F488147

General Info

Members Datasets Scaffolds Average Seq Length
1011 615 2022 156

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0044059|Ga0395900_0044059_2192_2770
Length 184
Sequence MALPPKSASRQKPDAFTKQPKQSFRIKNMARQPEEKSTGKFSSDDSALIRELALLLDETSLTEIEIERAGLRLRVARNISIATHMPAAVPMTGSAIAPAPIADLSKHPGVVPSPMVGTAYWAPEPGAKPFIEVGSKVSASQTLLIIEAMKTMNQIPSPRAGTVTQILVEDGQPVEFGEPLVIIE

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
116 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
117 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
118 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
207 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
237 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
240 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
362 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
365 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
366 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
367 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
368 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
369 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
370 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
371 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
372 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
373 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
374 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
375 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
376 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
377 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
378 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
379 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
380 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
381 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
386 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
389 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
390 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
396 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
397 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
398 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
399 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
400 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
401 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
402 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
403 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
404 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
405 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
406 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
407 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
408 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
409 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
410 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
411 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
412 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
413 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
414 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
415 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
416 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
417 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
418 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
419 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
420 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
421 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
422 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
423 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
424 2791355199
425 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
426 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
427 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
428 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
429 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
430 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
431 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
432 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
433 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
434 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
435 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
436 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
437 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
438 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
439 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
440 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
441 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
442 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
443 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
444 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
445 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
446 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
447 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
448 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
449 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
450 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
451 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
452 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
453 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
454 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
455 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
456 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
457 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
458 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
459 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
460 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
461 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
462 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
463 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
464 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
465 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
466 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
467 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
468 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
469 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
470 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
471 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
472 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
473 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
474 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
475 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
476 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
477 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
478 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
479 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
480 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
481 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
482 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
483 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
484 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
485 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
486 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
487 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
488 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
489 2904699407
490 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
491 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
492 2906610324
493 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
494 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
495 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
496 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
497 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
498 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
499 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
500 2922368715
501 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
502 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
503 2922425934
504 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
505 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
506 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
507 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
508 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
509 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
510 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
511 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
512 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
513 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
514 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
515 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
516 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
517 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
518 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
519 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
520 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
521 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
522 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
523 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
524 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
525 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
526 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
527 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
528 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
529 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
530 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
531 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
532 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
533 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
534 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
535 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
536 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
537 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
538 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
539 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
540 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
541 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
542 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
543 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
544 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
545 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
546 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
547 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
548 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
549 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
550 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
551 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
552 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
553 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
554 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
555 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
556 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
557 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
558 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
559 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
560 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
561 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
562 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
563 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
564 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
565 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
566 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
567 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
568 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
569 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
570 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
571 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
572 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
573 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
574 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
575 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
576 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
577 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
578 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
579 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
580 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
581 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
582 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
583 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
584 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
585 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
586 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
587 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
588 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
589 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
590 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
591 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
592 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
593 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
594 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
595 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
596 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
597 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
598 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
599 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
600 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
601 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
602 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
603 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
604 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
605 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
606 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
607 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
608 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
609 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
610 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
611 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
612 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
613 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
614 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
615 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.53
Metatranscriptomes 0
Isolates 21.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 16.62
Rhizoplane 9.4
Rhizosphere 58.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0044059 3300037418 Bacteria 4599
2 JGI25404J52841_10000074 3300003659 Bacteria 8897
3 JGI25404J52841_10017418 3300003659 Bacteria 1558
4 Ga0065715_10110964 3300005293 Bacteria 2585
5 Ga0070658_10097872 3300005327 Bacteria 2422
6 Ga0070676_10215456 3300005328 Bacteria 1265
7 Ga0070683_100127724 3300005329 Bacteria 2404
8 Ga0070683_100161825 3300005329 Bacteria 2124
9 Ga0070683_100631012 3300005329 Bacteria 1026
10 Ga0070690_100254248 3300005330 Bacteria 1244
11 Ga0070690_100575824 3300005330 Bacteria 852
12 Ga0070670_100502886 3300005331 Bacteria 1078
13 Ga0068869_100353398 3300005334 Bacteria 1198
14 Ga0068869_100488259 3300005334 Bacteria 1026
15 Ga0068869_100650899 3300005334 Bacteria 894
16 Ga0068869_100865143 3300005334 Bacteria 780
17 Ga0070666_10352313 3300005335 Bacteria 1053
18 Ga0070680_100023225 3300005336 Bacteria 4944
19 Ga0070680_100285490 3300005336 Bacteria 1399
20 Ga0070680_100485571 3300005336 Bacteria 1056
21 Ga0070682_100031462 3300005337 Bacteria 3210
22 Ga0070682_100318449 3300005337 Bacteria 1148
23 Ga0070682_100449235 3300005337 Bacteria 987
24 Ga0068868_100015782 3300005338 Bacteria 5595
25 Ga0068868_101047061 3300005338 Bacteria 748
26 Ga0070660_100101024 3300005339 Bacteria 2285
27 Ga0070660_100143997 3300005339 Bacteria 1914
28 Ga0070660_100173799 3300005339 Bacteria 1741
29 Ga0070689_100167031 3300005340 Bacteria 1781
30 Ga0070689_100577311 3300005340 Bacteria 971
31 Ga0070691_10203453 3300005341 Bacteria 1041
32 Ga0070691_10382341 3300005341 Bacteria 789
33 Ga0070661_100089964 3300005344 Bacteria 2273
34 Ga0070668_100040972 3300005347 Bacteria 3547
35 Ga0070668_100056554 3300005347 Bacteria 3030
36 Ga0070668_100386242 3300005347 Bacteria 1192
37 Ga0070668_100505427 3300005347 Bacteria 1047
38 Ga0070669_100425531 3300005353 Bacteria 1090
39 Ga0070675_100178981 3300005354 Bacteria 1832
40 Ga0070671_100130874 3300005355 Bacteria 2113
41 Ga0070674_100007645 3300005356 Bacteria 6383
42 Ga0070674_100050184 3300005356 Bacteria 2872
43 Ga0070673_100759091 3300005364 Bacteria 893
44 Ga0070673_101157450 3300005364 Bacteria 724
45 Ga0070688_100271284 3300005365 Bacteria 1215
46 Ga0070688_100497133 3300005365 Bacteria 919
47 Ga0070659_100145270 3300005366 Bacteria 1932
48 Ga0070659_100612486 3300005366 Bacteria 937
49 Ga0070667_100411748 3300005367 Bacteria 1232
50 Ga0070714_100121097 3300005435 Bacteria 2328
51 Ga0070714_100241367 3300005435 Bacteria 1668
52 Ga0070713_100010275 3300005436 Bacteria 6758
53 Ga0070713_100176956 3300005436 Bacteria 1915
54 Ga0070713_101134942 3300005436 Bacteria 756
55 Ga0070701_10032376 3300005438 Bacteria 2602
56 Ga0070701_10047195 3300005438 Bacteria 2217
57 Ga0070711_100267944 3300005439 Bacteria 1347
58 Ga0070711_100412532 3300005439 Bacteria 1099
59 Ga0070705_100164149 3300005440 Bacteria 1488
60 Ga0070705_100547035 3300005440 Bacteria 887
61 Ga0070700_100207092 3300005441 Bacteria 1381
62 Ga0070700_100487955 3300005441 Bacteria 945
63 Ga0070708_100022040 3300005445 Bacteria 5399
64 Ga0070663_100044064 3300005455 Bacteria 3143
65 Ga0070663_100086097 3300005455 Bacteria 2320
66 Ga0070663_100154382 3300005455 Bacteria 1763
67 Ga0070663_100187216 3300005455 Bacteria 1609
68 Ga0070663_100441891 3300005455 Bacteria 1070
69 Ga0070663_100799809 3300005455 Bacteria 808
70 Ga0070678_100089066 3300005456 Bacteria 2361
71 Ga0070678_100220875 3300005456 Bacteria 1575
72 Ga0070678_100293289 3300005456 Bacteria 1380
73 Ga0070678_100426195 3300005456 Bacteria 1157
74 Ga0070678_100814686 3300005456 Bacteria 848
75 Ga0070662_100222481 3300005457 Bacteria 1506
76 Ga0070681_10010339 3300005458 Bacteria 9211
77 Ga0070681_10146140 3300005458 Bacteria 2293
78 Ga0070681_10782510 3300005458 Bacteria 871
79 Ga0068867_100020024 3300005459 Bacteria 4768
80 Ga0068867_100207822 3300005459 Bacteria 1570
81 Ga0070685_10070010 3300005466 Bacteria 2076
82 Ga0070685_10530809 3300005466 Bacteria 837
83 Ga0070706_100259303 3300005467 Bacteria 1623
84 Ga0070707_100088681 3300005468 Bacteria 2992
85 Ga0070699_100201372 3300005518 Bacteria 1770
86 Ga0070679_100017059 3300005530 Bacteria 7019
87 Ga0070679_100043008 3300005530 Bacteria 4499
88 Ga0070679_100941009 3300005530 Bacteria 808
89 Ga0070684_100007403 3300005535 Bacteria 8533
90 Ga0070684_100065228 3300005535 Bacteria 3196
91 Ga0070684_100773382 3300005535 Bacteria 897
92 Ga0070697_100722321 3300005536 Bacteria 880
93 Ga0068853_100244989 3300005539 Bacteria 1644
94 Ga0068853_100721384 3300005539 Bacteria 952
95 Ga0070672_100060622 3300005543 Bacteria 2979
96 Ga0070672_100206859 3300005543 Bacteria 1643
97 Ga0070696_100145872 3300005546 Bacteria 1733
98 Ga0070696_100471424 3300005546 Bacteria 994
99 Ga0070696_100477014 3300005546 Bacteria 988
100 Ga0070693_100341891 3300005547 Bacteria 1021
101 Ga0070665_100224798 3300005548 Bacteria 1877
102 Ga0070665_100703544 3300005548 Bacteria 1023
103 Ga0068855_100003023 3300005563 Bacteria 20577
104 Ga0068855_100032053 3300005563 Bacteria 6275
105 Ga0068855_100315927 3300005563 Bacteria 1728
106 Ga0070664_100034166 3300005564 Bacteria 4265
107 Ga0070664_100545681 3300005564 Bacteria 1072
108 Ga0070664_100606329 3300005564 Bacteria 1016
109 Ga0068854_100454254 3300005578 Bacteria 1071
110 Ga0068854_101138903 3300005578 Bacteria 697
111 Ga0068856_100072308 3300005614 Bacteria 3415
112 Ga0070702_100035143 3300005615 Bacteria 2767
113 Ga0070702_100042749 3300005615 Bacteria 2549
114 Ga0070702_100135437 3300005615 Bacteria 1562
115 Ga0070702_100437287 3300005615 Bacteria 946
116 Ga0068852_100042910 3300005616 Bacteria 3832
117 Ga0068852_100398894 3300005616 Bacteria 1353
118 Ga0068859_100887809 3300005617 Bacteria 976
119 Ga0068859_100996175 3300005617 Bacteria 920
120 Ga0068864_100243560 3300005618 Bacteria 1667
121 Ga0068866_10064519 3300005718 Bacteria 1912
122 Ga0068861_100438602 3300005719 Bacteria 1167
123 Ga0068870_10035639 3300005840 Bacteria 2555
124 Ga0068863_100082674 3300005841 Bacteria 3044
125 Ga0068863_100283478 3300005841 Bacteria 1606
126 Ga0068863_100313459 3300005841 Bacteria 1523
127 Ga0068863_100583078 3300005841 Bacteria 1106
128 Ga0068858_100031889 3300005842 Bacteria 4897
129 Ga0068858_100692078 3300005842 Bacteria 992
130 Ga0068858_101069730 3300005842 Bacteria 791
131 Ga0068860_100079510 3300005843 Bacteria 3118
132 Ga0068860_101298411 3300005843 Bacteria 748
133 Ga0068862_100040181 3300005844 Bacteria 3976
134 Ga0068862_100066032 3300005844 Bacteria 3117
135 Ga0068862_100226739 3300005844 Bacteria 1693
136 Ga0068862_100272907 3300005844 Bacteria 1547
137 Ga0068862_101672090 3300005844 Bacteria 644
138 Ga0081455_10015473 3300005937 Bacteria 7410
139 Ga0081455_10055763 3300005937 Bacteria 3360
140 Ga0081455_10279684 3300005937 Bacteria 1206
141 Ga0081540_1000136 3300005983 Bacteria 78663
142 Ga0081540_1002694 3300005983 Bacteria 14452
143 Ga0081540_1003284 3300005983 Bacteria 12855
144 Ga0081540_1017176 3300005983 Bacteria 4489
145 Ga0081540_1046754 3300005983 Bacteria 2182
146 Ga0070717_10006942 3300006028 Bacteria 8368
147 Ga0070717_11100359 3300006028 Bacteria 724
148 Ga0075365_10394859 3300006038 Bacteria 976
149 Ga0075365_10550049 3300006038 Bacteria 816
150 Ga0075368_10068569 3300006042 Bacteria 1429
151 Ga0075363_100004820 3300006048 Bacteria 5953
152 Ga0075364_10146771 3300006051 Bacteria 1588
153 Ga0075364_10583538 3300006051 Bacteria 764
154 Ga0070715_10306404 3300006163 Bacteria 852
155 Ga0070716_100030634 3300006173 Bacteria 2921
156 Ga0070716_100055126 3300006173 Bacteria 2274
157 Ga0070716_100132426 3300006173 Bacteria 1578
158 Ga0070712_100235671 3300006175 Bacteria 1456
159 Ga0070712_100250555 3300006175 Bacteria 1415
160 Ga0075362_10123678 3300006177 Bacteria 1226
161 Ga0075367_10377543 3300006178 Bacteria 895
162 Ga0075369_10034195 3300006186 Bacteria 2157
163 Ga0075369_10050214 3300006186 Bacteria 1803
164 Ga0075369_10171134 3300006186 Bacteria 997
165 Ga0075366_10201274 3300006195 Bacteria 1211
166 Ga0097621_100196143 3300006237 Bacteria 1751
167 Ga0075370_10496315 3300006353 Bacteria 736
168 Ga0068871_100127534 3300006358 Bacteria 2155
169 Ga0075428_100065917 3300006844 Bacteria 3966
170 Ga0075428_100114252 3300006844 Bacteria 2941
171 Ga0075433_10693992 3300006852 Bacteria 892
172 Ga0075434_100067371 3300006871 Bacteria 3566
173 Ga0068865_100233609 3300006881 Bacteria 1444
174 Ga0068865_100683196 3300006881 Bacteria 875
175 Ga0097620_100887888 3300006931 Bacteria 976
176 Ga0097620_100996251 3300006931 Bacteria 920
177 Ga0105250_10059349 3300009092 Bacteria 1536
178 Ga0105250_10073381 3300009092 Bacteria 1384
179 Ga0105240_10038716 3300009093 Bacteria 6114
180 Ga0111539_10100424 3300009094 Bacteria 3398
181 Ga0111539_10433427 3300009094 Bacteria 1531
182 Ga0111539_12140220 3300009094 Bacteria 649
183 Ga0105245_10031330 3300009098 Bacteria 4705
184 Ga0105245_10315793 3300009098 Bacteria 1538
185 Ga0105247_10076877 3300009101 Bacteria 2097
186 Ga0105247_10187933 3300009101 Bacteria 1382
187 Ga0105247_10208359 3300009101 Bacteria 1317
188 Ga0114129_10085849 3300009147 Bacteria 4366
189 Ga0105243_10175945 3300009148 Bacteria 1857
190 Ga0105243_10843399 3300009148 Bacteria 907
191 Ga0105243_11053881 3300009148 Bacteria 819
192 Ga0105242_10108112 3300009176 Bacteria 2366
193 Ga0105242_10215584 3300009176 Bacteria 1713
194 Ga0105242_12535964 3300009176 Bacteria 561
195 Ga0105248_10118433 3300009177 Bacteria 2987
196 Ga0105248_10478290 3300009177 Bacteria 1404
197 Ga0105248_10626435 3300009177 Bacteria 1214
198 Ga0105248_11110761 3300009177 Bacteria 894
199 Ga0105248_11598787 3300009177 Bacteria 738
200 Ga0105237_10002239 3300009545 Bacteria 24152
201 Ga0105237_10080273 3300009545 Bacteria 3252
202 Ga0105237_10204224 3300009545 Bacteria 1976
203 Ga0105237_11061428 3300009545 Bacteria 817
204 Ga0105238_10054766 3300009551 Bacteria 4005
205 Ga0105238_10142623 3300009551 Bacteria 2372
206 Ga0105238_10554074 3300009551 Bacteria 1154
207 Ga0105238_10808944 3300009551 Bacteria 953
208 Ga0099796_10070297 3300010159 Bacteria 1262
209 Ga0105239_10015382 3300010375 Bacteria 8477
210 Ga0105239_10053264 3300010375 Bacteria 4438
211 Ga0105239_10070875 3300010375 Bacteria 3829
212 Ga0105239_10095982 3300010375 Bacteria 3275
213 Ga0105239_10717274 3300010375 Bacteria 1144
214 Ga0105239_11389049 3300010375 Bacteria 811
215 Ga0105246_10011321 3300011119 Bacteria 5536
216 Ga0105246_10475482 3300011119 Bacteria 1056
217 Ga0157370_10215983 3300013104 Bacteria 1777
218 Ga0157370_10316608 3300013104 Bacteria 1440
219 Ga0157369_10010134 3300013105 Bacteria 10756
220 Ga0157369_10012483 3300013105 Bacteria 9638
221 Ga0157369_11074110 3300013105 Bacteria 823
222 Ga0157374_10197400 3300013296 Bacteria 1969
223 Ga0157374_10254788 3300013296 Bacteria 1727
224 Ga0157374_10996916 3300013296 Bacteria 857
225 Ga0157374_11257552 3300013296 Bacteria 762
226 Ga0157378_10009924 3300013297 Bacteria 8300
227 Ga0157378_10092354 3300013297 Bacteria 2754
228 Ga0157378_10323074 3300013297 Bacteria 1500
229 Ga0163162_10087246 3300013306 Bacteria 3199
230 Ga0163162_10151024 3300013306 Bacteria 2441
231 Ga0163162_10409890 3300013306 Bacteria 1488
232 Ga0163162_10467021 3300013306 Bacteria 1393
233 Ga0163162_10500398 3300013306 Bacteria 1346
234 Ga0157372_10040112 3300013307 Bacteria 5169
235 Ga0157372_10685633 3300013307 Bacteria 1193
236 Ga0157375_10207380 3300013308 Bacteria 2117
237 Ga0157375_10229597 3300013308 Bacteria 2015
238 Ga0157375_10303746 3300013308 Bacteria 1759
239 Ga0157375_10461069 3300013308 Bacteria 1436
240 Ga0157375_10825504 3300013308 Bacteria 1075
241 Ga0157375_11338128 3300013308 Bacteria 843
242 Ga0163163_10005218 3300014325 Bacteria 11206
243 Ga0163163_10320542 3300014325 Bacteria 1603
244 Ga0163163_10400488 3300014325 Bacteria 1431
245 Ga0163163_10948120 3300014325 Bacteria 924
246 Ga0163163_12290552 3300014325 Bacteria 599
247 Ga0157380_11362017 3300014326 Bacteria 759
248 Ga0157380_11510137 3300014326 Bacteria 725
249 Ga0157379_10482118 3300014968 Bacteria 1148
250 Ga0157379_10713027 3300014968 Bacteria 942
251 Ga0157376_10004919 3300014969 Bacteria 9313
252 Ga0157376_11240303 3300014969 Bacteria 774
253 Ga0182006_1182580 3300015261 Bacteria 699
254 Ga0163161_10061568 3300017792 Bacteria 2732
255 Ga0214544_1000002 3300021320 Bacteria 753857
256 Ga0214542_1000001 3300021321 Bacteria 1018696
257 Ga0214545_1000001 3300021324 Bacteria 1092817
258 Ga0214545_1035778 3300021324 Bacteria 1619
259 Ga0214543_1000001 3300021327 Bacteria 776921
260 Ga0213873_10028727 3300021358 Bacteria 1366
261 Ga0213876_10002470 3300021384 Bacteria 10852
262 Ga0207673_1018247 3300025290 Bacteria 939
263 Ga0209758_1001025 3300025297 Bacteria 36697
264 Ga0207697_10031735 3300025315 Bacteria 2160
265 Ga0207697_10208722 3300025315 Bacteria 860
266 Ga0207682_10131823 3300025893 Bacteria 1116
267 Ga0207642_10051644 3300025899 Bacteria 1861
268 Ga0207710_10324834 3300025900 Bacteria 781
269 Ga0207688_10695000 3300025901 Bacteria 643
270 Ga0207680_10463946 3300025903 Bacteria 900
271 Ga0207645_10121693 3300025907 Bacteria 1694
272 Ga0207645_10202577 3300025907 Bacteria 1306
273 Ga0207645_10284791 3300025907 Bacteria 1098
274 Ga0207643_10137059 3300025908 Bacteria 1460
275 Ga0207643_10533787 3300025908 Bacteria 752
276 Ga0207705_10409394 3300025909 Bacteria 1049
277 Ga0207684_10251257 3300025910 Bacteria 1526
278 Ga0207654_10088179 3300025911 Bacteria 1885
279 Ga0207654_10553657 3300025911 Bacteria 817
280 Ga0207707_10125345 3300025912 Bacteria 2246
281 Ga0207695_10009431 3300025913 Bacteria 12072
282 Ga0207671_10243666 3300025914 Bacteria 1412
283 Ga0207671_10819340 3300025914 Bacteria 738
284 Ga0207693_10089167 3300025915 Bacteria 2417
285 Ga0207693_10195062 3300025915 Bacteria 1593
286 Ga0207693_10570215 3300025915 Bacteria 882
287 Ga0207660_10091846 3300025917 Bacteria 2252
288 Ga0207660_10582441 3300025917 Bacteria 911
289 Ga0207660_10808688 3300025917 Bacteria 765
290 Ga0207660_11413272 3300025917 Bacteria 564
291 Ga0207657_10000784 3300025919 Bacteria 33773
292 Ga0207657_10297522 3300025919 Bacteria 1279
293 Ga0207657_10301990 3300025919 Bacteria 1268
294 Ga0207649_10068978 3300025920 Bacteria 2250
295 Ga0207649_10630891 3300025920 Bacteria 826
296 Ga0207649_10658761 3300025920 Bacteria 809
297 Ga0207652_10026574 3300025921 Bacteria 4824
298 Ga0207652_10608749 3300025921 Bacteria 979
299 Ga0207646_10081518 3300025922 Bacteria 2893
300 Ga0207681_10319895 3300025923 Bacteria 1233
301 Ga0207694_10038951 3300025924 Bacteria 3656
302 Ga0207694_10201996 3300025924 Bacteria 1617
303 Ga0207694_10529359 3300025924 Bacteria 988
304 Ga0207650_10163067 3300025925 Bacteria 1767
305 Ga0207659_10365366 3300025926 Bacteria 1200
306 Ga0207659_11031694 3300025926 Bacteria 708
307 Ga0207687_10025922 3300025927 Bacteria 3924
308 Ga0207687_10760096 3300025927 Bacteria 825
309 Ga0207700_10120677 3300025928 Bacteria 2125
310 Ga0207700_10778581 3300025928 Bacteria 855
311 Ga0207664_10096819 3300025929 Bacteria 2430
312 Ga0207664_10202353 3300025929 Bacteria 1715
313 Ga0207706_10047791 3300025933 Bacteria 3786
314 Ga0207706_10148397 3300025933 Bacteria 2063
315 Ga0207706_10290648 3300025933 Bacteria 1425
316 Ga0207686_10258183 3300025934 Bacteria 1276
317 Ga0207709_10066147 3300025935 Bacteria 2276
318 Ga0207709_10529271 3300025935 Bacteria 924
319 Ga0207670_10344002 3300025936 Bacteria 1179
320 Ga0207670_10382852 3300025936 Bacteria 1121
321 Ga0207670_10758334 3300025936 Bacteria 806
322 Ga0207669_10018683 3300025937 Bacteria 3590
323 Ga0207669_10045638 3300025937 Bacteria 2583
324 Ga0207669_10757738 3300025937 Bacteria 802
325 Ga0207704_11082732 3300025938 Bacteria 680
326 Ga0207665_10078163 3300025939 Bacteria 2272
327 Ga0207665_10227420 3300025939 Bacteria 1370
328 Ga0207665_10236017 3300025939 Bacteria 1346
329 Ga0207665_10402270 3300025939 Bacteria 1043
330 Ga0207691_10048908 3300025940 Bacteria 3875
331 Ga0207691_10198496 3300025940 Bacteria 1747
332 Ga0207711_10019599 3300025941 Bacteria 5631
333 Ga0207689_10055708 3300025942 Bacteria 3254
334 Ga0207689_10460497 3300025942 Bacteria 1063
335 Ga0207689_10811391 3300025942 Bacteria 790
336 Ga0207661_10542790 3300025944 Bacteria 1065
337 Ga0207661_10871750 3300025944 Bacteria 829
338 Ga0207679_10028273 3300025945 Bacteria 3888
339 Ga0207679_10090770 3300025945 Bacteria 2362
340 Ga0207679_10760842 3300025945 Bacteria 881
341 Ga0207667_10039055 3300025949 Bacteria 5061
342 Ga0207667_10789181 3300025949 Bacteria 947
343 Ga0207667_11177075 3300025949 Bacteria 747
344 Ga0207712_10360816 3300025961 Bacteria 1211
345 Ga0207712_11570297 3300025961 Bacteria 590
346 Ga0207668_10115858 3300025972 Bacteria 2019
347 Ga0207668_10187657 3300025972 Bacteria 1636
348 Ga0207668_10313965 3300025972 Bacteria 1298
349 Ga0207668_10853379 3300025972 Bacteria 808
350 Ga0207668_11552542 3300025972 Bacteria 597
351 Ga0207640_10406556 3300025981 Bacteria 1110
352 Ga0207640_10865050 3300025981 Bacteria 787
353 Ga0207658_11249175 3300025986 Bacteria 679
354 Ga0207677_10076948 3300026023 Bacteria 2377
355 Ga0207677_10136957 3300026023 Bacteria 1868
356 Ga0207677_10187195 3300026023 Bacteria 1634
357 Ga0207677_10235816 3300026023 Bacteria 1477
358 Ga0207677_10719309 3300026023 Bacteria 887
359 Ga0207677_11880770 3300026023 Bacteria 556
360 Ga0207703_10131454 3300026035 Bacteria 2162
361 Ga0207703_10179271 3300026035 Bacteria 1869
362 Ga0207703_10317296 3300026035 Bacteria 1426
363 Ga0207639_10605090 3300026041 Bacteria 1011
364 Ga0207639_10781981 3300026041 Bacteria 889
365 Ga0207678_10037212 3300026067 Bacteria 4234
366 Ga0207678_10153356 3300026067 Bacteria 1967
367 Ga0207678_10220356 3300026067 Bacteria 1624
368 Ga0207678_10274850 3300026067 Bacteria 1445
369 Ga0207678_10280298 3300026067 Bacteria 1430
370 Ga0207678_10433812 3300026067 Bacteria 1140
371 Ga0207708_10488576 3300026075 Bacteria 1030
372 Ga0207708_10581060 3300026075 Bacteria 947
373 Ga0207641_10018331 3300026088 Bacteria 5738
374 Ga0207641_10098286 3300026088 Bacteria 2574
375 Ga0207641_10225237 3300026088 Bacteria 1741
376 Ga0207641_11301072 3300026088 Bacteria 727
377 Ga0207648_10025820 3300026089 Bacteria 5227
378 Ga0207648_10477439 3300026089 Bacteria 1138
379 Ga0207676_10094773 3300026095 Bacteria 2460
380 Ga0207676_10545106 3300026095 Bacteria 1107
381 Ga0207676_11888177 3300026095 Bacteria 596
382 Ga0207674_10215991 3300026116 Bacteria 1866
383 Ga0207675_100035028 3300026118 Bacteria 4681
384 Ga0207675_100041238 3300026118 Bacteria 4311
385 Ga0207675_100264237 3300026118 Bacteria 1668
386 Ga0207675_101924525 3300026118 Bacteria 610
387 Ga0207683_10050062 3300026121 Bacteria 3659
388 Ga0207683_10087234 3300026121 Bacteria 2775
389 Ga0207683_10420463 3300026121 Bacteria 1231
390 Ga0207683_10426560 3300026121 Bacteria 1222
391 Ga0207683_10573586 3300026121 Bacteria 1044
392 Ga0207698_10331680 3300026142 Bacteria 1429
393 Ga0207698_10371445 3300026142 Bacteria 1358
394 Ga0209813_10176274 3300027866 Bacteria 779
395 Ga0207428_10321642 3300027907 Bacteria 1142
396 Ga0268266_10001919 3300028379 Bacteria 23365
397 Ga0268266_10002779 3300028379 Bacteria 18266
398 Ga0268266_10104118 3300028379 Bacteria 2505
399 Ga0268266_10702727 3300028379 Bacteria 974
400 Ga0268266_10725901 3300028379 Bacteria 958
401 Ga0268265_10317916 3300028380 Bacteria 1408
402 Ga0268265_10624867 3300028380 Bacteria 1032
403 Ga0268265_11561698 3300028380 Bacteria 664
404 Ga0268264_10000043 3300028381 Bacteria 371761
405 Ga0268264_10033691 3300028381 Bacteria 4211
406 Ga0268264_10154443 3300028381 Bacteria 2061
407 Ga0265336_10035778 3300028666 Bacteria 1531
408 Ga0307517_10000063 3300028786 Bacteria 144304
409 Ga0307515_10534978 3300028794 Bacteria 781
410 Ga0265338_10061068 3300028800 Bacteria 3305
411 Ga0307511_10209660 3300030521 Bacteria 997
412 Ga0265330_10009689 3300031235 Bacteria 4566
413 Ga0265325_10011986 3300031241 Bacteria 4967
414 Ga0265340_10003402 3300031247 Bacteria 8987
415 Ga0265340_10125666 3300031247 Bacteria 1178
416 Ga0265339_10067376 3300031249 Bacteria 1914
417 Ga0307408_101280852 3300031548 Bacteria 686
418 Ga0307508_10000010 3300031616 Bacteria 255747
419 Ga0307508_10014670 3300031616 Bacteria 7147
420 Ga0307508_10414776 3300031616 Bacteria 938
421 Ga0307508_10457603 3300031616 Bacteria 869
422 Ga0307508_10525031 3300031616 Bacteria 780
423 Ga0265342_10056727 3300031712 Bacteria 2320
424 Ga0265342_10119181 3300031712 Bacteria 1487
425 Ga0307516_10222002 3300031730 Bacteria 1598
426 Ga0307405_11746251 3300031731 Bacteria 552
427 Ga0307413_10100977 3300031824 Bacteria 1906
428 Ga0307413_10111460 3300031824 Bacteria 1832
429 Ga0307410_10251121 3300031852 Bacteria 1375
430 Ga0307407_10255048 3300031903 Bacteria 1204
431 Ga0307412_10471370 3300031911 Bacteria 1039
432 Ga0307416_100397663 3300032002 Bacteria 1414
433 Ga0307416_100595776 3300032002 Bacteria 1184
434 Ga0307414_10778866 3300032004 Bacteria 871
435 Ga0307411_10116011 3300032005 Bacteria 1927
436 Ga0307510_10229266 3300033180 Bacteria 1361
437 Ga0373930_0092602 3300034816 Bacteria 710
438 Ga0373959_0044885 3300034820 Bacteria 939
439 Ga0373929_0010642 3300035085 Bacteria 1723
440 Ga0373934_0041894 3300035086 Bacteria 1808
441 Ga0373940_0030764 3300035088 Bacteria 1430
442 Ga0373944_0223338 3300035089 Bacteria 688
443 Ga0373949_0139366 3300035090 Bacteria 694
444 Ga0373952_0004283 3300035092 Bacteria 2583
445 Ga0373923_0022342 3300035111 Bacteria 2480
446 Ga0373932_0346984 3300035112 Bacteria 564
447 Ga0373936_0097700 3300035113 Bacteria 1237
448 Ga0373941_0086059 3300035115 Bacteria 1070
449 Ga0373941_0338866 3300035115 Bacteria 609
450 Ga0373943_0037733 3300035170 Bacteria 2320
451 Ga0373943_0382959 3300035170 Bacteria 810
452 Ga0373955_0060689 3300035172 Bacteria 2086
453 Ga0373924_0020261 3300035410 Bacteria 2583
454 Ga0373931_0009393 3300035691 Bacteria 4675
455 Ga0373935_0004357 3300035692 Bacteria 8307
456 Ga0373935_0008594 3300035692 Bacteria 6110
457 Ga0373935_0115339 3300035692 Bacteria 1788
458 Ga0373927_0002258 3300035695 Bacteria 14120
459 Ga0373927_0060753 3300035695 Bacteria 2445
460 Ga0373927_0116167 3300035695 Bacteria 1745
461 Ga0373927_0140502 3300035695 Bacteria 1579
462 Ga0373933_0189809 3300035724 Bacteria 1312
463 Ga0373947_0002634 3300035725 Bacteria 10777
464 Ga0373947_0023496 3300035725 Bacteria 3587
465 Ga0373947_0068387 3300035725 Bacteria 2172
466 Ga0373947_0244070 3300035725 Bacteria 1186
467 Ga0373937_0122685 3300036401 Bacteria 2422
468 Ga0373937_0155295 3300036401 Bacteria 2144
469 Ga0373937_0619546 3300036401 Bacteria 1027
470 Ga0373925_0008340 3300037068 Bacteria 7544
471 Ga0373925_0548134 3300037068 Bacteria 951
472 Ga0373925_0548920 3300037068 Bacteria 950
473 Ga0395899_0139395 3300037312 Bacteria 1727
474 Ga0395898_0051661 3300037466 Bacteria 4019
475 Ga0436364_0975533 3300037853 Bacteria 2416
476 Ga0395901_0837210 3300038443 Bacteria 906
477 Ga0436365_0163014 3300039437 Bacteria 2402
478 Ga0436365_0508090 3300039437 Bacteria 5532
479 Ga0436365_0589211 3300039437 Bacteria 844
480 Ga0436365_1190006 3300039437 Bacteria 14387
481 Ga0436360_0226663 3300039438 Bacteria 590
482 Ga0436360_1352026 3300039438 Bacteria 609
483 Ga0436363_0850716 3300039450 Bacteria 1137
484 Ga0436362_1192450 3300039453 Bacteria 7407
485 Ga0451797_1020677 3300041453 Bacteria 847
486 Ga0451795_0541422 3300041456 Bacteria 978
487 Ga0451807_2622904 3300041486 Bacteria 1312
488 Ga0451839_1163861 3300041496 Bacteria 766
489 Ga0451845_0217232 3300041501 Bacteria 869
490 Ga0451853_1762699 3300041512 Bacteria 1174
491 Ga0451853_2570889 3300041512 Bacteria 671
492 Ga0439431_0050249 3300041997 Bacteria 1080
493 Ga0439434_0210318 3300042435 Bacteria 658
494 Ga0466971_0012320 3300044719 Bacteria 3746
495 Ga0466970_0123467 3300044765 Bacteria 1419
496 Ga0466957_0207749 3300044842 Bacteria 1288
497 Ga0466959_0064221 3300045049 Bacteria 2665
498 Ga0466958_0111995 3300045836 Bacteria 1704
499 Ga0466958_0164205 3300045836 Bacteria 1404
500 Ga0495592_0157706 3300046454 Bacteria 1564
501 Ga0495592_0159799 3300046454 Bacteria 1551
502 Ga0495592_0834286 3300046454 Bacteria 546
503 Ga0495603_0000676 3300046455 Bacteria 19328
504 Ga0495603_0265566 3300046455 Bacteria 987
505 Ga0495591_069584 3300046458 Bacteria 917
506 Ga0495629_0231277 3300046459 Bacteria 1274
507 Ga0495629_0231914 3300046459 Bacteria 1272
508 Ga0495629_0327051 3300046459 Bacteria 1047
509 Ga0495629_0707476 3300046459 Bacteria 669
510 Ga0495641_0005779 3300046461 Bacteria 8216
511 Ga0495641_0059296 3300046461 Bacteria 1730
512 Ga0495651_0114580 3300046462 Bacteria 1989
513 Ga0495580_0951641 3300046472 Bacteria 550
514 Ga0495582_0000177 3300046473 Bacteria 34588
515 Ga0495582_0064536 3300046473 Bacteria 2022
516 Ga0495639_0156346 3300046475 Bacteria 1102
517 Ga0495639_0171384 3300046475 Bacteria 1053
518 Ga0495662_0000028 3300046476 Bacteria 51556
519 Ga0495664_0013279 3300046477 Bacteria 4671
520 Ga0495664_0406649 3300046477 Bacteria 817
521 Ga0495584_0032145 3300046491 Bacteria 2657
522 Ga0495585_0140898 3300046492 Bacteria 1263
523 Ga0495585_0170754 3300046492 Bacteria 1123
524 Ga0495594_0000020 3300046499 Bacteria 80534
525 Ga0495606_0004986 3300046507 Bacteria 12946
526 Ga0495606_0564624 3300046507 Bacteria 564
527 Ga0495608_0220879 3300046511 Bacteria 1189
528 Ga0495610_0048384 3300046512 Bacteria 2087
529 Ga0495616_0189004 3300046513 Bacteria 911
530 Ga0495618_0731070 3300046514 Bacteria 580
531 Ga0495630_0003026 3300046517 Bacteria 11659
532 Ga0495630_0028188 3300046517 Bacteria 4172
533 Ga0495630_0455892 3300046517 Bacteria 980
534 Ga0495637_0197147 3300046520 Bacteria 741
535 Ga0495637_0235144 3300046520 Bacteria 663
536 Ga0495644_0049011 3300046523 Bacteria 1586
537 Ga0495644_0247130 3300046523 Bacteria 692
538 Ga0495648_0095800 3300046524 Bacteria 1650
539 Ga0495666_0081834 3300046526 Bacteria 1527
540 Ga0495652_0036711 3300046529 Bacteria 4258
541 Ga0495652_0906265 3300046529 Bacteria 581
542 Ga0495665_0000057 3300046531 Bacteria 44876
543 Ga0495665_0495319 3300046531 Bacteria 616
544 Ga0495640_0009965 3300046533 Bacteria 7367
545 Ga0495640_0022817 3300046533 Bacteria 4570
546 Ga0495640_0072851 3300046533 Bacteria 2300
547 Ga0495587_0584005 3300046536 Bacteria 616
548 Ga0495621_0198836 3300046539 Bacteria 806
549 Ga0495597_0145441 3300046542 Bacteria 975
550 Ga0495597_0221203 3300046542 Bacteria 752
551 Ga0495622_0003396 3300046557 Bacteria 7510
552 Ga0495622_0146398 3300046557 Bacteria 1070
553 Ga0495667_0219763 3300046559 Bacteria 1213
554 Ga0495656_0100701 3300046615 Bacteria 1336
555 Ga0495668_0320896 3300046616 Bacteria 849
556 Ga0495634_0000324 3300046642 Bacteria 46211
557 Ga0495634_0014597 3300046642 Bacteria 5660
558 Ga0495634_0239917 3300046642 Bacteria 1112
559 Ga0495611_0109511 3300046648 Bacteria 1285
560 Ga0495625_0059002 3300046660 Bacteria 2724
561 Ga0495635_0000496 3300046663 Bacteria 24850
562 Ga0495635_0838383 3300046663 Bacteria 591
563 Ga0495588_0003434 3300046674 Bacteria 6887
564 Ga0495646_0103828 3300046680 Bacteria 1626
565 Ga0495646_0159192 3300046680 Bacteria 1251
566 Ga0495647_0183690 3300046681 Bacteria 911
567 Ga0495658_0007012 3300046683 Bacteria 5558
568 Ga0495658_0277471 3300046683 Bacteria 1057
569 Ga0495669_0010274 3300046684 Bacteria 3955
570 Ga0495613_0004688 3300046689 Bacteria 10257
571 Ga0495624_0252414 3300046690 Bacteria 1067
572 Ga0495671_0108683 3300046692 Bacteria 1354
573 Ga0495649_0106711 3300046694 Bacteria 1486
574 Ga0495589_0137655 3300046794 Bacteria 1170
575 Ga0495581_0006881 3300047315 Bacteria 6593
576 Ga0495604_0333125 3300047317 Bacteria 1012
577 Ga0495604_0479750 3300047317 Bacteria 809
578 Ga0495674_0024210 3300047319 Bacteria 5583
579 Ga0495674_0145108 3300047319 Bacteria 1993
580 Ga0495672_0009800 3300047320 Bacteria 6895
581 Ga0495676_0063040 3300047321 Bacteria 2891
582 Ga0495676_0137424 3300047321 Bacteria 1756
583 Ga0495675_0446468 3300047444 Bacteria 749
584 Ga0495677_0029189 3300047445 Bacteria 2005
585 Ga0495685_034944 3300047447 Bacteria 1727
586 Ga0495673_0164432 3300047469 Bacteria 850
587 Ga0495673_0183702 3300047469 Bacteria 790
588 Ga0495684_0020958 3300047471 Bacteria 5035
589 Ga0495686_0063144 3300047472 Bacteria 2296
590 Ga0495686_0068038 3300047472 Bacteria 2197
591 Ga0495593_0067263 3300047673 Bacteria 1865
592 Ga0495615_0020027 3300048090 Bacteria 1494
593 Ga0496100_0006178 3300048903 Bacteria 6514
594 Ga0496100_0035526 3300048903 Bacteria 3135
595 Ga0496100_0048766 3300048903 Bacteria 2735
596 Ga0496100_0132185 3300048903 Bacteria 1759
597 Ga0496100_1302928 3300048903 Bacteria 573
598 Ga0496101_0007887 3300048904 Bacteria 6930
599 Ga0496101_0014276 3300048904 Bacteria 5335
600 Ga0496101_0106766 3300048904 Bacteria 2103
601 Ga0496101_0180558 3300048904 Bacteria 1625
602 Ga0496101_0187689 3300048904 Bacteria 1594
603 Ga0496101_0222186 3300048904 Bacteria 1466
604 Ga0496101_0549085 3300048904 Bacteria 913
605 Ga0496102_0005734 3300048905 Bacteria 10553
606 Ga0496102_0048507 3300048905 Bacteria 3861
607 Ga0496102_0064455 3300048905 Bacteria 3356
608 Ga0496102_0068279 3300048905 Bacteria 3261
609 Ga0496102_0114709 3300048905 Bacteria 2513
610 Ga0496102_0186056 3300048905 Bacteria 1957
611 Ga0496102_0261712 3300048905 Bacteria 1631
612 Ga0496102_0316218 3300048905 Bacteria 1471
613 Ga0496102_0357950 3300048905 Bacteria 1374
614 Ga0496102_1051141 3300048905 Bacteria 734
615 Ga0496102_1341029 3300048905 Bacteria 634
616 Ga0496103_0023313 3300048906 Bacteria 3732
617 Ga0496103_0035178 3300048906 Bacteria 3066
618 Ga0496103_0058756 3300048906 Bacteria 2389
619 Ga0496103_0188693 3300048906 Bacteria 1325
620 Ga0496104_0007944 3300048907 Bacteria 9407
621 Ga0496104_0017208 3300048907 Bacteria 6577
622 Ga0496104_0138922 3300048907 Bacteria 2335
623 Ga0496104_0150175 3300048907 Bacteria 2237
624 Ga0496104_0634850 3300048907 Bacteria 977
625 Ga0496105_0045859 3300048908 Bacteria 3606
626 Ga0496105_0190761 3300048908 Bacteria 1675
627 Ga0496105_0330913 3300048908 Bacteria 1219
628 Ga0496105_0418700 3300048908 Bacteria 1061
629 Ga0496106_0001783 3300048909 Bacteria 16071
630 Ga0496106_0007982 3300048909 Bacteria 7822
631 Ga0496106_0070834 3300048909 Bacteria 2663
632 Ga0496106_0098878 3300048909 Bacteria 2261
633 Ga0496106_0153155 3300048909 Bacteria 1819
634 Ga0496106_0341996 3300048909 Bacteria 1202
635 Ga0496106_0474117 3300048909 Bacteria 1005
636 Ga0496107_0001739 3300048910 Bacteria 13695
637 Ga0496107_0048126 3300048910 Bacteria 3071
638 Ga0496107_0053497 3300048910 Bacteria 2912
639 Ga0496107_0053815 3300048910 Bacteria 2903
640 Ga0496107_0155167 3300048910 Bacteria 1695
641 Ga0496107_0786694 3300048910 Bacteria 697
642 Ga0496108_0052299 3300048911 Bacteria 3422
643 Ga0496108_0119792 3300048911 Bacteria 2256
644 Ga0496108_0245547 3300048911 Bacteria 1557
645 Ga0496108_0318428 3300048911 Bacteria 1356
646 Ga0496108_0526989 3300048911 Bacteria 1031
647 Ga0496108_0616597 3300048911 Bacteria 945
648 Ga0496108_1397905 3300048911 Bacteria 585
649 Ga0496109_0007958 3300048912 Bacteria 8985
650 Ga0496109_0011937 3300048912 Bacteria 7481
651 Ga0496109_0110862 3300048912 Bacteria 2551
652 Ga0496109_0157225 3300048912 Bacteria 2129
653 Ga0496109_0566321 3300048912 Bacteria 1071
654 Ga0496110_0004242 3300048913 Bacteria 11090
655 Ga0496110_0023887 3300048913 Bacteria 5204
656 Ga0496110_0046547 3300048913 Bacteria 3795
657 Ga0496110_0754565 3300048913 Bacteria 876
658 Ga0496111_0012624 3300048914 Bacteria 5723
659 Ga0496111_0036020 3300048914 Bacteria 3538
660 Ga0496111_0158281 3300048914 Bacteria 1681
661 Ga0496111_0999666 3300048914 Bacteria 599
662 Ga0496112_0000031 3300048915 Bacteria 120022
663 Ga0496112_0056939 3300048915 Bacteria 3848
664 Ga0496112_0238744 3300048915 Bacteria 1771
665 Ga0496113_0007392 3300048916 Bacteria 7064
666 Ga0496113_0022172 3300048916 Bacteria 4487
667 Ga0496113_0507440 3300048916 Bacteria 968
668 Ga0496113_0591531 3300048916 Bacteria 889
669 Ga0496114_0005673 3300048917 Bacteria 9791
670 Ga0496114_0022987 3300048917 Bacteria 5082
671 Ga0496114_0030943 3300048917 Bacteria 4403
672 Ga0496114_0076768 3300048917 Bacteria 2815
673 Ga0496114_0198371 3300048917 Bacteria 1757
674 Ga0496114_0281477 3300048917 Bacteria 1466
675 Ga0496114_1420093 3300048917 Bacteria 581
676 Ga0496115_0002452 3300048918 Bacteria 13321
677 Ga0496115_0023593 3300048918 Bacteria 4775
678 Ga0496115_0035163 3300048918 Bacteria 3963
679 Ga0496115_0040280 3300048918 Bacteria 3713
680 Ga0496115_0120774 3300048918 Bacteria 2156
681 Ga0496115_0444004 3300048918 Bacteria 1049
682 Ga0496115_0620904 3300048918 Bacteria 857
683 Ga0496115_0784234 3300048918 Bacteria 743
684 Ga0496117_0057783 3300048920 Bacteria 2691
685 Ga0496118_0001507 3300048921 Bacteria 34698
686 Ga0496119_0057524 3300048922 Bacteria 2349
687 Ga0496120_0136792 3300048923 Bacteria 1248
688 Ga0496121_0000183 3300048924 Bacteria 139168
689 Ga0496121_0000407 3300048924 Bacteria 85728
690 Ga0496121_0065910 3300048924 Bacteria 2943
691 Ga0496121_0082002 3300048924 Bacteria 2551
692 Ga0496121_0104964 3300048924 Bacteria 2169
693 Ga0496121_0272041 3300048924 Bacteria 1164
694 Ga0496124_0003899 3300048927 Bacteria 17843
695 Ga0496124_0365264 3300048927 Bacteria 1015
696 Ga0496125_0037479 3300048928 Bacteria 4215
697 Ga0496125_0091046 3300048928 Bacteria 2286
698 Ga0496126_0016402 3300048929 Bacteria 7409
699 Ga0496126_0026742 3300048929 Bacteria 5525
700 Ga0496126_0354945 3300048929 Bacteria 1198
701 Ga0496126_0453923 3300048929 Bacteria 1031
702 Ga0501034_0275584 3300049571 Bacteria 1622
703 Ga0501037_0145545 3300049573 Bacteria 1695
704 Ga0501042_0045953 3300049578 Bacteria 3112
705 Ga0501042_0288253 3300049578 Bacteria 1186
706 Ga0501046_0333426 3300049580 Bacteria 1104
707 Ga0501047_0115889 3300049581 Bacteria 2561
708 Ga0501047_0191056 3300049581 Bacteria 1911
709 Ga0501047_0247540 3300049581 Bacteria 1632
710 Ga0501069_0038412 3300049585 Bacteria 2643
711 Ga0501069_0058291 3300049585 Bacteria 2153
712 Ga0501070_0002951 3300049586 Bacteria 14812
713 Ga0501070_0244522 3300049586 Bacteria 1468
714 Ga0501071_0206781 3300049587 Bacteria 1475
715 Ga0501074_0180529 3300049590 Bacteria 1506
716 Ga0501079_0779087 3300049741 Bacteria 753
717 Ga0501080_0101140 3300049742 Bacteria 2674
718 Ga0501080_0448605 3300049742 Bacteria 1157
719 Ga0501083_0021975 3300049744 Bacteria 4430
720 Ga0501035_0055687 3300049822 Bacteria 3530
721 Ga0501035_0215511 3300049822 Bacteria 1641
722 Ga0501044_0189635 3300049823 Bacteria 2019
723 Ga0501044_0196804 3300049823 Bacteria 1975
724 Ga0501044_0557344 3300049823 Bacteria 1043
725 nmdc:mga03683_146506_c1 3300050489 Bacteria 1064
726 nmdc:mga03n38_518827_c1 3300050490 Bacteria 671
727 nmdc:mga00v17_251907_c1 3300050491 Bacteria 1145
728 nmdc:mga0yw44_363671_c1 3300050492 Bacteria 975
729 nmdc:mga0yw44_55241_c1 3300050492 Bacteria 2416
730 nmdc:mga0yw44_612562_c1 3300050492 Bacteria 740
731 nmdc:mga06z11_359328_c1 3300050494 Bacteria 873
732 nmdc:mga04h51_132514_c1 3300050495 Bacteria 939
733 nmdc:mga04h51_139952_c1 3300050495 Bacteria 917
734 nmdc:mga04h51_20146_c1 3300050495 Bacteria 1987
735 nmdc:mga07m45_119977_c1 3300050496 Bacteria 1519
736 nmdc:mga07m45_2740_c2 3300050496 Bacteria 5767
737 nmdc:mga07m45_348724_c1 3300050496 Bacteria 860
738 nmdc:mga05p37_307378_c1 3300050507 Bacteria 1881
739 nmdc:mga0qj67_41_c1 3300050509 Bacteria 89688
740 nmdc:mga08y16_187301_c1 3300050511 Bacteria 2147
741 nmdc:mga08y16_383261_c1 3300050511 Bacteria 1441
742 nmdc:mga08y16_423734_c1 3300050511 Bacteria 1360
743 nmdc:mga0sz30_119450_c1 3300050516 Bacteria 1158
744 nmdc:mga0sz30_246287_c1 3300050516 Bacteria 796
745 Ga0495601_0073827 3300053077 Bacteria 2182
746 Ga0495601_0139795 3300053077 Bacteria 1579
747 Ga0495601_0468704 3300053077 Bacteria 814
748 Ga0495612_0304302 3300053078 Bacteria 715
749 Ga0495655_0120443 3300053083 Bacteria 798
750 Ga0495655_0143383 3300053083 Bacteria 745
751 Ga0495595_0143097 3300053084 Bacteria 1174
752 Ga0495595_0173613 3300053084 Bacteria 1067
753 Ga0495619_0262235 3300053085 Bacteria 1197
754 Ga0500643_063404 3300053087 Bacteria 1034
755 Ga0500644_0063885 3300053088 Bacteria 1306
756 Ga0500581_158916 3300053089 Bacteria 1052
757 Ga0500646_0176548 3300053090 Bacteria 721
758 Ga0500646_0178462 3300053090 Bacteria 718
759 Ga0500651_0225852 3300053093 Bacteria 1096
760 Ga0500651_0487626 3300053093 Bacteria 681
761 Ga0500566_0281515 3300053094 Bacteria 792
762 Ga0500641_0022271 3300053096 Bacteria 2424
763 Ga0500641_0073066 3300053096 Bacteria 1446
764 Ga0500554_005156 3300053102 Bacteria 2824
765 Ga0500569_060966 3300053109 Bacteria 1164
766 Ga0500595_000844 3300053119 Bacteria 17484
767 Ga0500595_003905 3300053119 Bacteria 6839
768 Ga0500597_144648 3300053120 Bacteria 1023
769 Ga0500642_0145471 3300053130 Bacteria 1112
770 Ga0500652_000042 3300053131 Bacteria 67099
771 Ga0500568_0025777 3300053139 Bacteria 2475
772 Ga0500579_128041 3300053143 Bacteria 1200
773 Ga0500588_0083825 3300053146 Bacteria 1071
774 Ga0500589_039873 3300053147 Bacteria 2192
775 Ga0500589_251038 3300053147 Bacteria 649
776 Ga0500603_106980 3300053150 Bacteria 836
777 Ga0500604_0234711 3300053151 Bacteria 634
778 Ga0500616_0086832 3300053153 Bacteria 1559
779 Ga0500622_0051434 3300053156 Bacteria 2120
780 Ga0500633_0187699 3300053160 Bacteria 774
781 Ga0500638_000727 3300053162 Bacteria 8868
782 Ga0500638_081771 3300053162 Bacteria 1533
783 Ga0500636_0174238 3300053177 Bacteria 1161
784 Ga0500637_0000104 3300053178 Bacteria 30138
785 Ga0500609_012671 3300053731 Bacteria 1140
786 Ga0500552_009830 3300053733 Bacteria 1163
787 Ga0501084_0563430 3300054114 Bacteria 963
788 Ga0500661_001650 3300055283 Bacteria 4197
789 Ga0501082_0742905 3300060353 Bacteria 859
790 Ga0466962_0064772 3300061719 Bacteria 1745
791 2508542753 2508501009 Bacteria 7784016
792 2508691488 2508501042 Bacteria 8719808
793 2513623110 2513237092 Bacteria 8341956
794 2513639039 2513237094 Bacteria 8789602
795 2513645913 2513237095 Bacteria 8976980
796 2513654668 2513237096 Bacteria 8722461
797 2513673878 2513237098 Bacteria 9902361
798 2513692452 2513237101 Bacteria 7952346
799 2513700133 2513237102 Bacteria 7703324
800 2513719519 2513237104 Bacteria 10034502
801 2513855921 2513237137 Bacteria 9558895
802 2513872698 2513237139 Bacteria 8737671
803 2513915152 2513237145 Bacteria 8979722
804 2514011924 2513237161 Bacteria 8871253
805 2515628290 2515154112 Bacteria 8294334
806 2517108329 2517093001 Bacteria 9002274
807 2517892447 2517572143 Bacteria 9484767
808 2524440501 2524023205 Bacteria 8918781
809 2524469609 2524023210 Bacteria 9029266
810 2524541147 2524023228 Bacteria 10118060
811 2528851166 2528768022 Bacteria 10457665
812 2617348944 2617270735 Bacteria 9163226
813 2617375839 2617270741 Bacteria 8201522
814 2671122444 2667528175 Bacteria 7532676
815 2723845165 2721755755 Bacteria 8322773
816 2728751492 2728368998 Bacteria 8720350
817 2745075229 2744054633 Bacteria 8678936
818 2793062467 2791355196 Bacteria 7323613
819 2793072071 2791355197 Bacteria 8420563
820 2793080914
821 2805915404 2802429603 Bacteria 8777136
822 2818238981 2816332527 Bacteria 8933356
823 2824609142 2824600985 Bacteria 8488197
824 2824617649 2824609381 Bacteria 8672835
825 2824625725 2824617872 Bacteria 8814715
826 2824634503 2824626560 Bacteria 8813858
827 2824642567 2824635225 Bacteria 8785348
828 2824650321 2824644064 Bacteria 8743947
829 2824670349 2824661429 Bacteria 9877870
830 2824678235 2824671348 Bacteria 8369588
831 2824686011 2824679649 Bacteria 8248951
832 2824694662 2824687955 Bacteria 8360029
833 2824703597 2824696289 Bacteria 8335049
834 2824720838 2824714736 Bacteria 8717648
835 2824730616 2824723954 Bacteria 8758240
836 2824739021 2824732956 Bacteria 7810675
837 2824753266 2824746037 Bacteria 7911610
838 2824772785 2824763712 Bacteria 9792355
839 2824781165 2824773399 Bacteria 8360218
840 2838123824 2838122688 Bacteria 8803140
841 2841944047 2841941048 Bacteria 8688029
842 2841949924 2841949485 Bacteria 8680857
843 2841958598 2841957949 Bacteria 8652217
844 2841966342 2841966195 Bacteria 8673214
845 2841975076 2841974524 Bacteria 8931498
846 2841983352 2841983080 Bacteria 8395090
847 2842039136 2842038055 Bacteria 8002051
848 2842047917 2842045827 Bacteria 8006841
849 2844319023 2844315083 Bacteria 8138177
850 2847936143 2847930680 Bacteria 9342022
851 2847946493 2847939898 Bacteria 8606328
852 2849079384 2849076700 Bacteria 7039503
853 2857514383 2857509624 Bacteria 7472071
854 2874591536 2874590934 Bacteria 8299676
855 2874605120 2874604998 Bacteria 7834745
856 2874615236 2874612657 Bacteria 8252029
857 2874627170 2874620515 Bacteria 8290088
858 2874631780 2874628541 Bacteria 8630250
859 2874648946 2874645413 Bacteria 8214782
860 2876767028 2876761206 Bacteria 10111113
861 2876771973 2876771140 Bacteria 8287509
862 2876813278 2876808645 Bacteria 8824342
863 2876822082 2876818435 Bacteria 8274608
864 2879075595 2879074833 Bacteria 8279565
865 2879085337 2879083081 Bacteria 8587928
866 2879103289 2879099564 Bacteria 10442239
867 2879113624 2879110137 Bacteria 8907982
868 2879135497 2879127579 Bacteria 8294491
869 2879143106 2879142872 Bacteria 8267021
870 2881367010 2881364244 Bacteria 7710352
871 2881671106 2881665667 Bacteria 8175609
872 2885370539 2885366525 Bacteria 8326213
873 2885375050 2885374607 Bacteria 8927485
874 2885390534 2885383462 Bacteria 9473874
875 2885412211 2885409591 Bacteria 9235467
876 2888383992 2888378607 Bacteria 9652610
877 2888393866 2888388044 Bacteria 7304136
878 2888424400 2888419890 Bacteria 7857137
879 2889039909 2889033259 Bacteria 9099371
880 2903729052 2903727486 Bacteria 8281579
881 2903751745 2903748898 Bacteria 9972761
882 2903776000 2903768456 Bacteria 9749579
883 2904671311 2904666416 Bacteria 8226587
884 2904698404 2904690495 Bacteria 9412302
885 2904703370
886 2904714544 2904711408 Bacteria 9771557
887 2906610098 2906602504 Bacteria 8295279
888 2906618567
889 2906628601 2906626472 Bacteria 8826946
890 2906636115 2906635258 Bacteria 8601019
891 2906666434 2906660503 Bacteria 8595048
892 2908742753 2908739725 Bacteria 8628932
893 2908761064 2908756301 Bacteria 8864324
894 2908780105 2908775508 Bacteria 8092255
895 2922365286 2922361189 Bacteria 7436256
896 2922374313
897 2922390908 2922386360 Bacteria 7017218
898 2922396379 2922393267 Bacteria 8285685
899 2922430224
900 2929617987 2929615660 Bacteria 9193770
901 2929627668 2929624759 Bacteria 9339455
902 2932788231 2932784394 Bacteria 9704911
903 2932797541 2932794094 Bacteria 7915132
904 2932802855 2932801729 Bacteria 7987968
905 2932810619 2932809354 Bacteria 9135765
906 2932821235 2932818245 Bacteria 9955613
907 2932831228 2932828146 Bacteria 9745859
908 2933579915 2933577622 Bacteria 9116884
909 2935608812 2935608549 Bacteria 8203142
910 2935622976 2935616580 Bacteria 9032984
911 2935631715 2935630451 Bacteria 8169952
912 2935642336 2935638405 Bacteria 10015038
913 2935649972 2935648319 Bacteria 8801166
914 2935661876 2935656913 Bacteria 8965014
915 2935668361 2935665750 Bacteria 9571747
916 2935680494 2935675223 Bacteria 9928132
917 2935692836 2935684952 Bacteria 9590419
918 2935701005 2935694250 Bacteria 9291695
919 2935706216 2935703347 Bacteria 10242284
920 2935721439 2935713505 Bacteria 9608509
921 2935730357 2935722832 Bacteria 9608746
922 2935740370 2935732158 Bacteria 9706831
923 2935749634 2935741537 Bacteria 9707219
924 2935759053 2935750917 Bacteria 9590372
925 2935762617 2935760218 Bacteria 9817913
926 2935773226 2935769743 Bacteria 7878163
927 2935778472 2935777560 Bacteria 8077691
928 2935790409 2935785616 Bacteria 7962367
929 2935798138 2935793552 Bacteria 8012592
930 2935803216 2935801545 Bacteria 9301974
931 2935814536 2935810662 Bacteria 9401221
932 2935821972 2935819856 Bacteria 8261050
933 2935831674 2935827899 Bacteria 10038562
934 2935838542 2935837841 Bacteria 9454360
935 2935847554 2935847175 Bacteria 8228321
936 2935861224 2935855204 Bacteria 9035059
937 2935865762 2935864058 Bacteria 9784707
938 2935878263 2935873716 Bacteria 9632195
939 2935885197 2935883170 Bacteria 7964738
940 2935909179 2935908558 Bacteria 8568796
941 2935919900 2935916978 Bacteria 9113783
942 2935926247 2935926038 Bacteria 8601059
943 2935934697 2935934488 Bacteria 8602579
944 2935943147 2935942939 Bacteria 8599779
945 2935951585 2935951376 Bacteria 8602333
946 2935966417 2935959822 Bacteria 7869783
947 2935967710 2935967501 Bacteria 8603075
948 2935977090 2935975950 Bacteria 8347125
949 2935988244 2935984226 Bacteria 8302647
950 2935994576 2935992306 Bacteria 9802711
951 2936007624 2936002035 Bacteria 9362176
952 2936012545 2936011229 Bacteria 8801034
953 2936021109 2936019824 Bacteria 8804134
954 2936029838 2936028420 Bacteria 8965941
955 2936040093 2936037263 Bacteria 9446081
956 2936047303 2936046547 Bacteria 8903709
957 2936057539 2936055302 Bacteria 8785755
958 2940564942 2940556831 Bacteria 9590747
959 2941511509 2941507105 Bacteria 8166816
960 2941519210 2941515067 Bacteria 8166720
961 2941526210 2941523033 Bacteria 8169134
962 2941532687 2941531003 Bacteria 7653939
963 2941538790 2941538514 Bacteria 9402094
964 3005480157 3005474847 Bacteria 9259049
965 3005487273 3005483717 Bacteria 7877331
966 3005510266 3005506211 Bacteria 6943378
967 3005591062 3005587118 Bacteria 7794411
968 3005599167 3005594810 Bacteria 8716512
969 3005722263 3005718088 Bacteria 8283608
970 8001849777 8001845381 Bacteria 5804942
971 8006929964 8006926726 Bacteria 6749210
972 8006940731 8006933436 Bacteria 10410654
973 8006965665 8006964411 Bacteria 8966052
974 8006980421 8006973647 Bacteria 10679141
975 8006987124 8006984368 Bacteria 9651211
976 8006998801 8006994254 Bacteria 8309700
977 8016522416 8016511872 Bacteria 9921665
978 8016529681 8016522445 Bacteria 8156687
979 8016534900 8016530956 Bacteria 8155261
980 8016548110 8016539877 Bacteria 8155419
981 8016554015 8016548790 Bacteria 8155074
982 8016562390 8016557553 Bacteria 8154380
983 8016573245 8016566248 Bacteria 8158151
984 8016577388 8016575299 Bacteria 8154085
985 8016591860 8016583857 Bacteria 10421953
986 8016600191 8016595262 Bacteria 8149947
987 8016610562 8016603502 Bacteria 8731218
988 8016626618 8016622563 Bacteria 7999408
989 8016640425 8016630954 Bacteria 9217207
990 8017063145 8017057580 Bacteria 10023680
991 8019534660 8019530166 Bacteria 8155624
992 8019544810 8019538911 Bacteria 7872763
993 8019553727 8019547302 Bacteria 7996444
994 8019556812 8019555841 Bacteria 9642137
995 8019568495 8019565922 Bacteria 9639779
996 8019582579 8019576017 Bacteria 10049540
997 8019590370 8019586578 Bacteria 10212056
998 8019600984 8019597564 Bacteria 10041141
999 8019617569 8019608314 Bacteria 10042931
1000 8019628065 8019619141 Bacteria 9218857
1001 8019634542 8019629233 Bacteria 8687553
1002 8019645183 8019638758 Bacteria 9062356
1003 8019658318 8019648815 Bacteria 10014479
1004 8019662435 8019659431 Bacteria 8577854
1005 8019671934 8019668869 Bacteria 8791617
1006 8019684159 8019678201 Bacteria 8863603
1007 8019689997 8019687851 Bacteria 8712826
1008 8055746424 8055742211 Bacteria 9226248
1009 8056673937 8056673599 Bacteria 7871253
1010 8056686628 8056681323 Bacteria 8472857
1011 8056967966 8056967851 Bacteria 9038162
1012 Ga0395900_0044059
1013 JGI25404J52841_10000074
1014 JGI25404J52841_10017418
1015 Ga0065715_10110964
1016 Ga0070658_10097872
1017 Ga0070676_10215456
1018 Ga0070683_100127724
1019 Ga0070683_100161825
1020 Ga0070683_100631012
1021 Ga0070690_100254248
1022 Ga0070690_100575824
1023 Ga0070670_100502886
1024 Ga0068869_100353398
1025 Ga0068869_100488259
1026 Ga0068869_100650899
1027 Ga0068869_100865143
1028 Ga0070666_10352313
1029 Ga0070680_100023225
1030 Ga0070680_100285490
1031 Ga0070680_100485571
1032 Ga0070682_100031462
1033 Ga0070682_100318449
1034 Ga0070682_100449235
1035 Ga0068868_100015782
1036 Ga0068868_101047061
1037 Ga0070660_100101024
1038 Ga0070660_100143997
1039 Ga0070660_100173799
1040 Ga0070689_100167031
1041 Ga0070689_100577311
1042 Ga0070691_10203453
1043 Ga0070691_10382341
1044 Ga0070661_100089964
1045 Ga0070668_100040972
1046 Ga0070668_100056554
1047 Ga0070668_100386242
1048 Ga0070668_100505427
1049 Ga0070669_100425531
1050 Ga0070675_100178981
1051 Ga0070671_100130874
1052 Ga0070674_100007645
1053 Ga0070674_100050184
1054 Ga0070673_100759091
1055 Ga0070673_101157450
1056 Ga0070688_100271284
1057 Ga0070688_100497133
1058 Ga0070659_100145270
1059 Ga0070659_100612486
1060 Ga0070667_100411748
1061 Ga0070714_100121097
1062 Ga0070714_100241367
1063 Ga0070713_100010275
1064 Ga0070713_100176956
1065 Ga0070713_101134942
1066 Ga0070701_10032376
1067 Ga0070701_10047195
1068 Ga0070711_100267944
1069 Ga0070711_100412532
1070 Ga0070705_100164149
1071 Ga0070705_100547035
1072 Ga0070700_100207092
1073 Ga0070700_100487955
1074 Ga0070708_100022040
1075 Ga0070663_100044064
1076 Ga0070663_100086097
1077 Ga0070663_100154382
1078 Ga0070663_100187216
1079 Ga0070663_100441891
1080 Ga0070663_100799809
1081 Ga0070678_100089066
1082 Ga0070678_100220875
1083 Ga0070678_100293289
1084 Ga0070678_100426195
1085 Ga0070678_100814686
1086 Ga0070662_100222481
1087 Ga0070681_10010339
1088 Ga0070681_10146140
1089 Ga0070681_10782510
1090 Ga0068867_100020024
1091 Ga0068867_100207822
1092 Ga0070685_10070010
1093 Ga0070685_10530809
1094 Ga0070706_100259303
1095 Ga0070707_100088681
1096 Ga0070699_100201372
1097 Ga0070679_100017059
1098 Ga0070679_100043008
1099 Ga0070679_100941009
1100 Ga0070684_100007403
1101 Ga0070684_100065228
1102 Ga0070684_100773382
1103 Ga0070697_100722321
1104 Ga0068853_100244989
1105 Ga0068853_100721384
1106 Ga0070672_100060622
1107 Ga0070672_100206859
1108 Ga0070696_100145872
1109 Ga0070696_100471424
1110 Ga0070696_100477014
1111 Ga0070693_100341891
1112 Ga0070665_100224798
1113 Ga0070665_100703544
1114 Ga0068855_100003023
1115 Ga0068855_100032053
1116 Ga0068855_100315927
1117 Ga0070664_100034166
1118 Ga0070664_100545681
1119 Ga0070664_100606329
1120 Ga0068854_100454254
1121 Ga0068854_101138903
1122 Ga0068856_100072308
1123 Ga0070702_100035143
1124 Ga0070702_100042749
1125 Ga0070702_100135437
1126 Ga0070702_100437287
1127 Ga0068852_100042910
1128 Ga0068852_100398894
1129 Ga0068859_100887809
1130 Ga0068859_100996175
1131 Ga0068864_100243560
1132 Ga0068866_10064519
1133 Ga0068861_100438602
1134 Ga0068870_10035639
1135 Ga0068863_100082674
1136 Ga0068863_100283478
1137 Ga0068863_100313459
1138 Ga0068863_100583078
1139 Ga0068858_100031889
1140 Ga0068858_100692078
1141 Ga0068858_101069730
1142 Ga0068860_100079510
1143 Ga0068860_101298411
1144 Ga0068862_100040181
1145 Ga0068862_100066032
1146 Ga0068862_100226739
1147 Ga0068862_100272907
1148 Ga0068862_101672090
1149 Ga0081455_10015473
1150 Ga0081455_10055763
1151 Ga0081455_10279684
1152 Ga0081540_1000136
1153 Ga0081540_1002694
1154 Ga0081540_1003284
1155 Ga0081540_1017176
1156 Ga0081540_1046754
1157 Ga0070717_10006942
1158 Ga0070717_11100359
1159 Ga0075365_10394859
1160 Ga0075365_10550049
1161 Ga0075368_10068569
1162 Ga0075363_100004820
1163 Ga0075364_10146771
1164 Ga0075364_10583538
1165 Ga0070715_10306404
1166 Ga0070716_100030634
1167 Ga0070716_100055126
1168 Ga0070716_100132426
1169 Ga0070712_100235671
1170 Ga0070712_100250555
1171 Ga0075362_10123678
1172 Ga0075367_10377543
1173 Ga0075369_10034195
1174 Ga0075369_10050214
1175 Ga0075369_10171134
1176 Ga0075366_10201274
1177 Ga0097621_100196143
1178 Ga0075370_10496315
1179 Ga0068871_100127534
1180 Ga0075428_100065917
1181 Ga0075428_100114252
1182 Ga0075433_10693992
1183 Ga0075434_100067371
1184 Ga0068865_100233609
1185 Ga0068865_100683196
1186 Ga0097620_100887888
1187 Ga0097620_100996251
1188 Ga0105250_10059349
1189 Ga0105250_10073381
1190 Ga0105240_10038716
1191 Ga0111539_10100424
1192 Ga0111539_10433427
1193 Ga0111539_12140220
1194 Ga0105245_10031330
1195 Ga0105245_10315793
1196 Ga0105247_10076877
1197 Ga0105247_10187933
1198 Ga0105247_10208359
1199 Ga0114129_10085849
1200 Ga0105243_10175945
1201 Ga0105243_10843399
1202 Ga0105243_11053881
1203 Ga0105242_10108112
1204 Ga0105242_10215584
1205 Ga0105242_12535964
1206 Ga0105248_10118433
1207 Ga0105248_10478290
1208 Ga0105248_10626435
1209 Ga0105248_11110761
1210 Ga0105248_11598787
1211 Ga0105237_10002239
1212 Ga0105237_10080273
1213 Ga0105237_10204224
1214 Ga0105237_11061428
1215 Ga0105238_10054766
1216 Ga0105238_10142623
1217 Ga0105238_10554074
1218 Ga0105238_10808944
1219 Ga0099796_10070297
1220 Ga0105239_10015382
1221 Ga0105239_10053264
1222 Ga0105239_10070875
1223 Ga0105239_10095982
1224 Ga0105239_10717274
1225 Ga0105239_11389049
1226 Ga0105246_10011321
1227 Ga0105246_10475482
1228 Ga0157370_10215983
1229 Ga0157370_10316608
1230 Ga0157369_10010134
1231 Ga0157369_10012483
1232 Ga0157369_11074110
1233 Ga0157374_10197400
1234 Ga0157374_10254788
1235 Ga0157374_10996916
1236 Ga0157374_11257552
1237 Ga0157378_10009924
1238 Ga0157378_10092354
1239 Ga0157378_10323074
1240 Ga0163162_10087246
1241 Ga0163162_10151024
1242 Ga0163162_10409890
1243 Ga0163162_10467021
1244 Ga0163162_10500398
1245 Ga0157372_10040112
1246 Ga0157372_10685633
1247 Ga0157375_10207380
1248 Ga0157375_10229597
1249 Ga0157375_10303746
1250 Ga0157375_10461069
1251 Ga0157375_10825504
1252 Ga0157375_11338128
1253 Ga0163163_10005218
1254 Ga0163163_10320542
1255 Ga0163163_10400488
1256 Ga0163163_10948120
1257 Ga0163163_12290552
1258 Ga0157380_11362017
1259 Ga0157380_11510137
1260 Ga0157379_10482118
1261 Ga0157379_10713027
1262 Ga0157376_10004919
1263 Ga0157376_11240303
1264 Ga0182006_1182580
1265 Ga0163161_10061568
1266 Ga0214544_1000002
1267 Ga0214542_1000001
1268 Ga0214545_1000001
1269 Ga0214545_1035778
1270 Ga0214543_1000001
1271 Ga0213873_10028727
1272 Ga0213876_10002470
1273 Ga0207673_1018247
1274 Ga0209758_1001025
1275 Ga0207697_10031735
1276 Ga0207697_10208722
1277 Ga0207682_10131823
1278 Ga0207642_10051644
1279 Ga0207710_10324834
1280 Ga0207688_10695000
1281 Ga0207680_10463946
1282 Ga0207645_10121693
1283 Ga0207645_10202577
1284 Ga0207645_10284791
1285 Ga0207643_10137059
1286 Ga0207643_10533787
1287 Ga0207705_10409394
1288 Ga0207684_10251257
1289 Ga0207654_10088179
1290 Ga0207654_10553657
1291 Ga0207707_10125345
1292 Ga0207695_10009431
1293 Ga0207671_10243666
1294 Ga0207671_10819340
1295 Ga0207693_10089167
1296 Ga0207693_10195062
1297 Ga0207693_10570215
1298 Ga0207660_10091846
1299 Ga0207660_10582441
1300 Ga0207660_10808688
1301 Ga0207660_11413272
1302 Ga0207657_10000784
1303 Ga0207657_10297522
1304 Ga0207657_10301990
1305 Ga0207649_10068978
1306 Ga0207649_10630891
1307 Ga0207649_10658761
1308 Ga0207652_10026574
1309 Ga0207652_10608749
1310 Ga0207646_10081518
1311 Ga0207681_10319895
1312 Ga0207694_10038951
1313 Ga0207694_10201996
1314 Ga0207694_10529359
1315 Ga0207650_10163067
1316 Ga0207659_10365366
1317 Ga0207659_11031694
1318 Ga0207687_10025922
1319 Ga0207687_10760096
1320 Ga0207700_10120677
1321 Ga0207700_10778581
1322 Ga0207664_10096819
1323 Ga0207664_10202353
1324 Ga0207706_10047791
1325 Ga0207706_10148397
1326 Ga0207706_10290648
1327 Ga0207686_10258183
1328 Ga0207709_10066147
1329 Ga0207709_10529271
1330 Ga0207670_10344002
1331 Ga0207670_10382852
1332 Ga0207670_10758334
1333 Ga0207669_10018683
1334 Ga0207669_10045638
1335 Ga0207669_10757738
1336 Ga0207704_11082732
1337 Ga0207665_10078163
1338 Ga0207665_10227420
1339 Ga0207665_10236017
1340 Ga0207665_10402270
1341 Ga0207691_10048908
1342 Ga0207691_10198496
1343 Ga0207711_10019599
1344 Ga0207689_10055708
1345 Ga0207689_10460497
1346 Ga0207689_10811391
1347 Ga0207661_10542790
1348 Ga0207661_10871750
1349 Ga0207679_10028273
1350 Ga0207679_10090770
1351 Ga0207679_10760842
1352 Ga0207667_10039055
1353 Ga0207667_10789181
1354 Ga0207667_11177075
1355 Ga0207712_10360816
1356 Ga0207712_11570297
1357 Ga0207668_10115858
1358 Ga0207668_10187657
1359 Ga0207668_10313965
1360 Ga0207668_10853379
1361 Ga0207668_11552542
1362 Ga0207640_10406556
1363 Ga0207640_10865050
1364 Ga0207658_11249175
1365 Ga0207677_10076948
1366 Ga0207677_10136957
1367 Ga0207677_10187195
1368 Ga0207677_10235816
1369 Ga0207677_10719309
1370 Ga0207677_11880770
1371 Ga0207703_10131454
1372 Ga0207703_10179271
1373 Ga0207703_10317296
1374 Ga0207639_10605090
1375 Ga0207639_10781981
1376 Ga0207678_10037212
1377 Ga0207678_10153356
1378 Ga0207678_10220356
1379 Ga0207678_10274850
1380 Ga0207678_10280298
1381 Ga0207678_10433812
1382 Ga0207708_10488576
1383 Ga0207708_10581060
1384 Ga0207641_10018331
1385 Ga0207641_10098286
1386 Ga0207641_10225237
1387 Ga0207641_11301072
1388 Ga0207648_10025820
1389 Ga0207648_10477439
1390 Ga0207676_10094773
1391 Ga0207676_10545106
1392 Ga0207676_11888177
1393 Ga0207674_10215991
1394 Ga0207675_100035028
1395 Ga0207675_100041238
1396 Ga0207675_100264237
1397 Ga0207675_101924525
1398 Ga0207683_10050062
1399 Ga0207683_10087234
1400 Ga0207683_10420463
1401 Ga0207683_10426560
1402 Ga0207683_10573586
1403 Ga0207698_10331680
1404 Ga0207698_10371445
1405 Ga0209813_10176274
1406 Ga0207428_10321642
1407 Ga0268266_10001919
1408 Ga0268266_10002779
1409 Ga0268266_10104118
1410 Ga0268266_10702727
1411 Ga0268266_10725901
1412 Ga0268265_10317916
1413 Ga0268265_10624867
1414 Ga0268265_11561698
1415 Ga0268264_10000043
1416 Ga0268264_10033691
1417 Ga0268264_10154443
1418 Ga0265336_10035778
1419 Ga0307517_10000063
1420 Ga0307515_10534978
1421 Ga0265338_10061068
1422 Ga0307511_10209660
1423 Ga0265330_10009689
1424 Ga0265325_10011986
1425 Ga0265340_10003402
1426 Ga0265340_10125666
1427 Ga0265339_10067376
1428 Ga0307408_101280852
1429 Ga0307508_10000010
1430 Ga0307508_10014670
1431 Ga0307508_10414776
1432 Ga0307508_10457603
1433 Ga0307508_10525031
1434 Ga0265342_10056727
1435 Ga0265342_10119181
1436 Ga0307516_10222002
1437 Ga0307405_11746251
1438 Ga0307413_10100977
1439 Ga0307413_10111460
1440 Ga0307410_10251121
1441 Ga0307407_10255048
1442 Ga0307412_10471370
1443 Ga0307416_100397663
1444 Ga0307416_100595776
1445 Ga0307414_10778866
1446 Ga0307411_10116011
1447 Ga0307510_10229266
1448 Ga0373930_0092602
1449 Ga0373959_0044885
1450 Ga0373929_0010642
1451 Ga0373934_0041894
1452 Ga0373940_0030764
1453 Ga0373944_0223338
1454 Ga0373949_0139366
1455 Ga0373952_0004283
1456 Ga0373923_0022342
1457 Ga0373932_0346984
1458 Ga0373936_0097700
1459 Ga0373941_0086059
1460 Ga0373941_0338866
1461 Ga0373943_0037733
1462 Ga0373943_0382959
1463 Ga0373955_0060689
1464 Ga0373924_0020261
1465 Ga0373931_0009393
1466 Ga0373935_0004357
1467 Ga0373935_0008594
1468 Ga0373935_0115339
1469 Ga0373927_0002258
1470 Ga0373927_0060753
1471 Ga0373927_0116167
1472 Ga0373927_0140502
1473 Ga0373933_0189809
1474 Ga0373947_0002634
1475 Ga0373947_0023496
1476 Ga0373947_0068387
1477 Ga0373947_0244070
1478 Ga0373937_0122685
1479 Ga0373937_0155295
1480 Ga0373937_0619546
1481 Ga0373925_0008340
1482 Ga0373925_0548134
1483 Ga0373925_0548920
1484 Ga0395899_0139395
1485 Ga0395898_0051661
1486 Ga0436364_0975533
1487 Ga0395901_0837210
1488 Ga0436365_0163014
1489 Ga0436365_0508090
1490 Ga0436365_0589211
1491 Ga0436365_1190006
1492 Ga0436360_0226663
1493 Ga0436360_1352026
1494 Ga0436363_0850716
1495 Ga0436362_1192450
1496 Ga0451797_1020677
1497 Ga0451795_0541422
1498 Ga0451807_2622904
1499 Ga0451839_1163861
1500 Ga0451845_0217232
1501 Ga0451853_1762699
1502 Ga0451853_2570889
1503 Ga0439431_0050249
1504 Ga0439434_0210318
1505 Ga0466971_0012320
1506 Ga0466970_0123467
1507 Ga0466957_0207749
1508 Ga0466959_0064221
1509 Ga0466958_0111995
1510 Ga0466958_0164205
1511 Ga0495592_0157706
1512 Ga0495592_0159799
1513 Ga0495592_0834286
1514 Ga0495603_0000676
1515 Ga0495603_0265566
1516 Ga0495591_069584
1517 Ga0495629_0231277
1518 Ga0495629_0231914
1519 Ga0495629_0327051
1520 Ga0495629_0707476
1521 Ga0495641_0005779
1522 Ga0495641_0059296
1523 Ga0495651_0114580
1524 Ga0495580_0951641
1525 Ga0495582_0000177
1526 Ga0495582_0064536
1527 Ga0495639_0156346
1528 Ga0495639_0171384
1529 Ga0495662_0000028
1530 Ga0495664_0013279
1531 Ga0495664_0406649
1532 Ga0495584_0032145
1533 Ga0495585_0140898
1534 Ga0495585_0170754
1535 Ga0495594_0000020
1536 Ga0495606_0004986
1537 Ga0495606_0564624
1538 Ga0495608_0220879
1539 Ga0495610_0048384
1540 Ga0495616_0189004
1541 Ga0495618_0731070
1542 Ga0495630_0003026
1543 Ga0495630_0028188
1544 Ga0495630_0455892
1545 Ga0495637_0197147
1546 Ga0495637_0235144
1547 Ga0495644_0049011
1548 Ga0495644_0247130
1549 Ga0495648_0095800
1550 Ga0495666_0081834
1551 Ga0495652_0036711
1552 Ga0495652_0906265
1553 Ga0495665_0000057
1554 Ga0495665_0495319
1555 Ga0495640_0009965
1556 Ga0495640_0022817
1557 Ga0495640_0072851
1558 Ga0495587_0584005
1559 Ga0495621_0198836
1560 Ga0495597_0145441
1561 Ga0495597_0221203
1562 Ga0495622_0003396
1563 Ga0495622_0146398
1564 Ga0495667_0219763
1565 Ga0495656_0100701
1566 Ga0495668_0320896
1567 Ga0495634_0000324
1568 Ga0495634_0014597
1569 Ga0495634_0239917
1570 Ga0495611_0109511
1571 Ga0495625_0059002
1572 Ga0495635_0000496
1573 Ga0495635_0838383
1574 Ga0495588_0003434
1575 Ga0495646_0103828
1576 Ga0495646_0159192
1577 Ga0495647_0183690
1578 Ga0495658_0007012
1579 Ga0495658_0277471
1580 Ga0495669_0010274
1581 Ga0495613_0004688
1582 Ga0495624_0252414
1583 Ga0495671_0108683
1584 Ga0495649_0106711
1585 Ga0495589_0137655
1586 Ga0495581_0006881
1587 Ga0495604_0333125
1588 Ga0495604_0479750
1589 Ga0495674_0024210
1590 Ga0495674_0145108
1591 Ga0495672_0009800
1592 Ga0495676_0063040
1593 Ga0495676_0137424
1594 Ga0495675_0446468
1595 Ga0495677_0029189
1596 Ga0495685_034944
1597 Ga0495673_0164432
1598 Ga0495673_0183702
1599 Ga0495684_0020958
1600 Ga0495686_0063144
1601 Ga0495686_0068038
1602 Ga0495593_0067263
1603 Ga0495615_0020027
1604 Ga0496100_0006178
1605 Ga0496100_0035526
1606 Ga0496100_0048766
1607 Ga0496100_0132185
1608 Ga0496100_1302928
1609 Ga0496101_0007887
1610 Ga0496101_0014276
1611 Ga0496101_0106766
1612 Ga0496101_0180558
1613 Ga0496101_0187689
1614 Ga0496101_0222186
1615 Ga0496101_0549085
1616 Ga0496102_0005734
1617 Ga0496102_0048507
1618 Ga0496102_0064455
1619 Ga0496102_0068279
1620 Ga0496102_0114709
1621 Ga0496102_0186056
1622 Ga0496102_0261712
1623 Ga0496102_0316218
1624 Ga0496102_0357950
1625 Ga0496102_1051141
1626 Ga0496102_1341029
1627 Ga0496103_0023313
1628 Ga0496103_0035178
1629 Ga0496103_0058756
1630 Ga0496103_0188693
1631 Ga0496104_0007944
1632 Ga0496104_0017208
1633 Ga0496104_0138922
1634 Ga0496104_0150175
1635 Ga0496104_0634850
1636 Ga0496105_0045859
1637 Ga0496105_0190761
1638 Ga0496105_0330913
1639 Ga0496105_0418700
1640 Ga0496106_0001783
1641 Ga0496106_0007982
1642 Ga0496106_0070834
1643 Ga0496106_0098878
1644 Ga0496106_0153155
1645 Ga0496106_0341996
1646 Ga0496106_0474117
1647 Ga0496107_0001739
1648 Ga0496107_0048126
1649 Ga0496107_0053497
1650 Ga0496107_0053815
1651 Ga0496107_0155167
1652 Ga0496107_0786694
1653 Ga0496108_0052299
1654 Ga0496108_0119792
1655 Ga0496108_0245547
1656 Ga0496108_0318428
1657 Ga0496108_0526989
1658 Ga0496108_0616597
1659 Ga0496108_1397905
1660 Ga0496109_0007958
1661 Ga0496109_0011937
1662 Ga0496109_0110862
1663 Ga0496109_0157225
1664 Ga0496109_0566321
1665 Ga0496110_0004242
1666 Ga0496110_0023887
1667 Ga0496110_0046547
1668 Ga0496110_0754565
1669 Ga0496111_0012624
1670 Ga0496111_0036020
1671 Ga0496111_0158281
1672 Ga0496111_0999666
1673 Ga0496112_0000031
1674 Ga0496112_0056939
1675 Ga0496112_0238744
1676 Ga0496113_0007392
1677 Ga0496113_0022172
1678 Ga0496113_0507440
1679 Ga0496113_0591531
1680 Ga0496114_0005673
1681 Ga0496114_0022987
1682 Ga0496114_0030943
1683 Ga0496114_0076768
1684 Ga0496114_0198371
1685 Ga0496114_0281477
1686 Ga0496114_1420093
1687 Ga0496115_0002452
1688 Ga0496115_0023593
1689 Ga0496115_0035163
1690 Ga0496115_0040280
1691 Ga0496115_0120774
1692 Ga0496115_0444004
1693 Ga0496115_0620904
1694 Ga0496115_0784234
1695 Ga0496117_0057783
1696 Ga0496118_0001507
1697 Ga0496119_0057524
1698 Ga0496120_0136792
1699 Ga0496121_0000183
1700 Ga0496121_0000407
1701 Ga0496121_0065910
1702 Ga0496121_0082002
1703 Ga0496121_0104964
1704 Ga0496121_0272041
1705 Ga0496124_0003899
1706 Ga0496124_0365264
1707 Ga0496125_0037479
1708 Ga0496125_0091046
1709 Ga0496126_0016402
1710 Ga0496126_0026742
1711 Ga0496126_0354945
1712 Ga0496126_0453923
1713 Ga0501034_0275584
1714 Ga0501037_0145545
1715 Ga0501042_0045953
1716 Ga0501042_0288253
1717 Ga0501046_0333426
1718 Ga0501047_0115889
1719 Ga0501047_0191056
1720 Ga0501047_0247540
1721 Ga0501069_0038412
1722 Ga0501069_0058291
1723 Ga0501070_0002951
1724 Ga0501070_0244522
1725 Ga0501071_0206781
1726 Ga0501074_0180529
1727 Ga0501079_0779087
1728 Ga0501080_0101140
1729 Ga0501080_0448605
1730 Ga0501083_0021975
1731 Ga0501035_0055687
1732 Ga0501035_0215511
1733 Ga0501044_0189635
1734 Ga0501044_0196804
1735 Ga0501044_0557344
1736 nmdc:mga03683_146506_c1
1737 nmdc:mga03n38_518827_c1
1738 nmdc:mga00v17_251907_c1
1739 nmdc:mga0yw44_363671_c1
1740 nmdc:mga0yw44_55241_c1
1741 nmdc:mga0yw44_612562_c1
1742 nmdc:mga06z11_359328_c1
1743 nmdc:mga04h51_132514_c1
1744 nmdc:mga04h51_139952_c1
1745 nmdc:mga04h51_20146_c1
1746 nmdc:mga07m45_119977_c1
1747 nmdc:mga07m45_2740_c2
1748 nmdc:mga07m45_348724_c1
1749 nmdc:mga05p37_307378_c1
1750 nmdc:mga0qj67_41_c1
1751 nmdc:mga08y16_187301_c1
1752 nmdc:mga08y16_383261_c1
1753 nmdc:mga08y16_423734_c1
1754 nmdc:mga0sz30_119450_c1
1755 nmdc:mga0sz30_246287_c1
1756 Ga0495601_0073827
1757 Ga0495601_0139795
1758 Ga0495601_0468704
1759 Ga0495612_0304302
1760 Ga0495655_0120443
1761 Ga0495655_0143383
1762 Ga0495595_0143097
1763 Ga0495595_0173613
1764 Ga0495619_0262235
1765 Ga0500643_063404
1766 Ga0500644_0063885
1767 Ga0500581_158916
1768 Ga0500646_0176548
1769 Ga0500646_0178462
1770 Ga0500651_0225852
1771 Ga0500651_0487626
1772 Ga0500566_0281515
1773 Ga0500641_0022271
1774 Ga0500641_0073066
1775 Ga0500554_005156
1776 Ga0500569_060966
1777 Ga0500595_000844
1778 Ga0500595_003905
1779 Ga0500597_144648
1780 Ga0500642_0145471
1781 Ga0500652_000042
1782 Ga0500568_0025777
1783 Ga0500579_128041
1784 Ga0500588_0083825
1785 Ga0500589_039873
1786 Ga0500589_251038
1787 Ga0500603_106980
1788 Ga0500604_0234711
1789 Ga0500616_0086832
1790 Ga0500622_0051434
1791 Ga0500633_0187699
1792 Ga0500638_000727
1793 Ga0500638_081771
1794 Ga0500636_0174238
1795 Ga0500637_0000104
1796 Ga0500609_012671
1797 Ga0500552_009830
1798 Ga0501084_0563430
1799 Ga0500661_001650
1800 Ga0501082_0742905
1801 Ga0466962_0064772
1802 2508542753
1803 2508691488
1804 2513623110
1805 2513639039
1806 2513645913
1807 2513654668
1808 2513673878
1809 2513692452
1810 2513700133
1811 2513719519
1812 2513855921
1813 2513872698
1814 2513915152
1815 2514011924
1816 2515628290
1817 2517108329
1818 2517892447
1819 2524440501
1820 2524469609
1821 2524541147
1822 2528851166
1823 2617348944
1824 2617375839
1825 2671122444
1826 2723845165
1827 2728751492
1828 2745075229
1829 2793062467
1830 2793072071
1831 2793080914
1832 2805915404
1833 2818238981
1834 2824609142
1835 2824617649
1836 2824625725
1837 2824634503
1838 2824642567
1839 2824650321
1840 2824670349
1841 2824678235
1842 2824686011
1843 2824694662
1844 2824703597
1845 2824720838
1846 2824730616
1847 2824739021
1848 2824753266
1849 2824772785
1850 2824781165
1851 2838123824
1852 2841944047
1853 2841949924
1854 2841958598
1855 2841966342
1856 2841975076
1857 2841983352
1858 2842039136
1859 2842047917
1860 2844319023
1861 2847936143
1862 2847946493
1863 2849079384
1864 2857514383
1865 2874591536
1866 2874605120
1867 2874615236
1868 2874627170
1869 2874631780
1870 2874648946
1871 2876767028
1872 2876771973
1873 2876813278
1874 2876822082
1875 2879075595
1876 2879085337
1877 2879103289
1878 2879113624
1879 2879135497
1880 2879143106
1881 2881367010
1882 2881671106
1883 2885370539
1884 2885375050
1885 2885390534
1886 2885412211
1887 2888383992
1888 2888393866
1889 2888424400
1890 2889039909
1891 2903729052
1892 2903751745
1893 2903776000
1894 2904671311
1895 2904698404
1896 2904703370
1897 2904714544
1898 2906610098
1899 2906618567
1900 2906628601
1901 2906636115
1902 2906666434
1903 2908742753
1904 2908761064
1905 2908780105
1906 2922365286
1907 2922374313
1908 2922390908
1909 2922396379
1910 2922430224
1911 2929617987
1912 2929627668
1913 2932788231
1914 2932797541
1915 2932802855
1916 2932810619
1917 2932821235
1918 2932831228
1919 2933579915
1920 2935608812
1921 2935622976
1922 2935631715
1923 2935642336
1924 2935649972
1925 2935661876
1926 2935668361
1927 2935680494
1928 2935692836
1929 2935701005
1930 2935706216
1931 2935721439
1932 2935730357
1933 2935740370
1934 2935749634
1935 2935759053
1936 2935762617
1937 2935773226
1938 2935778472
1939 2935790409
1940 2935798138
1941 2935803216
1942 2935814536
1943 2935821972
1944 2935831674
1945 2935838542
1946 2935847554
1947 2935861224
1948 2935865762
1949 2935878263
1950 2935885197
1951 2935909179
1952 2935919900
1953 2935926247
1954 2935934697
1955 2935943147
1956 2935951585
1957 2935966417
1958 2935967710
1959 2935977090
1960 2935988244
1961 2935994576
1962 2936007624
1963 2936012545
1964 2936021109
1965 2936029838
1966 2936040093
1967 2936047303
1968 2936057539
1969 2940564942
1970 2941511509
1971 2941519210
1972 2941526210
1973 2941532687
1974 2941538790
1975 3005480157
1976 3005487273
1977 3005510266
1978 3005591062
1979 3005599167
1980 3005722263
1981 8001849777
1982 8006929964
1983 8006940731
1984 8006965665
1985 8006980421
1986 8006987124
1987 8006998801
1988 8016522416
1989 8016529681
1990 8016534900
1991 8016548110
1992 8016554015
1993 8016562390
1994 8016573245
1995 8016577388
1996 8016591860
1997 8016600191
1998 8016610562
1999 8016626618
2000 8016640425
2001 8017063145
2002 8019534660
2003 8019544810
2004 8019553727
2005 8019556812
2006 8019568495
2007 8019582579
2008 8019590370
2009 8019600984
2010 8019617569
2011 8019628065
2012 8019634542
2013 8019645183
2014 8019658318
2015 8019662435
2016 8019671934
2017 8019684159
2018 8019689997
2019 8055746424
2020 8056673937
2021 8056686628
2022 8056967966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

109

183

0.97

Map