
53 3300021388 Ga0213875_10292036 Ga0213875_102920361 197
54 3300025893 Ga0207682_10058435 Ga0207682_100584352 197
55 3300025923 Ga0207681_10261458 Ga0207681_102614582 197
56 3300025933 Ga0207706_10123297 Ga0207706_101232972 197
57 3300025961 Ga0207712_10037262 Ga0207712_100372623 197
58 3300025981 Ga0207640_10014816 Ga0207640_100148163 197
59 3300026075 Ga0207708_10069713 Ga0207708_100697132 197
60 3300026075 Ga0207708_10096882 Ga0207708_100968823 197
61 3300026118 Ga0207675_100229512 Ga0207675_1002295122 197
62 3300026121 Ga0207683_10080211 Ga0207683_100802113 197
63 3300028380 Ga0268265_10122619 Ga0268265_101226192 197
64 3300006847 Ga0075431_100093711 Ga0075431_1000937113 198
65 3300009147 Ga0114129_10149045 Ga0114129_101490452 198
66 3300031548 Ga0307408_100509753 Ga0307408_1005097532 198
67 3300037418 Ga0395900_0345971 Ga0395900_0345971_230_838 198
68 3300049663 Ga0501223_005173 Ga0501223_005173_490_1122 198
69 3300050507 nmdc:mga05p37_136097_c1 nmdc:mga05p37_136097_c1_2175_2786 198
70 3300050508 nmdc:mga09592_95776_c1 nmdc:mga09592_95776_c1_1665_2276 198
71 3300050509 nmdc:mga0qj67_204259_c1 nmdc:mga0qj67_204259_c1_645_1256 198
72 3300005295 Ga0065707_10107559 Ga0065707_101075592 199
73 3300005331 Ga0070670_100253954 Ga0070670_1002539542 199
74 3300005334 Ga0068869_100108174 Ga0068869_1001081742 199
75 3300005335 Ga0070666_10077869 Ga0070666_100778692 199
76 3300005338 Ga0068868_100012130 Ga0068868_1000121305 199
77 3300005354 Ga0070675_100159298 Ga0070675_1001592982 199
78 3300005355 Ga0070671_100225165 Ga0070671_1002251652 199
79 3300005365 Ga0070688_100327451 Ga0070688_1003274512 199
80 3300005367 Ga0070667_100808510 Ga0070667_1008085102 199
81 3300005445 Ga0070708_100188259 Ga0070708_1001882592 199
82 3300005445 Ga0070708_101367246 Ga0070708_1013672461 199
83 3300005455 Ga0070663_100440258 Ga0070663_1004402582 199
84 3300005468 Ga0070707_100000349 Ga0070707_10000034927 199
85 3300005468 Ga0070707_100011592 Ga0070707_1000115924 199
86 3300005468 Ga0070707_100262783 Ga0070707_1002627832 199
87 3300005471 Ga0070698_100000214 Ga0070698_10000021447 199
88 3300005471 Ga0070698_100441906 Ga0070698_1004419062 199
89 3300005548 Ga0070665_100883143 Ga0070665_1008831432 199
90 3300005549 Ga0070704_100003232 Ga0070704_1000032327 199
91 3300005549 Ga0070704_100050571 Ga0070704_1000505713 199
92 3300005577 Ga0068857_100951970 Ga0068857_1009519701 199
93 3300005578 Ga0068854_100181278 Ga0068854_1001812782 199
94 3300005616 Ga0068852_100707377 Ga0068852_1007073771 199
95 3300005617 Ga0068859_100126246 Ga0068859_1001262462 199
96 3300005617 Ga0068859_100178192 Ga0068859_1001781922 199
97 3300005617 Ga0068859_101190759 Ga0068859_1011907591 199
98 3300005618 Ga0068864_100483302 Ga0068864_1004833021 199
99 3300005718 Ga0068866_10076173 Ga0068866_100761732 199
100 3300005840 Ga0068870_10051005 Ga0068870_100510052 199
101 3300005840 Ga0068870_10150257 Ga0068870_101502572 199
102 3300005843 Ga0068860_100153124 Ga0068860_1001531243 199
103 3300006173 Ga0070716_100142786 Ga0070716_1001427862 199
104 3300006173 Ga0070716_100815578 Ga0070716_1008155781 199
105 3300006358 Ga0068871_100133507 Ga0068871_1001335071 199
106 3300006358 Ga0068871_100919660 Ga0068871_1009196601 199
107 3300006931 Ga0097620_100126241 Ga0097620_1001262412 199
108 3300006931 Ga0097620_100178175 Ga0097620_1001781752 199
109 3300006931 Ga0097620_101191116 Ga0097620_1011911161 199
110 3300007265 Ga0099794_10004171 Ga0099794_100041715 199
111 3300009148 Ga0105243_10092878 Ga0105243_100928782 199
112 3300009176 Ga0105242_10032609 Ga0105242_100326093 199
113 3300009177 Ga0105248_10009861 Ga0105248_100098612 199
114 3300009177 Ga0105248_10129580 Ga0105248_101295802 199
115 3300009545 Ga0105237_10490011 Ga0105237_104900112 199
116 3300013296 Ga0157374_10022394 Ga0157374_100223941 199
117 3300013297 Ga0157378_10017810 Ga0157378_100178106 199
118 3300013297 Ga0157378_10127853 Ga0157378_101278532 199
119 3300013297 Ga0157378_10240225 Ga0157378_102402252 199
120 3300013308 Ga0157375_10125642 Ga0157375_101256423 199
121 3300014325 Ga0163163_10001208 Ga0163163_100012089 199
122 3300014325 Ga0163163_10060630 Ga0163163_100606303 199
123 3300014968 Ga0157379_10151703 Ga0157379_101517033 199
124 3300014969 Ga0157376_10072525 Ga0157376_100725252 199
125 3300025908 Ga0207643_10029946 Ga0207643_100299462 199
126 3300025910 Ga0207684_10007903 Ga0207684_100079039 199
127 3300025914 Ga0207671_10438007 Ga0207671_104380072 199
128 3300025917 Ga0207660_10818039 Ga0207660_108180391 199
129 3300025922 Ga0207646_10000199 Ga0207646_1000019957 199
130 3300025922 Ga0207646_10012482 Ga0207646_100124826 199
131 3300025925 Ga0207650_10143185 Ga0207650_101431852 199
132 3300025926 Ga0207659_10063331 Ga0207659_100633312 199
133 3300025931 Ga0207644_10021315 Ga0207644_100213154 199
134 3300025935 Ga0207709_10074255 Ga0207709_100742552 199
135 3300025936 Ga0207670_10308976 Ga0207670_103089761 199
136 3300025939 Ga0207665_10186956 Ga0207665_101869562 199
137 3300025941 Ga0207711_10013606 Ga0207711_100136063 199
138 3300025942 Ga0207689_10120891 Ga0207689_101208912 199
139 3300025960 Ga0207651_10821546 Ga0207651_108215462 199
140 3300025981 Ga0207640_10137699 Ga0207640_101376992 199
141 3300025986 Ga0207658_10234953 Ga0207658_102349532 199
142 3300026035 Ga0207703_10401040 Ga0207703_104010402 199
143 3300026088 Ga0207641_10075438 Ga0207641_100754382 199
144 3300026089 Ga0207648_10406731 Ga0207648_104067312 199
145 3300026095 Ga0207676_10008551 Ga0207676_100085515 199
146 3300026116 Ga0207674_10328590 Ga0207674_103285902 199
147 3300026116 Ga0207674_10582220 Ga0207674_105822202 199
148 3300026121 Ga0207683_10433747 Ga0207683_104337472 199
149 3300028379 Ga0268266_10765376 Ga0268266_107653762 199
150 3300028381 Ga0268264_10129367 Ga0268264_101293673 199
151 3300041997 Ga0439431_0084883 Ga0439431_0084883_172_786 199
152 3300046475 Ga0495639_0097569 Ga0495639_0097569_576_1199 199
153 3300046535 Ga0495586_0194213 Ga0495586_0194213_145_768 199
154 3300046689 Ga0495613_0018185 Ga0495613_0018185_31_654 199
155 3300047319 Ga0495674_0438464 Ga0495674_0438464_37_645 199
156 3300047322 Ga0495680_0050097 Ga0495680_0050097_2631_3254 199
157 3300049575 Ga0501039_0382406 Ga0501039_0382406_47_655 199
158 3300049588 Ga0501072_0235266 Ga0501072_0235266_536_1144 199
159 3300049741 Ga0501079_0917730 Ga0501079_0917730_51_659 199
160 3300049743 Ga0501081_0215047 Ga0501081_0215047_308_916 199
161 3300049743 Ga0501081_0497792 Ga0501081_0497792_219_833 199
162 3300053083 Ga0495655_0004099 Ga0495655_0004099_1064_1672 199
163 3300054114 Ga0501084_0167175 Ga0501084_0167175_1026_1634 199
164 3300005289 Ga0065704_10158725 Ga0065704_101587252 200
165 3300005295 Ga0065707_10099533 Ga0065707_100995332 200
166 3300005295 Ga0065707_10294977 Ga0065707_102949772 200
167 3300005328 Ga0070676_10776551 Ga0070676_107765511 200
168 3300005330 Ga0070690_100142793 Ga0070690_1001427932 200
169 3300005331 Ga0070670_100872126 Ga0070670_1008721261 200
170 3300005337 Ga0070682_100702342 Ga0070682_1007023421 200
171 3300005338 Ga0068868_100432309 Ga0068868_1004323091 200
172 3300005343 Ga0070687_100232675 Ga0070687_1002326752 200
173 3300005345 Ga0070692_10001749 Ga0070692_100017495 200
174 3300005364 Ga0070673_100448507 Ga0070673_1004485071 200
175 3300005406 Ga0070703_10000117 Ga0070703_1000011727 200
176 3300005406 Ga0070703_10036845 Ga0070703_100368451 200
177 3300005440 Ga0070705_100117059 Ga0070705_1001170592 200
178 3300005440 Ga0070705_100119594 Ga0070705_1001195942 200
179 3300005441 Ga0070700_100007690 Ga0070700_1000076902 200
180 3300005444 Ga0070694_100007085 Ga0070694_1000070857 200
181 3300005444 Ga0070694_100340587 Ga0070694_1003405871 200
182 3300005444 Ga0070694_100764636 Ga0070694_1007646362 200
183 3300005445 Ga0070708_100016622 Ga0070708_1000166226 200
184 3300005445 Ga0070708_100045673 Ga0070708_1000456733 200
185 3300005445 Ga0070708_100077547 Ga0070708_1000775472 200
186 3300005466 Ga0070685_10133495 Ga0070685_101334952 200
187 3300005467 Ga0070706_100043332 Ga0070706_1000433322 200
188 3300005467 Ga0070706_100199596 Ga0070706_1001995962 200
189 3300005468 Ga0070707_100018277 Ga0070707_1000182776 200
190 3300005468 Ga0070707_100661499 Ga0070707_1006614992 200
191 3300005468 Ga0070707_100961995 Ga0070707_1009619951 200
192 3300005518 Ga0070699_100272927 Ga0070699_1002729271 200
193 3300005543 Ga0070672_100270755 Ga0070672_1002707552 200
194 3300005544 Ga0070686_100020844 Ga0070686_1000208444 200
195 3300005544 Ga0070686_100095756 Ga0070686_1000957562 200
196 3300005545 Ga0070695_100474366 Ga0070695_1004743662 200
197 3300005549 Ga0070704_100102529 Ga0070704_1001025292 200
198 3300005617 Ga0068859_100020309 Ga0068859_1000203096 200
199 3300005617 Ga0068859_100045155 Ga0068859_1000451552 200
200 3300005618 Ga0068864_100124782 Ga0068864_1001247823 200
201 3300005618 Ga0068864_100167807 Ga0068864_1001678072 200
202 3300005618 Ga0068864_100482718 Ga0068864_1004827181 200
203 3300005718 Ga0068866_10031530 Ga0068866_100315302 200
204 3300005841 Ga0068863_100595866 Ga0068863_1005958662 200
205 3300005842 Ga0068858_100033321 Ga0068858_1000333214 200
206 3300005842 Ga0068858_100115266 Ga0068858_1001152663 200
207 3300006173 Ga0070716_100166330 Ga0070716_1001663302 200
208 3300006844 Ga0075428_100052364 Ga0075428_1000523645 200
209 3300006871 Ga0075434_100208089 Ga0075434_1002080893 200
210 3300006931 Ga0097620_100020310 Ga0097620_1000203106 200
211 3300006931 Ga0097620_100045156 Ga0097620_1000451562 200
212 3300007076 Ga0075435_100426004 Ga0075435_1004260042 200
213 3300009094 Ga0111539_10006549 Ga0111539_1000654914 200
214 3300009094 Ga0111539_10389665 Ga0111539_103896652 200
215 3300009148 Ga0105243_10000015 Ga0105243_1000001588 200
216 3300009176 Ga0105242_10000028 Ga0105242_1000002823 200
217 3300009176 Ga0105242_10008738 Ga0105242_100087383 200
218 3300009176 Ga0105242_10408433 Ga0105242_104084332 200
219 3300009177 Ga0105248_10059640 Ga0105248_100596402 200
220 3300009177 Ga0105248_10489232 Ga0105248_104892322 200
221 3300009177 Ga0105248_11424512 Ga0105248_114245121 200
222 3300011119 Ga0105246_10102185 Ga0105246_101021852 200
223 3300013297 Ga0157378_10014880 Ga0157378_100148807 200
224 3300013297 Ga0157378_10067110 Ga0157378_100671102 200
225 3300013297 Ga0157378_10088050 Ga0157378_100880502 200
226 3300013297 Ga0157378_10127387 Ga0157378_101273872 200
227 3300013306 Ga0163162_10137921 Ga0163162_101379212 200
228 3300014745 Ga0157377_10122821 Ga0157377_101228212 200
229 3300017792 Ga0163161_10011523 Ga0163161_100115235 200
230 3300017792 Ga0163161_10317381 Ga0163161_103173811 200
231 3300025885 Ga0207653_10000342 Ga0207653_100003425 200
232 3300025885 Ga0207653_10140400 Ga0207653_101404001 200
233 3300025899 Ga0207642_10013304 Ga0207642_100133041 200
234 3300025910 Ga0207684_10197959 Ga0207684_101979592 200
235 3300025918 Ga0207662_10118564 Ga0207662_101185642 200
236 3300025922 Ga0207646_10237233 Ga0207646_102372332 200
237 3300025927 Ga0207687_10493327 Ga0207687_104933272 200
238 3300025934 Ga0207686_10000031 Ga0207686_1000003131 200
239 3300025934 Ga0207686_10000381 Ga0207686_100003812 200
240 3300025935 Ga0207709_10000009 Ga0207709_10000009206 200
241 3300025939 Ga0207665_10201259 Ga0207665_102012592 200
242 3300025941 Ga0207711_10331757 Ga0207711_103317572 200
243 3300025941 Ga0207711_10732150 Ga0207711_107321501 200
244 3300025942 Ga0207689_10163621 Ga0207689_101636212 200
245 3300025960 Ga0207651_10096351 Ga0207651_100963512 200
246 3300025961 Ga0207712_10723660 Ga0207712_107236601 200
247 3300025981 Ga0207640_10035631 Ga0207640_100356313 200
248 3300026035 Ga0207703_10045746 Ga0207703_100457464 200
249 3300026035 Ga0207703_10165919 Ga0207703_101659192 200
250 3300026075 Ga0207708_10007047 Ga0207708_100070474 200
251 3300026075 Ga0207708_10092804 Ga0207708_100928042 200
252 3300026088 Ga0207641_10530339 Ga0207641_105303392 200
253 3300026095 Ga0207676_10300850 Ga0207676_103008502 200
254 3300026118 Ga0207675_100959419 Ga0207675_1009594191 200
255 3300027907 Ga0207428_10002219 Ga0207428_100022197 200
256 3300028380 Ga0268265_10218442 Ga0268265_102184421 200
257 3300044673 Ga0453683_0117074 Ga0453683_0117074_929_1540 200
258 3300045051 Ga0451576_0565285 Ga0451576_0565285_420_1031 200
259 3300046664 Ga0495659_0019215 Ga0495659_0019215_1202_1813 200
260 3300050511 nmdc:mga08y16_697458_c1 nmdc:mga08y16_697458_c1_98_709 200
261 3300050511 nmdc:mga08y16_8582_c1 nmdc:mga08y16_8582_c1_5902_6513 200
262 3300050513 nmdc:mga0rr50_545386_c1 nmdc:mga0rr50_545386_c1_71_688 200
263 3300050515 nmdc:mga0a205_418409_c1 nmdc:mga0a205_418409_c1_113_724 200
264 3300005331 Ga0070670_100046457 Ga0070670_1000464573 201
265 3300005353 Ga0070669_100064092 Ga0070669_1000640922 201
266 3300005364 Ga0070673_100527543 Ga0070673_1005275432 201
267 3300005445 Ga0070708_100682779 Ga0070708_1006827792 201
268 3300005466 Ga0070685_10807272 Ga0070685_108072721 201
269 3300005468 Ga0070707_100049224 Ga0070707_1000492241 201
270 3300005468 Ga0070707_100995040 Ga0070707_1009950401 201
271 3300005471 Ga0070698_100527919 Ga0070698_1005279191 201
272 3300005518 Ga0070699_100065301 Ga0070699_1000653014 201
273 3300005536 Ga0070697_100167892 Ga0070697_1001678922 201
274 3300005539 Ga0068853_100453121 Ga0068853_1004531212 201
275 3300005546 Ga0070696_100405273 Ga0070696_1004052732 201
276 3300005546 Ga0070696_100587500 Ga0070696_1005875001 201
277 3300005549 Ga0070704_100817063 Ga0070704_1008170632 201
278 3300005577 Ga0068857_100600591 Ga0068857_1006005911 201
279 3300005578 Ga0068854_100129147 Ga0068854_1001291472 201
280 3300005841 Ga0068863_100499072 Ga0068863_1004990722 201
281 3300005844 Ga0068862_100721625 Ga0068862_1007216252 201
282 3300006163 Ga0070715_10000002 Ga0070715_1000000275 201
283 3300006173 Ga0070716_100000001 Ga0070716_10000000144 201
284 3300007788 Ga0099795_10058360 Ga0099795_100583601 201
285 3300009147 Ga0114129_10876941 Ga0114129_108769411 201
286 3300009176 Ga0105242_10390455 Ga0105242_103904552 201
287 3300009176 Ga0105242_10391601 Ga0105242_103916011 201
288 3300025315 Ga0207697_10047072 Ga0207697_100470722 201
289 3300025904 Ga0207647_10240161 Ga0207647_102401611 201
290 3300025905 Ga0207685_10000002 Ga0207685_10000002357 201
291 3300025922 Ga0207646_10914361 Ga0207646_109143612 201
292 3300025923 Ga0207681_10009399 Ga0207681_100093996 201
293 3300025927 Ga0207687_10325776 Ga0207687_103257762 201
294 3300025934 Ga0207686_10367006 Ga0207686_103670061 201
295 3300025939 Ga0207665_10000016 Ga0207665_1000001640 201
296 3300025939 Ga0207665_10071790 Ga0207665_100717902 201
297 3300026075 Ga0207708_11022617 Ga0207708_110226171 201
298 3300026088 Ga0207641_10022808 Ga0207641_100228083 201
299 3300026116 Ga0207674_10605508 Ga0207674_106055081 201
300 3300031852 Ga0307410_10206176 Ga0307410_102061762 201
301 3300032002 Ga0307416_100165479 Ga0307416_1001654791 201
302 3300041406 Ga0439439_0097744 Ga0439439_0097744_156_773 201
303 3300042439 Ga0439464_0056276 Ga0439464_0056276_450_1070 201
304 3300050507 nmdc:mga05p37_507149_c1 nmdc:mga05p37_507149_c1_718_1341 201
305 3300005289 Ga0065704_10087916 Ga0065704_100879161 202
306 3300005289 Ga0065704_10141261 Ga0065704_101412611 202
307 3300005293 Ga0065715_10068422 Ga0065715_100684221 202
308 3300005334 Ga0068869_100556540 Ga0068869_1005565402 202
309 3300005334 Ga0068869_100744021 Ga0068869_1007440212 202
310 3300005336 Ga0070680_100000624 Ga0070680_10000062421 202
311 3300005337 Ga0070682_100003448 Ga0070682_1000034484 202
312 3300005338 Ga0068868_100349530 Ga0068868_1003495302 202
313 3300005339 Ga0070660_100185064 Ga0070660_1001850642 202
314 3300005340 Ga0070689_100137948 Ga0070689_1001379482 202
315 3300005340 Ga0070689_100205479 Ga0070689_1002054792 202
316 3300005345 Ga0070692_10009660 Ga0070692_100096602 202
317 3300005347 Ga0070668_100001433 Ga0070668_1000014334 202
318 3300005353 Ga0070669_100001869 Ga0070669_10000186919 202
319 3300005353 Ga0070669_100186423 Ga0070669_1001864232 202
320 3300005364 Ga0070673_100081375 Ga0070673_1000813752 202
321 3300005366 Ga0070659_100167007 Ga0070659_1001670072 202
322 3300005367 Ga0070667_100550020 Ga0070667_1005500202 202
323 3300005406 Ga0070703_10021983 Ga0070703_100219832 202
324 3300005438 Ga0070701_10200044 Ga0070701_102000442 202
325 3300005440 Ga0070705_100007202 Ga0070705_1000072023 202
326 3300005440 Ga0070705_100067535 Ga0070705_1000675352 202
327 3300005444 Ga0070694_100004696 Ga0070694_1000046961 202
328 3300005444 Ga0070694_100009483 Ga0070694_1000094833 202
329 3300005444 Ga0070694_100116800 Ga0070694_1001168002 202
330 3300005444 Ga0070694_100162633 Ga0070694_1001626332 202
331 3300005444 Ga0070694_100341338 Ga0070694_1003413382 202
332 3300005444 Ga0070694_100540898 Ga0070694_1005408982 202
333 3300005457 Ga0070662_100389585 Ga0070662_1003895852 202
334 3300005458 Ga0070681_10025119 Ga0070681_100251196 202
335 3300005458 Ga0070681_10072851 Ga0070681_100728513 202
336 3300005459 Ga0068867_100072287 Ga0068867_1000722872 202
337 3300005467 Ga0070706_100274933 Ga0070706_1002749332 202
338 3300005467 Ga0070706_100377280 Ga0070706_1003772802 202
339 3300005471 Ga0070698_100066657 Ga0070698_1000666573 202
340 3300005471 Ga0070698_100073161 Ga0070698_1000731613 202
341 3300005518 Ga0070699_100556037 Ga0070699_1005560372 202
342 3300005530 Ga0070679_100000047 Ga0070679_10000004722 202
343 3300005536 Ga0070697_100044313 Ga0070697_1000443133 202
344 3300005536 Ga0070697_100379832 Ga0070697_1003798322 202
345 3300005536 Ga0070697_100392709 Ga0070697_1003927092 202
346 3300005539 Ga0068853_100488941 Ga0068853_1004889411 202
347 3300005539 Ga0068853_100946251 Ga0068853_1009462511 202
348 3300005543 Ga0070672_100809191 Ga0070672_1008091911 202
349 3300005543 Ga0070672_100832642 Ga0070672_1008326421 202
350 3300005545 Ga0070695_100103748 Ga0070695_1001037482 202
351 3300005545 Ga0070695_100275601 Ga0070695_1002756011 202
352 3300005545 Ga0070695_100396149 Ga0070695_1003961491 202
353 3300005545 Ga0070695_100723643 Ga0070695_1007236431 202
354 3300005546 Ga0070696_100156761 Ga0070696_1001567612 202
355 3300005547 Ga0070693_100001695 Ga0070693_1000016957 202
356 3300005547 Ga0070693_100004426 Ga0070693_1000044262 202
357 3300005549 Ga0070704_100347020 Ga0070704_1003470202 202
358 3300005549 Ga0070704_100751961 Ga0070704_1007519611 202
359 3300005577 Ga0068857_100615014 Ga0068857_1006150142 202
360 3300005614 Ga0068856_100006841 Ga0068856_10000684112 202
361 3300005615 Ga0070702_100013605 Ga0070702_1000136052 202
362 3300005617 Ga0068859_100056736 Ga0068859_1000567364 202
363 3300005719 Ga0068861_100023899 Ga0068861_1000238993 202
364 3300005719 Ga0068861_100223068 Ga0068861_1002230681 202
365 3300005841 Ga0068863_100592415 Ga0068863_1005924152 202
366 3300005842 Ga0068858_100146758 Ga0068858_1001467582 202
367 3300005844 Ga0068862_100070844 Ga0068862_1000708442 202
368 3300006173 Ga0070716_100591540 Ga0070716_1005915401 202
369 3300006844 Ga0075428_100294946 Ga0075428_1002949462 202
370 3300006852 Ga0075433_10066356 Ga0075433_100663562 202
371 3300006852 Ga0075433_10111034 Ga0075433_101110342 202
372 3300006852 Ga0075433_10592137 Ga0075433_105921371 202
373 3300006871 Ga0075434_100252352 Ga0075434_1002523522 202
374 3300006931 Ga0097620_100056736 Ga0097620_1000567364 202
375 3300009098 Ga0105245_10724165 Ga0105245_107241651 202
376 3300009098 Ga0105245_10868491 Ga0105245_108684911 202
377 3300009101 Ga0105247_10472538 Ga0105247_104725381 202
378 3300009147 Ga0114129_10010658 Ga0114129_100106589 202
379 3300009147 Ga0114129_10279643 Ga0114129_102796431 202
380 3300009147 Ga0114129_10873829 Ga0114129_108738292 202
381 3300009148 Ga0105243_10055616 Ga0105243_100556163 202
382 3300009148 Ga0105243_10066347 Ga0105243_100663473 202
383 3300009148 Ga0105243_10434797 Ga0105243_104347972 202
384 3300009148 Ga0105243_11115138 Ga0105243_111151381 202
385 3300009174 Ga0105241_10513392 Ga0105241_105133922 202
386 3300009174 Ga0105241_10921539 Ga0105241_109215391 202
387 3300009545 Ga0105237_10000903 Ga0105237_1000090324 202
388 3300009545 Ga0105237_10101023 Ga0105237_101010233 202
389 3300009551 Ga0105238_10005940 Ga0105238_1000594010 202
390 3300009553 Ga0105249_10000136 Ga0105249_1000013657 202
391 3300009553 Ga0105249_10234405 Ga0105249_102344052 202
392 3300009553 Ga0105249_10324364 Ga0105249_103243642 202
393 3300009553 Ga0105249_10406408 Ga0105249_104064082 202
394 3300009553 Ga0105249_10783920 Ga0105249_107839202 202
395 3300010375 Ga0105239_10334780 Ga0105239_103347802 202
396 3300010375 Ga0105239_10542069 Ga0105239_105420691 202
397 3300010375 Ga0105239_10669845 Ga0105239_106698451 202
398 3300013297 Ga0157378_10529931 Ga0157378_105299311 202
399 3300013306 Ga0163162_10000001 Ga0163162_10000001429 202
400 3300013306 Ga0163162_10022132 Ga0163162_100221322 202
401 3300013306 Ga0163162_10094875 Ga0163162_100948752 202
402 3300013306 Ga0163162_10119313 Ga0163162_101193132 202
403 3300013307 Ga0157372_10176650 Ga0157372_101766502 202
404 3300013307 Ga0157372_10429643 Ga0157372_104296432 202
405 3300013308 Ga0157375_10010051 Ga0157375_100100516 202
406 3300014326 Ga0157380_10000283 Ga0157380_1000028321 202
407 3300014326 Ga0157380_10012283 Ga0157380_100122832 202
408 3300014326 Ga0157380_10023647 Ga0157380_100236472 202
409 3300014326 Ga0157380_11117106 Ga0157380_111171062 202
410 3300014968 Ga0157379_10201694 Ga0157379_102016942 202
411 3300014968 Ga0157379_10326075 Ga0157379_103260752 202
412 3300025885 Ga0207653_10047542 Ga0207653_100475422 202
413 3300025911 Ga0207654_10113646 Ga0207654_101136462 202
414 3300025911 Ga0207654_10122934 Ga0207654_101229341 202
415 3300025912 Ga0207707_10000006 Ga0207707_10000006291 202
416 3300025912 Ga0207707_10285501 Ga0207707_102855012 202
417 3300025914 Ga0207671_10796205 Ga0207671_107962051 202
418 3300025917 Ga0207660_10002802 Ga0207660_100028025 202
419 3300025921 Ga0207652_10001029 Ga0207652_1000102913 202
420 3300025923 Ga0207681_10000407 Ga0207681_1000040715 202
421 3300025923 Ga0207681_10144120 Ga0207681_101441202 202
422 3300025923 Ga0207681_10350999 Ga0207681_103509992 202
423 3300025924 Ga0207694_10000938 Ga0207694_1000093814 202
424 3300025925 Ga0207650_10000517 Ga0207650_100005172 202
425 3300025927 Ga0207687_10913768 Ga0207687_109137681 202
426 3300025933 Ga0207706_10242791 Ga0207706_102427912 202
427 3300025933 Ga0207706_10423200 Ga0207706_104232002 202
428 3300025935 Ga0207709_10090719 Ga0207709_100907192 202
429 3300025936 Ga0207670_10036079 Ga0207670_100360793 202
430 3300025940 Ga0207691_10300598 Ga0207691_103005982 202
431 3300025942 Ga0207689_10083245 Ga0207689_100832452 202
432 3300025942 Ga0207689_10173036 Ga0207689_101730361 202
433 3300025942 Ga0207689_10326790 Ga0207689_103267902 202
434 3300025949 Ga0207667_10312336 Ga0207667_103123362 202
435 3300025960 Ga0207651_10119147 Ga0207651_101191473 202
436 3300025961 Ga0207712_10000092 Ga0207712_1000009257 202
437 3300025961 Ga0207712_10105243 Ga0207712_101052432 202
438 3300025961 Ga0207712_10195886 Ga0207712_101958862 202
439 3300025972 Ga0207668_10002111 Ga0207668_100021114 202
440 3300026023 Ga0207677_11103331 Ga0207677_111033311 202
441 3300026035 Ga0207703_10081772 Ga0207703_100817722 202
442 3300026035 Ga0207703_10129429 Ga0207703_101294292 202
443 3300026075 Ga0207708_10008389 Ga0207708_100083892 202
444 3300026088 Ga0207641_10437633 Ga0207641_104376331 202
445 3300026089 Ga0207648_10029342 Ga0207648_100293424 202
446 3300026089 Ga0207648_10647435 Ga0207648_106474352 202
447 3300026116 Ga0207674_10222075 Ga0207674_102220752 202
448 3300026118 Ga0207675_100037618 Ga0207675_1000376185 202
449 3300026118 Ga0207675_100038139 Ga0207675_1000381393 202
450 3300026118 Ga0207675_100113146 Ga0207675_1001131461 202
451 3300026118 Ga0207675_100258880 Ga0207675_1002588802 202
452 3300026142 Ga0207698_10767282 Ga0207698_107672822 202
453 3300028380 Ga0268265_10295444 Ga0268265_102954442 202
454 3300028381 Ga0268264_10389432 Ga0268264_103894322 202
455 3300032126 Ga0307415_100025864 Ga0307415_1000258643 202
456 3300045051 Ga0451576_1169985 Ga0451576_1169985_140_760 202
457 3300048905 Ga0496102_0010003 Ga0496102_0010003_1045_1659 202
458 3300048911 Ga0496108_0082717 Ga0496108_0082717_693_1307 202
459 3300048911 Ga0496108_0445103 Ga0496108_0445103_167_787 202
460 3300048913 Ga0496110_0544706 Ga0496110_0544706_105_719 202
461 3300048916 Ga0496113_0064526 Ga0496113_0064526_1882_2505 202
462 3300049574 Ga0501038_0007240 Ga0501038_0007240_7215_7847 202
463 3300049588 Ga0501072_0857907 Ga0501072_0857907_68_700 202
464 3300050507 nmdc:mga05p37_97921_c1 nmdc:mga05p37_97921_c1_2836_3453 202
465 3300050508 nmdc:mga09592_26548_c1 nmdc:mga09592_26548_c1_1576_2190 202
466 3300050512 nmdc:mga0n895_253264_c1 nmdc:mga0n895_253264_c1_886_1500 202
467 3300050512 nmdc:mga0n895_264806_c1 nmdc:mga0n895_264806_c1_267_881 202
468 3300050513 nmdc:mga0rr50_115016_c1 nmdc:mga0rr50_115016_c1_236_850 202
469 3300050513 nmdc:mga0rr50_188637_c1 nmdc:mga0rr50_188637_c1_738_1355 202
470 3300050515 nmdc:mga0a205_44029_c1 nmdc:mga0a205_44029_c1_1343_1957 202
471 3300050515 nmdc:mga0a205_44167_c1 nmdc:mga0a205_44167_c1_158_772 202
472 3300002459 JGI24751J29686_10000044 JGI24751J29686_1000004446 203
473 3300003203 JGI25406J46586_10002885 JGI25406J46586_100028852 203
474 3300005289 Ga0065704_10100713 Ga0065704_101007132 203
475 3300005290 Ga0065712_10000123 Ga0065712_1000012315 203
476 3300005290 Ga0065712_10146274 Ga0065712_101462742 203
477 3300005293 Ga0065715_10089361 Ga0065715_100893612 203
478 3300005293 Ga0065715_10360617 Ga0065715_103606171 203
479 3300005295 Ga0065707_10003187 Ga0065707_100031872 203
480 3300005295 Ga0065707_10106281 Ga0065707_101062811 203
481 3300005295 Ga0065707_10271768 Ga0065707_102717681 203
482 3300005295 Ga0065707_10286549 Ga0065707_102865491 203
483 3300005328 Ga0070676_10259573 Ga0070676_102595731 203
484 3300005329 Ga0070683_100539584 Ga0070683_1005395841 203
485 3300005330 Ga0070690_100128731 Ga0070690_1001287312 203
486 3300005331 Ga0070670_100000144 Ga0070670_10000014440 203
487 3300005331 Ga0070670_100132631 Ga0070670_1001326312 203
488 3300005334 Ga0068869_100026023 Ga0068869_1000260232 203
489 3300005334 Ga0068869_100053422 Ga0068869_1000534223 203
490 3300005334 Ga0068869_100720234 Ga0068869_1007202341 203
491 3300005334 Ga0068869_101067821 Ga0068869_1010678211 203
492 3300005335 Ga0070666_10058851 Ga0070666_100588513 203
493 3300005337 Ga0070682_100000405 Ga0070682_10000040525 203
494 3300005337 Ga0070682_100011524 Ga0070682_1000115245 203
495 3300005338 Ga0068868_100087038 Ga0068868_1000870383 203
496 3300005338 Ga0068868_100346800 Ga0068868_1003468001 203
497 3300005341 Ga0070691_10469824 Ga0070691_104698241 203
498 3300005343 Ga0070687_100181944 Ga0070687_1001819441 203
499 3300005343 Ga0070687_100281004 Ga0070687_1002810042 203
500 3300005343 Ga0070687_100629167 Ga0070687_1006291671 203
501 3300005344 Ga0070661_100177215 Ga0070661_1001772152 203
502 3300005344 Ga0070661_100846179 Ga0070661_1008461791 203
503 3300005345 Ga0070692_10279775 Ga0070692_102797751 203
504 3300005353 Ga0070669_100308450 Ga0070669_1003084502 203
505 3300005353 Ga0070669_100389284 Ga0070669_1003892842 203
506 3300005355 Ga0070671_100003832 Ga0070671_1000038325 203
507 3300005355 Ga0070671_100085327 Ga0070671_1000853272 203
508 3300005355 Ga0070671_100339530 Ga0070671_1003395301 203
509 3300005356 Ga0070674_100792502 Ga0070674_1007925021 203
510 3300005364 Ga0070673_101107574 Ga0070673_1011075741 203
511 3300005365 Ga0070688_100790993 Ga0070688_1007909931 203
512 3300005366 Ga0070659_100016910 Ga0070659_1000169102 203
513 3300005367 Ga0070667_100677013 Ga0070667_1006770132 203
514 3300005438 Ga0070701_10036020 Ga0070701_100360202 203
515 3300005438 Ga0070701_10040733 Ga0070701_100407332 203
516 3300005441 Ga0070700_100166334 Ga0070700_1001663342 203
517 3300005441 Ga0070700_100426070 Ga0070700_1004260702 203
518 3300005444 Ga0070694_100056456 Ga0070694_1000564563 203
519 3300005444 Ga0070694_100206996 Ga0070694_1002069962 203
520 3300005444 Ga0070694_100561943 Ga0070694_1005619431 203
521 3300005444 Ga0070694_100863718 Ga0070694_1008637181 203
522 3300005445 Ga0070708_100001183 Ga0070708_10000118316 203
523 3300005455 Ga0070663_100449565 Ga0070663_1004495652 203
524 3300005457 Ga0070662_100021490 Ga0070662_1000214904 203
525 3300005457 Ga0070662_100386373 Ga0070662_1003863732 203
526 3300005457 Ga0070662_100537709 Ga0070662_1005377091 203
527 3300005458 Ga0070681_10007691 Ga0070681_100076916 203
528 3300005459 Ga0068867_100012727 Ga0068867_1000127273 203
529 3300005467 Ga0070706_100014834 Ga0070706_1000148343 203
530 3300005467 Ga0070706_100044179 Ga0070706_1000441793 203
531 3300005468 Ga0070707_100324760 Ga0070707_1003247602 203
532 3300005471 Ga0070698_100000126 Ga0070698_10000012628 203
533 3300005471 Ga0070698_100010112 Ga0070698_1000101126 203
534 3300005471 Ga0070698_100016175 Ga0070698_1000161753 203
535 3300005471 Ga0070698_100550075 Ga0070698_1005500751 203
536 3300005518 Ga0070699_100005850 Ga0070699_1000058505 203
537 3300005518 Ga0070699_100006980 Ga0070699_1000069806 203
538 3300005518 Ga0070699_100957260 Ga0070699_1009572601 203
539 3300005530 Ga0070679_100912282 Ga0070679_1009122821 203
540 3300005535 Ga0070684_100776426 Ga0070684_1007764261 203
541 3300005536 Ga0070697_100000217 Ga0070697_10000021718 203
542 3300005536 Ga0070697_100000380 Ga0070697_1000003804 203
543 3300005539 Ga0068853_100150415 Ga0068853_1001504152 203
544 3300005539 Ga0068853_100706419 Ga0068853_1007064191 203
545 3300005544 Ga0070686_100000648 Ga0070686_10000064810 203
546 3300005544 Ga0070686_100833525 Ga0070686_1008335251 203
547 3300005544 Ga0070686_100914422 Ga0070686_1009144221 203
548 3300005545 Ga0070695_100039878 Ga0070695_1000398783 203
549 3300005545 Ga0070695_100045540 Ga0070695_1000455402 203
550 3300005545 Ga0070695_100435736 Ga0070695_1004357361 203
551 3300005545 Ga0070695_100465171 Ga0070695_1004651712 203
552 3300005546 Ga0070696_100037727 Ga0070696_1000377273 203
553 3300005546 Ga0070696_100293413 Ga0070696_1002934133 203
554 3300005546 Ga0070696_100320826 Ga0070696_1003208262 203
555 3300005546 Ga0070696_100557848 Ga0070696_1005578481 203
556 3300005548 Ga0070665_100622772 Ga0070665_1006227721 203
557 3300005549 Ga0070704_100282862 Ga0070704_1002828622 203
558 3300005564 Ga0070664_100014957 Ga0070664_1000149572 203
559 3300005577 Ga0068857_100138045 Ga0068857_1001380453 203
560 3300005577 Ga0068857_101149657 Ga0068857_1011496571 203
561 3300005578 Ga0068854_100378895 Ga0068854_1003788951 203
562 3300005615 Ga0070702_100063061 Ga0070702_1000630612 203
563 3300005615 Ga0070702_100095456 Ga0070702_1000954561 203
564 3300005616 Ga0068852_100131637 Ga0068852_1001316372 203
565 3300005616 Ga0068852_100331812 Ga0068852_1003318122 203
566 3300005617 Ga0068859_100022806 Ga0068859_1000228065 203
567 3300005617 Ga0068859_100114087 Ga0068859_1001140871 203
568 3300005617 Ga0068859_100280931 Ga0068859_1002809312 203
569 3300005617 Ga0068859_100315592 Ga0068859_1003155921 203
570 3300005617 Ga0068859_100466912 Ga0068859_1004669122 203
571 3300005618 Ga0068864_100098969 Ga0068864_1000989693 203
572 3300005618 Ga0068864_100122297 Ga0068864_1001222972 203
573 3300005618 Ga0068864_100151645 Ga0068864_1001516451 203
574 3300005618 Ga0068864_100264650 Ga0068864_1002646502 203
575 3300005618 Ga0068864_100443012 Ga0068864_1004430121 203
576 3300005618 Ga0068864_100610628 Ga0068864_1006106281 203
577 3300005719 Ga0068861_100089492 Ga0068861_1000894922 203
578 3300005719 Ga0068861_100698675 Ga0068861_1006986752 203
579 3300005834 Ga0068851_10362742 Ga0068851_103627422 203
580 3300005841 Ga0068863_100026639 Ga0068863_1000266396 203
581 3300005841 Ga0068863_100133871 Ga0068863_1001338712 203
582 3300005841 Ga0068863_100163148 Ga0068863_1001631482 203
583 3300005841 Ga0068863_100750732 Ga0068863_1007507322 203
584 3300005842 Ga0068858_100014545 Ga0068858_1000145454 203
585 3300005842 Ga0068858_100176608 Ga0068858_1001766082 203
586 3300005842 Ga0068858_100726763 Ga0068858_1007267632 203
587 3300005843 Ga0068860_100035879 Ga0068860_1000358792 203
588 3300005843 Ga0068860_100055864 Ga0068860_1000558642 203
589 3300005843 Ga0068860_100710189 Ga0068860_1007101892 203
590 3300005844 Ga0068862_100102217 Ga0068862_1001022172 203
591 3300005983 Ga0081540_1063214 Ga0081540_10632142 203
592 3300005985 Ga0081539_10000422 Ga0081539_1000042263 203
593 3300005985 Ga0081539_10007568 Ga0081539_100075684 203
594 3300006237 Ga0097621_100010916 Ga0097621_1000109163 203
595 3300006237 Ga0097621_100218321 Ga0097621_1002183212 203
596 3300006358 Ga0068871_100106369 Ga0068871_1001063693 203
597 3300006844 Ga0075428_100140028 Ga0075428_1001400281 203
598 3300006846 Ga0075430_100101202 Ga0075430_1001012022 203
599 3300006847 Ga0075431_100789153 Ga0075431_1007891532 203
600 3300006852 Ga0075433_10073659 Ga0075433_100736593 203
601 3300006852 Ga0075433_10119161 Ga0075433_101191612 203
602 3300006871 Ga0075434_100105261 Ga0075434_1001052613 203
603 3300006871 Ga0075434_100106497 Ga0075434_1001064973 203
604 3300006871 Ga0075434_100179512 Ga0075434_1001795122 203
605 3300006871 Ga0075434_100603563 Ga0075434_1006035632 203
606 3300006880 Ga0075429_100547152 Ga0075429_1005471521 203
607 3300006914 Ga0075436_100022320 Ga0075436_1000223204 203
608 3300006931 Ga0097620_100022804 Ga0097620_1000228043 203
609 3300006931 Ga0097620_100114088 Ga0097620_1001140883 203
610 3300006931 Ga0097620_100280938 Ga0097620_1002809382 203
611 3300006931 Ga0097620_100315570 Ga0097620_1003155701 203
612 3300006931 Ga0097620_100466931 Ga0097620_1004669312 203
613 3300007076 Ga0075435_100021741 Ga0075435_1000217412 203
614 3300009011 Ga0105251_10167242 Ga0105251_101672422 203
615 3300009093 Ga0105240_10176724 Ga0105240_101767242 203
616 3300009094 Ga0111539_10001877 Ga0111539_1000187710 203
617 3300009094 Ga0111539_10125960 Ga0111539_101259603 203
618 3300009094 Ga0111539_10150037 Ga0111539_101500373 203
619 3300009098 Ga0105245_10985689 Ga0105245_109856891 203
620 3300009101 Ga0105247_10003373 Ga0105247_100033735 203
621 3300009101 Ga0105247_10130714 Ga0105247_101307142 203
622 3300009147 Ga0114129_10071582 Ga0114129_100715822 203
623 3300009147 Ga0114129_10200232 Ga0114129_102002322 203
624 3300009148 Ga0105243_10012901 Ga0105243_100129014 203
625 3300009148 Ga0105243_10014515 Ga0105243_100145156 203
626 3300009148 Ga0105243_10267282 Ga0105243_102672822 203
627 3300009148 Ga0105243_10735466 Ga0105243_107354662 203
628 3300009174 Ga0105241_10105290 Ga0105241_101052902 203
629 3300009174 Ga0105241_10503279 Ga0105241_105032792 203
630 3300009174 Ga0105241_10592148 Ga0105241_105921481 203
631 3300009174 Ga0105241_11443259 Ga0105241_114432591 203
632 3300009176 Ga0105242_10040362 Ga0105242_100403623 203
633 3300009176 Ga0105242_10293396 Ga0105242_102933962 203
634 3300009177 Ga0105248_10205134 Ga0105248_102051342 203
635 3300009177 Ga0105248_10466434 Ga0105248_104664342 203
636 3300009551 Ga0105238_10013120 Ga0105238_100131207 203
637 3300009553 Ga0105249_10043269 Ga0105249_100432692 203
638 3300009553 Ga0105249_10624820 Ga0105249_106248202 203
639 3300010375 Ga0105239_10095554 Ga0105239_100955543 203
640 3300010375 Ga0105239_11401104 Ga0105239_114011041 203
641 3300011119 Ga0105246_10020265 Ga0105246_100202652 203
642 3300011119 Ga0105246_10364491 Ga0105246_103644912 203
643 3300011119 Ga0105246_10766682 Ga0105246_107666821 203
644 3300013296 Ga0157374_10052804 Ga0157374_100528042 203
645 3300013297 Ga0157378_10003478 Ga0157378_1000347810 203
646 3300013297 Ga0157378_10225211 Ga0157378_102252112 203
647 3300013297 Ga0157378_11115083 Ga0157378_111150831 203
648 3300013306 Ga0163162_10020922 Ga0163162_100209223 203
649 3300013306 Ga0163162_10221403 Ga0163162_102214032 203
650 3300013307 Ga0157372_10010237 Ga0157372_100102372 203
651 3300013308 Ga0157375_10035990 Ga0157375_100359902 203
652 3300013308 Ga0157375_10625156 Ga0157375_106251562 203
653 3300013308 Ga0157375_11467363 Ga0157375_114673632 203
654 3300014325 Ga0163163_10005816 Ga0163163_100058168 203
655 3300014325 Ga0163163_10009856 Ga0163163_100098561 203
656 3300014325 Ga0163163_10040627 Ga0163163_100406274 203
657 3300014325 Ga0163163_10044834 Ga0163163_100448341 203
658 3300014325 Ga0163163_10050659 Ga0163163_100506592 203
659 3300014325 Ga0163163_10125892 Ga0163163_101258922 203
660 3300014325 Ga0163163_10199147 Ga0163163_101991473 203
661 3300014325 Ga0163163_10271820 Ga0163163_102718201 203
662 3300014325 Ga0163163_10870422 Ga0163163_108704221 203
663 3300014326 Ga0157380_10133196 Ga0157380_101331962 203
664 3300014326 Ga0157380_10944655 Ga0157380_109446552 203
665 3300014745 Ga0157377_10070675 Ga0157377_100706752 203
666 3300014969 Ga0157376_10084445 Ga0157376_100844452 203
667 3300025315 Ga0207697_10008507 Ga0207697_100085072 203
668 3300025900 Ga0207710_10000927 Ga0207710_100009275 203
669 3300025904 Ga0207647_10007102 Ga0207647_100071025 203
670 3300025907 Ga0207645_10091469 Ga0207645_100914692 203
671 3300025908 Ga0207643_10338456 Ga0207643_103384562 203
672 3300025910 Ga0207684_10000314 Ga0207684_1000031414 203
673 3300025910 Ga0207684_10008012 Ga0207684_100080125 203
674 3300025910 Ga0207684_10174676 Ga0207684_101746762 203
675 3300025911 Ga0207654_10065174 Ga0207654_100651742 203
676 3300025911 Ga0207654_10455917 Ga0207654_104559172 203
677 3300025913 Ga0207695_10066767 Ga0207695_100667672 203
678 3300025918 Ga0207662_10002563 Ga0207662_100025637 203
679 3300025918 Ga0207662_10094642 Ga0207662_100946422 203
680 3300025922 Ga0207646_10072002 Ga0207646_100720022 203
681 3300025923 Ga0207681_10788517 Ga0207681_107885172 203
682 3300025924 Ga0207694_10026046 Ga0207694_100260463 203
683 3300025925 Ga0207650_10000047 Ga0207650_1000004771 203
684 3300025925 Ga0207650_10238573 Ga0207650_102385731 203
685 3300025926 Ga0207659_10855579 Ga0207659_108555791 203
686 3300025931 Ga0207644_10011207 Ga0207644_100112075 203
687 3300025931 Ga0207644_10526847 Ga0207644_105268471 203
688 3300025932 Ga0207690_10013277 Ga0207690_100132773 203
689 3300025932 Ga0207690_10808606 Ga0207690_108086061 203
690 3300025933 Ga0207706_10141782 Ga0207706_101417822 203
691 3300025934 Ga0207686_10069084 Ga0207686_100690842 203
692 3300025935 Ga0207709_10008224 Ga0207709_100082242 203
693 3300025935 Ga0207709_10102046 Ga0207709_101020462 203
694 3300025935 Ga0207709_10271435 Ga0207709_102714352 203
695 3300025936 Ga0207670_10415949 Ga0207670_104159491 203
696 3300025937 Ga0207669_10051011 Ga0207669_100510112 203
697 3300025940 Ga0207691_10007252 Ga0207691_100072522 203
698 3300025941 Ga0207711_10062117 Ga0207711_100621173 203
699 3300025941 Ga0207711_10103335 Ga0207711_101033352 203
700 3300025941 Ga0207711_10846212 Ga0207711_108462122 203
701 3300025942 Ga0207689_10001827 Ga0207689_1000182710 203
702 3300025942 Ga0207689_10002806 Ga0207689_100028061 203
703 3300025942 Ga0207689_10104862 Ga0207689_101048622 203
704 3300025945 Ga0207679_10032627 Ga0207679_100326271 203
705 3300025945 Ga0207679_10165235 Ga0207679_101652352 203
706 3300025949 Ga0207667_10279566 Ga0207667_102795662 203
707 3300025960 Ga0207651_10134655 Ga0207651_101346552 203
708 3300025960 Ga0207651_10276718 Ga0207651_102767181 203
709 3300025961 Ga0207712_10005073 Ga0207712_100050737 203
710 3300025961 Ga0207712_10352094 Ga0207712_103520942 203
711 3300025981 Ga0207640_10389470 Ga0207640_103894702 203
712 3300026023 Ga0207677_10674697 Ga0207677_106746971 203
713 3300026035 Ga0207703_10015611 Ga0207703_100156115 203
714 3300026075 Ga0207708_10041981 Ga0207708_100419813 203
715 3300026075 Ga0207708_10219950 Ga0207708_102199501 203
716 3300026088 Ga0207641_10242088 Ga0207641_102420882 203
717 3300026089 Ga0207648_10009860 Ga0207648_100098608 203
718 3300026089 Ga0207648_10072970 Ga0207648_100729702 203
719 3300026089 Ga0207648_10270326 Ga0207648_102703262 203
720 3300026089 Ga0207648_11157929 Ga0207648_111579291 203
721 3300026095 Ga0207676_10029779 Ga0207676_100297794 203
722 3300026095 Ga0207676_10246216 Ga0207676_102462162 203
723 3300026095 Ga0207676_10275852 Ga0207676_102758521 203
724 3300026095 Ga0207676_10312591 Ga0207676_103125912 203
725 3300026116 Ga0207674_10019731 Ga0207674_100197316 203
726 3300026116 Ga0207674_10110002 Ga0207674_101100023 203
727 3300026118 Ga0207675_100009521 Ga0207675_1000095217 203
728 3300026118 Ga0207675_100254800 Ga0207675_1002548002 203
729 3300026121 Ga0207683_10206396 Ga0207683_102063962 203
730 3300026121 Ga0207683_10418297 Ga0207683_104182971 203
731 3300026142 Ga0207698_10356844 Ga0207698_103568442 203
732 3300027907 Ga0207428_10013301 Ga0207428_100133013 203
733 3300028381 Ga0268264_10110750 Ga0268264_101107503 203
734 3300028381 Ga0268264_10110935 Ga0268264_101109352 203
735 3300028381 Ga0268264_10158615 Ga0268264_101586152 203
736 3300028381 Ga0268264_10196724 Ga0268264_101967241 203
737 3300031456 Ga0307513_10453815 Ga0307513_104538151 203
738 3300031852 Ga0307410_10873844 Ga0307410_108738441 203
739 3300031901 Ga0307406_10871705 Ga0307406_108717052 203
740 3300031911 Ga0307412_10101083 Ga0307412_101010832 203
741 3300031911 Ga0307412_10277657 Ga0307412_102776571 203
742 3300032002 Ga0307416_100100284 Ga0307416_1001002842 203
743 3300032004 Ga0307414_10186038 Ga0307414_101860382 203
744 3300038443 Ga0395901_0371842 Ga0395901_0371842_79_699 203
745 3300042435 Ga0439434_0013509 Ga0439434_0013509_759_1379 203
746 3300045051 Ga0451576_1074163 Ga0451576_1074163_110_739 203
747 3300045051 Ga0451576_1215512 Ga0451576_1215512_31_753 203
748 3300046539 Ga0495621_0000007 Ga0495621_0000007_5039_5662 203
749 3300046539 Ga0495621_0005112 Ga0495621_0005112_832_1452 203
750 3300047320 Ga0495672_0008903 Ga0495672_0008903_6513_7133 203
751 3300047445 Ga0495677_0063226 Ga0495677_0063226_320_943 203
752 3300048909 Ga0496106_0612599 Ga0496106_0612599_130_750 203
753 3300048913 Ga0496110_0208063 Ga0496110_0208063_661_1281 203
754 3300048913 Ga0496110_0458932 Ga0496110_0458932_91_720 203
755 3300048915 Ga0496112_0353446 Ga0496112_0353446_268_903 203
756 3300048915 Ga0496112_0686872 Ga0496112_0686872_84_719 203
757 3300048916 Ga0496113_0317784 Ga0496113_0317784_449_1078 203
758 3300049514 Ga0501291_021658 Ga0501291_021658_286_921 203
759 3300049515 Ga0501292_011788 Ga0501292_011788_241_867 203
760 3300049516 Ga0501293_008273 Ga0501293_008273_183_809 203
761 3300049521 Ga0501298_022136 Ga0501298_022136_441_1076 203
762 3300049522 Ga0501299_002870 Ga0501299_002870_62_697 203
763 3300049522 Ga0501299_010131 Ga0501299_010131_246_869 203
764 3300049522 Ga0501299_050322 Ga0501299_050322_47_673 203
765 3300049652 Ga0501202_003380 Ga0501202_003380_566_1201 203
766 3300049652 Ga0501202_011961 Ga0501202_011961_720_1346 203
767 3300049660 Ga0501216_002824 Ga0501216_002824_518_1144 203
768 3300049661 Ga0501217_003056 Ga0501217_003056_2007_2633 203
769 3300049661 Ga0501217_091789 Ga0501217_091789_167_802 203
770 3300049663 Ga0501223_011979 Ga0501223_011979_1063_1689 203
771 3300049667 Ga0501230_066605 Ga0501230_066605_11_637 203
772 3300049668 Ga0501233_007716 Ga0501233_007716_906_1532 203
773 3300049668 Ga0501233_008092 Ga0501233_008092_637_1272 203
774 3300049668 Ga0501233_043158 Ga0501233_043158_414_1037 203
775 3300049669 Ga0501235_003719 Ga0501235_003719_1318_1956 203
776 3300049669 Ga0501235_009688 Ga0501235_009688_708_1331 203
777 3300049669 Ga0501235_018171 Ga0501235_018171_781_1407 203
778 3300049669 Ga0501235_033090 Ga0501235_033090_441_1076 203
779 3300049675 Ga0501243_007641 Ga0501243_007641_166_792 203
780 3300049679 Ga0501249_013306 Ga0501249_013306_498_1124 203
781 3300049679 Ga0501249_014692 Ga0501249_014692_963_1601 203
782 3300049679 Ga0501249_089058 Ga0501249_089058_69_692 203
783 3300049686 Ga0501257_011905 Ga0501257_011905_608_1234 203
784 3300049705 Ga0501225_0007957 Ga0501225_0007957_2234_2869 203
785 3300049705 Ga0501225_0093622 Ga0501225_0093622_29_667 203
786 3300049707 Ga0501234_007226 Ga0501234_007226_1047_1673 203
787 3300049765 Ga0501268_024751 Ga0501268_024751_98_736 203
788 3300049779 Ga0501283_001080 Ga0501283_001080_1058_1693 203
789 3300049851 Ga0501212_024371 Ga0501212_024371_153_788 203
790 3300049851 Ga0501212_024512 Ga0501212_024512_197_820 203
791 3300050507 nmdc:mga05p37_213946_c1 nmdc:mga05p37_213946_c1_589_1215 203
792 3300050508 nmdc:mga09592_206209_c1 nmdc:mga09592_206209_c1_137_757 203
793 3300050509 nmdc:mga0qj67_115701_c1 nmdc:mga0qj67_115701_c1_585_1205 203
794 3300050511 nmdc:mga08y16_233036_c1 nmdc:mga08y16_233036_c1_609_1235 203
795 3300050512 nmdc:mga0n895_434117_c1 nmdc:mga0n895_434117_c1_212_847 203
796 3300050512 nmdc:mga0n895_76060_c1 nmdc:mga0n895_76060_c1_1030_1659 203
797 3300050513 nmdc:mga0rr50_153545_c1 nmdc:mga0rr50_153545_c1_195_815 203
798 3300050514 nmdc:mga08x19_4099_c1 nmdc:mga08x19_4099_c1_4541_5170 203
799 3300050515 nmdc:mga0a205_284960_c1 nmdc:mga0a205_284960_c1_159_788 203
800 3300050515 nmdc:mga0a205_333661_c1 nmdc:mga0a205_333661_c1_86_706 203
801 3300050515 nmdc:mga0a205_81896_c1 nmdc:mga0a205_81896_c1_2346_2969 203
802 3300000531 CNBas_1001844 CNBas_10018442 204
803 3300005290 Ga0065712_10010968 Ga0065712_100109682 204
804 3300005290 Ga0065712_10048272 Ga0065712_100482721 204
805 3300005293 Ga0065715_10017239 Ga0065715_100172392 204
806 3300005293 Ga0065715_10586200 Ga0065715_105862001 204
807 3300005331 Ga0070670_100292051 Ga0070670_1002920512 204
808 3300005334 Ga0068869_100762964 Ga0068869_1007629641 204
809 3300005343 Ga0070687_100759905 Ga0070687_1007599051 204
810 3300005345 Ga0070692_10229614 Ga0070692_102296141 204
811 3300005364 Ga0070673_100236121 Ga0070673_1002361212 204
812 3300005364 Ga0070673_100245695 Ga0070673_1002456952 204
813 3300005406 Ga0070703_10047071 Ga0070703_100470711 204
814 3300005440 Ga0070705_100056427 Ga0070705_1000564272 204
815 3300005441 Ga0070700_100000062 Ga0070700_10000006218 204
816 3300005444 Ga0070694_100002065 Ga0070694_1000020657 204
817 3300005458 Ga0070681_10020025 Ga0070681_100200255 204
818 3300005518 Ga0070699_100002296 Ga0070699_1000022968 204
819 3300005518 Ga0070699_100047578 Ga0070699_1000475783 204
820 3300005539 Ga0068853_100405778 Ga0068853_1004057782 204
821 3300005546 Ga0070696_100031651 Ga0070696_1000316513 204
822 3300005546 Ga0070696_100171861 Ga0070696_1001718612 204
823 3300005547 Ga0070693_100031014 Ga0070693_1000310142 204
824 3300005564 Ga0070664_100456518 Ga0070664_1004565182 204
825 3300005615 Ga0070702_100217094 Ga0070702_1002170942 204
826 3300005615 Ga0070702_100473090 Ga0070702_1004730901 204
827 3300005616 Ga0068852_100912548 Ga0068852_1009125482 204
828 3300005617 Ga0068859_100040540 Ga0068859_1000405403 204
829 3300005617 Ga0068859_100049851 Ga0068859_1000498512 204
830 3300005617 Ga0068859_100150795 Ga0068859_1001507951 204
831 3300005618 Ga0068864_100239213 Ga0068864_1002392132 204
832 3300005719 Ga0068861_100130256 Ga0068861_1001302562 204
833 3300005841 Ga0068863_100276594 Ga0068863_1002765941 204
834 3300005842 Ga0068858_100161681 Ga0068858_1001616812 204
835 3300005842 Ga0068858_100355061 Ga0068858_1003550612 204
836 3300005842 Ga0068858_100377009 Ga0068858_1003770092 204
837 3300005843 Ga0068860_100340565 Ga0068860_1003405652 204
838 3300005844 Ga0068862_100535118 Ga0068862_1005351182 204
839 3300005844 Ga0068862_100615184 Ga0068862_1006151842 204
840 3300006058 Ga0075432_10071248 Ga0075432_100712482 204
841 3300006852 Ga0075433_10042512 Ga0075433_100425122 204
842 3300006852 Ga0075433_10673275 Ga0075433_106732752 204
843 3300006931 Ga0097620_100040539 Ga0097620_1000405393 204
844 3300006931 Ga0097620_100049850 Ga0097620_1000498502 204
845 3300006931 Ga0097620_100150795 Ga0097620_1001507951 204
846 3300009094 Ga0111539_10723326 Ga0111539_107233262 204
847 3300009098 Ga0105245_10427013 Ga0105245_104270132 204
848 3300009101 Ga0105247_10102872 Ga0105247_101028722 204
849 3300009101 Ga0105247_10117094 Ga0105247_101170942 204
850 3300009101 Ga0105247_10165925 Ga0105247_101659252 204
851 3300009147 Ga0114129_10210011 Ga0114129_102100112 204
852 3300009148 Ga0105243_10197930 Ga0105243_101979302 204
853 3300009148 Ga0105243_11257944 Ga0105243_112579441 204
854 3300009174 Ga0105241_10045407 Ga0105241_100454074 204
855 3300009176 Ga0105242_10527510 Ga0105242_105275101 204
856 3300009177 Ga0105248_10025944 Ga0105248_100259447 204
857 3300009177 Ga0105248_10117472 Ga0105248_101174722 204
858 3300009177 Ga0105248_10804707 Ga0105248_108047071 204
859 3300009177 Ga0105248_10870785 Ga0105248_108707851 204
860 3300010375 Ga0105239_10109014 Ga0105239_101090142 204
861 3300013100 Ga0157373_10010134 Ga0157373_100101345 204
862 3300013100 Ga0157373_10418838 Ga0157373_104188382 204
863 3300013306 Ga0163162_10803230 Ga0163162_108032302 204
864 3300013308 Ga0157375_11841562 Ga0157375_118415621 204
865 3300014325 Ga0163163_10612970 Ga0163163_106129702 204
866 3300014968 Ga0157379_11081104 Ga0157379_110811041 204
867 3300025900 Ga0207710_10185716 Ga0207710_101857162 204
868 3300025911 Ga0207654_10030444 Ga0207654_100304442 204
869 3300025911 Ga0207654_10225858 Ga0207654_102258582 204
870 3300025912 Ga0207707_10032652 Ga0207707_100326524 204
871 3300025914 Ga0207671_10160785 Ga0207671_101607851 204
872 3300025918 Ga0207662_10072803 Ga0207662_100728032 204
873 3300025922 Ga0207646_10076563 Ga0207646_100765633 204
874 3300025925 Ga0207650_10146613 Ga0207650_101466132 204
875 3300025935 Ga0207709_10366874 Ga0207709_103668742 204
876 3300025935 Ga0207709_10488021 Ga0207709_104880212 204
877 3300025935 Ga0207709_10609559 Ga0207709_106095592 204
878 3300025941 Ga0207711_10023587 Ga0207711_100235872 204
879 3300025941 Ga0207711_10266561 Ga0207711_102665612 204
880 3300025941 Ga0207711_10366906 Ga0207711_103669062 204
881 3300025942 Ga0207689_10090588 Ga0207689_100905882 204
882 3300025942 Ga0207689_10519742 Ga0207689_105197422 204
883 3300025945 Ga0207679_10495974 Ga0207679_104959741 204
884 3300025960 Ga0207651_10192477 Ga0207651_101924772 204
885 3300026035 Ga0207703_10125571 Ga0207703_101255712 204
886 3300026035 Ga0207703_10374853 Ga0207703_103748532 204
887 3300026041 Ga0207639_10440794 Ga0207639_104407942 204
888 3300026041 Ga0207639_10614019 Ga0207639_106140192 204
889 3300026075 Ga0207708_10000246 Ga0207708_1000024618 204
890 3300026088 Ga0207641_10173552 Ga0207641_101735522 204
891 3300026095 Ga0207676_10120854 Ga0207676_101208543 204
892 3300026095 Ga0207676_10787841 Ga0207676_107878412 204
893 3300026116 Ga0207674_10182682 Ga0207674_101826822 204
894 3300026118 Ga0207675_100184169 Ga0207675_1001841692 204
895 3300026142 Ga0207698_10607455 Ga0207698_106074552 204
896 3300027907 Ga0207428_10296088 Ga0207428_102960881 204
897 3300028380 Ga0268265_10481059 Ga0268265_104810592 204
898 3300028380 Ga0268265_10508919 Ga0268265_105089191 204
899 3300028381 Ga0268264_10117790 Ga0268264_101177901 204
900 3300031548 Ga0307408_100112541 Ga0307408_1001125413 204
901 3300031731 Ga0307405_10016049 Ga0307405_100160493 204
902 3300031824 Ga0307413_10711986 Ga0307413_107119862 204
903 3300031852 Ga0307410_10031517 Ga0307410_100315172 204
904 3300031901 Ga0307406_10098864 Ga0307406_100988642 204
905 3300031903 Ga0307407_10042041 Ga0307407_100420412 204
906 3300031911 Ga0307412_10021603 Ga0307412_100216034 204
907 3300031995 Ga0307409_100295642 Ga0307409_1002956422 204
908 3300032002 Ga0307416_100035493 Ga0307416_1000354932 204
909 3300032004 Ga0307414_10039672 Ga0307414_100396722 204
910 3300032126 Ga0307415_100074212 Ga0307415_1000742122 204
911 3300035090 Ga0373949_0077918 Ga0373949_0077918_69_692 204
912 3300035091 Ga0373951_0000456 Ga0373951_0000456_7761_8387 204
913 3300035115 Ga0373941_0005444 Ga0373941_0005444_2199_2822 204
914 3300035691 Ga0373931_0013124 Ga0373931_0013124_255_878 204
915 3300035691 Ga0373931_0103930 Ga0373931_0103930_564_1190 204
916 3300037466 Ga0395898_0084385 Ga0395898_0084385_509_1132 204
917 3300037471 Ga0395905_0998662 Ga0395905_0998662_83_706 204
918 3300038699 Ga0242422_01462 Ga0242422_01462_587_1213 204
919 3300038996 Ga0242420_014220 Ga0242420_014220_249_875 204
920 3300042012 Ga0439455_0011346 Ga0439455_0011346_749_1372 204
921 3300042157 Ga0439458_0010133 Ga0439458_0010133_622_1245 204
922 3300048910 Ga0496107_0063454 Ga0496107_0063454_848_1483 204
923 3300048915 Ga0496112_0113304 Ga0496112_0113304_100_723 204
924 3300048916 Ga0496113_0134251 Ga0496113_0134251_294_917 204
925 3300049653 Ga0501206_024900 Ga0501206_024900_113_736 204
926 3300049654 Ga0501207_003570 Ga0501207_003570_1014_1637 204
927 3300049660 Ga0501216_001897 Ga0501216_001897_408_1031 204
928 3300049661 Ga0501217_000772 Ga0501217_000772_1708_2331 204
929 3300049663 Ga0501223_005210 Ga0501223_005210_1359_1982 204
930 3300049664 Ga0501224_001375 Ga0501224_001375_2405_3028 204
931 3300049665 Ga0501227_084161 Ga0501227_084161_152_775 204
932 3300049667 Ga0501230_000985 Ga0501230_000985_1379_2002 204
933 3300049668 Ga0501233_003750 Ga0501233_003750_942_1565 204
934 3300049669 Ga0501235_004036 Ga0501235_004036_1351_1974 204
935 3300049675 Ga0501243_004127 Ga0501243_004127_673_1296 204
936 3300049679 Ga0501249_035677 Ga0501249_035677_131_754 204
937 3300049686 Ga0501257_011404 Ga0501257_011404_1095_1718 204
938 3300049688 Ga0501259_013009 Ga0501259_013009_422_1045 204
939 3300049705 Ga0501225_0004958 Ga0501225_0004958_2602_3225 204
940 3300049707 Ga0501234_010505 Ga0501234_010505_177_800 204
941 3300049764 Ga0501267_009689 Ga0501267_009689_84_707 204
942 3300049851 Ga0501212_043988 Ga0501212_043988_53_676 204
943 3300049853 Ga0501226_000589 Ga0501226_000589_1571_2194 204
944 3300050507 nmdc:mga05p37_192430_c1 nmdc:mga05p37_192430_c1_14_637 204
945 3300050507 nmdc:mga05p37_205646_c1 nmdc:mga05p37_205646_c1_1562_2185 204
946 3300050512 nmdc:mga0n895_266812_c1 nmdc:mga0n895_266812_c1_30_653 204
947 3300050515 nmdc:mga0a205_42897_c1 nmdc:mga0a205_42897_c1_139_765 204
948 3300005330 Ga0070690_100431157 Ga0070690_1004311571 205
949 3300005331 Ga0070670_100016819 Ga0070670_1000168194 205
950 3300005340 Ga0070689_100001209 Ga0070689_1000012097 205
951 3300005719 Ga0068861_100312448 Ga0068861_1003124482 205
952 3300005840 Ga0068870_10017039 Ga0068870_100170392 205
953 3300005841 Ga0068863_100091832 Ga0068863_1000918321 205
954 3300005843 Ga0068860_100226580 Ga0068860_1002265802 205
955 3300009148 Ga0105243_10422313 Ga0105243_104223132 205
956 3300011119 Ga0105246_10057398 Ga0105246_100573982 205
957 3300014326 Ga0157380_10174950 Ga0157380_101749502 205
958 3300025908 Ga0207643_10000595 Ga0207643_100005954 205
959 3300025925 Ga0207650_10960879 Ga0207650_109608791 205
960 3300025936 Ga0207670_10000162 Ga0207670_100001627 205
961 3300025941 Ga0207711_10771806 Ga0207711_107718061 205
962 3300026095 Ga0207676_10003037 Ga0207676_100030377 205
963 3300026116 Ga0207674_10124154 Ga0207674_101241543 205
964 3300026118 Ga0207675_100269991 Ga0207675_1002699912 205
965 3300028381 Ga0268264_10560060 Ga0268264_105600602 205
966 3300005328 Ga0070676_10267149 Ga0070676_102671491 206
967 3300005937 Ga0081455_10463840 Ga0081455_104638401 206
968 2162886012 MBSR1b_contig_11831596 MBSR1b_0369.00006710 207
969 3300005289 Ga0065704_10119347 Ga0065704_101193472 207
970 3300005293 Ga0065715_10214062 Ga0065715_102140622 207
971 3300005330 Ga0070690_100085278 Ga0070690_1000852782 207
972 3300005330 Ga0070690_100119691 Ga0070690_1001196912 207
973 3300005338 Ga0068868_100022784 Ga0068868_1000227845 207
974 3300005343 Ga0070687_100012833 Ga0070687_1000128333 207
975 3300005343 Ga0070687_100012923 Ga0070687_1000129232 207
976 3300005345 Ga0070692_10063808 Ga0070692_100638082 207
977 3300005353 Ga0070669_100036875 Ga0070669_1000368752 207
978 3300005441 Ga0070700_100010600 Ga0070700_1000106004 207
979 3300005444 Ga0070694_100026789 Ga0070694_1000267892 207
980 3300005544 Ga0070686_100009242 Ga0070686_1000092422 207
981 3300005549 Ga0070704_100126943 Ga0070704_1001269432 207
982 3300005549 Ga0070704_100316789 Ga0070704_1003167892 207
983 3300005578 Ga0068854_100082457 Ga0068854_1000824571 207
984 3300005719 Ga0068861_100006125 Ga0068861_1000061255 207
985 3300005840 Ga0068870_10245124 Ga0068870_102451241 207
986 3300005843 Ga0068860_100022110 Ga0068860_1000221105 207
987 3300005844 Ga0068862_100076839 Ga0068862_1000768393 207
988 3300006844 Ga0075428_100354918 Ga0075428_1003549182 207
989 3300009094 Ga0111539_11179587 Ga0111539_111795871 207
990 3300009098 Ga0105245_11261122 Ga0105245_112611221 207
991 3300009176 Ga0105242_10150891 Ga0105242_101508912 207
992 3300009553 Ga0105249_10011401 Ga0105249_100114016 207
993 3300013102 Ga0157371_10511310 Ga0157371_105113101 207
994 3300013297 Ga0157378_10009116 Ga0157378_100091168 207
995 3300013297 Ga0157378_10029842 Ga0157378_100298424 207
996 3300013306 Ga0163162_10323460 Ga0163162_103234601 207
997 3300013306 Ga0163162_10335240 Ga0163162_103352402 207
998 3300014326 Ga0157380_10005686 Ga0157380_100056863 207
999 3300014326 Ga0157380_10146960 Ga0157380_101469602 207
1000 3300017792 Ga0163161_10353702 Ga0163161_103537022 207
1001 3300025918 Ga0207662_10135164 Ga0207662_101351642 207
1002 3300025923 Ga0207681_10046565 Ga0207681_100465651 207
1003 3300025942 Ga0207689_10071917 Ga0207689_100719173 207
1004 3300025961 Ga0207712_10016894 Ga0207712_100168941 207
1005 3300025981 Ga0207640_10100247 Ga0207640_101002472 207
1006 3300026035 Ga0207703_10042431 Ga0207703_100424313 207
1007 3300026075 Ga0207708_10024106 Ga0207708_100241062 207
1008 3300026075 Ga0207708_10883393 Ga0207708_108833931 207
1009 3300026118 Ga0207675_100097066 Ga0207675_1000970662 207
1010 3300027907 Ga0207428_10069112 Ga0207428_100691122 207
1011 3300028380 Ga0268265_10199819 Ga0268265_101998191 207
1012 3300028381 Ga0268264_10171380 Ga0268264_101713802 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

54

175

0.85

PF00578

AhpC-TSA

AhpC/TSA family

54

160

0.83

PF00085

Thioredoxin

Thioredoxin

62

153

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7luj-assembly3.cif.gz_C burkholderia pseudomallei disulfide bond forming protein a (dsba) liganded with fragment 4-methoxy-n-phenylbenzenesulfonamide 0.8855 59 100
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8181 39 195
2h1b-assembly2.cif.gz_B resa e80q 0.8056 33 195
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.8053 39 195
2h1a-assembly1.cif.gz_A resa c74a variant 0.8045 39 195
ID Description Score Start End Superfamily
5vyoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8684 58 100 3.40.30.10
3apoA02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8133 55 100 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8015 40 196 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8006 41 194 3.40.30.10
af_B2RYB1_652_773_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7968 58 100 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V8P7L8-F1-model_v4 Thioredoxin domain-containing protein 0.9584 41 205 GO:0016209
GO:0016491
AF-A0A2V8P7L8-F1-model_v4 Thioredoxin domain-containing protein 0.947 41 205 GO:0016209
GO:0016491
AF-A0A7V9SMR1-F1-model_v4 TlpA family protein disulfide reductase 0.8884 18 207 GO:0016209
GO:0016491
AF-A0A2W4S4J2-F1-model_v4 Thiol:disulfide interchange protein 0.8682 39 194 GO:0016020
GO:0016491
GO:0017004
AF-A0A5B3GEP1-F1-model_v4 AhpC/TSA family protein 0.8675 39 160 GO:0016491
GO:0017004

Feature Viewer

pLDDT pTM Quality
87.84 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map