F488115

General Info

Members Datasets Scaffolds Average Seq Length
1010 418 2020 111

Family's Representative Sequence

Representative Sequence 3300025711|Ga0207696_1082141|Ga0207696_10821411
Length 132
Sequence MTNWIEIGTLNDIPVLGSRVVRTASGDIAVFRTADDEVFALDDRCPHKGVPLSQGIVHNKRVTCPLHNFVIELKSGAAVAPDEGCTRAHPTKVENDIVWLCLQTAAAAPAEAAADAPRRTARLLINGPPCQA

Samples

Sample ID Description Type Environment
1 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
205 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
222 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
239 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
365 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
368 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
369 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
370 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
378 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
379 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
387 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
388 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
389 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
392 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
393 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
394 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
395 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
396 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
399 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
400 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
401 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
405 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
406 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
407 2791355199
408 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
409 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
410 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
411 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
412 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
413 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
414 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
415 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
416 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
417 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
418 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.1
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.37
Nodule 1.29
Rhizoplane 5.64
Rhizosphere 72.38
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207696_1082141 3300025711 Bacteria 889
2 JGI24740J21852_10001094 3300001979 Bacteria 12251
3 JGI24740J21852_10005300 3300001979 Bacteria 5472
4 JGI24740J21852_10131517 3300001979 Bacteria 624
5 JGI24739J22299_10015149 3300001989 Bacteria 2801
6 JGI24737J22298_10003886 3300001990 Bacteria 5252
7 JGI24735J21928_10091875 3300002067 Bacteria 870
8 JGI24738J21930_10074740 3300002075 Bacteria 705
9 JGI25406J46586_10002763 3300003203 Bacteria 8249
10 JGI25153J46596_10002549 3300003215 Bacteria 10443
11 JGI25404J52841_10063360 3300003659 Bacteria 774
12 JGI25404J52841_10125579 3300003659 Bacteria 541
13 JGI25405J52794_10145314 3300003911 Bacteria 540
14 Ga0070676_10068295 3300005328 Bacteria 2127
15 Ga0070676_10414962 3300005328 Bacteria 939
16 Ga0070690_100779236 3300005330 Bacteria 740
17 Ga0070670_100816799 3300005331 Bacteria 842
18 Ga0068869_100055250 3300005334 Bacteria 2893
19 Ga0068869_100631471 3300005334 Bacteria 907
20 Ga0068869_101061041 3300005334 Bacteria 707
21 Ga0070666_10293230 3300005335 Bacteria 1157
22 Ga0070666_10401478 3300005335 Bacteria 985
23 Ga0070666_10580645 3300005335 Bacteria 817
24 Ga0070682_100100067 3300005337 Bacteria 1912
25 Ga0070682_100837228 3300005337 Bacteria 751
26 Ga0068868_100567929 3300005338 Bacteria 1002
27 Ga0068868_100935413 3300005338 Bacteria 790
28 Ga0068868_101787437 3300005338 Bacteria 581
29 Ga0070660_100047409 3300005339 Bacteria 3297
30 Ga0070660_100343184 3300005339 Bacteria 1229
31 Ga0070660_100484734 3300005339 Bacteria 1028
32 Ga0070660_101033347 3300005339 Bacteria 695
33 Ga0070689_100034415 3300005340 Bacteria 3865
34 Ga0070689_101187114 3300005340 Bacteria 685
35 Ga0070689_101334788 3300005340 Bacteria 647
36 Ga0070687_100474966 3300005343 Bacteria 837
37 Ga0070687_100803714 3300005343 Bacteria 666
38 Ga0070661_100082937 3300005344 Bacteria 2368
39 Ga0070661_100409163 3300005344 Bacteria 1074
40 Ga0070661_100577702 3300005344 Bacteria 907
41 Ga0070692_10319046 3300005345 Bacteria 955
42 Ga0070668_100058572 3300005347 Bacteria 2980
43 Ga0070668_100194538 3300005347 Bacteria 1662
44 Ga0070668_100288609 3300005347 Bacteria 1372
45 Ga0070668_100401393 3300005347 Bacteria 1170
46 Ga0070668_100733316 3300005347 Bacteria 873
47 Ga0070668_101134203 3300005347 Bacteria 707
48 Ga0070669_100270436 3300005353 Bacteria 1359
49 Ga0070669_100362549 3300005353 Bacteria 1179
50 Ga0070669_100450715 3300005353 Bacteria 1060
51 Ga0070675_101230000 3300005354 Bacteria 690
52 Ga0070671_100051812 3300005355 Bacteria 3413
53 Ga0070671_101571826 3300005355 Bacteria 583
54 Ga0070674_100024631 3300005356 Bacteria 3908
55 Ga0070674_101103722 3300005356 Bacteria 701
56 Ga0070673_100528639 3300005364 Bacteria 1069
57 Ga0070673_100824262 3300005364 Bacteria 858
58 Ga0070688_100126949 3300005365 Bacteria 1716
59 Ga0070688_101344611 3300005365 Bacteria 578
60 Ga0070659_100573664 3300005366 Bacteria 967
61 Ga0070659_101680910 3300005366 Bacteria 568
62 Ga0070667_100360464 3300005367 Bacteria 1317
63 Ga0070667_100783740 3300005367 Bacteria 885
64 Ga0070714_100644905 3300005435 Bacteria 1019
65 Ga0070701_10087030 3300005438 Bacteria 1704
66 Ga0070701_10345491 3300005438 Bacteria 928
67 Ga0070701_11046922 3300005438 Bacteria 572
68 Ga0070711_101564605 3300005439 Bacteria 576
69 Ga0070705_100066694 3300005440 Bacteria 2159
70 Ga0070700_100028185 3300005441 Bacteria 3337
71 Ga0070700_100183612 3300005441 Bacteria 1457
72 Ga0070700_101705887 3300005441 Bacteria 540
73 Ga0070694_100257593 3300005444 Bacteria 1322
74 Ga0070694_100974931 3300005444 Bacteria 703
75 Ga0070694_101679256 3300005444 Bacteria 540
76 Ga0070663_100037642 3300005455 Bacteria 3369
77 Ga0070663_100097519 3300005455 Bacteria 2188
78 Ga0070663_100112493 3300005455 Bacteria 2048
79 Ga0070663_100117676 3300005455 Bacteria 2004
80 Ga0070663_100233060 3300005455 Bacteria 1450
81 Ga0070663_100313384 3300005455 Bacteria 1260
82 Ga0070663_100555502 3300005455 Bacteria 960
83 Ga0070678_100190501 3300005456 Bacteria 1686
84 Ga0070678_100481930 3300005456 Bacteria 1091
85 Ga0070678_100695144 3300005456 Bacteria 916
86 Ga0070678_100724818 3300005456 Bacteria 897
87 Ga0070662_100125582 3300005457 Bacteria 1972
88 Ga0070662_100362331 3300005457 Bacteria 1190
89 Ga0070662_100487231 3300005457 Bacteria 1027
90 Ga0070662_100646643 3300005457 Bacteria 892
91 Ga0070662_100977955 3300005457 Bacteria 724
92 Ga0068867_100397502 3300005459 Bacteria 1161
93 Ga0070685_10067798 3300005466 Bacteria 2106
94 Ga0070685_10173375 3300005466 Bacteria 1384
95 Ga0070706_101404912 3300005467 Bacteria 639
96 Ga0070679_101992647 3300005530 Bacteria 530
97 Ga0070684_100448270 3300005535 Bacteria 1193
98 Ga0068853_100007923 3300005539 Bacteria 8517
99 Ga0068853_100011924 3300005539 Bacteria 7068
100 Ga0068853_100059471 3300005539 Bacteria 3301
101 Ga0068853_100231228 3300005539 Bacteria 1692
102 Ga0068853_101237965 3300005539 Bacteria 721
103 Ga0068853_101559320 3300005539 Bacteria 640
104 Ga0068853_102419998 3300005539 Bacteria 508
105 Ga0070672_100097752 3300005543 Bacteria 2377
106 Ga0070672_100155498 3300005543 Bacteria 1894
107 Ga0070672_100664370 3300005543 Bacteria 911
108 Ga0070686_100182949 3300005544 Bacteria 1490
109 Ga0070686_101120078 3300005544 Bacteria 651
110 Ga0070695_100739747 3300005545 Bacteria 784
111 Ga0070696_100530341 3300005546 Bacteria 941
112 Ga0070693_100105724 3300005547 Bacteria 1722
113 Ga0070693_101097177 3300005547 Bacteria 607
114 Ga0070665_100076859 3300005548 Bacteria 3345
115 Ga0070665_100238188 3300005548 Bacteria 1820
116 Ga0070665_100288777 3300005548 Bacteria 1643
117 Ga0070665_100507184 3300005548 Bacteria 1218
118 Ga0070665_100534379 3300005548 Bacteria 1184
119 Ga0070665_100592678 3300005548 Bacteria 1121
120 Ga0070665_100759574 3300005548 Bacteria 982
121 Ga0070665_101223618 3300005548 Bacteria 762
122 Ga0070665_101555229 3300005548 Bacteria 669
123 Ga0070665_101975087 3300005548 Bacteria 589
124 Ga0068855_100009024 3300005563 Bacteria 12048
125 Ga0068855_100074198 3300005563 Bacteria 3951
126 Ga0068855_100321118 3300005563 Bacteria 1711
127 Ga0068857_100007393 3300005577 Bacteria 9460
128 Ga0068857_100419514 3300005577 Bacteria 1247
129 Ga0068854_100002956 3300005578 Bacteria 10542
130 Ga0068854_100166457 3300005578 Bacteria 1712
131 Ga0068854_100441834 3300005578 Bacteria 1084
132 Ga0068856_100001141 3300005614 Bacteria 27918
133 Ga0068856_100115610 3300005614 Bacteria 2683
134 Ga0068856_100205998 3300005614 Bacteria 1981
135 Ga0068856_101604859 3300005614 Bacteria 664
136 Ga0068856_102032266 3300005614 Bacteria 585
137 Ga0068852_100028739 3300005616 Bacteria 4556
138 Ga0068852_100070354 3300005616 Bacteria 3069
139 Ga0068852_100168897 3300005616 Bacteria 2049
140 Ga0068852_100597501 3300005616 Bacteria 1107
141 Ga0068852_101205897 3300005616 Bacteria 778
142 Ga0068852_101234699 3300005616 Bacteria 769
143 Ga0068852_101335945 3300005616 Bacteria 739
144 Ga0068852_101394204 3300005616 Bacteria 723
145 Ga0068852_101861417 3300005616 Bacteria 624
146 Ga0068859_100206093 3300005617 Bacteria 2051
147 Ga0068859_100269457 3300005617 Bacteria 1795
148 Ga0068859_101932108 3300005617 Bacteria 652
149 Ga0068864_100487955 3300005618 Bacteria 1183
150 Ga0068864_100721406 3300005618 Bacteria 975
151 Ga0068864_102416163 3300005618 Bacteria 532
152 Ga0068866_10180508 3300005718 Bacteria 1246
153 Ga0068866_10254791 3300005718 Bacteria 1076
154 Ga0068861_100126078 3300005719 Bacteria 2071
155 Ga0068861_100307101 3300005719 Bacteria 1376
156 Ga0068851_10004446 3300005834 Bacteria 6321
157 Ga0068870_10972495 3300005840 Bacteria 604
158 Ga0068870_11000673 3300005840 Bacteria 596
159 Ga0068863_100238562 3300005841 Bacteria 1755
160 Ga0068863_100429156 3300005841 Bacteria 1295
161 Ga0068863_100693921 3300005841 Bacteria 1012
162 Ga0068858_100239692 3300005842 Bacteria 1720
163 Ga0068858_100411717 3300005842 Bacteria 1299
164 Ga0068858_100742923 3300005842 Bacteria 956
165 Ga0068858_100822415 3300005842 Bacteria 907
166 Ga0068858_100881783 3300005842 Bacteria 874
167 Ga0068858_101421287 3300005842 Bacteria 683
168 Ga0068860_100000629 3300005843 Bacteria 41623
169 Ga0068860_100189232 3300005843 Bacteria 1991
170 Ga0068860_100405756 3300005843 Bacteria 1349
171 Ga0068860_100461129 3300005843 Bacteria 1264
172 Ga0068860_100601928 3300005843 Bacteria 1105
173 Ga0068860_101415225 3300005843 Bacteria 716
174 Ga0068860_101593393 3300005843 Bacteria 675
175 Ga0068862_100050435 3300005844 Bacteria 3557
176 Ga0068862_100083185 3300005844 Bacteria 2779
177 Ga0068862_100142248 3300005844 Bacteria 2130
178 Ga0068862_100814915 3300005844 Bacteria 912
179 Ga0068862_100888065 3300005844 Bacteria 875
180 Ga0068862_100964288 3300005844 Bacteria 841
181 Ga0068862_101517135 3300005844 Bacteria 676
182 Ga0081455_10013601 3300005937 Bacteria 8019
183 Ga0081455_10016717 3300005937 Bacteria 7066
184 Ga0081455_10027621 3300005937 Bacteria 5199
185 Ga0081455_10034056 3300005937 Bacteria 4569
186 Ga0081455_10835919 3300005937 Bacteria 576
187 Ga0081455_11045859 3300005937 Bacteria 505
188 Ga0081538_10009009 3300005981 Bacteria 8382
189 Ga0081538_10132303 3300005981 Bacteria 1170
190 Ga0081540_1007279 3300005983 Bacteria 7924
191 Ga0081540_1007703 3300005983 Bacteria 7633
192 Ga0081540_1007923 3300005983 Bacteria 7497
193 Ga0081540_1014089 3300005983 Bacteria 5149
194 Ga0081540_1022712 3300005983 Bacteria 3698
195 Ga0081540_1052178 3300005983 Bacteria 2016
196 Ga0081540_1103125 3300005983 Bacteria 1224
197 Ga0081540_1161943 3300005983 Bacteria 867
198 Ga0081539_10000319 3300005985 Bacteria 106944
199 Ga0081539_10013438 3300005985 Bacteria 6167
200 Ga0081539_10015119 3300005985 Bacteria 5643
201 Ga0081539_10070518 3300005985 Bacteria 1876
202 Ga0075365_10077933 3300006038 Bacteria 2240
203 Ga0075365_10103512 3300006038 Bacteria 1951
204 Ga0075365_10104837 3300006038 Bacteria 1939
205 Ga0075365_10117468 3300006038 Bacteria 1832
206 Ga0075365_10282268 3300006038 Bacteria 1168
207 Ga0075365_10544887 3300006038 Bacteria 820
208 Ga0075365_11221544 3300006038 Bacteria 529
209 Ga0075368_10059166 3300006042 Bacteria 1532
210 Ga0075368_10249841 3300006042 Bacteria 758
211 Ga0075363_100004884 3300006048 Bacteria 5923
212 Ga0075363_100142115 3300006048 Bacteria 1352
213 Ga0075363_100172757 3300006048 Bacteria 1227
214 Ga0075363_100407209 3300006048 Bacteria 800
215 Ga0075363_100490688 3300006048 Bacteria 728
216 Ga0075363_100520231 3300006048 Bacteria 708
217 Ga0075364_10158860 3300006051 Bacteria 1525
218 Ga0075364_10284733 3300006051 Bacteria 1124
219 Ga0075364_10835477 3300006051 Bacteria 627
220 Ga0075364_11185794 3300006051 Bacteria 518
221 Ga0075432_10135187 3300006058 Bacteria 937
222 Ga0070715_10725175 3300006163 Bacteria 596
223 Ga0070716_100458784 3300006173 Bacteria 931
224 Ga0075362_10170771 3300006177 Bacteria 1050
225 Ga0075362_10287885 3300006177 Bacteria 813
226 Ga0075362_10297284 3300006177 Bacteria 801
227 Ga0075367_10045211 3300006178 Bacteria 2583
228 Ga0075367_10047109 3300006178 Bacteria 2535
229 Ga0075367_10124939 3300006178 Bacteria 1587
230 Ga0075367_10222857 3300006178 Bacteria 1180
231 Ga0075367_10285276 3300006178 Bacteria 1038
232 Ga0075367_10375256 3300006178 Bacteria 898
233 Ga0075369_10027861 3300006186 Bacteria 2364
234 Ga0075369_10108955 3300006186 Bacteria 1247
235 Ga0075369_10441931 3300006186 Bacteria 615
236 Ga0075366_10196113 3300006195 Bacteria 1227
237 Ga0075366_10201604 3300006195 Bacteria 1210
238 Ga0075366_10377971 3300006195 Bacteria 871
239 Ga0075366_10868708 3300006195 Bacteria 561
240 Ga0097621_101189847 3300006237 Bacteria 718
241 Ga0075370_10082719 3300006353 Bacteria 1846
242 Ga0075370_10133458 3300006353 Bacteria 1449
243 Ga0075370_10160781 3300006353 Bacteria 1318
244 Ga0075370_10223690 3300006353 Bacteria 1113
245 Ga0075370_10238137 3300006353 Bacteria 1077
246 Ga0075370_10326426 3300006353 Bacteria 915
247 Ga0075370_10730125 3300006353 Bacteria 603
248 Ga0075370_10977315 3300006353 Bacteria 519
249 Ga0068871_100279203 3300006358 Bacteria 1461
250 Ga0068871_101054498 3300006358 Bacteria 759
251 Ga0068871_101770962 3300006358 Bacteria 586
252 Ga0075428_100554451 3300006844 Bacteria 1229
253 Ga0075428_101024409 3300006844 Bacteria 873
254 Ga0075434_100219535 3300006871 Bacteria 1921
255 Ga0075434_100515704 3300006871 Bacteria 1216
256 Ga0068865_100055935 3300006881 Bacteria 2747
257 Ga0068865_100676323 3300006881 Bacteria 880
258 Ga0068865_101019215 3300006881 Bacteria 726
259 Ga0075436_100283347 3300006914 Bacteria 1185
260 Ga0097620_100206082 3300006931 Bacteria 2051
261 Ga0097620_100269452 3300006931 Bacteria 1795
262 Ga0097620_101932065 3300006931 Bacteria 652
263 Ga0075435_101379124 3300007076 Bacteria 618
264 Ga0105244_10215911 3300009036 Bacteria 901
265 Ga0105250_10067801 3300009092 Bacteria 1440
266 Ga0105250_10444088 3300009092 Bacteria 581
267 Ga0105240_10003265 3300009093 Bacteria 25360
268 Ga0105240_10126516 3300009093 Bacteria 3070
269 Ga0105240_12086876 3300009093 Bacteria 588
270 Ga0111539_11038366 3300009094 Bacteria 953
271 Ga0105245_10261067 3300009098 Bacteria 1686
272 Ga0105245_10509120 3300009098 Bacteria 1221
273 Ga0105245_10961531 3300009098 Bacteria 897
274 Ga0105245_11353989 3300009098 Bacteria 761
275 Ga0105245_11492950 3300009098 Bacteria 727
276 Ga0105247_10165282 3300009101 Bacteria 1468
277 Ga0105247_10202129 3300009101 Bacteria 1336
278 Ga0105247_10202199 3300009101 Bacteria 1335
279 Ga0105247_10442605 3300009101 Bacteria 935
280 Ga0105247_10915544 3300009101 Bacteria 678
281 Ga0105247_10941805 3300009101 Bacteria 670
282 Ga0114129_10885336 3300009147 Bacteria 1132
283 Ga0114129_11117043 3300009147 Bacteria 986
284 Ga0114129_11170825 3300009147 Bacteria 959
285 Ga0105243_10169154 3300009148 Bacteria 1891
286 Ga0105243_11366334 3300009148 Bacteria 728
287 Ga0105243_11427090 3300009148 Bacteria 714
288 Ga0105243_11479176 3300009148 Bacteria 702
289 Ga0105241_10001773 3300009174 Bacteria 16384
290 Ga0105241_11394058 3300009174 Bacteria 671
291 Ga0105242_10023610 3300009176 Bacteria 4847
292 Ga0105242_11734336 3300009176 Bacteria 661
293 Ga0105248_10226481 3300009177 Bacteria 2104
294 Ga0105248_10255991 3300009177 Bacteria 1971
295 Ga0105248_10829040 3300009177 Bacteria 1044
296 Ga0105248_10840169 3300009177 Bacteria 1036
297 Ga0105248_11213833 3300009177 Bacteria 853
298 Ga0105237_10036895 3300009545 Bacteria 4943
299 Ga0105237_10076697 3300009545 Bacteria 3333
300 Ga0105237_10265428 3300009545 Bacteria 1720
301 Ga0105237_10272597 3300009545 Bacteria 1695
302 Ga0105237_10312808 3300009545 Bacteria 1574
303 Ga0105237_10522447 3300009545 Bacteria 1194
304 Ga0105237_10598578 3300009545 Bacteria 1110
305 Ga0105237_10673205 3300009545 Bacteria 1041
306 Ga0105237_10976633 3300009545 Bacteria 854
307 Ga0105237_11678395 3300009545 Bacteria 642
308 Ga0105237_12759596 3300009545 Bacteria 502
309 Ga0105238_10001191 3300009551 Bacteria 26202
310 Ga0105238_10001606 3300009551 Bacteria 22644
311 Ga0105238_10490133 3300009551 Bacteria 1229
312 Ga0105238_10652976 3300009551 Bacteria 1062
313 Ga0105238_11373192 3300009551 Bacteria 733
314 Ga0105238_12132467 3300009551 Bacteria 595
315 Ga0105238_12303292 3300009551 Bacteria 574
316 Ga0105249_10099219 3300009553 Bacteria 2737
317 Ga0105249_10537548 3300009553 Bacteria 1218
318 Ga0105249_11169587 3300009553 Bacteria 840
319 Ga0105249_11756921 3300009553 Bacteria 693
320 Ga0105035_113643 3300009988 Bacteria 736
321 Ga0105239_10004064 3300010375 Bacteria 17666
322 Ga0105239_10088787 3300010375 Bacteria 3409
323 Ga0105239_10140535 3300010375 Bacteria 2690
324 Ga0105239_10232040 3300010375 Bacteria 2070
325 Ga0105239_10289367 3300010375 Bacteria 1845
326 Ga0105239_10723768 3300010375 Bacteria 1138
327 Ga0105239_10735693 3300010375 Bacteria 1129
328 Ga0105239_10908421 3300010375 Bacteria 1011
329 Ga0105239_11120046 3300010375 Bacteria 906
330 Ga0105239_12228302 3300010375 Bacteria 637
331 Ga0105246_10316231 3300011119 Bacteria 1267
332 Ga0105246_10325292 3300011119 Bacteria 1251
333 Ga0105246_10421425 3300011119 Bacteria 1114
334 Ga0105246_11101137 3300011119 Bacteria 725
335 Ga0157314_1053662 3300012500 Bacteria 522
336 Ga0157371_10912392 3300013102 Bacteria 667
337 Ga0157369_11420565 3300013105 Bacteria 706
338 Ga0157374_10016811 3300013296 Bacteria 6437
339 Ga0157374_11033798 3300013296 Bacteria 841
340 Ga0157378_10003012 3300013297 Bacteria 14970
341 Ga0157378_10070155 3300013297 Bacteria 3145
342 Ga0157378_10711303 3300013297 Bacteria 1025
343 Ga0157378_10758735 3300013297 Bacteria 993
344 Ga0163162_10209964 3300013306 Bacteria 2076
345 Ga0163162_10355626 3300013306 Bacteria 1597
346 Ga0163162_10397380 3300013306 Bacteria 1511
347 Ga0163162_10624045 3300013306 Bacteria 1203
348 Ga0163162_10684044 3300013306 Bacteria 1148
349 Ga0163162_11008692 3300013306 Bacteria 941
350 Ga0157375_10467552 3300013308 Bacteria 1426
351 Ga0157375_10619465 3300013308 Bacteria 1240
352 Ga0157375_11159536 3300013308 Bacteria 906
353 Ga0163163_10053892 3300014325 Bacteria 3972
354 Ga0163163_10240660 3300014325 Bacteria 1859
355 Ga0163163_11549094 3300014325 Bacteria 724
356 Ga0163163_12410193 3300014325 Bacteria 585
357 Ga0163163_12736574 3300014325 Bacteria 550
358 Ga0157380_10082723 3300014326 Bacteria 2628
359 Ga0157380_10136400 3300014326 Bacteria 2101
360 Ga0157380_10912994 3300014326 Bacteria 905
361 Ga0182008_10244921 3300014497 Bacteria 923
362 Ga0157377_10285878 3300014745 Bacteria 1083
363 Ga0157379_10096070 3300014968 Bacteria 2660
364 Ga0157379_10400330 3300014968 Bacteria 1262
365 Ga0157379_10616576 3300014968 Bacteria 1014
366 Ga0157376_10173797 3300014969 Bacteria 1964
367 Ga0157376_10836001 3300014969 Bacteria 935
368 Ga0157376_11083761 3300014969 Bacteria 826
369 Ga0157376_11185581 3300014969 Bacteria 791
370 Ga0157376_11785960 3300014969 Bacteria 651
371 Ga0157376_12989255 3300014969 Bacteria 512
372 Ga0163161_10032412 3300017792 Bacteria 3730
373 Ga0163161_10882149 3300017792 Bacteria 757
374 Ga0163161_11805115 3300017792 Bacteria 544
375 Ga0209233_1001794 3300025261 Bacteria 8267
376 Ga0209758_1003578 3300025297 Bacteria 13914
377 Ga0209758_1023468 3300025297 Bacteria 2788
378 Ga0209758_1033522 3300025297 Bacteria 2060
379 Ga0209758_1042224 3300025297 Bacteria 1693
380 Ga0209758_1042900 3300025297 Bacteria 1672
381 Ga0207697_10347724 3300025315 Bacteria 658
382 Ga0207697_10443404 3300025315 Bacteria 576
383 Ga0207656_10038646 3300025321 Bacteria 2014
384 Ga0207653_10015861 3300025885 Bacteria 2364
385 Ga0207642_10176826 3300025899 Bacteria 1159
386 Ga0207710_10204604 3300025900 Bacteria 976
387 Ga0207710_10215337 3300025900 Bacteria 952
388 Ga0207710_10335963 3300025900 Bacteria 768
389 Ga0207688_10038787 3300025901 Bacteria 2645
390 Ga0207688_10096220 3300025901 Bacteria 1705
391 Ga0207688_10373135 3300025901 Bacteria 882
392 Ga0207688_10447267 3300025901 Bacteria 805
393 Ga0207688_10484945 3300025901 Bacteria 773
394 Ga0207688_10697612 3300025901 Bacteria 642
395 Ga0207647_10000220 3300025904 Bacteria 46910
396 Ga0207647_10472912 3300025904 Bacteria 701
397 Ga0207645_10019173 3300025907 Bacteria 4490
398 Ga0207645_10211205 3300025907 Bacteria 1278
399 Ga0207643_10023394 3300025908 Bacteria 3406
400 Ga0207654_10000081 3300025911 Bacteria 62713
401 Ga0207654_10037089 3300025911 Bacteria 2727
402 Ga0207654_10715812 3300025911 Bacteria 720
403 Ga0207695_10000792 3300025913 Bacteria 59401
404 Ga0207695_10097263 3300025913 Bacteria 2945
405 Ga0207671_10021682 3300025914 Bacteria 4869
406 Ga0207671_10113857 3300025914 Bacteria 2061
407 Ga0207671_10134442 3300025914 Bacteria 1901
408 Ga0207671_10203337 3300025914 Bacteria 1547
409 Ga0207671_10206946 3300025914 Bacteria 1534
410 Ga0207671_10595284 3300025914 Bacteria 881
411 Ga0207693_10010367 3300025915 Bacteria 7565
412 Ga0207662_10092949 3300025918 Bacteria 1858
413 Ga0207662_10219139 3300025918 Bacteria 1238
414 Ga0207657_10050142 3300025919 Bacteria 3634
415 Ga0207657_10139684 3300025919 Bacteria 1980
416 Ga0207657_10803287 3300025919 Bacteria 727
417 Ga0207649_10053662 3300025920 Bacteria 2506
418 Ga0207649_10340634 3300025920 Bacteria 1107
419 Ga0207681_10359905 3300025923 Bacteria 1167
420 Ga0207681_10540196 3300025923 Bacteria 958
421 Ga0207694_10000134 3300025924 Bacteria 75759
422 Ga0207694_10637437 3300025924 Bacteria 897
423 Ga0207694_10665489 3300025924 Bacteria 878
424 Ga0207650_10352863 3300025925 Bacteria 1210
425 Ga0207650_10640497 3300025925 Bacteria 895
426 Ga0207659_10066616 3300025926 Bacteria 2614
427 Ga0207659_10947050 3300025926 Bacteria 741
428 Ga0207687_10027489 3300025927 Bacteria 3818
429 Ga0207700_10107132 3300025928 Bacteria 2242
430 Ga0207644_10055357 3300025931 Bacteria 2859
431 Ga0207644_10297163 3300025931 Bacteria 1300
432 Ga0207690_10821331 3300025932 Bacteria 769
433 Ga0207690_11393982 3300025932 Bacteria 586
434 Ga0207706_10057791 3300025933 Bacteria 3417
435 Ga0207706_10073794 3300025933 Bacteria 3000
436 Ga0207706_10503544 3300025933 Bacteria 1045
437 Ga0207706_10702812 3300025933 Bacteria 864
438 Ga0207706_10787560 3300025933 Bacteria 808
439 Ga0207706_10797504 3300025933 Bacteria 802
440 Ga0207706_11096724 3300025933 Bacteria 665
441 Ga0207709_10217342 3300025935 Bacteria 1376
442 Ga0207709_10407525 3300025935 Bacteria 1041
443 Ga0207709_11288466 3300025935 Bacteria 604
444 Ga0207670_10095975 3300025936 Bacteria 2107
445 Ga0207670_10851717 3300025936 Bacteria 762
446 Ga0207670_11117858 3300025936 Bacteria 665
447 Ga0207669_10081813 3300025937 Bacteria 2071
448 Ga0207669_10127658 3300025937 Bacteria 1741
449 Ga0207669_10151814 3300025937 Bacteria 1623
450 Ga0207704_10085080 3300025938 Bacteria 2057
451 Ga0207691_10028768 3300025940 Bacteria 5201
452 Ga0207691_10103330 3300025940 Bacteria 2541
453 Ga0207691_10480480 3300025940 Bacteria 1056
454 Ga0207689_10222243 3300025942 Bacteria 1560
455 Ga0207689_10264155 3300025942 Bacteria 1424
456 Ga0207689_10737686 3300025942 Bacteria 831
457 Ga0207689_10763079 3300025942 Bacteria 816
458 Ga0207689_10780360 3300025942 Bacteria 807
459 Ga0207689_10996401 3300025942 Bacteria 707
460 Ga0207661_11013397 3300025944 Bacteria 765
461 Ga0207679_10385532 3300025945 Bacteria 1229
462 Ga0207667_10056046 3300025949 Bacteria 4141
463 Ga0207667_10772139 3300025949 Bacteria 959
464 Ga0207651_10022407 3300025960 Bacteria 3862
465 Ga0207651_10544506 3300025960 Bacteria 1008
466 Ga0207651_10749961 3300025960 Bacteria 863
467 Ga0207712_10387936 3300025961 Bacteria 1171
468 Ga0207712_10698050 3300025961 Bacteria 885
469 Ga0207668_10034082 3300025972 Bacteria 3378
470 Ga0207668_10082115 3300025972 Bacteria 2340
471 Ga0207668_10084639 3300025972 Bacteria 2311
472 Ga0207668_10311734 3300025972 Bacteria 1302
473 Ga0207668_10413157 3300025972 Bacteria 1144
474 Ga0207668_11984723 3300025972 Bacteria 524
475 Ga0207640_10040455 3300025981 Bacteria 2957
476 Ga0207640_10196603 3300025981 Bacteria 1524
477 Ga0207640_10458157 3300025981 Bacteria 1052
478 Ga0207640_10678179 3300025981 Bacteria 881
479 Ga0207640_11118853 3300025981 Bacteria 697
480 Ga0207658_11410046 3300025986 Bacteria 637
481 Ga0207677_10031096 3300026023 Bacteria 3416
482 Ga0207677_10459042 3300026023 Bacteria 1093
483 Ga0207677_10560016 3300026023 Bacteria 998
484 Ga0207703_10163409 3300026035 Bacteria 1952
485 Ga0207703_10275036 3300026035 Bacteria 1527
486 Ga0207703_11992970 3300026035 Bacteria 557
487 Ga0207639_10018686 3300026041 Bacteria 4929
488 Ga0207639_10089617 3300026041 Bacteria 2458
489 Ga0207639_10104806 3300026041 Bacteria 2293
490 Ga0207639_10143832 3300026041 Bacteria 1990
491 Ga0207639_10930188 3300026041 Bacteria 813
492 Ga0207678_10014126 3300026067 Bacteria 7022
493 Ga0207678_10016014 3300026067 Bacteria 6586
494 Ga0207678_10090781 3300026067 Bacteria 2611
495 Ga0207678_10123902 3300026067 Bacteria 2206
496 Ga0207678_10176810 3300026067 Bacteria 1822
497 Ga0207678_10266557 3300026067 Bacteria 1468
498 Ga0207678_10968055 3300026067 Bacteria 753
499 Ga0207678_11176091 3300026067 Bacteria 679
500 Ga0207708_10131847 3300026075 Bacteria 1954
501 Ga0207708_10191917 3300026075 Bacteria 1626
502 Ga0207708_10273563 3300026075 Bacteria 1367
503 Ga0207708_11491502 3300026075 Bacteria 594
504 Ga0207702_10000180 3300026078 Bacteria 76230
505 Ga0207702_10007101 3300026078 Bacteria 9581
506 Ga0207702_10052831 3300026078 Bacteria 3439
507 Ga0207702_11405224 3300026078 Bacteria 692
508 Ga0207641_10530962 3300026088 Bacteria 1145
509 Ga0207641_10833702 3300026088 Bacteria 913
510 Ga0207641_11143128 3300026088 Bacteria 778
511 Ga0207641_12306901 3300026088 Bacteria 538
512 Ga0207648_10051800 3300026089 Bacteria 3588
513 Ga0207648_10236531 3300026089 Bacteria 1626
514 Ga0207648_12095094 3300026089 Bacteria 527
515 Ga0207676_10244839 3300026095 Bacteria 1611
516 Ga0207676_12568947 3300026095 Bacteria 506
517 Ga0207674_10001084 3300026116 Bacteria 35396
518 Ga0207674_10236426 3300026116 Bacteria 1774
519 Ga0207674_10320840 3300026116 Bacteria 1498
520 Ga0207674_10393425 3300026116 Bacteria 1340
521 Ga0207674_10547036 3300026116 Bacteria 1118
522 Ga0207674_10954081 3300026116 Bacteria 826
523 Ga0207674_11218931 3300026116 Bacteria 722
524 Ga0207675_100038990 3300026118 Bacteria 4434
525 Ga0207675_100041066 3300026118 Bacteria 4320
526 Ga0207675_100286227 3300026118 Bacteria 1602
527 Ga0207675_100546096 3300026118 Bacteria 1157
528 Ga0207675_100587417 3300026118 Bacteria 1116
529 Ga0207683_10074344 3300026121 Bacteria 3006
530 Ga0207683_10125661 3300026121 Bacteria 2305
531 Ga0207683_10208760 3300026121 Bacteria 1777
532 Ga0207683_10462428 3300026121 Bacteria 1170
533 Ga0207683_11341173 3300026121 Bacteria 662
534 Ga0207698_10072960 3300026142 Bacteria 2731
535 Ga0207698_10077770 3300026142 Bacteria 2661
536 Ga0207698_10093849 3300026142 Bacteria 2465
537 Ga0207698_10853098 3300026142 Bacteria 916
538 Ga0207698_11839430 3300026142 Bacteria 621
539 Ga0207698_12751564 3300026142 Bacteria 500
540 Ga0209589_1000009 3300027357 Bacteria 252104
541 Ga0209489_100010 3300027361 Bacteria 252139
542 Ga0209700_100017 3300027363 Bacteria 252104
543 Ga0209813_10075417 3300027866 Bacteria 1105
544 Ga0207428_10605609 3300027907 Bacteria 789
545 Ga0268266_10003694 3300028379 Bacteria 15090
546 Ga0268266_10017382 3300028379 Bacteria 6136
547 Ga0268266_10035331 3300028379 Bacteria 4251
548 Ga0268266_10103809 3300028379 Bacteria 2509
549 Ga0268266_10151456 3300028379 Bacteria 2091
550 Ga0268266_10423798 3300028379 Bacteria 1261
551 Ga0268266_10452550 3300028379 Bacteria 1221
552 Ga0268266_10507319 3300028379 Bacteria 1152
553 Ga0268266_10772311 3300028379 Bacteria 928
554 Ga0268266_10940152 3300028379 Bacteria 836
555 Ga0268266_11680560 3300028379 Bacteria 610
556 Ga0268266_12144439 3300028379 Bacteria 531
557 Ga0268265_10009784 3300028380 Bacteria 6473
558 Ga0268265_10100523 3300028380 Bacteria 2334
559 Ga0268265_10101045 3300028380 Bacteria 2329
560 Ga0268265_10139827 3300028380 Bacteria 2025
561 Ga0268265_10564925 3300028380 Bacteria 1082
562 Ga0268265_10679550 3300028380 Bacteria 992
563 Ga0268265_11377738 3300028380 Bacteria 707
564 Ga0268265_12170440 3300028380 Bacteria 562
565 Ga0268264_10000049 3300028381 Bacteria 329992
566 Ga0268264_10230199 3300028381 Bacteria 1711
567 Ga0268264_10521434 3300028381 Bacteria 1162
568 Ga0268264_10579539 3300028381 Bacteria 1104
569 Ga0268264_10951143 3300028381 Bacteria 864
570 Ga0268264_10987255 3300028381 Bacteria 848
571 Ga0268264_11006473 3300028381 Bacteria 840
572 Ga0307517_10000042 3300028786 Bacteria 166943
573 Ga0307517_10095033 3300028786 Bacteria 2402
574 Ga0307517_10121100 3300028786 Bacteria 1934
575 Ga0307515_10013174 3300028794 Bacteria 15470
576 Ga0307515_10275514 3300028794 Bacteria 1397
577 Ga0307515_10356496 3300028794 Bacteria 1106
578 Ga0307511_10180799 3300030521 Bacteria 1137
579 Ga0307511_10268275 3300030521 Bacteria 801
580 Ga0307513_10253619 3300031456 Bacteria 1554
581 Ga0307509_10037761 3300031507 Bacteria 5277
582 Ga0307509_10232291 3300031507 Bacteria 1646
583 Ga0307509_10454751 3300031507 Bacteria 973
584 Ga0307509_10488992 3300031507 Bacteria 917
585 Ga0307509_10567452 3300031507 Bacteria 811
586 Ga0307509_10570411 3300031507 Bacteria 807
587 Ga0307509_10938408 3300031507 Bacteria 531
588 Ga0307408_100119531 3300031548 Bacteria 2039
589 Ga0307408_100228667 3300031548 Bacteria 1522
590 Ga0307408_101406099 3300031548 Bacteria 657
591 Ga0307508_10140836 3300031616 Bacteria 2015
592 Ga0307508_10232905 3300031616 Bacteria 1440
593 Ga0307508_10288695 3300031616 Bacteria 1234
594 Ga0307516_10063865 3300031730 Bacteria 3563
595 Ga0307516_10178970 3300031730 Bacteria 1855
596 Ga0307516_10190529 3300031730 Bacteria 1777
597 Ga0307516_10352474 3300031730 Bacteria 1137
598 Ga0307516_10898216 3300031730 Bacteria 552
599 Ga0307405_10266196 3300031731 Bacteria 1283
600 Ga0316577_10058388 3300031733 Bacteria 2154
601 Ga0307406_10802396 3300031901 Bacteria 794
602 Ga0307407_11676418 3300031903 Bacteria 506
603 Ga0307412_10952560 3300031911 Bacteria 756
604 Ga0307412_12089279 3300031911 Bacteria 526
605 Ga0307409_100299254 3300031995 Bacteria 1496
606 Ga0307409_100373004 3300031995 Bacteria 1354
607 Ga0307416_100513343 3300032002 Bacteria 1265
608 Ga0307416_101238515 3300032002 Bacteria 852
609 Ga0307416_101346703 3300032002 Bacteria 820
610 Ga0307416_102179164 3300032002 Bacteria 656
611 Ga0307416_102568341 3300032002 Bacteria 607
612 Ga0307414_10484147 3300032004 Bacteria 1092
613 Ga0307411_11159736 3300032005 Bacteria 699
614 Ga0307411_11947198 3300032005 Bacteria 548
615 Ga0307415_100507273 3300032126 Bacteria 1056
616 Ga0307415_100699963 3300032126 Bacteria 914
617 Ga0307415_101421569 3300032126 Bacteria 661
618 Ga0307415_102049327 3300032126 Bacteria 558
619 Ga0307507_10023537 3300033179 Bacteria 6755
620 Ga0315911_1000009 3300033442 Bacteria 379354
621 Ga0316596_1119691 3300033541 Unclassified 716
622 Ga0373959_0023721 3300034820 Bacteria 1195
623 Ga0373928_0088161 3300035084 Bacteria 793
624 Ga0373932_0367905 3300035112 Bacteria 550
625 Ga0373939_0231712 3300035114 Bacteria 711
626 Ga0373943_0130549 3300035170 Bacteria 1344
627 Ga0373943_0729215 3300035170 Bacteria 588
628 Ga0373946_0716995 3300035171 Bacteria 524
629 Ga0373935_0089347 3300035692 Bacteria 2014
630 Ga0373935_1500857 3300035692 Bacteria 505
631 Ga0373927_0068028 3300035695 Bacteria 2304
632 Ga0373927_0252326 3300035695 Bacteria 1160
633 Ga0373933_0518644 3300035724 Bacteria 781
634 Ga0316582_0099907 3300036647 Bacteria 1920
635 Ga0316584_0021455 3300036712 Bacteria 4694
636 Ga0373925_0007093 3300037068 Bacteria 8190
637 Ga0395905_0928175 3300037471 Bacteria 773
638 Ga0316581_0014515 3300037588 Bacteria 2244
639 Ga0395901_0618751 3300038443 Bacteria 1090
640 Ga0439461_0086776 3300041410 Bacteria 745
641 Ga0439466_0122704 3300041411 Bacteria 802
642 Ga0439465_0066541 3300041413 Bacteria 1201
643 Ga0439465_0348574 3300041413 Bacteria 559
644 Ga0451791_0914176 3300041451 Bacteria 564
645 Ga0451793_1818343 3300041452 Bacteria 608
646 Ga0451800_0913300 3300041459 Bacteria 553
647 Ga0451802_0524660 3300041460 Bacteria 790
648 Ga0451802_2102988 3300041460 Bacteria 708
649 Ga0451804_0148726 3300041463 Bacteria 1197
650 Ga0451807_0154486 3300041486 Bacteria 825
651 Ga0451807_0427815 3300041486 Bacteria 817
652 Ga0451833_0792570 3300041491 Bacteria 510
653 Ga0451841_0119800 3300041498 Bacteria 500
654 Ga0451847_0160630 3300041503 Bacteria 737
655 Ga0451843_0166739 3300041509 Bacteria 549
656 Ga0451843_1582574 3300041509 Bacteria 503
657 Ga0451853_2841819 3300041512 Bacteria 641
658 Ga0451853_3380255 3300041512 Bacteria 587
659 Ga0451853_3984957 3300041512 Bacteria 1759
660 Ga0439441_051873 3300042001 Bacteria 847
661 Ga0439445_0054717 3300042004 Bacteria 1083
662 Ga0439455_0047568 3300042012 Bacteria 1114
663 Ga0439455_0248447 3300042012 Bacteria 521
664 Ga0439463_102121 3300042016 Bacteria 740
665 Ga0439458_0149223 3300042157 Bacteria 626
666 Ga0439459_0092830 3300042438 Bacteria 728
667 Ga0451576_2122807 3300045051 Bacteria 578
668 Ga0495617_016262 3300046452 Bacteria 2515
669 Ga0495617_183429 3300046452 Bacteria 658
670 Ga0495627_103606 3300046453 Bacteria 811
671 Ga0495592_0487695 3300046454 Bacteria 767
672 Ga0495603_0067855 3300046455 Bacteria 2098
673 Ga0495603_0075141 3300046455 Bacteria 1984
674 Ga0495590_0045590 3300046457 Bacteria 1529
675 Ga0495590_0331028 3300046457 Bacteria 576
676 Ga0495629_0062789 3300046459 Bacteria 2594
677 Ga0495638_0044288 3300046460 Bacteria 2803
678 Ga0495638_0176165 3300046460 Bacteria 1223
679 Ga0495638_0228721 3300046460 Bacteria 1036
680 Ga0495638_0299620 3300046460 Bacteria 867
681 Ga0495638_0351401 3300046460 Bacteria 778
682 Ga0495641_0142446 3300046461 Bacteria 1071
683 Ga0495651_0281017 3300046462 Bacteria 1124
684 Ga0495650_0188798 3300046471 Bacteria 721
685 Ga0495650_0249731 3300046471 Bacteria 603
686 Ga0495580_0065605 3300046472 Bacteria 2543
687 Ga0495582_0300380 3300046473 Bacteria 923
688 Ga0495605_0111143 3300046474 Bacteria 1250
689 Ga0495605_0482100 3300046474 Bacteria 508
690 Ga0495639_0553135 3300046475 Bacteria 590
691 Ga0495664_0425277 3300046477 Bacteria 797
692 Ga0495584_0051809 3300046491 Bacteria 2066
693 Ga0495584_0096691 3300046491 Bacteria 1491
694 Ga0495584_0590643 3300046491 Bacteria 566
695 Ga0495585_0049531 3300046492 Bacteria 2332
696 Ga0495585_0081746 3300046492 Bacteria 1750
697 Ga0495594_0159836 3300046499 Bacteria 1281
698 Ga0495594_0312031 3300046499 Bacteria 896
699 Ga0495594_0387288 3300046499 Bacteria 795
700 Ga0495596_0049012 3300046500 Bacteria 1656
701 Ga0495596_0054563 3300046500 Bacteria 1563
702 Ga0495596_0186720 3300046500 Bacteria 806
703 Ga0495583_0302426 3300046506 Bacteria 635
704 Ga0495606_0126937 3300046507 Bacteria 1520
705 Ga0495606_0182693 3300046507 Bacteria 1208
706 Ga0495610_0073591 3300046512 Bacteria 1587
707 Ga0495610_0170563 3300046512 Bacteria 913
708 Ga0495616_0174679 3300046513 Bacteria 958
709 Ga0495620_0118071 3300046515 Bacteria 1047
710 Ga0495620_0124706 3300046515 Bacteria 1013
711 Ga0495620_0212026 3300046515 Bacteria 743
712 Ga0495630_0694267 3300046517 Bacteria 779
713 Ga0495631_0037158 3300046518 Bacteria 2171
714 Ga0495631_0078094 3300046518 Bacteria 1429
715 Ga0495631_0267333 3300046518 Bacteria 728
716 Ga0495632_0351035 3300046519 Bacteria 648
717 Ga0495637_0104665 3300046520 Bacteria 1103
718 Ga0495637_0200165 3300046520 Bacteria 734
719 Ga0495637_0316589 3300046520 Bacteria 551
720 Ga0495643_0149324 3300046522 Bacteria 1158
721 Ga0495644_0146523 3300046523 Bacteria 903
722 Ga0495663_0041985 3300046525 Bacteria 1393
723 Ga0495642_0125206 3300046528 Bacteria 1104
724 Ga0495598_0016980 3300046537 Bacteria 1868
725 Ga0495598_0396973 3300046537 Bacteria 538
726 Ga0495598_0426028 3300046537 Bacteria 522
727 Ga0495609_0245598 3300046538 Bacteria 738
728 Ga0495609_0253316 3300046538 Bacteria 724
729 Ga0495621_0047906 3300046539 Bacteria 1520
730 Ga0495621_0158232 3300046539 Bacteria 895
731 Ga0495621_0268996 3300046539 Bacteria 700
732 Ga0495621_0493921 3300046539 Bacteria 527
733 Ga0495597_0229172 3300046542 Bacteria 735
734 Ga0495645_0785433 3300046543 Bacteria 572
735 Ga0495622_0014731 3300046557 Bacteria 3632
736 Ga0495633_0082283 3300046558 Bacteria 1498
737 Ga0495633_0086462 3300046558 Bacteria 1458
738 Ga0495633_0179056 3300046558 Bacteria 976
739 Ga0495633_0309675 3300046558 Bacteria 717
740 Ga0495656_0015674 3300046615 Bacteria 2866
741 Ga0495656_0271012 3300046615 Bacteria 862
742 Ga0495656_0420100 3300046615 Bacteria 701
743 Ga0495668_0024676 3300046616 Bacteria 3419
744 Ga0495668_0077849 3300046616 Bacteria 1821
745 Ga0495668_0081956 3300046616 Bacteria 1770
746 Ga0495668_0112912 3300046616 Bacteria 1486
747 Ga0495668_0155294 3300046616 Bacteria 1253
748 Ga0495668_0239744 3300046616 Bacteria 993
749 Ga0495668_0672614 3300046616 Bacteria 572
750 Ga0495668_0696810 3300046616 Bacteria 562
751 Ga0495634_0258078 3300046642 Bacteria 1064
752 Ga0495625_0414098 3300046660 Bacteria 839
753 Ga0495625_0497661 3300046660 Bacteria 746
754 Ga0495625_0684599 3300046660 Bacteria 607
755 Ga0495635_0224242 3300046663 Bacteria 1271
756 Ga0495659_0122562 3300046664 Bacteria 1025
757 Ga0495661_0526220 3300046665 Bacteria 561
758 Ga0495647_0016193 3300046681 Bacteria 2622
759 Ga0495647_0069764 3300046681 Bacteria 1405
760 Ga0495658_0522492 3300046683 Bacteria 760
761 Ga0495669_0012430 3300046684 Bacteria 3624
762 Ga0495669_0057609 3300046684 Bacteria 1753
763 Ga0495669_0565549 3300046684 Bacteria 553
764 Ga0495624_0095466 3300046690 Bacteria 1833
765 Ga0495670_0163145 3300046691 Bacteria 1171
766 Ga0495670_0228558 3300046691 Bacteria 989
767 Ga0495670_0742343 3300046691 Bacteria 535
768 Ga0495671_0139368 3300046692 Bacteria 1182
769 Ga0495671_0247196 3300046692 Bacteria 861
770 Ga0495671_0327633 3300046692 Bacteria 735
771 Ga0495671_0359046 3300046692 Bacteria 698
772 Ga0495649_0039825 3300046694 Bacteria 2576
773 Ga0495649_0317750 3300046694 Bacteria 791
774 Ga0495649_0352153 3300046694 Bacteria 744
775 Ga0495589_0137975 3300046794 Bacteria 1169
776 Ga0495589_0395761 3300046794 Bacteria 634
777 Ga0495600_0297453 3300046809 Bacteria 1019
778 Ga0495660_0306881 3300046810 Bacteria 717
779 Ga0495581_0075765 3300047315 Bacteria 1946
780 Ga0495581_0078675 3300047315 Bacteria 1908
781 Ga0495676_0736158 3300047321 Bacteria 637
782 Ga0495683_0030790 3300047323 Bacteria 2736
783 Ga0495685_053636 3300047447 Bacteria 1365
784 Ga0495673_0027316 3300047469 Bacteria 2718
785 Ga0495673_0097332 3300047469 Bacteria 1194
786 Ga0495681_0120271 3300047470 Bacteria 1128
787 Ga0495681_0255249 3300047470 Bacteria 691
788 Ga0495686_0100508 3300047472 Bacteria 1745
789 Ga0495686_0128305 3300047472 Bacteria 1506
790 Ga0495686_0132401 3300047472 Bacteria 1477
791 Ga0495686_0330876 3300047472 Bacteria 833
792 Ga0495686_0433520 3300047472 Bacteria 701
793 Ga0495593_0242247 3300047673 Bacteria 903
794 Ga0495602_1049687 3300048088 Bacteria 536
795 Ga0495615_0026889 3300048090 Bacteria 1346
796 Ga0495626_0108052 3300048091 Bacteria 1207
797 Ga0496100_0399108 3300048903 Bacteria 1047
798 Ga0496101_0176581 3300048904 Bacteria 1643
799 Ga0496101_0884969 3300048904 Bacteria 703
800 Ga0496101_1283327 3300048904 Bacteria 573
801 Ga0496101_1310953 3300048904 Bacteria 566
802 Ga0496102_0028484 3300048905 Bacteria 4990
803 Ga0496102_0163988 3300048905 Bacteria 2091
804 Ga0496102_0344679 3300048905 Bacteria 1403
805 Ga0496102_0637455 3300048905 Bacteria 989
806 Ga0496102_0676228 3300048905 Bacteria 955
807 Ga0496103_0913716 3300048906 Bacteria 550
808 Ga0496104_0515655 3300048907 Bacteria 1107
809 Ga0496104_0694799 3300048907 Bacteria 925
810 Ga0496104_1146940 3300048907 Bacteria 681
811 Ga0496104_1502854 3300048907 Bacteria 576
812 Ga0496105_0708798 3300048908 Bacteria 772
813 Ga0496106_0031348 3300048909 Bacteria 3961
814 Ga0496106_0079481 3300048909 Bacteria 2518
815 Ga0496106_0083393 3300048909 Bacteria 2458
816 Ga0496106_0331966 3300048909 Bacteria 1221
817 Ga0496106_0402617 3300048909 Bacteria 1100
818 Ga0496107_0172929 3300048910 Bacteria 1603
819 Ga0496107_0294952 3300048910 Bacteria 1207
820 Ga0496107_0588887 3300048910 Bacteria 822
821 Ga0496107_0760663 3300048910 Bacteria 711
822 Ga0496107_0895403 3300048910 Bacteria 647
823 Ga0496107_1233438 3300048910 Bacteria 537
824 Ga0496108_0364645 3300048911 Bacteria 1261
825 Ga0496108_0449167 3300048911 Bacteria 1126
826 Ga0496108_0476090 3300048911 Bacteria 1091
827 Ga0496109_0057333 3300048912 Bacteria 3555
828 Ga0496109_0408823 3300048912 Bacteria 1282
829 Ga0496109_0532129 3300048912 Bacteria 1109
830 Ga0496109_2048951 3300048912 Bacteria 504
831 Ga0496110_0775581 3300048913 Bacteria 863
832 Ga0496110_0904328 3300048913 Bacteria 789
833 Ga0496110_1307642 3300048913 Bacteria 634
834 Ga0496110_1398468 3300048913 Bacteria 609
835 Ga0496110_1716556 3300048913 Bacteria 538
836 Ga0496111_0256674 3300048914 Bacteria 1297
837 Ga0496112_0733640 3300048915 Bacteria 915
838 Ga0496112_0940162 3300048915 Bacteria 786
839 Ga0496112_1080679 3300048915 Bacteria 721
840 Ga0496113_0178551 3300048916 Bacteria 1683
841 Ga0496114_0115625 3300048917 Bacteria 2302
842 Ga0496114_0494991 3300048917 Bacteria 1081
843 Ga0496114_0613157 3300048917 Bacteria 959
844 Ga0496114_1065289 3300048917 Bacteria 693
845 Ga0496115_0284564 3300048918 Bacteria 1357
846 Ga0496116_0265180 3300048919 Bacteria 844
847 Ga0496116_0409719 3300048919 Bacteria 596
848 Ga0496117_0029946 3300048920 Bacteria 4186
849 Ga0496118_0007295 3300048921 Bacteria 11768
850 Ga0496118_0278022 3300048921 Bacteria 934
851 Ga0496119_0169732 3300048922 Bacteria 1153
852 Ga0496120_0203277 3300048923 Bacteria 958
853 Ga0496120_0418985 3300048923 Bacteria 588
854 Ga0496121_0000261 3300048924 Bacteria 110085
855 Ga0496121_0042455 3300048924 Bacteria 3955
856 Ga0496121_0065417 3300048924 Bacteria 2958
857 Ga0496121_0140078 3300048924 Bacteria 1796
858 Ga0496121_0225640 3300048924 Bacteria 1316
859 Ga0496121_0252388 3300048924 Bacteria 1222
860 Ga0496121_0276436 3300048924 Bacteria 1151
861 Ga0496121_0387590 3300048924 Bacteria 919
862 Ga0496121_0445852 3300048924 Bacteria 835
863 Ga0496121_0632258 3300048924 Bacteria 655
864 Ga0496124_0002237 3300048927 Bacteria 25740
865 Ga0496124_0151001 3300048927 Bacteria 1822
866 Ga0496124_0212962 3300048927 Bacteria 1460
867 Ga0496124_0331389 3300048927 Bacteria 1085
868 Ga0496125_0033256 3300048928 Bacteria 4566
869 Ga0496125_0077454 3300048928 Bacteria 2563
870 Ga0496125_0080727 3300048928 Bacteria 2488
871 Ga0496125_0329518 3300048928 Bacteria 921
872 Ga0496125_0430436 3300048928 Bacteria 762
873 Ga0496126_0013371 3300048929 Bacteria 8353
874 Ga0496126_0056339 3300048929 Bacteria 3553
875 Ga0496126_0061887 3300048929 Bacteria 3360
876 Ga0496126_0175216 3300048929 Bacteria 1825
877 Ga0496126_0236362 3300048929 Bacteria 1528
878 Ga0496126_0419601 3300048929 Bacteria 1082
879 Ga0496126_0448482 3300048929 Bacteria 1039
880 Ga0496126_0612254 3300048929 Bacteria 857
881 Ga0496126_0661747 3300048929 Bacteria 816
882 Ga0496126_1185540 3300048929 Bacteria 562
883 Ga0495678_060538 3300049459 Bacteria 1424
884 Ga0501031_0270770 3300049568 Bacteria 1103
885 Ga0501033_1146802 3300049570 Bacteria 516
886 Ga0501036_0308265 3300049572 Bacteria 1324
887 Ga0501036_0599653 3300049572 Bacteria 914
888 Ga0501038_1135336 3300049574 Bacteria 569
889 Ga0501048_0419880 3300049582 Bacteria 957
890 Ga0501067_0131267 3300049583 Bacteria 1394
891 Ga0501067_0731167 3300049583 Bacteria 557
892 Ga0501069_0315074 3300049585 Bacteria 919
893 Ga0501071_0736461 3300049587 Bacteria 759
894 Ga0501073_0372724 3300049589 Bacteria 986
895 Ga0501074_0449488 3300049590 Bacteria 914
896 Ga0501074_0538345 3300049590 Bacteria 827
897 Ga0501075_1149979 3300049591 Bacteria 589
898 Ga0501076_1566920 3300049592 Bacteria 541
899 Ga0501080_0225512 3300049742 Bacteria 1714
900 Ga0501035_1308097 3300049822 Bacteria 559
901 nmdc:mga03683_181259_c1 3300050489 Bacteria 961
902 nmdc:mga03683_33649_c1 3300050489 Bacteria 2070
903 nmdc:mga03n38_11531_c1 3300050490 Bacteria 3297
904 nmdc:mga03n38_470343_c1 3300050490 Bacteria 702
905 nmdc:mga03n38_476955_c1 3300050490 Bacteria 697
906 nmdc:mga03n38_96272_c1 3300050490 Bacteria 1419
907 nmdc:mga00v17_205470_c1 3300050491 Bacteria 1274
908 nmdc:mga00v17_374805_c1 3300050491 Bacteria 925
909 nmdc:mga0yw44_1104963_c1 3300050492 Bacteria 536
910 nmdc:mga0yw44_124950_c1 3300050492 Bacteria 1660
911 nmdc:mga0yw44_326586_c1 3300050492 Bacteria 1031
912 nmdc:mga0yw44_4202_c1 3300050492 Bacteria 6551
913 nmdc:mga0k408_131917_c1 3300050493 Bacteria 1483
914 nmdc:mga0k408_240339_c1 3300050493 Bacteria 1081
915 nmdc:mga0k408_257595_c1 3300050493 Bacteria 1042
916 nmdc:mga0k408_269622_c1 3300050493 Bacteria 1016
917 nmdc:mga0k408_64864_c1 3300050493 Bacteria 2125
918 nmdc:mga06z11_176191_c1 3300050494 Bacteria 1231
919 nmdc:mga06z11_22056_c1 3300050494 Bacteria 2968
920 nmdc:mga06z11_329268_c1 3300050494 Bacteria 912
921 nmdc:mga06z11_371978_c1 3300050494 Bacteria 858
922 nmdc:mga06z11_515773_c1 3300050494 Bacteria 725
923 nmdc:mga04h51_466242_c1 3300050495 Bacteria 536
924 nmdc:mga04h51_81377_c1 3300050495 Bacteria 1150
925 nmdc:mga07m45_134077_c1 3300050496 Bacteria 1433
926 nmdc:mga07m45_147797_c1 3300050496 Bacteria 1362
927 nmdc:mga07m45_166806_c1 3300050496 Bacteria 1279
928 nmdc:mga07m45_25927_c1 3300050496 Bacteria 2224
929 nmdc:mga07m45_432122_c1 3300050496 Bacteria 764
930 nmdc:mga07m45_4680_c1 3300050496 Bacteria 6717
931 nmdc:mga07m45_614874_c1 3300050496 Bacteria 627
932 nmdc:mga07m45_664497_c1 3300050496 Bacteria 600
933 nmdc:mga05p37_1865429_c1 3300050507 Bacteria 576
934 nmdc:mga06r32_1361939_c1 3300050510 Bacteria 652
935 nmdc:mga0n895_989545_c1 3300050512 Bacteria 823
936 nmdc:mga0rr50_1710215_c1 3300050513 Bacteria 530
937 nmdc:mga0a205_604544_c1 3300050515 Bacteria 949
938 nmdc:mga0sz30_136860_c1 3300050516 Bacteria 1081
939 nmdc:mga0sz30_215795_c1 3300050516 Bacteria 853
940 nmdc:mga0sz30_45780_c1 3300050516 Bacteria 1846
941 nmdc:mga0sz30_86716_c1 3300050516 Bacteria 1359
942 Ga0495601_0044799 3300053077 Bacteria 2781
943 Ga0500610_0384206 3300053079 Bacteria 578
944 Ga0500635_0013469 3300053080 Bacteria 2376
945 Ga0495655_0228142 3300053083 Bacteria 619
946 Ga0500578_0490005 3300053086 Bacteria 693
947 Ga0500644_0352596 3300053088 Bacteria 637
948 Ga0500647_0052623 3300053091 Bacteria 1959
949 Ga0500583_0588883 3300053092 Bacteria 512
950 Ga0500651_0102832 3300053093 Bacteria 1750
951 Ga0500566_0099208 3300053094 Bacteria 1599
952 Ga0500641_0000644 3300053096 Bacteria 12588
953 Ga0500650_0085743 3300053098 Bacteria 1474
954 Ga0500558_199941 3300053106 Bacteria 697
955 Ga0500562_102148 3300053108 Bacteria 780
956 Ga0500569_057155 3300053109 Bacteria 1195
957 Ga0500582_179953 3300053114 Bacteria 720
958 Ga0500594_0144791 3300053118 Bacteria 760
959 Ga0500595_008644 3300053119 Bacteria 4153
960 Ga0500595_083380 3300053119 Bacteria 933
961 Ga0500642_0007569 3300053130 Bacteria 3657
962 Ga0500642_0067196 3300053130 Bacteria 1624
963 Ga0500655_015499 3300053133 Bacteria 1399
964 Ga0500658_0135097 3300053134 Bacteria 1103
965 Ga0500658_0364772 3300053134 Bacteria 662
966 Ga0500561_0043539 3300053137 Bacteria 1196
967 Ga0500568_0091489 3300053139 Bacteria 1147
968 Ga0500577_0018371 3300053142 Bacteria 2247
969 Ga0500577_0145264 3300053142 Bacteria 1003
970 Ga0500577_0243027 3300053142 Bacteria 781
971 Ga0500588_0423525 3300053146 Bacteria 507
972 Ga0500589_035746 3300053147 Bacteria 2319
973 Ga0500604_0092864 3300053151 Bacteria 988
974 Ga0500622_0226290 3300053156 Bacteria 835
975 Ga0500624_113403 3300053157 Bacteria 565
976 Ga0500634_0355527 3300053161 Bacteria 557
977 Ga0500636_0056657 3300053177 Bacteria 2294
978 Ga0500636_0095109 3300053177 Bacteria 1701
979 Ga0500636_0164845 3300053177 Bacteria 1204
980 Ga0500636_0249767 3300053177 Bacteria 905
981 Ga0500637_0378691 3300053178 Bacteria 742
982 Ga0500637_0459607 3300053178 Bacteria 643
983 Ga0500567_136908 3300053723 Bacteria 946
984 Ga0500611_024229 3300053727 Bacteria 1190
985 Ga0500645_014458 3300053730 Bacteria 2513
986 Ga0500645_038284 3300053730 Bacteria 1424
987 Ga0500609_023230 3300053731 Bacteria 849
988 Ga0500609_023345 3300053731 Bacteria 847
989 Ga0500656_027033 3300053732 Bacteria 744
990 Ga0500552_013827 3300053733 Bacteria 1054
991 Ga0500596_011466 3300053735 Bacteria 1355
992 Ga0501084_1119069 3300054114 Bacteria 661
993 Ga0501084_1136673 3300054114 Bacteria 655
994 Ga0501082_0230190 3300060353 Bacteria 1613
995 Ga0530510_0745724 3300061734 Bacteria 747
996 Ga0530510_0827739 3300061734 Bacteria 707
997 2513696437 2513237101 Bacteria 7952346
998 2723842936 2721755755 Bacteria 8322773
999 2793080186
1000 2874606407 2874604998 Bacteria 7834745
1001 2876810278 2876808645 Bacteria 8824342
1002 2879114278 2879110137 Bacteria 8907982
1003 2889033767 2889033259 Bacteria 9099371
1004 2917558118 2917554339 Bacteria 4987857
1005 2922367124 2922361189 Bacteria 7436256
1006 2922390102 2922386360 Bacteria 7017218
1007 8006966655 8006964411 Bacteria 8966052
1008 8006989521 8006984368 Bacteria 9651211
1009 8006997971 8006994254 Bacteria 8309700
1010 8056675001 8056673599 Bacteria 7871253
1011 Ga0207696_1082141
1012 JGI24740J21852_10001094
1013 JGI24740J21852_10005300
1014 JGI24740J21852_10131517
1015 JGI24739J22299_10015149
1016 JGI24737J22298_10003886
1017 JGI24735J21928_10091875
1018 JGI24738J21930_10074740
1019 JGI25406J46586_10002763
1020 JGI25153J46596_10002549
1021 JGI25404J52841_10063360
1022 JGI25404J52841_10125579
1023 JGI25405J52794_10145314
1024 Ga0070676_10068295
1025 Ga0070676_10414962
1026 Ga0070690_100779236
1027 Ga0070670_100816799
1028 Ga0068869_100055250
1029 Ga0068869_100631471
1030 Ga0068869_101061041
1031 Ga0070666_10293230
1032 Ga0070666_10401478
1033 Ga0070666_10580645
1034 Ga0070682_100100067
1035 Ga0070682_100837228
1036 Ga0068868_100567929
1037 Ga0068868_100935413
1038 Ga0068868_101787437
1039 Ga0070660_100047409
1040 Ga0070660_100343184
1041 Ga0070660_100484734
1042 Ga0070660_101033347
1043 Ga0070689_100034415
1044 Ga0070689_101187114
1045 Ga0070689_101334788
1046 Ga0070687_100474966
1047 Ga0070687_100803714
1048 Ga0070661_100082937
1049 Ga0070661_100409163
1050 Ga0070661_100577702
1051 Ga0070692_10319046
1052 Ga0070668_100058572
1053 Ga0070668_100194538
1054 Ga0070668_100288609
1055 Ga0070668_100401393
1056 Ga0070668_100733316
1057 Ga0070668_101134203
1058 Ga0070669_100270436
1059 Ga0070669_100362549
1060 Ga0070669_100450715
1061 Ga0070675_101230000
1062 Ga0070671_100051812
1063 Ga0070671_101571826
1064 Ga0070674_100024631
1065 Ga0070674_101103722
1066 Ga0070673_100528639
1067 Ga0070673_100824262
1068 Ga0070688_100126949
1069 Ga0070688_101344611
1070 Ga0070659_100573664
1071 Ga0070659_101680910
1072 Ga0070667_100360464
1073 Ga0070667_100783740
1074 Ga0070714_100644905
1075 Ga0070701_10087030
1076 Ga0070701_10345491
1077 Ga0070701_11046922
1078 Ga0070711_101564605
1079 Ga0070705_100066694
1080 Ga0070700_100028185
1081 Ga0070700_100183612
1082 Ga0070700_101705887
1083 Ga0070694_100257593
1084 Ga0070694_100974931
1085 Ga0070694_101679256
1086 Ga0070663_100037642
1087 Ga0070663_100097519
1088 Ga0070663_100112493
1089 Ga0070663_100117676
1090 Ga0070663_100233060
1091 Ga0070663_100313384
1092 Ga0070663_100555502
1093 Ga0070678_100190501
1094 Ga0070678_100481930
1095 Ga0070678_100695144
1096 Ga0070678_100724818
1097 Ga0070662_100125582
1098 Ga0070662_100362331
1099 Ga0070662_100487231
1100 Ga0070662_100646643
1101 Ga0070662_100977955
1102 Ga0068867_100397502
1103 Ga0070685_10067798
1104 Ga0070685_10173375
1105 Ga0070706_101404912
1106 Ga0070679_101992647
1107 Ga0070684_100448270
1108 Ga0068853_100007923
1109 Ga0068853_100011924
1110 Ga0068853_100059471
1111 Ga0068853_100231228
1112 Ga0068853_101237965
1113 Ga0068853_101559320
1114 Ga0068853_102419998
1115 Ga0070672_100097752
1116 Ga0070672_100155498
1117 Ga0070672_100664370
1118 Ga0070686_100182949
1119 Ga0070686_101120078
1120 Ga0070695_100739747
1121 Ga0070696_100530341
1122 Ga0070693_100105724
1123 Ga0070693_101097177
1124 Ga0070665_100076859
1125 Ga0070665_100238188
1126 Ga0070665_100288777
1127 Ga0070665_100507184
1128 Ga0070665_100534379
1129 Ga0070665_100592678
1130 Ga0070665_100759574
1131 Ga0070665_101223618
1132 Ga0070665_101555229
1133 Ga0070665_101975087
1134 Ga0068855_100009024
1135 Ga0068855_100074198
1136 Ga0068855_100321118
1137 Ga0068857_100007393
1138 Ga0068857_100419514
1139 Ga0068854_100002956
1140 Ga0068854_100166457
1141 Ga0068854_100441834
1142 Ga0068856_100001141
1143 Ga0068856_100115610
1144 Ga0068856_100205998
1145 Ga0068856_101604859
1146 Ga0068856_102032266
1147 Ga0068852_100028739
1148 Ga0068852_100070354
1149 Ga0068852_100168897
1150 Ga0068852_100597501
1151 Ga0068852_101205897
1152 Ga0068852_101234699
1153 Ga0068852_101335945
1154 Ga0068852_101394204
1155 Ga0068852_101861417
1156 Ga0068859_100206093
1157 Ga0068859_100269457
1158 Ga0068859_101932108
1159 Ga0068864_100487955
1160 Ga0068864_100721406
1161 Ga0068864_102416163
1162 Ga0068866_10180508
1163 Ga0068866_10254791
1164 Ga0068861_100126078
1165 Ga0068861_100307101
1166 Ga0068851_10004446
1167 Ga0068870_10972495
1168 Ga0068870_11000673
1169 Ga0068863_100238562
1170 Ga0068863_100429156
1171 Ga0068863_100693921
1172 Ga0068858_100239692
1173 Ga0068858_100411717
1174 Ga0068858_100742923
1175 Ga0068858_100822415
1176 Ga0068858_100881783
1177 Ga0068858_101421287
1178 Ga0068860_100000629
1179 Ga0068860_100189232
1180 Ga0068860_100405756
1181 Ga0068860_100461129
1182 Ga0068860_100601928
1183 Ga0068860_101415225
1184 Ga0068860_101593393
1185 Ga0068862_100050435
1186 Ga0068862_100083185
1187 Ga0068862_100142248
1188 Ga0068862_100814915
1189 Ga0068862_100888065
1190 Ga0068862_100964288
1191 Ga0068862_101517135
1192 Ga0081455_10013601
1193 Ga0081455_10016717
1194 Ga0081455_10027621
1195 Ga0081455_10034056
1196 Ga0081455_10835919
1197 Ga0081455_11045859
1198 Ga0081538_10009009
1199 Ga0081538_10132303
1200 Ga0081540_1007279
1201 Ga0081540_1007703
1202 Ga0081540_1007923
1203 Ga0081540_1014089
1204 Ga0081540_1022712
1205 Ga0081540_1052178
1206 Ga0081540_1103125
1207 Ga0081540_1161943
1208 Ga0081539_10000319
1209 Ga0081539_10013438
1210 Ga0081539_10015119
1211 Ga0081539_10070518
1212 Ga0075365_10077933
1213 Ga0075365_10103512
1214 Ga0075365_10104837
1215 Ga0075365_10117468
1216 Ga0075365_10282268
1217 Ga0075365_10544887
1218 Ga0075365_11221544
1219 Ga0075368_10059166
1220 Ga0075368_10249841
1221 Ga0075363_100004884
1222 Ga0075363_100142115
1223 Ga0075363_100172757
1224 Ga0075363_100407209
1225 Ga0075363_100490688
1226 Ga0075363_100520231
1227 Ga0075364_10158860
1228 Ga0075364_10284733
1229 Ga0075364_10835477
1230 Ga0075364_11185794
1231 Ga0075432_10135187
1232 Ga0070715_10725175
1233 Ga0070716_100458784
1234 Ga0075362_10170771
1235 Ga0075362_10287885
1236 Ga0075362_10297284
1237 Ga0075367_10045211
1238 Ga0075367_10047109
1239 Ga0075367_10124939
1240 Ga0075367_10222857
1241 Ga0075367_10285276
1242 Ga0075367_10375256
1243 Ga0075369_10027861
1244 Ga0075369_10108955
1245 Ga0075369_10441931
1246 Ga0075366_10196113
1247 Ga0075366_10201604
1248 Ga0075366_10377971
1249 Ga0075366_10868708
1250 Ga0097621_101189847
1251 Ga0075370_10082719
1252 Ga0075370_10133458
1253 Ga0075370_10160781
1254 Ga0075370_10223690
1255 Ga0075370_10238137
1256 Ga0075370_10326426
1257 Ga0075370_10730125
1258 Ga0075370_10977315
1259 Ga0068871_100279203
1260 Ga0068871_101054498
1261 Ga0068871_101770962
1262 Ga0075428_100554451
1263 Ga0075428_101024409
1264 Ga0075434_100219535
1265 Ga0075434_100515704
1266 Ga0068865_100055935
1267 Ga0068865_100676323
1268 Ga0068865_101019215
1269 Ga0075436_100283347
1270 Ga0097620_100206082
1271 Ga0097620_100269452
1272 Ga0097620_101932065
1273 Ga0075435_101379124
1274 Ga0105244_10215911
1275 Ga0105250_10067801
1276 Ga0105250_10444088
1277 Ga0105240_10003265
1278 Ga0105240_10126516
1279 Ga0105240_12086876
1280 Ga0111539_11038366
1281 Ga0105245_10261067
1282 Ga0105245_10509120
1283 Ga0105245_10961531
1284 Ga0105245_11353989
1285 Ga0105245_11492950
1286 Ga0105247_10165282
1287 Ga0105247_10202129
1288 Ga0105247_10202199
1289 Ga0105247_10442605
1290 Ga0105247_10915544
1291 Ga0105247_10941805
1292 Ga0114129_10885336
1293 Ga0114129_11117043
1294 Ga0114129_11170825
1295 Ga0105243_10169154
1296 Ga0105243_11366334
1297 Ga0105243_11427090
1298 Ga0105243_11479176
1299 Ga0105241_10001773
1300 Ga0105241_11394058
1301 Ga0105242_10023610
1302 Ga0105242_11734336
1303 Ga0105248_10226481
1304 Ga0105248_10255991
1305 Ga0105248_10829040
1306 Ga0105248_10840169
1307 Ga0105248_11213833
1308 Ga0105237_10036895
1309 Ga0105237_10076697
1310 Ga0105237_10265428
1311 Ga0105237_10272597
1312 Ga0105237_10312808
1313 Ga0105237_10522447
1314 Ga0105237_10598578
1315 Ga0105237_10673205
1316 Ga0105237_10976633
1317 Ga0105237_11678395
1318 Ga0105237_12759596
1319 Ga0105238_10001191
1320 Ga0105238_10001606
1321 Ga0105238_10490133
1322 Ga0105238_10652976
1323 Ga0105238_11373192
1324 Ga0105238_12132467
1325 Ga0105238_12303292
1326 Ga0105249_10099219
1327 Ga0105249_10537548
1328 Ga0105249_11169587
1329 Ga0105249_11756921
1330 Ga0105035_113643
1331 Ga0105239_10004064
1332 Ga0105239_10088787
1333 Ga0105239_10140535
1334 Ga0105239_10232040
1335 Ga0105239_10289367
1336 Ga0105239_10723768
1337 Ga0105239_10735693
1338 Ga0105239_10908421
1339 Ga0105239_11120046
1340 Ga0105239_12228302
1341 Ga0105246_10316231
1342 Ga0105246_10325292
1343 Ga0105246_10421425
1344 Ga0105246_11101137
1345 Ga0157314_1053662
1346 Ga0157371_10912392
1347 Ga0157369_11420565
1348 Ga0157374_10016811
1349 Ga0157374_11033798
1350 Ga0157378_10003012
1351 Ga0157378_10070155
1352 Ga0157378_10711303
1353 Ga0157378_10758735
1354 Ga0163162_10209964
1355 Ga0163162_10355626
1356 Ga0163162_10397380
1357 Ga0163162_10624045
1358 Ga0163162_10684044
1359 Ga0163162_11008692
1360 Ga0157375_10467552
1361 Ga0157375_10619465
1362 Ga0157375_11159536
1363 Ga0163163_10053892
1364 Ga0163163_10240660
1365 Ga0163163_11549094
1366 Ga0163163_12410193
1367 Ga0163163_12736574
1368 Ga0157380_10082723
1369 Ga0157380_10136400
1370 Ga0157380_10912994
1371 Ga0182008_10244921
1372 Ga0157377_10285878
1373 Ga0157379_10096070
1374 Ga0157379_10400330
1375 Ga0157379_10616576
1376 Ga0157376_10173797
1377 Ga0157376_10836001
1378 Ga0157376_11083761
1379 Ga0157376_11185581
1380 Ga0157376_11785960
1381 Ga0157376_12989255
1382 Ga0163161_10032412
1383 Ga0163161_10882149
1384 Ga0163161_11805115
1385 Ga0209233_1001794
1386 Ga0209758_1003578
1387 Ga0209758_1023468
1388 Ga0209758_1033522
1389 Ga0209758_1042224
1390 Ga0209758_1042900
1391 Ga0207697_10347724
1392 Ga0207697_10443404
1393 Ga0207656_10038646
1394 Ga0207653_10015861
1395 Ga0207642_10176826
1396 Ga0207710_10204604
1397 Ga0207710_10215337
1398 Ga0207710_10335963
1399 Ga0207688_10038787
1400 Ga0207688_10096220
1401 Ga0207688_10373135
1402 Ga0207688_10447267
1403 Ga0207688_10484945
1404 Ga0207688_10697612
1405 Ga0207647_10000220
1406 Ga0207647_10472912
1407 Ga0207645_10019173
1408 Ga0207645_10211205
1409 Ga0207643_10023394
1410 Ga0207654_10000081
1411 Ga0207654_10037089
1412 Ga0207654_10715812
1413 Ga0207695_10000792
1414 Ga0207695_10097263
1415 Ga0207671_10021682
1416 Ga0207671_10113857
1417 Ga0207671_10134442
1418 Ga0207671_10203337
1419 Ga0207671_10206946
1420 Ga0207671_10595284
1421 Ga0207693_10010367
1422 Ga0207662_10092949
1423 Ga0207662_10219139
1424 Ga0207657_10050142
1425 Ga0207657_10139684
1426 Ga0207657_10803287
1427 Ga0207649_10053662
1428 Ga0207649_10340634
1429 Ga0207681_10359905
1430 Ga0207681_10540196
1431 Ga0207694_10000134
1432 Ga0207694_10637437
1433 Ga0207694_10665489
1434 Ga0207650_10352863
1435 Ga0207650_10640497
1436 Ga0207659_10066616
1437 Ga0207659_10947050
1438 Ga0207687_10027489
1439 Ga0207700_10107132
1440 Ga0207644_10055357
1441 Ga0207644_10297163
1442 Ga0207690_10821331
1443 Ga0207690_11393982
1444 Ga0207706_10057791
1445 Ga0207706_10073794
1446 Ga0207706_10503544
1447 Ga0207706_10702812
1448 Ga0207706_10787560
1449 Ga0207706_10797504
1450 Ga0207706_11096724
1451 Ga0207709_10217342
1452 Ga0207709_10407525
1453 Ga0207709_11288466
1454 Ga0207670_10095975
1455 Ga0207670_10851717
1456 Ga0207670_11117858
1457 Ga0207669_10081813
1458 Ga0207669_10127658
1459 Ga0207669_10151814
1460 Ga0207704_10085080
1461 Ga0207691_10028768
1462 Ga0207691_10103330
1463 Ga0207691_10480480
1464 Ga0207689_10222243
1465 Ga0207689_10264155
1466 Ga0207689_10737686
1467 Ga0207689_10763079
1468 Ga0207689_10780360
1469 Ga0207689_10996401
1470 Ga0207661_11013397
1471 Ga0207679_10385532
1472 Ga0207667_10056046
1473 Ga0207667_10772139
1474 Ga0207651_10022407
1475 Ga0207651_10544506
1476 Ga0207651_10749961
1477 Ga0207712_10387936
1478 Ga0207712_10698050
1479 Ga0207668_10034082
1480 Ga0207668_10082115
1481 Ga0207668_10084639
1482 Ga0207668_10311734
1483 Ga0207668_10413157
1484 Ga0207668_11984723
1485 Ga0207640_10040455
1486 Ga0207640_10196603
1487 Ga0207640_10458157
1488 Ga0207640_10678179
1489 Ga0207640_11118853
1490 Ga0207658_11410046
1491 Ga0207677_10031096
1492 Ga0207677_10459042
1493 Ga0207677_10560016
1494 Ga0207703_10163409
1495 Ga0207703_10275036
1496 Ga0207703_11992970
1497 Ga0207639_10018686
1498 Ga0207639_10089617
1499 Ga0207639_10104806
1500 Ga0207639_10143832
1501 Ga0207639_10930188
1502 Ga0207678_10014126
1503 Ga0207678_10016014
1504 Ga0207678_10090781
1505 Ga0207678_10123902
1506 Ga0207678_10176810
1507 Ga0207678_10266557
1508 Ga0207678_10968055
1509 Ga0207678_11176091
1510 Ga0207708_10131847
1511 Ga0207708_10191917
1512 Ga0207708_10273563
1513 Ga0207708_11491502
1514 Ga0207702_10000180
1515 Ga0207702_10007101
1516 Ga0207702_10052831
1517 Ga0207702_11405224
1518 Ga0207641_10530962
1519 Ga0207641_10833702
1520 Ga0207641_11143128
1521 Ga0207641_12306901
1522 Ga0207648_10051800
1523 Ga0207648_10236531
1524 Ga0207648_12095094
1525 Ga0207676_10244839
1526 Ga0207676_12568947
1527 Ga0207674_10001084
1528 Ga0207674_10236426
1529 Ga0207674_10320840
1530 Ga0207674_10393425
1531 Ga0207674_10547036
1532 Ga0207674_10954081
1533 Ga0207674_11218931
1534 Ga0207675_100038990
1535 Ga0207675_100041066
1536 Ga0207675_100286227
1537 Ga0207675_100546096
1538 Ga0207675_100587417
1539 Ga0207683_10074344
1540 Ga0207683_10125661
1541 Ga0207683_10208760
1542 Ga0207683_10462428
1543 Ga0207683_11341173
1544 Ga0207698_10072960
1545 Ga0207698_10077770
1546 Ga0207698_10093849
1547 Ga0207698_10853098
1548 Ga0207698_11839430
1549 Ga0207698_12751564
1550 Ga0209589_1000009
1551 Ga0209489_100010
1552 Ga0209700_100017
1553 Ga0209813_10075417
1554 Ga0207428_10605609
1555 Ga0268266_10003694
1556 Ga0268266_10017382
1557 Ga0268266_10035331
1558 Ga0268266_10103809
1559 Ga0268266_10151456
1560 Ga0268266_10423798
1561 Ga0268266_10452550
1562 Ga0268266_10507319
1563 Ga0268266_10772311
1564 Ga0268266_10940152
1565 Ga0268266_11680560
1566 Ga0268266_12144439
1567 Ga0268265_10009784
1568 Ga0268265_10100523
1569 Ga0268265_10101045
1570 Ga0268265_10139827
1571 Ga0268265_10564925
1572 Ga0268265_10679550
1573 Ga0268265_11377738
1574 Ga0268265_12170440
1575 Ga0268264_10000049
1576 Ga0268264_10230199
1577 Ga0268264_10521434
1578 Ga0268264_10579539
1579 Ga0268264_10951143
1580 Ga0268264_10987255
1581 Ga0268264_11006473
1582 Ga0307517_10000042
1583 Ga0307517_10095033
1584 Ga0307517_10121100
1585 Ga0307515_10013174
1586 Ga0307515_10275514
1587 Ga0307515_10356496
1588 Ga0307511_10180799
1589 Ga0307511_10268275
1590 Ga0307513_10253619
1591 Ga0307509_10037761
1592 Ga0307509_10232291
1593 Ga0307509_10454751
1594 Ga0307509_10488992
1595 Ga0307509_10567452
1596 Ga0307509_10570411
1597 Ga0307509_10938408
1598 Ga0307408_100119531
1599 Ga0307408_100228667
1600 Ga0307408_101406099
1601 Ga0307508_10140836
1602 Ga0307508_10232905
1603 Ga0307508_10288695
1604 Ga0307516_10063865
1605 Ga0307516_10178970
1606 Ga0307516_10190529
1607 Ga0307516_10352474
1608 Ga0307516_10898216
1609 Ga0307405_10266196
1610 Ga0316577_10058388
1611 Ga0307406_10802396
1612 Ga0307407_11676418
1613 Ga0307412_10952560
1614 Ga0307412_12089279
1615 Ga0307409_100299254
1616 Ga0307409_100373004
1617 Ga0307416_100513343
1618 Ga0307416_101238515
1619 Ga0307416_101346703
1620 Ga0307416_102179164
1621 Ga0307416_102568341
1622 Ga0307414_10484147
1623 Ga0307411_11159736
1624 Ga0307411_11947198
1625 Ga0307415_100507273
1626 Ga0307415_100699963
1627 Ga0307415_101421569
1628 Ga0307415_102049327
1629 Ga0307507_10023537
1630 Ga0315911_1000009
1631 Ga0316596_1119691
1632 Ga0373959_0023721
1633 Ga0373928_0088161
1634 Ga0373932_0367905
1635 Ga0373939_0231712
1636 Ga0373943_0130549
1637 Ga0373943_0729215
1638 Ga0373946_0716995
1639 Ga0373935_0089347
1640 Ga0373935_1500857
1641 Ga0373927_0068028
1642 Ga0373927_0252326
1643 Ga0373933_0518644
1644 Ga0316582_0099907
1645 Ga0316584_0021455
1646 Ga0373925_0007093
1647 Ga0395905_0928175
1648 Ga0316581_0014515
1649 Ga0395901_0618751
1650 Ga0439461_0086776
1651 Ga0439466_0122704
1652 Ga0439465_0066541
1653 Ga0439465_0348574
1654 Ga0451791_0914176
1655 Ga0451793_1818343
1656 Ga0451800_0913300
1657 Ga0451802_0524660
1658 Ga0451802_2102988
1659 Ga0451804_0148726
1660 Ga0451807_0154486
1661 Ga0451807_0427815
1662 Ga0451833_0792570
1663 Ga0451841_0119800
1664 Ga0451847_0160630
1665 Ga0451843_0166739
1666 Ga0451843_1582574
1667 Ga0451853_2841819
1668 Ga0451853_3380255
1669 Ga0451853_3984957
1670 Ga0439441_051873
1671 Ga0439445_0054717
1672 Ga0439455_0047568
1673 Ga0439455_0248447
1674 Ga0439463_102121
1675 Ga0439458_0149223
1676 Ga0439459_0092830
1677 Ga0451576_2122807
1678 Ga0495617_016262
1679 Ga0495617_183429
1680 Ga0495627_103606
1681 Ga0495592_0487695
1682 Ga0495603_0067855
1683 Ga0495603_0075141
1684 Ga0495590_0045590
1685 Ga0495590_0331028
1686 Ga0495629_0062789
1687 Ga0495638_0044288
1688 Ga0495638_0176165
1689 Ga0495638_0228721
1690 Ga0495638_0299620
1691 Ga0495638_0351401
1692 Ga0495641_0142446
1693 Ga0495651_0281017
1694 Ga0495650_0188798
1695 Ga0495650_0249731
1696 Ga0495580_0065605
1697 Ga0495582_0300380
1698 Ga0495605_0111143
1699 Ga0495605_0482100
1700 Ga0495639_0553135
1701 Ga0495664_0425277
1702 Ga0495584_0051809
1703 Ga0495584_0096691
1704 Ga0495584_0590643
1705 Ga0495585_0049531
1706 Ga0495585_0081746
1707 Ga0495594_0159836
1708 Ga0495594_0312031
1709 Ga0495594_0387288
1710 Ga0495596_0049012
1711 Ga0495596_0054563
1712 Ga0495596_0186720
1713 Ga0495583_0302426
1714 Ga0495606_0126937
1715 Ga0495606_0182693
1716 Ga0495610_0073591
1717 Ga0495610_0170563
1718 Ga0495616_0174679
1719 Ga0495620_0118071
1720 Ga0495620_0124706
1721 Ga0495620_0212026
1722 Ga0495630_0694267
1723 Ga0495631_0037158
1724 Ga0495631_0078094
1725 Ga0495631_0267333
1726 Ga0495632_0351035
1727 Ga0495637_0104665
1728 Ga0495637_0200165
1729 Ga0495637_0316589
1730 Ga0495643_0149324
1731 Ga0495644_0146523
1732 Ga0495663_0041985
1733 Ga0495642_0125206
1734 Ga0495598_0016980
1735 Ga0495598_0396973
1736 Ga0495598_0426028
1737 Ga0495609_0245598
1738 Ga0495609_0253316
1739 Ga0495621_0047906
1740 Ga0495621_0158232
1741 Ga0495621_0268996
1742 Ga0495621_0493921
1743 Ga0495597_0229172
1744 Ga0495645_0785433
1745 Ga0495622_0014731
1746 Ga0495633_0082283
1747 Ga0495633_0086462
1748 Ga0495633_0179056
1749 Ga0495633_0309675
1750 Ga0495656_0015674
1751 Ga0495656_0271012
1752 Ga0495656_0420100
1753 Ga0495668_0024676
1754 Ga0495668_0077849
1755 Ga0495668_0081956
1756 Ga0495668_0112912
1757 Ga0495668_0155294
1758 Ga0495668_0239744
1759 Ga0495668_0672614
1760 Ga0495668_0696810
1761 Ga0495634_0258078
1762 Ga0495625_0414098
1763 Ga0495625_0497661
1764 Ga0495625_0684599
1765 Ga0495635_0224242
1766 Ga0495659_0122562
1767 Ga0495661_0526220
1768 Ga0495647_0016193
1769 Ga0495647_0069764
1770 Ga0495658_0522492
1771 Ga0495669_0012430
1772 Ga0495669_0057609
1773 Ga0495669_0565549
1774 Ga0495624_0095466
1775 Ga0495670_0163145
1776 Ga0495670_0228558
1777 Ga0495670_0742343
1778 Ga0495671_0139368
1779 Ga0495671_0247196
1780 Ga0495671_0327633
1781 Ga0495671_0359046
1782 Ga0495649_0039825
1783 Ga0495649_0317750
1784 Ga0495649_0352153
1785 Ga0495589_0137975
1786 Ga0495589_0395761
1787 Ga0495600_0297453
1788 Ga0495660_0306881
1789 Ga0495581_0075765
1790 Ga0495581_0078675
1791 Ga0495676_0736158
1792 Ga0495683_0030790
1793 Ga0495685_053636
1794 Ga0495673_0027316
1795 Ga0495673_0097332
1796 Ga0495681_0120271
1797 Ga0495681_0255249
1798 Ga0495686_0100508
1799 Ga0495686_0128305
1800 Ga0495686_0132401
1801 Ga0495686_0330876
1802 Ga0495686_0433520
1803 Ga0495593_0242247
1804 Ga0495602_1049687
1805 Ga0495615_0026889
1806 Ga0495626_0108052
1807 Ga0496100_0399108
1808 Ga0496101_0176581
1809 Ga0496101_0884969
1810 Ga0496101_1283327
1811 Ga0496101_1310953
1812 Ga0496102_0028484
1813 Ga0496102_0163988
1814 Ga0496102_0344679
1815 Ga0496102_0637455
1816 Ga0496102_0676228
1817 Ga0496103_0913716
1818 Ga0496104_0515655
1819 Ga0496104_0694799
1820 Ga0496104_1146940
1821 Ga0496104_1502854
1822 Ga0496105_0708798
1823 Ga0496106_0031348
1824 Ga0496106_0079481
1825 Ga0496106_0083393
1826 Ga0496106_0331966
1827 Ga0496106_0402617
1828 Ga0496107_0172929
1829 Ga0496107_0294952
1830 Ga0496107_0588887
1831 Ga0496107_0760663
1832 Ga0496107_0895403
1833 Ga0496107_1233438
1834 Ga0496108_0364645
1835 Ga0496108_0449167
1836 Ga0496108_0476090
1837 Ga0496109_0057333
1838 Ga0496109_0408823
1839 Ga0496109_0532129
1840 Ga0496109_2048951
1841 Ga0496110_0775581
1842 Ga0496110_0904328
1843 Ga0496110_1307642
1844 Ga0496110_1398468
1845 Ga0496110_1716556
1846 Ga0496111_0256674
1847 Ga0496112_0733640
1848 Ga0496112_0940162
1849 Ga0496112_1080679
1850 Ga0496113_0178551
1851 Ga0496114_0115625
1852 Ga0496114_0494991
1853 Ga0496114_0613157
1854 Ga0496114_1065289
1855 Ga0496115_0284564
1856 Ga0496116_0265180
1857 Ga0496116_0409719
1858 Ga0496117_0029946
1859 Ga0496118_0007295
1860 Ga0496118_0278022
1861 Ga0496119_0169732
1862 Ga0496120_0203277
1863 Ga0496120_0418985
1864 Ga0496121_0000261
1865 Ga0496121_0042455
1866 Ga0496121_0065417
1867 Ga0496121_0140078
1868 Ga0496121_0225640
1869 Ga0496121_0252388
1870 Ga0496121_0276436
1871 Ga0496121_0387590
1872 Ga0496121_0445852
1873 Ga0496121_0632258
1874 Ga0496124_0002237
1875 Ga0496124_0151001
1876 Ga0496124_0212962
1877 Ga0496124_0331389
1878 Ga0496125_0033256
1879 Ga0496125_0077454
1880 Ga0496125_0080727
1881 Ga0496125_0329518
1882 Ga0496125_0430436
1883 Ga0496126_0013371
1884 Ga0496126_0056339
1885 Ga0496126_0061887
1886 Ga0496126_0175216
1887 Ga0496126_0236362
1888 Ga0496126_0419601
1889 Ga0496126_0448482
1890 Ga0496126_0612254
1891 Ga0496126_0661747
1892 Ga0496126_1185540
1893 Ga0495678_060538
1894 Ga0501031_0270770
1895 Ga0501033_1146802
1896 Ga0501036_0308265
1897 Ga0501036_0599653
1898 Ga0501038_1135336
1899 Ga0501048_0419880
1900 Ga0501067_0131267
1901 Ga0501067_0731167
1902 Ga0501069_0315074
1903 Ga0501071_0736461
1904 Ga0501073_0372724
1905 Ga0501074_0449488
1906 Ga0501074_0538345
1907 Ga0501075_1149979
1908 Ga0501076_1566920
1909 Ga0501080_0225512
1910 Ga0501035_1308097
1911 nmdc:mga03683_181259_c1
1912 nmdc:mga03683_33649_c1
1913 nmdc:mga03n38_11531_c1
1914 nmdc:mga03n38_470343_c1
1915 nmdc:mga03n38_476955_c1
1916 nmdc:mga03n38_96272_c1
1917 nmdc:mga00v17_205470_c1
1918 nmdc:mga00v17_374805_c1
1919 nmdc:mga0yw44_1104963_c1
1920 nmdc:mga0yw44_124950_c1
1921 nmdc:mga0yw44_326586_c1
1922 nmdc:mga0yw44_4202_c1
1923 nmdc:mga0k408_131917_c1
1924 nmdc:mga0k408_240339_c1
1925 nmdc:mga0k408_257595_c1
1926 nmdc:mga0k408_269622_c1
1927 nmdc:mga0k408_64864_c1
1928 nmdc:mga06z11_176191_c1
1929 nmdc:mga06z11_22056_c1
1930 nmdc:mga06z11_329268_c1
1931 nmdc:mga06z11_371978_c1
1932 nmdc:mga06z11_515773_c1
1933 nmdc:mga04h51_466242_c1
1934 nmdc:mga04h51_81377_c1
1935 nmdc:mga07m45_134077_c1
1936 nmdc:mga07m45_147797_c1
1937 nmdc:mga07m45_166806_c1
1938 nmdc:mga07m45_25927_c1
1939 nmdc:mga07m45_432122_c1
1940 nmdc:mga07m45_4680_c1
1941 nmdc:mga07m45_614874_c1
1942 nmdc:mga07m45_664497_c1
1943 nmdc:mga05p37_1865429_c1
1944 nmdc:mga06r32_1361939_c1
1945 nmdc:mga0n895_989545_c1
1946 nmdc:mga0rr50_1710215_c1
1947 nmdc:mga0a205_604544_c1
1948 nmdc:mga0sz30_136860_c1
1949 nmdc:mga0sz30_215795_c1
1950 nmdc:mga0sz30_45780_c1
1951 nmdc:mga0sz30_86716_c1
1952 Ga0495601_0044799
1953 Ga0500610_0384206
1954 Ga0500635_0013469
1955 Ga0495655_0228142
1956 Ga0500578_0490005
1957 Ga0500644_0352596
1958 Ga0500647_0052623
1959 Ga0500583_0588883
1960 Ga0500651_0102832
1961 Ga0500566_0099208
1962 Ga0500641_0000644
1963 Ga0500650_0085743
1964 Ga0500558_199941
1965 Ga0500562_102148
1966 Ga0500569_057155
1967 Ga0500582_179953
1968 Ga0500594_0144791
1969 Ga0500595_008644
1970 Ga0500595_083380
1971 Ga0500642_0007569
1972 Ga0500642_0067196
1973 Ga0500655_015499
1974 Ga0500658_0135097
1975 Ga0500658_0364772
1976 Ga0500561_0043539
1977 Ga0500568_0091489
1978 Ga0500577_0018371
1979 Ga0500577_0145264
1980 Ga0500577_0243027
1981 Ga0500588_0423525
1982 Ga0500589_035746
1983 Ga0500604_0092864
1984 Ga0500622_0226290
1985 Ga0500624_113403
1986 Ga0500634_0355527
1987 Ga0500636_0056657
1988 Ga0500636_0095109
1989 Ga0500636_0164845
1990 Ga0500636_0249767
1991 Ga0500637_0378691
1992 Ga0500637_0459607
1993 Ga0500567_136908
1994 Ga0500611_024229
1995 Ga0500645_014458
1996 Ga0500645_038284
1997 Ga0500609_023230
1998 Ga0500609_023345
1999 Ga0500656_027033
2000 Ga0500552_013827
2001 Ga0500596_011466
2002 Ga0501084_1119069
2003 Ga0501084_1136673
2004 Ga0501082_0230190
2005 Ga0530510_0745724
2006 Ga0530510_0827739
2007 2513696437
2008 2723842936
2009 2793080186
2010 2874606407
2011 2876810278
2012 2879114278
2013 2889033767
2014 2917558118
2015 2922367124
2016 2922390102
2017 8006966655
2018 8006989521
2019 8006997971
2020 8056675001

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

3

101

0.97

PF00355

Rieske

Rieske [2Fe-2S] domain

3

92

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9086 3 100
4aiv-assembly1.cif.gz_A crystal structure of putative nadh-dependent nitrite reductase small subunit from mycobacterium tuberculosis 0.9083 1 103
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9075 3 100
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.904 3 100
4qdf-assembly2.cif.gz_B crystal structure of apo ksha5 and ksha1 in complex with 1,4-30q-coa from r. rhodochrous 0.9012 4 103
ID Description Score Start End Superfamily
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9546 3 100 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.92 3 103 2.102.10.10
4aivA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9083 1 103 2.102.10.10
af_Q1JUZ1_92_225_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9078 1 103 2.102.10.10
af_Q6DHJ3_118_252_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9072 4 103 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A2E9JKZ9-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9927 3 103 GO:0042128
GO:0046872
GO:0051537
AF-A0A6A7RS96-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9923 10 102 GO:0042128
GO:0046872
GO:0051537
AF-A0A2W5HCL2-F1-model_v4 deleted 0.9918 3 102
AF-A0A2N2AB24-F1-model_v4 Nitrite reductase (NAD(P)H) small subunit 0.9905 4 103 GO:0042128
GO:0046872
GO:0051537
AF-A0A0N0K9F7-F1-model_v4 Nitrite reductase 0.9902 2 102 GO:0042128
GO:0046872
GO:0051537

Map