F488086

General Info

Members Datasets Scaffolds Average Seq Length
1009 493 2018 308

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10047981|Ga0070709_100479812
Length 339
Sequence LITDHPGRSPFRVADNGLDYPFVALAPGYLMTTLLLTHPASLDHVTPPGHPERPDRMRAVAEVLSDARFNSLVRDEAPEGDLDLVTLCHNEHYVTELRHIAPTSGMIYLDGDTSMSPGTWEAVMRGVGGAVSAMDAVMSGKHDNAFVAMRPPGHHAEISKPMGFCFFDNAAIAARHAQRKYGIGRAAVVDFDVHHGNGTQDIFWADPTVMYCSTHQMPLFPGTGAASERGEHDTIVNAPLASEDGSAKFRAAFENVILPQLKKFAPELIIISAGFDAHYRDPLASLNLKAEDFGWVTRKLMDVADSSAEGRIVSVLEGGYDLQGLKESVAAHVTALIGA

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
222 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
374 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
380 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
381 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
382 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
383 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
384 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
388 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
389 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
390 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
391 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
394 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
397 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
398 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
399 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
400 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
401 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
402 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
403 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
404 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
408 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
409 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
410 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
416 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
417 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
418 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
419 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
420 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
421 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
422 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
423 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
424 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
425 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
426 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
427 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
428 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
429 2643221651 Afipia sp. Root123D2 Isolate Unclassified
430 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
431 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
432 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
433 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
434 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
435 2791355199
436 2818991467 Bosea vestrisii 3192 Isolate Unclassified
437 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
438 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
439 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
440 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
441 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
442 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
443 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
444 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
445 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
446 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
447 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
448 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
449 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
450 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
451 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
452 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
453 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
454 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
455 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
456 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
457 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
458 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
459 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
460 2904699407
461 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
462 2906610324
463 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
464 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
465 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
466 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
467 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
468 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
469 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
470 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
471 2922425934
472 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
473 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
474 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
475 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
476 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
477 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
478 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
479 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
480 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
481 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
482 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
483 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
484 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
485 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
486 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
487 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
488 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
489 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
490 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
491 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
492 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
493 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.24
Metatranscriptomes 0.3
Isolates 7.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.91
Nodule 5.55
Rhizoplane 6.94
Rhizosphere 68.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10047981 3300005434 Bacteria 2663
2 JGI25406J46586_10000018 3300003203 Bacteria 88860
3 JGI25406J46586_10005340 3300003203 Bacteria 5960
4 JGI25406J46586_10006262 3300003203 Bacteria 5491
5 JGI25153J46596_10004213 3300003215 Bacteria 7795
6 JGI25153J46596_10008093 3300003215 Bacteria 5070
7 JGI25404J52841_10006165 3300003659 Bacteria 2499
8 JGI25404J52841_10036465 3300003659 Bacteria 1046
9 Ga0070658_10017070 3300005327 Bacteria 5809
10 Ga0070683_100013394 3300005329 Bacteria 7151
11 Ga0070683_100030933 3300005329 Bacteria 4864
12 Ga0068869_100032048 3300005334 Bacteria 3701
13 Ga0068869_100157173 3300005334 Bacteria 1767
14 Ga0070666_10264149 3300005335 Bacteria 1221
15 Ga0070680_100012612 3300005336 Bacteria 6570
16 Ga0070680_100498333 3300005336 Bacteria 1042
17 Ga0070682_100308629 3300005337 Bacteria 1164
18 Ga0068868_100058578 3300005338 Bacteria 3044
19 Ga0068868_100209989 3300005338 Bacteria 1627
20 Ga0070660_100248390 3300005339 Bacteria 1450
21 Ga0070689_100173153 3300005340 Bacteria 1750
22 Ga0070687_100030536 3300005343 Bacteria 2635
23 Ga0070661_100321895 3300005344 Bacteria 1208
24 Ga0070668_100023719 3300005347 Bacteria 4643
25 Ga0070668_100067352 3300005347 Bacteria 2781
26 Ga0070668_100190290 3300005347 Bacteria 1680
27 Ga0070674_100059750 3300005356 Bacteria 2654
28 Ga0070688_100089555 3300005365 Bacteria 2008
29 Ga0070688_100239186 3300005365 Bacteria 1288
30 Ga0070659_100123548 3300005366 Bacteria 2099
31 Ga0070659_100158477 3300005366 Bacteria 1850
32 Ga0070667_100069942 3300005367 Bacteria 2987
33 Ga0070667_100323540 3300005367 Bacteria 1392
34 Ga0070709_10005136 3300005434 Bacteria 7082
35 Ga0070709_10005610 3300005434 Bacteria 6792
36 Ga0070709_10009222 3300005434 Bacteria 5432
37 Ga0070714_100006193 3300005435 Bacteria 9201
38 Ga0070714_100021334 3300005435 Bacteria 5301
39 Ga0070714_100310414 3300005435 Bacteria 1472
40 Ga0070713_100002525 3300005436 Bacteria 11957
41 Ga0070713_100019290 3300005436 Bacteria 5202
42 Ga0070713_100036104 3300005436 Bacteria 3986
43 Ga0070713_100090628 3300005436 Bacteria 2629
44 Ga0070713_100100027 3300005436 Bacteria 2509
45 Ga0070713_100150376 3300005436 Bacteria 2070
46 Ga0070710_10001159 3300005437 Bacteria 12475
47 Ga0070710_10023562 3300005437 Bacteria 3237
48 Ga0070710_10030708 3300005437 Bacteria 2893
49 Ga0070701_10048550 3300005438 Bacteria 2191
50 Ga0070701_10318475 3300005438 Bacteria 962
51 Ga0070711_100002007 3300005439 Bacteria 11458
52 Ga0070711_100004216 3300005439 Bacteria 8451
53 Ga0070711_100010835 3300005439 Bacteria 5652
54 Ga0070711_100067859 3300005439 Bacteria 2504
55 Ga0070711_100086272 3300005439 Bacteria 2250
56 Ga0070663_100035803 3300005455 Bacteria 3446
57 Ga0070663_100129492 3300005455 Bacteria 1915
58 Ga0070663_100288317 3300005455 Bacteria 1310
59 Ga0070678_100040300 3300005456 Bacteria 3304
60 Ga0070678_100056425 3300005456 Bacteria 2872
61 Ga0070678_100142071 3300005456 Bacteria 1922
62 Ga0070678_100391859 3300005456 Bacteria 1204
63 Ga0070662_100036426 3300005457 Bacteria 3480
64 Ga0070662_100090074 3300005457 Bacteria 2302
65 Ga0070681_10007970 3300005458 Bacteria 10367
66 Ga0070681_10016550 3300005458 Bacteria 7363
67 Ga0070681_10088042 3300005458 Bacteria 3058
68 Ga0070681_10177810 3300005458 Bacteria 2050
69 Ga0070681_10201308 3300005458 Bacteria 1909
70 Ga0068867_100017580 3300005459 Bacteria 5077
71 Ga0068867_100147277 3300005459 Bacteria 1847
72 Ga0070707_100165528 3300005468 Bacteria 2155
73 Ga0070698_100027277 3300005471 Bacteria 5942
74 Ga0070699_100314639 3300005518 Bacteria 1406
75 Ga0070679_100013091 3300005530 Bacteria 7944
76 Ga0070679_100047345 3300005530 Bacteria 4286
77 Ga0070679_100187798 3300005530 Bacteria 2036
78 Ga0070679_100260768 3300005530 Bacteria 1688
79 Ga0070684_100005702 3300005535 Bacteria 9563
80 Ga0070684_100007810 3300005535 Bacteria 8341
81 Ga0068853_100231742 3300005539 Bacteria 1690
82 Ga0070672_100037602 3300005543 Bacteria 3694
83 Ga0070672_100174946 3300005543 Bacteria 1787
84 Ga0070672_100273872 3300005543 Bacteria 1426
85 Ga0070686_100109598 3300005544 Bacteria 1879
86 Ga0070665_100027974 3300005548 Bacteria 5678
87 Ga0070665_100040289 3300005548 Bacteria 4696
88 Ga0070665_100101604 3300005548 Bacteria 2879
89 Ga0070665_100174338 3300005548 Bacteria 2151
90 Ga0070665_100177636 3300005548 Bacteria 2130
91 Ga0068855_100028483 3300005563 Bacteria 6681
92 Ga0068855_100145464 3300005563 Bacteria 2699
93 Ga0068855_100200019 3300005563 Bacteria 2250
94 Ga0068855_100249194 3300005563 Bacteria 1981
95 Ga0068855_100310689 3300005563 Bacteria 1744
96 Ga0068857_100419966 3300005577 Bacteria 1247
97 Ga0068854_100071969 3300005578 Bacteria 2531
98 Ga0068856_100000505 3300005614 Bacteria 43297
99 Ga0068856_100079591 3300005614 Bacteria 3250
100 Ga0068856_100205879 3300005614 Bacteria 1982
101 Ga0068856_100209643 3300005614 Bacteria 1964
102 Ga0068852_100012532 3300005616 Bacteria 6441
103 Ga0068852_100014578 3300005616 Bacteria 6057
104 Ga0068852_100106904 3300005616 Bacteria 2537
105 Ga0068859_100112115 3300005617 Bacteria 2790
106 Ga0068859_100212866 3300005617 Bacteria 2019
107 Ga0068864_100154674 3300005618 Bacteria 2080
108 Ga0068861_100054079 3300005719 Bacteria 3057
109 Ga0068870_10220881 3300005840 Bacteria 1160
110 Ga0068863_100521610 3300005841 Bacteria 1171
111 Ga0068858_100131906 3300005842 Bacteria 2343
112 Ga0068860_100000101 3300005843 Bacteria 142856
113 Ga0068860_100054649 3300005843 Bacteria 3795
114 Ga0068860_100151843 3300005843 Bacteria 2231
115 Ga0068862_100068784 3300005844 Bacteria 3055
116 Ga0068862_100101143 3300005844 Bacteria 2521
117 Ga0068862_100257281 3300005844 Bacteria 1592
118 Ga0068862_100318665 3300005844 Bacteria 1434
119 Ga0081455_10005572 3300005937 Bacteria 13777
120 Ga0081455_10005785 3300005937 Bacteria 13478
121 Ga0081455_10006447 3300005937 Bacteria 12574
122 Ga0081455_10021510 3300005937 Bacteria 6051
123 Ga0081538_10107252 3300005981 Bacteria 1384
124 Ga0081540_1002041 3300005983 Bacteria 16838
125 Ga0081540_1003848 3300005983 Bacteria 11726
126 Ga0081540_1007700 3300005983 Bacteria 7634
127 Ga0081540_1011669 3300005983 Bacteria 5856
128 Ga0081540_1014956 3300005983 Bacteria 4935
129 Ga0081540_1019359 3300005983 Bacteria 4141
130 Ga0081540_1045183 3300005983 Bacteria 2241
131 Ga0081539_10000003 3300005985 Bacteria 594833
132 Ga0081539_10000199 3300005985 Bacteria 139305
133 Ga0081539_10032330 3300005985 Bacteria 3206
134 Ga0081539_10100868 3300005985 Bacteria 1472
135 Ga0081539_10151778 3300005985 Bacteria 1114
136 Ga0070717_10001543 3300006028 Bacteria 15977
137 Ga0070717_10067095 3300006028 Bacteria 2984
138 Ga0070717_10069149 3300006028 Bacteria 2940
139 Ga0075365_10011224 3300006038 Bacteria 5260
140 Ga0075365_10040460 3300006038 Bacteria 3040
141 Ga0075365_10090329 3300006038 Bacteria 2086
142 Ga0075365_10093018 3300006038 Bacteria 2056
143 Ga0075365_10121863 3300006038 Bacteria 1799
144 Ga0075364_10036099 3300006051 Bacteria 3195
145 Ga0075364_10072950 3300006051 Bacteria 2262
146 Ga0070715_10000555 3300006163 Bacteria 9825
147 Ga0070716_100006104 3300006173 Bacteria 5875
148 Ga0070716_100028516 3300006173 Bacteria 3008
149 Ga0070716_100060116 3300006173 Bacteria 2193
150 Ga0070716_100099729 3300006173 Bacteria 1778
151 Ga0070712_100007857 3300006175 Bacteria 6683
152 Ga0070712_100012273 3300006175 Bacteria 5446
153 Ga0070712_100016728 3300006175 Bacteria 4740
154 Ga0070712_100097092 3300006175 Bacteria 2171
155 Ga0075367_10050011 3300006178 Bacteria 2466
156 Ga0075367_10192497 3300006178 Bacteria 1273
157 Ga0075366_10029876 3300006195 Bacteria 3202
158 Ga0075370_10046260 3300006353 Bacteria 2462
159 Ga0075434_100422636 3300006871 Bacteria 1354
160 Ga0075429_100439220 3300006880 Bacteria 1143
161 Ga0068865_100214855 3300006881 Bacteria 1500
162 Ga0097620_100112123 3300006931 Bacteria 2790
163 Ga0097620_100212868 3300006931 Bacteria 2019
164 Ga0099822_1000663 3300006943 Bacteria 34548
165 Ga0099794_10013970 3300007265 Bacteria 3507
166 Ga0099794_10033008 3300007265 Bacteria 2432
167 Ga0105240_10004584 3300009093 Bacteria 20953
168 Ga0105240_10200101 3300009093 Bacteria 2342
169 Ga0105240_10365133 3300009093 Bacteria 1634
170 Ga0105240_10446667 3300009093 Bacteria 1448
171 Ga0111539_10467329 3300009094 Bacteria 1469
172 Ga0105245_10014011 3300009098 Bacteria 6982
173 Ga0105245_10125798 3300009098 Bacteria 2399
174 Ga0105247_10182419 3300009101 Bacteria 1401
175 Ga0114129_10240320 3300009147 Bacteria 2435
176 Ga0105243_10019284 3300009148 Bacteria 5170
177 Ga0105243_10065157 3300009148 Bacteria 2926
178 Ga0105241_10036436 3300009174 Bacteria 3702
179 Ga0105241_10047652 3300009174 Bacteria 3259
180 Ga0105242_10193818 3300009176 Bacteria 1801
181 Ga0105242_10335742 3300009176 Bacteria 1391
182 Ga0105248_10036694 3300009177 Bacteria 5482
183 Ga0105248_10126848 3300009177 Bacteria 2878
184 Ga0105237_10017452 3300009545 Bacteria 7440
185 Ga0105237_10086786 3300009545 Bacteria 3119
186 Ga0105237_10090991 3300009545 Bacteria 3041
187 Ga0105238_10003279 3300009551 Bacteria 16156
188 Ga0105238_10015544 3300009551 Bacteria 7706
189 Ga0105238_10088935 3300009551 Bacteria 3075
190 Ga0105238_10109487 3300009551 Bacteria 2744
191 Ga0105249_10307808 3300009553 Bacteria 1591
192 Ga0105249_10535490 3300009553 Bacteria 1220
193 Ga0099796_10003116 3300010159 Bacteria 3782
194 Ga0105239_10022515 3300010375 Bacteria 6947
195 Ga0105239_10058045 3300010375 Bacteria 4246
196 Ga0105239_10436941 3300010375 Bacteria 1484
197 Ga0157370_10013258 3300013104 Bacteria 8495
198 Ga0157370_10021342 3300013104 Bacteria 6453
199 Ga0157369_10018648 3300013105 Bacteria 7780
200 Ga0157369_10050530 3300013105 Bacteria 4502
201 Ga0157369_10173351 3300013105 Bacteria 2272
202 Ga0157369_10475226 3300013105 Bacteria 1294
203 Ga0157374_10021557 3300013296 Bacteria 5735
204 Ga0157374_10049574 3300013296 Bacteria 3901
205 Ga0157374_10226054 3300013296 Bacteria 1838
206 Ga0157378_10024322 3300013297 Bacteria 5327
207 Ga0157378_10299303 3300013297 Bacteria 1556
208 Ga0157378_10379549 3300013297 Bacteria 1388
209 Ga0163162_10160155 3300013306 Bacteria 2372
210 Ga0163162_10183944 3300013306 Bacteria 2216
211 Ga0163162_10602555 3300013306 Bacteria 1225
212 Ga0157372_10100777 3300013307 Bacteria 3296
213 Ga0157372_10229748 3300013307 Bacteria 2151
214 Ga0157375_10053921 3300013308 Bacteria 3959
215 Ga0157375_10163180 3300013308 Bacteria 2371
216 Ga0163163_10313416 3300014325 Bacteria 1622
217 Ga0157380_10371022 3300014326 Bacteria 1347
218 Ga0157379_10066497 3300014968 Bacteria 3222
219 Ga0157376_10036968 3300014969 Bacteria 3959
220 Ga0163161_10221020 3300017792 Bacteria 1467
221 Ga0163161_10266945 3300017792 Bacteria 1338
222 Ga0206356_11193562 3300020070 Bacteria 1792
223 Ga0206353_11100446 3300020082 Bacteria 1106
224 Ga0213872_10003012 3300021361 Bacteria 9521
225 Ga0213872_10003019 3300021361 Bacteria 9506
226 Ga0213872_10006968 3300021361 Bacteria 5608
227 Ga0213872_10011539 3300021361 Bacteria 4178
228 Ga0213872_10024525 3300021361 Bacteria 2774
229 Ga0213872_10026435 3300021361 Bacteria 2666
230 Ga0213876_10016846 3300021384 Bacteria 3860
231 Ga0213875_10057382 3300021388 Bacteria 1824
232 Ga0213871_10026820 3300021441 Bacteria 1476
233 Ga0209564_1000865 3300025295 Bacteria 40348
234 Ga0209758_1000120 3300025297 Bacteria 192212
235 Ga0209758_1000267 3300025297 Bacteria 103340
236 Ga0209758_1000720 3300025297 Bacteria 48767
237 Ga0209758_1003178 3300025297 Bacteria 15387
238 Ga0209758_1005954 3300025297 Bacteria 9038
239 Ga0209758_1010377 3300025297 Bacteria 5585
240 Ga0209758_1015367 3300025297 Bacteria 3971
241 Ga0209758_1033211 3300025297 Bacteria 2078
242 Ga0207426_1026634 3300025302 Bacteria 1934
243 Ga0209257_1043208 3300025304 Bacteria 1323
244 Ga0207697_10072132 3300025315 Bacteria 1448
245 Ga0207656_10017228 3300025321 Bacteria 2826
246 Ga0207656_10142318 3300025321 Bacteria 1131
247 Ga0207653_10049560 3300025885 Bacteria 1394
248 Ga0207682_10068106 3300025893 Bacteria 1504
249 Ga0207692_10002181 3300025898 Bacteria 7480
250 Ga0207692_10009758 3300025898 Bacteria 4021
251 Ga0207692_10065282 3300025898 Bacteria 1898
252 Ga0207642_10111458 3300025899 Bacteria 1394
253 Ga0207710_10071162 3300025900 Bacteria 1595
254 Ga0207680_10071245 3300025903 Bacteria 2154
255 Ga0207685_10027658 3300025905 Bacteria 1988
256 Ga0207699_10001171 3300025906 Bacteria 12393
257 Ga0207699_10115073 3300025906 Bacteria 1730
258 Ga0207645_10014371 3300025907 Bacteria 5298
259 Ga0207705_10121553 3300025909 Bacteria 1938
260 Ga0207654_10011567 3300025911 Bacteria 4503
261 Ga0207654_10309633 3300025911 Bacteria 1076
262 Ga0207707_10004201 3300025912 Bacteria 12753
263 Ga0207707_10028716 3300025912 Bacteria 4860
264 Ga0207707_10052097 3300025912 Bacteria 3564
265 Ga0207707_10061385 3300025912 Bacteria 3270
266 Ga0207707_10116244 3300025912 Bacteria 2337
267 Ga0207695_10000163 3300025913 Bacteria 197030
268 Ga0207695_10428331 3300025913 Bacteria 1207
269 Ga0207671_10011282 3300025914 Bacteria 7288
270 Ga0207671_10030974 3300025914 Bacteria 3988
271 Ga0207671_10043463 3300025914 Bacteria 3323
272 Ga0207693_10003158 3300025915 Bacteria 14168
273 Ga0207693_10006713 3300025915 Bacteria 9501
274 Ga0207693_10024089 3300025915 Bacteria 4832
275 Ga0207693_10039929 3300025915 Bacteria 3695
276 Ga0207693_10044762 3300025915 Bacteria 3478
277 Ga0207693_10426772 3300025915 Bacteria 1036
278 Ga0207663_10000261 3300025916 Bacteria 22957
279 Ga0207663_10008702 3300025916 Bacteria 5327
280 Ga0207663_10047740 3300025916 Bacteria 2645
281 Ga0207663_10096533 3300025916 Bacteria 1974
282 Ga0207663_10275375 3300025916 Bacteria 1248
283 Ga0207660_10009640 3300025917 Bacteria 6251
284 Ga0207660_10137522 3300025917 Bacteria 1865
285 Ga0207660_10237550 3300025917 Bacteria 1435
286 Ga0207657_10002700 3300025919 Bacteria 19128
287 Ga0207657_10005124 3300025919 Bacteria 13731
288 Ga0207652_10006338 3300025921 Bacteria 9558
289 Ga0207652_10009869 3300025921 Bacteria 7683
290 Ga0207652_10017004 3300025921 Bacteria 5949
291 Ga0207652_10495896 3300025921 Bacteria 1100
292 Ga0207646_10084060 3300025922 Bacteria 2847
293 Ga0207694_10038223 3300025924 Bacteria 3690
294 Ga0207694_10059974 3300025924 Bacteria 2960
295 Ga0207694_10489088 3300025924 Bacteria 1030
296 Ga0207687_10009704 3300025927 Bacteria 6296
297 Ga0207687_10033220 3300025927 Bacteria 3499
298 Ga0207687_10265166 3300025927 Bacteria 1371
299 Ga0207700_10007733 3300025928 Bacteria 6602
300 Ga0207700_10024258 3300025928 Bacteria 4195
301 Ga0207700_10044654 3300025928 Bacteria 3264
302 Ga0207700_10069105 3300025928 Bacteria 2710
303 Ga0207700_10086075 3300025928 Bacteria 2469
304 Ga0207700_10096957 3300025928 Bacteria 2343
305 Ga0207664_10023451 3300025929 Bacteria 4624
306 Ga0207664_10084912 3300025929 Bacteria 2583
307 Ga0207664_10113811 3300025929 Bacteria 2254
308 Ga0207664_10336092 3300025929 Bacteria 1335
309 Ga0207664_10381981 3300025929 Bacteria 1250
310 Ga0207664_10428254 3300025929 Bacteria 1179
311 Ga0207644_10070982 3300025931 Bacteria 2547
312 Ga0207706_10037862 3300025933 Bacteria 4280
313 Ga0207686_10204562 3300025934 Bacteria 1416
314 Ga0207670_10110812 3300025936 Bacteria 1978
315 Ga0207704_10024462 3300025938 Bacteria 3276
316 Ga0207704_10258411 3300025938 Bacteria 1312
317 Ga0207665_10000280 3300025939 Bacteria 35528
318 Ga0207665_10002029 3300025939 Bacteria 13628
319 Ga0207665_10066558 3300025939 Bacteria 2452
320 Ga0207665_10132765 3300025939 Bacteria 1769
321 Ga0207691_10168950 3300025940 Bacteria 1916
322 Ga0207711_10030253 3300025941 Bacteria 4567
323 Ga0207711_10362277 3300025941 Bacteria 1343
324 Ga0207689_10079591 3300025942 Bacteria 2693
325 Ga0207661_10000532 3300025944 Bacteria 24432
326 Ga0207661_10002592 3300025944 Bacteria 12429
327 Ga0207661_10018698 3300025944 Bacteria 5152
328 Ga0207667_10128551 3300025949 Bacteria 2610
329 Ga0207667_10137958 3300025949 Bacteria 2511
330 Ga0207667_10358269 3300025949 Bacteria 1488
331 Ga0207651_10480525 3300025960 Bacteria 1071
332 Ga0207668_10055665 3300025972 Bacteria 2751
333 Ga0207640_10069450 3300025981 Bacteria 2365
334 Ga0207658_10261034 3300025986 Bacteria 1476
335 Ga0207677_10026809 3300026023 Bacteria 3619
336 Ga0207678_10042731 3300026067 Bacteria 3924
337 Ga0207678_10115319 3300026067 Bacteria 2292
338 Ga0207678_10177504 3300026067 Bacteria 1819
339 Ga0207708_10045881 3300026075 Bacteria 3330
340 Ga0207702_10000127 3300026078 Bacteria 89755
341 Ga0207702_10195945 3300026078 Bacteria 1870
342 Ga0207702_10242785 3300026078 Bacteria 1688
343 Ga0207641_10053496 3300026088 Bacteria 3423
344 Ga0207641_10330047 3300026088 Bacteria 1449
345 Ga0207648_10095226 3300026089 Bacteria 2604
346 Ga0207648_10485139 3300026089 Bacteria 1129
347 Ga0207674_10073279 3300026116 Bacteria 3438
348 Ga0207674_10437166 3300026116 Bacteria 1264
349 Ga0207675_100106446 3300026118 Bacteria 2644
350 Ga0207675_100148533 3300026118 Bacteria 2230
351 Ga0207683_10051817 3300026121 Bacteria 3596
352 Ga0207683_10300587 3300026121 Bacteria 1468
353 Ga0207698_10008740 3300026142 Bacteria 6422
354 Ga0207698_10020122 3300026142 Bacteria 4588
355 Ga0207698_10146869 3300026142 Bacteria 2040
356 Ga0207698_10223686 3300026142 Bacteria 1703
357 Ga0207698_10236000 3300026142 Bacteria 1663
358 Ga0207698_10467637 3300026142 Bacteria 1221
359 Ga0209389_1000186 3300027296 Bacteria 47149
360 Ga0209389_1000261 3300027296 Bacteria 33507
361 Ga0209589_1000006 3300027357 Bacteria 436292
362 Ga0209589_1001077 3300027357 Bacteria 43273
363 Ga0209489_100007 3300027361 Bacteria 436292
364 Ga0209489_100176 3300027361 Bacteria 100053
365 Ga0209489_112845 3300027361 Bacteria 7271
366 Ga0209700_100008 3300027363 Bacteria 436292
367 Ga0209700_101165 3300027363 Bacteria 53492
368 Ga0209588_1000499 3300027671 Bacteria 10047
369 Ga0209588_1016019 3300027671 Bacteria 2309
370 Ga0268266_10002993 3300028379 Bacteria 17411
371 Ga0268266_10073304 3300028379 Bacteria 2971
372 Ga0268266_10074116 3300028379 Bacteria 2955
373 Ga0268266_10241032 3300028379 Bacteria 1669
374 Ga0268266_10263537 3300028379 Bacteria 1598
375 Ga0268265_10069393 3300028380 Bacteria 2736
376 Ga0268264_10000030 3300028381 Bacteria 418542
377 Ga0307517_10000744 3300028786 Bacteria 56253
378 Ga0307511_10097451 3300030521 Bacteria 1952
379 Ga0265330_10012783 3300031235 Bacteria 3918
380 Ga0265330_10093495 3300031235 Bacteria 1290
381 Ga0265332_10146508 3300031238 Bacteria 988
382 Ga0265340_10006832 3300031247 Bacteria 6242
383 Ga0265339_10001302 3300031249 Bacteria 18677
384 Ga0265339_10093600 3300031249 Bacteria 1572
385 Ga0265331_10128069 3300031250 Bacteria 1159
386 Ga0265331_10128079 3300031250 Bacteria 1159
387 Ga0307513_10229452 3300031456 Bacteria 1670
388 Ga0307408_100007557 3300031548 Bacteria 7186
389 Ga0307408_100294245 3300031548 Bacteria 1357
390 Ga0265313_10113715 3300031595 Bacteria 1188
391 Ga0307508_10000051 3300031616 Bacteria 134500
392 Ga0265314_10001137 3300031711 Bacteria 30830
393 Ga0265342_10014921 3300031712 Bacteria 5135
394 Ga0265342_10017603 3300031712 Bacteria 4644
395 Ga0307516_10011569 3300031730 Bacteria 9575
396 Ga0307516_10209330 3300031730 Bacteria 1665
397 Ga0307405_10055379 3300031731 Bacteria 2482
398 Ga0307412_10170917 3300031911 Bacteria 1625
399 Ga0307416_100266727 3300032002 Bacteria 1678
400 Ga0307507_10006354 3300033179 Bacteria 18224
401 Ga0307510_10021805 3300033180 Bacteria 7456
402 Ga0307510_10038903 3300033180 Bacteria 5250
403 Ga0315911_1000003 3300033442 Bacteria 502217
404 Ga0373926_0001921 3300035083 Bacteria 6498
405 Ga0373934_0004312 3300035086 Bacteria 5252
406 Ga0373944_0088312 3300035089 Bacteria 1033
407 Ga0373923_0008455 3300035111 Bacteria 3671
408 Ga0373923_0111930 3300035111 Bacteria 1213
409 Ga0373936_0033852 3300035113 Bacteria 2027
410 Ga0373941_0004414 3300035115 Bacteria 3250
411 Ga0373953_0002981 3300035117 Bacteria 5177
412 Ga0373953_0066316 3300035117 Bacteria 1483
413 Ga0373954_0002129 3300035118 Bacteria 8219
414 Ga0373954_0042019 3300035118 Bacteria 2132
415 Ga0373956_0003044 3300035119 Bacteria 6786
416 Ga0373957_0000776 3300035120 Bacteria 8304
417 Ga0373946_0002366 3300035171 Bacteria 6671
418 Ga0373955_0004043 3300035172 Bacteria 6474
419 Ga0373924_0016757 3300035410 Bacteria 2802
420 Ga0373924_0025943 3300035410 Bacteria 2320
421 Ga0373924_0051372 3300035410 Bacteria 1709
422 Ga0373931_0001492 3300035691 Bacteria 10065
423 Ga0373931_0062680 3300035691 Bacteria 2008
424 Ga0373935_0006343 3300035692 Bacteria 7054
425 Ga0373935_0237665 3300035692 Bacteria 1271
426 Ga0373935_0257872 3300035692 Bacteria 1222
427 Ga0373927_0003904 3300035695 Bacteria 10572
428 Ga0373927_0005891 3300035695 Bacteria 8398
429 Ga0373927_0007576 3300035695 Bacteria 7347
430 Ga0373927_0034813 3300035695 Bacteria 3275
431 Ga0373927_0074134 3300035695 Bacteria 2203
432 Ga0373927_0152846 3300035695 Bacteria 1511
433 Ga0373933_0000342 3300035724 Bacteria 29960
434 Ga0373933_0013742 3300035724 Bacteria 4492
435 Ga0373933_0084118 3300035724 Bacteria 1955
436 Ga0373933_0114086 3300035724 Bacteria 1687
437 Ga0373933_0118584 3300035724 Bacteria 1656
438 Ga0373933_0168080 3300035724 Bacteria 1395
439 Ga0373947_0144671 3300035725 Bacteria 1527
440 Ga0373947_0202056 3300035725 Bacteria 1300
441 Ga0373937_0033338 3300036401 Bacteria 4675
442 Ga0373937_0047682 3300036401 Bacteria 3921
443 Ga0373937_0158558 3300036401 Bacteria 2121
444 Ga0373937_0260560 3300036401 Bacteria 1635
445 Ga0372808_010827 3300036459 Bacteria 1287
446 Ga0373925_0015751 3300037068 Bacteria 5472
447 Ga0373925_0048031 3300037068 Bacteria 3179
448 Ga0373925_0070092 3300037068 Bacteria 2649
449 Ga0395899_0061768 3300037312 Bacteria 2759
450 Ga0395900_0003599 3300037418 Bacteria 16656
451 Ga0395900_0086144 3300037418 Bacteria 3228
452 Ga0395900_0177363 3300037418 Bacteria 2167
453 Ga0395898_0129104 3300037466 Bacteria 2421
454 Ga0395898_0145864 3300037466 Bacteria 2265
455 Ga0395905_0052126 3300037471 Bacteria 3832
456 Ga0436364_0997829 3300037853 Bacteria 3081
457 Ga0395901_0060727 3300038443 Bacteria 3934
458 Ga0395901_0352152 3300038443 Bacteria 1519
459 Ga0395901_0564445 3300038443 Bacteria 1152
460 Ga0436365_0386944 3300039437 Bacteria 1591
461 Ga0436365_0629162 3300039437 Bacteria 1413
462 Ga0436365_0838985 3300039437 Bacteria 7476
463 Ga0436365_0948695 3300039437 Bacteria 2565
464 Ga0436360_0974952 3300039438 Bacteria 1712
465 Ga0436361_0017850 3300039447 Bacteria 11403
466 Ga0436361_0107745 3300039447 Bacteria 4065
467 Ga0436361_0158927 3300039447 Bacteria 13531
468 Ga0436361_0336033 3300039447 Bacteria 4187
469 Ga0436361_0352642 3300039447 Bacteria 8388
470 Ga0436361_0421829 3300039447 Bacteria 4324
471 Ga0436361_0786450 3300039447 Bacteria 2409
472 Ga0436361_0791494 3300039447 Bacteria 1452
473 Ga0436363_0123844 3300039450 Bacteria 1194
474 Ga0436363_1054182 3300039450 Bacteria 2916
475 Ga0436363_1110633 3300039450 Bacteria 5127
476 Ga0436362_1134339 3300039453 Bacteria 4484
477 Ga0439438_023360 3300041405 Bacteria 1705
478 Ga0439465_0015316 3300041413 Bacteria 2392
479 Ga0450920_010714 3300042122 Bacteria 1703
480 Ga0450909_007227 3300042185 Bacteria 1605
481 Ga0466966_0021986 3300044684 Bacteria 4188
482 Ga0466966_0053736 3300044684 Bacteria 2555
483 Ga0466961_0000005 3300044693 Bacteria 173105
484 Ga0466963_0142709 3300044694 Bacteria 1660
485 Ga0466968_0083797 3300044735 Bacteria 1405
486 Ga0466957_0021630 3300044842 Bacteria 3792
487 Ga0466959_0005696 3300045049 Bacteria 8573
488 Ga0466959_0062058 3300045049 Bacteria 2717
489 Ga0466959_0305774 3300045049 Bacteria 1088
490 Ga0466958_0000489 3300045836 Bacteria 16548
491 Ga0466967_0405689 3300045976 Bacteria 1327
492 Ga0495592_0006971 3300046454 Bacteria 8443
493 Ga0495603_0004320 3300046455 Bacteria 8476
494 Ga0495603_0011117 3300046455 Bacteria 5457
495 Ga0495603_0011224 3300046455 Bacteria 5426
496 Ga0495603_0055469 3300046455 Bacteria 2348
497 Ga0495629_0000439 3300046459 Bacteria 34692
498 Ga0495629_0008693 3300046459 Bacteria 7475
499 Ga0495629_0025310 3300046459 Bacteria 4220
500 Ga0495629_0100051 3300046459 Bacteria 2023
501 Ga0495651_0042346 3300046462 Bacteria 3535
502 Ga0495651_0250894 3300046462 Bacteria 1208
503 Ga0495653_0011927 3300046463 Bacteria 7098
504 Ga0495653_0023097 3300046463 Bacteria 5029
505 Ga0495653_0183161 3300046463 Bacteria 1435
506 Ga0495650_0071355 3300046471 Bacteria 1362
507 Ga0495580_0010913 3300046472 Bacteria 7047
508 Ga0495580_0063049 3300046472 Bacteria 2600
509 Ga0495582_0095209 3300046473 Bacteria 1663
510 Ga0495639_0063048 3300046475 Bacteria 1701
511 Ga0495639_0072485 3300046475 Bacteria 1592
512 Ga0495639_0129605 3300046475 Bacteria 1207
513 Ga0495639_0180987 3300046475 Bacteria 1026
514 Ga0495662_0002831 3300046476 Bacteria 8772
515 Ga0495662_0014677 3300046476 Bacteria 3808
516 Ga0495664_0013575 3300046477 Bacteria 4620
517 Ga0495664_0026776 3300046477 Bacteria 3359
518 Ga0495664_0177552 3300046477 Bacteria 1291
519 Ga0495664_0179188 3300046477 Bacteria 1285
520 Ga0495594_0005519 3300046499 Bacteria 6494
521 Ga0495606_0002132 3300046507 Bacteria 23896
522 Ga0495606_0033400 3300046507 Bacteria 3548
523 Ga0495606_0069189 3300046507 Bacteria 2230
524 Ga0495606_0191328 3300046507 Bacteria 1173
525 Ga0495608_0005431 3300046511 Bacteria 9112
526 Ga0495608_0034052 3300046511 Bacteria 3440
527 Ga0495608_0198955 3300046511 Bacteria 1263
528 Ga0495616_0022428 3300046513 Bacteria 3410
529 Ga0495618_0007998 3300046514 Bacteria 6401
530 Ga0495618_0014482 3300046514 Bacteria 4805
531 Ga0495620_0059400 3300046515 Bacteria 1598
532 Ga0495628_0013324 3300046516 Bacteria 6918
533 Ga0495628_0020870 3300046516 Bacteria 5396
534 Ga0495628_0029898 3300046516 Bacteria 4414
535 Ga0495628_0060379 3300046516 Bacteria 2975
536 Ga0495628_0182993 3300046516 Bacteria 1584
537 Ga0495630_0070295 3300046517 Bacteria 2634
538 Ga0495631_0030231 3300046518 Bacteria 2458
539 Ga0495632_0053190 3300046519 Bacteria 1989
540 Ga0495644_0016361 3300046523 Bacteria 2838
541 Ga0495648_0003395 3300046524 Bacteria 13998
542 Ga0495648_0015565 3300046524 Bacteria 5518
543 Ga0495648_0019958 3300046524 Bacteria 4689
544 Ga0495663_0069778 3300046525 Bacteria 1117
545 Ga0495666_0021512 3300046526 Bacteria 3193
546 Ga0495652_0060178 3300046529 Bacteria 3210
547 Ga0495652_0093996 3300046529 Bacteria 2446
548 Ga0495665_0005469 3300046531 Bacteria 6842
549 Ga0495665_0017404 3300046531 Bacteria 3866
550 Ga0495665_0073583 3300046531 Bacteria 1799
551 Ga0495640_0004906 3300046533 Bacteria 10629
552 Ga0495640_0092548 3300046533 Bacteria 1994
553 Ga0495587_0157856 3300046536 Bacteria 1291
554 Ga0495597_0025921 3300046542 Bacteria 2696
555 Ga0495645_0015849 3300046543 Bacteria 5367
556 Ga0495645_0114450 3300046543 Bacteria 1906
557 Ga0495645_0211699 3300046543 Bacteria 1308
558 Ga0495622_0047942 3300046557 Bacteria 1985
559 Ga0495667_0005621 3300046559 Bacteria 8473
560 Ga0495667_0094625 3300046559 Bacteria 1934
561 Ga0495667_0273281 3300046559 Bacteria 1073
562 Ga0495656_0041568 3300046615 Bacteria 1921
563 Ga0495656_0130033 3300046615 Bacteria 1197
564 Ga0495668_0061198 3300046616 Bacteria 2077
565 Ga0495668_0174252 3300046616 Bacteria 1178
566 Ga0495634_0003738 3300046642 Bacteria 12123
567 Ga0495634_0024516 3300046642 Bacteria 4232
568 Ga0495634_0034617 3300046642 Bacteria 3465
569 Ga0495634_0100438 3300046642 Bacteria 1870
570 Ga0495625_0089530 3300046660 Bacteria 2130
571 Ga0495635_0013164 3300046663 Bacteria 5791
572 Ga0495635_0016717 3300046663 Bacteria 5125
573 Ga0495659_0011155 3300046664 Bacteria 2895
574 Ga0495588_0009072 3300046674 Bacteria 4583
575 Ga0495657_0010362 3300046675 Bacteria 7014
576 Ga0495657_0013824 3300046675 Bacteria 5941
577 Ga0495599_0001369 3300046678 Bacteria 13928
578 Ga0495599_0033876 3300046678 Bacteria 3211
579 Ga0495623_0005388 3300046679 Bacteria 8375
580 Ga0495623_0014960 3300046679 Bacteria 5015
581 Ga0495646_0024958 3300046680 Bacteria 3761
582 Ga0495646_0026668 3300046680 Bacteria 3627
583 Ga0495646_0071750 3300046680 Bacteria 2037
584 Ga0495658_0003784 3300046683 Bacteria 7489
585 Ga0495658_0009854 3300046683 Bacteria 4766
586 Ga0495669_0049543 3300046684 Bacteria 1881
587 Ga0495613_0007099 3300046689 Bacteria 8338
588 Ga0495613_0063134 3300046689 Bacteria 2710
589 Ga0495613_0090896 3300046689 Bacteria 2211
590 Ga0495624_0026173 3300046690 Bacteria 3823
591 Ga0495624_0035050 3300046690 Bacteria 3241
592 Ga0495670_0069591 3300046691 Bacteria 1779
593 Ga0495671_0028224 3300046692 Bacteria 2893
594 Ga0495649_0053047 3300046694 Bacteria 2196
595 Ga0495600_0001020 3300046809 Bacteria 15122
596 Ga0495600_0012902 3300046809 Bacteria 5236
597 Ga0495660_0078292 3300046810 Bacteria 1738
598 Ga0495581_0041911 3300047315 Bacteria 2649
599 Ga0495581_0109441 3300047315 Bacteria 1606
600 Ga0495604_0013033 3300047317 Bacteria 6623
601 Ga0495604_0060803 3300047317 Bacteria 2891
602 Ga0495604_0160593 3300047317 Bacteria 1588
603 Ga0495674_0000458 3300047319 Bacteria 36828
604 Ga0495674_0083470 3300047319 Bacteria 2738
605 Ga0495674_0113470 3300047319 Bacteria 2295
606 Ga0495674_0268601 3300047319 Bacteria 1400
607 Ga0495672_0019236 3300047320 Bacteria 4509
608 Ga0495672_0086763 3300047320 Bacteria 1730
609 Ga0495676_0065097 3300047321 Bacteria 2831
610 Ga0495676_0164141 3300047321 Bacteria 1569
611 Ga0495676_0232609 3300047321 Bacteria 1265
612 Ga0495680_0013039 3300047322 Bacteria 7270
613 Ga0495680_0015630 3300047322 Bacteria 6542
614 Ga0495683_0021464 3300047323 Bacteria 3328
615 Ga0495675_0009601 3300047444 Bacteria 6025
616 Ga0495677_0054803 3300047445 Bacteria 1471
617 Ga0495685_062018 3300047447 Bacteria 1259
618 Ga0495673_0048299 3300047469 Bacteria 1877
619 Ga0495681_0101552 3300047470 Bacteria 1257
620 Ga0495684_0000340 3300047471 Bacteria 37592
621 Ga0495684_0008134 3300047471 Bacteria 8111
622 Ga0495684_0249755 3300047471 Bacteria 1291
623 Ga0495686_0085798 3300047472 Bacteria 1916
624 Ga0495593_0000687 3300047673 Bacteria 19500
625 Ga0495593_0006332 3300047673 Bacteria 6945
626 Ga0495602_0008226 3300048088 Bacteria 10893
627 Ga0495602_0048912 3300048088 Bacteria 3793
628 Ga0495602_0050554 3300048088 Bacteria 3712
629 Ga0496100_0045126 3300048903 Bacteria 2827
630 Ga0496100_0200943 3300048903 Bacteria 1453
631 Ga0496100_0312377 3300048903 Bacteria 1179
632 Ga0496101_0025700 3300048904 Bacteria 4087
633 Ga0496101_0037723 3300048904 Bacteria 3430
634 Ga0496101_0053981 3300048904 Bacteria 2901
635 Ga0496101_0119798 3300048904 Bacteria 1989
636 Ga0496101_0193485 3300048904 Bacteria 1570
637 Ga0496102_0002648 3300048905 Bacteria 15215
638 Ga0496102_0021600 3300048905 Bacteria 5693
639 Ga0496102_0061834 3300048905 Bacteria 3428
640 Ga0496102_0086214 3300048905 Bacteria 2900
641 Ga0496102_0127148 3300048905 Bacteria 2383
642 Ga0496102_0129305 3300048905 Bacteria 2363
643 Ga0496102_0312680 3300048905 Bacteria 1480
644 Ga0496103_0029358 3300048906 Bacteria 3342
645 Ga0496103_0094489 3300048906 Bacteria 1889
646 Ga0496104_0019459 3300048907 Bacteria 6212
647 Ga0496104_0034268 3300048907 Bacteria 4732
648 Ga0496104_0073979 3300048907 Bacteria 3243
649 Ga0496105_0042398 3300048908 Bacteria 3751
650 Ga0496105_0071133 3300048908 Bacteria 2875
651 Ga0496105_0074458 3300048908 Bacteria 2805
652 Ga0496106_0000740 3300048909 Bacteria 23552
653 Ga0496106_0005785 3300048909 Bacteria 9143
654 Ga0496106_0015920 3300048909 Bacteria 5562
655 Ga0496106_0135311 3300048909 Bacteria 1935
656 Ga0496107_0004783 3300048910 Bacteria 9200
657 Ga0496107_0040726 3300048910 Bacteria 3335
658 Ga0496107_0069367 3300048910 Bacteria 2559
659 Ga0496107_0172903 3300048910 Bacteria 1603
660 Ga0496107_0194884 3300048910 Bacteria 1506
661 Ga0496108_0000938 3300048911 Bacteria 22748
662 Ga0496108_0025718 3300048911 Bacteria 4853
663 Ga0496108_0028262 3300048911 Bacteria 4640
664 Ga0496108_0062145 3300048911 Bacteria 3145
665 Ga0496109_0001723 3300048912 Bacteria 18237
666 Ga0496109_0008707 3300048912 Bacteria 8639
667 Ga0496109_0009518 3300048912 Bacteria 8282
668 Ga0496109_0109705 3300048912 Bacteria 2565
669 Ga0496109_0158599 3300048912 Bacteria 2119
670 Ga0496109_0208576 3300048912 Bacteria 1837
671 Ga0496110_0003174 3300048913 Bacteria 12507
672 Ga0496110_0034357 3300048913 Bacteria 4392
673 Ga0496110_0089604 3300048913 Bacteria 2749
674 Ga0496110_0092353 3300048913 Bacteria 2709
675 Ga0496110_0190977 3300048913 Bacteria 1860
676 Ga0496110_0200331 3300048913 Bacteria 1814
677 Ga0496111_0010537 3300048914 Bacteria 6210
678 Ga0496111_0047341 3300048914 Bacteria 3097
679 Ga0496111_0131890 3300048914 Bacteria 1849
680 Ga0496112_0000045 3300048915 Bacteria 85873
681 Ga0496112_0000590 3300048915 Bacteria 24921
682 Ga0496112_0046726 3300048915 Bacteria 4247
683 Ga0496112_0056721 3300048915 Bacteria 3856
684 Ga0496112_0078909 3300048915 Bacteria 3255
685 Ga0496112_0145890 3300048915 Bacteria 2335
686 Ga0496112_0188229 3300048915 Bacteria 2027
687 Ga0496112_0491158 3300048915 Bacteria 1163
688 Ga0496113_0005714 3300048916 Bacteria 7791
689 Ga0496113_0166662 3300048916 Bacteria 1743
690 Ga0496114_0008753 3300048917 Bacteria 8017
691 Ga0496114_0046976 3300048917 Bacteria 3589
692 Ga0496115_0005155 3300048918 Bacteria 9509
693 Ga0496115_0031770 3300048918 Bacteria 4162
694 Ga0496115_0066606 3300048918 Bacteria 2911
695 Ga0496115_0093493 3300048918 Bacteria 2459
696 Ga0496116_0001982 3300048919 Bacteria 22049
697 Ga0496117_0015594 3300048920 Bacteria 6465
698 Ga0496117_0052468 3300048920 Bacteria 2872
699 Ga0496118_0001758 3300048921 Bacteria 31406
700 Ga0496118_0064473 3300048921 Bacteria 2688
701 Ga0496118_0078658 3300048921 Bacteria 2332
702 Ga0496119_0085714 3300048922 Bacteria 1803
703 Ga0496119_0140962 3300048922 Bacteria 1302
704 Ga0496121_0000089 3300048924 Bacteria 219007
705 Ga0496121_0000379 3300048924 Bacteria 91131
706 Ga0496121_0008678 3300048924 Bacteria 11871
707 Ga0496121_0026666 3300048924 Bacteria 5434
708 Ga0496121_0053419 3300048924 Bacteria 3385
709 Ga0496121_0059468 3300048924 Bacteria 3150
710 Ga0496121_0070283 3300048924 Bacteria 2821
711 Ga0496121_0084635 3300048924 Bacteria 2499
712 Ga0496121_0120205 3300048924 Bacteria 1985
713 Ga0496122_0064048 3300048925 Bacteria 2677
714 Ga0496122_0134727 3300048925 Bacteria 1560
715 Ga0496123_0097852 3300048926 Bacteria 1717
716 Ga0496124_0004074 3300048927 Bacteria 17311
717 Ga0496124_0065983 3300048927 Bacteria 3016
718 Ga0496124_0171525 3300048927 Bacteria 1679
719 Ga0496124_0188071 3300048927 Bacteria 1583
720 Ga0496125_0000199 3300048928 Bacteria 126676
721 Ga0496125_0000964 3300048928 Bacteria 45175
722 Ga0496125_0005864 3300048928 Bacteria 13489
723 Ga0496125_0020565 3300048928 Bacteria 6192
724 Ga0496126_0003657 3300048929 Bacteria 19210
725 Ga0496126_0009808 3300048929 Bacteria 10138
726 Ga0496126_0015287 3300048929 Bacteria 7726
727 Ga0496126_0018065 3300048929 Bacteria 7005
728 Ga0496126_0027947 3300048929 Bacteria 5379
729 Ga0496126_0036593 3300048929 Bacteria 4587
730 Ga0496126_0049668 3300048929 Bacteria 3828
731 Ga0496126_0072571 3300048929 Bacteria 3062
732 Ga0496126_0142847 3300048929 Bacteria 2059
733 Ga0496126_0178468 3300048929 Bacteria 1805
734 Ga0496126_0226970 3300048929 Bacteria 1566
735 Ga0496126_0249487 3300048929 Bacteria 1480
736 Ga0496126_0305230 3300048929 Bacteria 1312
737 Ga0496126_0467470 3300048929 Bacteria 1013
738 Ga0495678_084968 3300049459 Bacteria 1128
739 Ga0495682_0042364 3300049460 Bacteria 1668
740 Ga0501031_0000712 3300049568 Bacteria 19893
741 Ga0501031_0007196 3300049568 Bacteria 7260
742 Ga0501032_0001162 3300049569 Bacteria 21118
743 Ga0501032_0012997 3300049569 Bacteria 5929
744 Ga0501032_0030027 3300049569 Bacteria 3729
745 Ga0501032_0239094 3300049569 Bacteria 1180
746 Ga0501033_0000163 3300049570 Bacteria 63913
747 Ga0501033_0003345 3300049570 Bacteria 13239
748 Ga0501033_0004893 3300049570 Bacteria 10660
749 Ga0501033_0040106 3300049570 Bacteria 3496
750 Ga0501033_0106298 3300049570 Bacteria 2044
751 Ga0501033_0259059 3300049570 Bacteria 1231
752 Ga0501034_0000202 3300049571 Bacteria 112985
753 Ga0501034_0232300 3300049571 Bacteria 1793
754 Ga0501034_0244680 3300049571 Bacteria 1739
755 Ga0501034_0274523 3300049571 Bacteria 1626
756 Ga0501034_0361547 3300049571 Bacteria 1378
757 Ga0501034_0364759 3300049571 Bacteria 1371
758 Ga0501034_0385783 3300049571 Bacteria 1325
759 Ga0501036_0000021 3300049572 Bacteria 114136
760 Ga0501036_0092713 3300049572 Bacteria 2552
761 Ga0501037_0001561 3300049573 Bacteria 16713
762 Ga0501037_0002687 3300049573 Bacteria 12835
763 Ga0501037_0158779 3300049573 Bacteria 1613
764 Ga0501038_0000226 3300049574 Bacteria 47831
765 Ga0501038_0008947 3300049574 Bacteria 9185
766 Ga0501038_0042787 3300049574 Bacteria 3943
767 Ga0501038_0050458 3300049574 Bacteria 3594
768 Ga0501038_0059839 3300049574 Bacteria 3262
769 Ga0501038_0294991 3300049574 Bacteria 1273
770 Ga0501038_0360701 3300049574 Bacteria 1130
771 Ga0501039_0001542 3300049575 Bacteria 16931
772 Ga0501039_0013937 3300049575 Bacteria 6150
773 Ga0501039_0071979 3300049575 Bacteria 2686
774 Ga0501039_0091639 3300049575 Bacteria 2369
775 Ga0501039_0209614 3300049575 Bacteria 1532
776 Ga0501042_0046481 3300049578 Bacteria 3095
777 Ga0501043_0000297 3300049579 Bacteria 44905
778 Ga0501043_0007506 3300049579 Bacteria 8659
779 Ga0501043_0157346 3300049579 Bacteria 1777
780 Ga0501043_0311569 3300049579 Bacteria 1201
781 Ga0501046_0000354 3300049580 Bacteria 46165
782 Ga0501046_0004244 3300049580 Bacteria 13045
783 Ga0501046_0055260 3300049580 Bacteria 3121
784 Ga0501046_0074042 3300049580 Bacteria 2642
785 Ga0501046_0097773 3300049580 Bacteria 2255
786 Ga0501047_0000232 3300049581 Bacteria 66245
787 Ga0501047_0024750 3300049581 Bacteria 5763
788 Ga0501047_0042605 3300049581 Bacteria 4386
789 Ga0501047_0077396 3300049581 Bacteria 3200
790 Ga0501047_0353183 3300049581 Bacteria 1306
791 Ga0501048_0000050 3300049582 Bacteria 57921
792 Ga0501048_0309750 3300049582 Bacteria 1124
793 Ga0501067_0033397 3300049583 Bacteria 2855
794 Ga0501068_0005647 3300049584 Bacteria 6852
795 Ga0501068_0099425 3300049584 Bacteria 1802
796 Ga0501068_0102216 3300049584 Bacteria 1777
797 Ga0501069_0013995 3300049585 Bacteria 4285
798 Ga0501069_0164635 3300049585 Bacteria 1278
799 Ga0501069_0257334 3300049585 Bacteria 1019
800 Ga0501070_0010465 3300049586 Bacteria 7843
801 Ga0501070_0012142 3300049586 Bacteria 7269
802 Ga0501070_0126992 3300049586 Bacteria 2107
803 Ga0501070_0146503 3300049586 Bacteria 1949
804 Ga0501070_0408153 3300049586 Bacteria 1098
805 Ga0501071_0007174 3300049587 Bacteria 7290
806 Ga0501072_0002675 3300049588 Bacteria 13364
807 Ga0501073_0000329 3300049589 Bacteria 31824
808 Ga0501073_0030779 3300049589 Bacteria 3832
809 Ga0501073_0078360 3300049589 Bacteria 2299
810 Ga0501074_0000092 3300049590 Bacteria 43073
811 Ga0501074_0058728 3300049590 Bacteria 2771
812 Ga0501076_0439530 3300049592 Bacteria 1074
813 Ga0501079_0003108 3300049741 Bacteria 12164
814 Ga0501080_0003432 3300049742 Bacteria 13983
815 Ga0501080_0010464 3300049742 Bacteria 8493
816 Ga0501081_0131732 3300049743 Bacteria 1787
817 Ga0501083_0001578 3300049744 Bacteria 15557
818 Ga0501035_0000120 3300049822 Bacteria 94532
819 Ga0501035_0006842 3300049822 Bacteria 10654
820 Ga0501035_0034371 3300049822 Bacteria 4606
821 Ga0501035_0052075 3300049822 Bacteria 3664
822 Ga0501035_0135730 3300049822 Bacteria 2142
823 Ga0501035_0207791 3300049822 Bacteria 1676
824 Ga0501035_0483978 3300049822 Bacteria 1020
825 Ga0501044_0000179 3300049823 Bacteria 78633
826 Ga0501044_0006711 3300049823 Bacteria 12684
827 Ga0501044_0011798 3300049823 Bacteria 9467
828 Ga0501044_0036929 3300049823 Bacteria 5109
829 Ga0501044_0067683 3300049823 Bacteria 3638
830 Ga0501044_0076403 3300049823 Bacteria 3399
831 Ga0501044_0341285 3300049823 Bacteria 1419
832 Ga0501045_0029730 3300049824 Bacteria 3951
833 Ga0501045_0070105 3300049824 Bacteria 2578
834 nmdc:mga00v17_30387_c1 3300050491 Bacteria 3179
835 nmdc:mga00v17_67999_c1 3300050491 Bacteria 2202
836 nmdc:mga0yw44_124113_c1 3300050492 Bacteria 1666
837 nmdc:mga0yw44_16058_c1 3300050492 Bacteria 4034
838 nmdc:mga0yw44_78142_c1 3300050492 Bacteria 2069
839 nmdc:mga0k408_122584_c1 3300050493 Bacteria 1540
840 nmdc:mga06z11_246834_c1 3300050494 Bacteria 1050
841 nmdc:mga06z11_5224_c1 3300050494 Bacteria 5189
842 nmdc:mga07m45_24176_c1 3300050496 Bacteria 3326
843 nmdc:mga07m45_30288_c1 3300050496 Bacteria 2996
844 nmdc:mga0qj67_228926_c1 3300050509 Bacteria 1508
845 nmdc:mga08y16_317611_c1 3300050511 Bacteria 1604
846 nmdc:mga0n895_396351_c1 3300050512 Bacteria 1396
847 nmdc:mga0a205_399935_c1 3300050515 Bacteria 1237
848 nmdc:mga0sz30_16504_c1 3300050516 Bacteria 2934
849 nmdc:mga0sz30_4339_c1 3300050516 Bacteria 5118
850 Ga0495601_0035464 3300053077 Bacteria 3114
851 Ga0495601_0079177 3300053077 Bacteria 2106
852 Ga0495601_0189622 3300053077 Bacteria 1344
853 Ga0495612_0056013 3300053078 Bacteria 1626
854 Ga0495655_0027424 3300053083 Bacteria 1351
855 Ga0495595_0018265 3300053084 Bacteria 3029
856 Ga0495595_0055957 3300053084 Bacteria 1837
857 Ga0495619_0006768 3300053085 Bacteria 7250
858 Ga0495619_0009872 3300053085 Bacteria 6017
859 Ga0495619_0199100 3300053085 Bacteria 1386
860 Ga0500643_014733 3300053087 Bacteria 2705
861 Ga0500646_0029959 3300053090 Bacteria 1492
862 Ga0500647_0034601 3300053091 Bacteria 2412
863 Ga0500647_0073858 3300053091 Bacteria 1636
864 Ga0500651_0066979 3300053093 Bacteria 2236
865 Ga0500651_0093884 3300053093 Bacteria 1844
866 Ga0500566_0000046 3300053094 Bacteria 59187
867 Ga0500566_0016032 3300053094 Bacteria 4401
868 Ga0500640_004013 3300053095 Bacteria 5279
869 Ga0500641_0001509 3300053096 Bacteria 8318
870 Ga0500648_120363 3300053097 Bacteria 1438
871 Ga0500556_0000003 3300053104 Bacteria 679379
872 Ga0500572_000872 3300053111 Bacteria 9361
873 Ga0500591_056543 3300053115 Bacteria 1822
874 Ga0500592_000851 3300053116 Bacteria 4973
875 Ga0500593_012453 3300053117 Bacteria 3608
876 Ga0500594_0015594 3300053118 Bacteria 1834
877 Ga0500595_000414 3300053119 Bacteria 27179
878 Ga0500595_003094 3300053119 Bacteria 7875
879 Ga0500595_012256 3300053119 Bacteria 3322
880 Ga0500595_019000 3300053119 Bacteria 2500
881 Ga0500595_064569 3300053119 Bacteria 1097
882 Ga0500607_104657 3300053121 Bacteria 1399
883 Ga0500608_003561 3300053122 Bacteria 5864
884 Ga0500608_012741 3300053122 Bacteria 3698
885 Ga0500618_009501 3300053125 Bacteria 2651
886 Ga0500642_0000104 3300053130 Bacteria 40747
887 Ga0500642_0043190 3300053130 Bacteria 1957
888 Ga0500642_0099933 3300053130 Bacteria 1348
889 Ga0500652_000138 3300053131 Bacteria 27584
890 Ga0500559_0000117 3300053136 Bacteria 62940
891 Ga0500559_0003688 3300053136 Bacteria 7469
892 Ga0500559_0060606 3300053136 Bacteria 1686
893 Ga0500568_0000838 3300053139 Bacteria 21617
894 Ga0500568_0006686 3300053139 Bacteria 5763
895 Ga0500568_0025219 3300053139 Bacteria 2511
896 Ga0500573_0005299 3300053140 Bacteria 6895
897 Ga0500577_0000338 3300053142 Bacteria 12057
898 Ga0500586_015772 3300053145 Bacteria 2277
899 Ga0500588_0005197 3300053146 Bacteria 2875
900 Ga0500603_000071 3300053150 Bacteria 23487
901 Ga0500603_000634 3300053150 Bacteria 8611
902 Ga0500603_044551 3300053150 Bacteria 1195
903 Ga0500616_0000028 3300053153 Bacteria 435722
904 Ga0500616_0000033 3300053153 Bacteria 398830
905 Ga0500616_0014363 3300053153 Bacteria 4553
906 Ga0500616_0022356 3300053153 Bacteria 3531
907 Ga0500622_0013876 3300053156 Bacteria 4338
908 Ga0500624_007945 3300053157 Bacteria 1474
909 Ga0500630_001587 3300053159 Bacteria 10874
910 Ga0500634_0044729 3300053161 Bacteria 2397
911 Ga0500639_000009 3300053163 Bacteria 139043
912 Ga0500636_0003823 3300053177 Bacteria 8511
913 Ga0500636_0112470 3300053177 Bacteria 1537
914 Ga0500637_0001208 3300053178 Bacteria 10778
915 Ga0500637_0010301 3300053178 Bacteria 4788
916 Ga0500637_0098075 3300053178 Bacteria 1699
917 Ga0500637_0154145 3300053178 Bacteria 1326
918 Ga0500649_016624 3300053722 Bacteria 2928
919 Ga0500570_086481 3300053724 Bacteria 1386
920 Ga0500611_043147 3300053727 Bacteria 1001
921 Ga0500596_000313 3300053735 Bacteria 8675
922 Ga0500596_002297 3300053735 Bacteria 3784
923 Ga0501084_0015100 3300054114 Bacteria 6405
924 Ga0501084_0216475 3300054114 Bacteria 1616
925 Ga0500661_000369 3300055283 Bacteria 8304
926 Ga0501082_0011284 3300060353 Bacteria 7680
927 Ga0501082_0098093 3300060353 Bacteria 2534
928 Ga0501082_0357985 3300060353 Bacteria 1273
929 Ga0466962_0051513 3300061719 Bacteria 1968
930 Ga0466962_0140066 3300061719 Bacteria 1172
931 2509151023 2508501128 Bacteria 8613869
932 2511395122 2511231028 Bacteria 8046582
933 2513636971 2513237094 Bacteria 8789602
934 2513657288 2513237096 Bacteria 8722461
935 2513693045 2513237101 Bacteria 7952346
936 2513857759 2513237137 Bacteria 9558895
937 2513887298 2513237141 Bacteria 8496279
938 2513919296 2513237145 Bacteria 8979722
939 2517891012 2517572143 Bacteria 9484767
940 2524441223 2524023205 Bacteria 8918781
941 2524464982 2524023210 Bacteria 9029266
942 2524537543 2524023228 Bacteria 10118060
943 2599333212 2599185156 Bacteria 5403036
944 2603860393 2602042107 Bacteria 6226103
945 2644289337 2643221651 Bacteria 4798932
946 2671120071 2667528175 Bacteria 7532676
947 2723843319 2721755755 Bacteria 8322773
948 2745078684 2744054633 Bacteria 8678936
949 2793061135 2791355196 Bacteria 7323613
950 2793066368 2791355197 Bacteria 8420563
951 2793080687
952 2819719732 2818991467 Bacteria 5893227
953 2824681515 2824679649 Bacteria 8248951
954 2837652360 2837651117 Bacteria 3772164
955 2842040940 2842038055 Bacteria 8002051
956 2842046115 2842045827 Bacteria 8006841
957 2842923519 2842922631 Bacteria 5824079
958 2844320268 2844315083 Bacteria 8138177
959 2847937590 2847930680 Bacteria 9342022
960 2857525340 2857524615 Bacteria 6615449
961 2874611793 2874604998 Bacteria 7834745
962 2874614408 2874612657 Bacteria 8252029
963 2874623800 2874620515 Bacteria 8290088
964 2876809606 2876808645 Bacteria 8824342
965 2879084086 2879083081 Bacteria 8587928
966 2879110888 2879110137 Bacteria 8907982
967 2881667144 2881665667 Bacteria 8175609
968 2885370256 2885366525 Bacteria 8326213
969 2885377333 2885374607 Bacteria 8927485
970 2889037638 2889033259 Bacteria 9099371
971 2893066285 2893066018 Bacteria 6158120
972 2903731548 2903727486 Bacteria 8281579
973 2903749655 2903748898 Bacteria 9972761
974 2904674029 2904666416 Bacteria 8226587
975 2904694462 2904690495 Bacteria 9412302
976 2904700543
977 2906608343 2906602504 Bacteria 8295279
978 2906616211
979 2906636954 2906635258 Bacteria 8601019
980 2906664452 2906660503 Bacteria 8595048
981 2908741279 2908739725 Bacteria 8628932
982 2908763402 2908756301 Bacteria 8864324
983 2919074969 2919073203 Bacteria 6531949
984 2922361597 2922361189 Bacteria 7436256
985 2922387177 2922386360 Bacteria 7017218
986 2922393704 2922393267 Bacteria 8285685
987 2922431813
988 2932799741 2932794094 Bacteria 7915132
989 2932808672 2932801729 Bacteria 7987968
990 2935635345 2935630451 Bacteria 8169952
991 2935885597 2935883170 Bacteria 7964738
992 2941512149 2941507105 Bacteria 8166816
993 2941519851 2941515067 Bacteria 8166720
994 2941527862 2941523033 Bacteria 8169134
995 2941531474 2941531003 Bacteria 7653939
996 3005481754 3005474847 Bacteria 9259049
997 3005508095 3005506211 Bacteria 6943378
998 3005723418 3005718088 Bacteria 8283608
999 8006939116 8006933436 Bacteria 10410654
1000 8006972349 8006964411 Bacteria 8966052
1001 8006978773 8006973647 Bacteria 10679141
1002 8006985032 8006984368 Bacteria 9651211
1003 8006999746 8006994254 Bacteria 8309700
1004 8019559931 8019555841 Bacteria 9642137
1005 8019570034 8019565922 Bacteria 9639779
1006 8054560946 8054558443 Bacteria 5204801
1007 8056678772 8056673599 Bacteria 7871253
1008 8056687845 8056681323 Bacteria 8472857
1009 8056690507 8056689827 Bacteria 6712655
1010 Ga0070709_10047981
1011 JGI25406J46586_10000018
1012 JGI25406J46586_10005340
1013 JGI25406J46586_10006262
1014 JGI25153J46596_10004213
1015 JGI25153J46596_10008093
1016 JGI25404J52841_10006165
1017 JGI25404J52841_10036465
1018 Ga0070658_10017070
1019 Ga0070683_100013394
1020 Ga0070683_100030933
1021 Ga0068869_100032048
1022 Ga0068869_100157173
1023 Ga0070666_10264149
1024 Ga0070680_100012612
1025 Ga0070680_100498333
1026 Ga0070682_100308629
1027 Ga0068868_100058578
1028 Ga0068868_100209989
1029 Ga0070660_100248390
1030 Ga0070689_100173153
1031 Ga0070687_100030536
1032 Ga0070661_100321895
1033 Ga0070668_100023719
1034 Ga0070668_100067352
1035 Ga0070668_100190290
1036 Ga0070674_100059750
1037 Ga0070688_100089555
1038 Ga0070688_100239186
1039 Ga0070659_100123548
1040 Ga0070659_100158477
1041 Ga0070667_100069942
1042 Ga0070667_100323540
1043 Ga0070709_10005136
1044 Ga0070709_10005610
1045 Ga0070709_10009222
1046 Ga0070714_100006193
1047 Ga0070714_100021334
1048 Ga0070714_100310414
1049 Ga0070713_100002525
1050 Ga0070713_100019290
1051 Ga0070713_100036104
1052 Ga0070713_100090628
1053 Ga0070713_100100027
1054 Ga0070713_100150376
1055 Ga0070710_10001159
1056 Ga0070710_10023562
1057 Ga0070710_10030708
1058 Ga0070701_10048550
1059 Ga0070701_10318475
1060 Ga0070711_100002007
1061 Ga0070711_100004216
1062 Ga0070711_100010835
1063 Ga0070711_100067859
1064 Ga0070711_100086272
1065 Ga0070663_100035803
1066 Ga0070663_100129492
1067 Ga0070663_100288317
1068 Ga0070678_100040300
1069 Ga0070678_100056425
1070 Ga0070678_100142071
1071 Ga0070678_100391859
1072 Ga0070662_100036426
1073 Ga0070662_100090074
1074 Ga0070681_10007970
1075 Ga0070681_10016550
1076 Ga0070681_10088042
1077 Ga0070681_10177810
1078 Ga0070681_10201308
1079 Ga0068867_100017580
1080 Ga0068867_100147277
1081 Ga0070707_100165528
1082 Ga0070698_100027277
1083 Ga0070699_100314639
1084 Ga0070679_100013091
1085 Ga0070679_100047345
1086 Ga0070679_100187798
1087 Ga0070679_100260768
1088 Ga0070684_100005702
1089 Ga0070684_100007810
1090 Ga0068853_100231742
1091 Ga0070672_100037602
1092 Ga0070672_100174946
1093 Ga0070672_100273872
1094 Ga0070686_100109598
1095 Ga0070665_100027974
1096 Ga0070665_100040289
1097 Ga0070665_100101604
1098 Ga0070665_100174338
1099 Ga0070665_100177636
1100 Ga0068855_100028483
1101 Ga0068855_100145464
1102 Ga0068855_100200019
1103 Ga0068855_100249194
1104 Ga0068855_100310689
1105 Ga0068857_100419966
1106 Ga0068854_100071969
1107 Ga0068856_100000505
1108 Ga0068856_100079591
1109 Ga0068856_100205879
1110 Ga0068856_100209643
1111 Ga0068852_100012532
1112 Ga0068852_100014578
1113 Ga0068852_100106904
1114 Ga0068859_100112115
1115 Ga0068859_100212866
1116 Ga0068864_100154674
1117 Ga0068861_100054079
1118 Ga0068870_10220881
1119 Ga0068863_100521610
1120 Ga0068858_100131906
1121 Ga0068860_100000101
1122 Ga0068860_100054649
1123 Ga0068860_100151843
1124 Ga0068862_100068784
1125 Ga0068862_100101143
1126 Ga0068862_100257281
1127 Ga0068862_100318665
1128 Ga0081455_10005572
1129 Ga0081455_10005785
1130 Ga0081455_10006447
1131 Ga0081455_10021510
1132 Ga0081538_10107252
1133 Ga0081540_1002041
1134 Ga0081540_1003848
1135 Ga0081540_1007700
1136 Ga0081540_1011669
1137 Ga0081540_1014956
1138 Ga0081540_1019359
1139 Ga0081540_1045183
1140 Ga0081539_10000003
1141 Ga0081539_10000199
1142 Ga0081539_10032330
1143 Ga0081539_10100868
1144 Ga0081539_10151778
1145 Ga0070717_10001543
1146 Ga0070717_10067095
1147 Ga0070717_10069149
1148 Ga0075365_10011224
1149 Ga0075365_10040460
1150 Ga0075365_10090329
1151 Ga0075365_10093018
1152 Ga0075365_10121863
1153 Ga0075364_10036099
1154 Ga0075364_10072950
1155 Ga0070715_10000555
1156 Ga0070716_100006104
1157 Ga0070716_100028516
1158 Ga0070716_100060116
1159 Ga0070716_100099729
1160 Ga0070712_100007857
1161 Ga0070712_100012273
1162 Ga0070712_100016728
1163 Ga0070712_100097092
1164 Ga0075367_10050011
1165 Ga0075367_10192497
1166 Ga0075366_10029876
1167 Ga0075370_10046260
1168 Ga0075434_100422636
1169 Ga0075429_100439220
1170 Ga0068865_100214855
1171 Ga0097620_100112123
1172 Ga0097620_100212868
1173 Ga0099822_1000663
1174 Ga0099794_10013970
1175 Ga0099794_10033008
1176 Ga0105240_10004584
1177 Ga0105240_10200101
1178 Ga0105240_10365133
1179 Ga0105240_10446667
1180 Ga0111539_10467329
1181 Ga0105245_10014011
1182 Ga0105245_10125798
1183 Ga0105247_10182419
1184 Ga0114129_10240320
1185 Ga0105243_10019284
1186 Ga0105243_10065157
1187 Ga0105241_10036436
1188 Ga0105241_10047652
1189 Ga0105242_10193818
1190 Ga0105242_10335742
1191 Ga0105248_10036694
1192 Ga0105248_10126848
1193 Ga0105237_10017452
1194 Ga0105237_10086786
1195 Ga0105237_10090991
1196 Ga0105238_10003279
1197 Ga0105238_10015544
1198 Ga0105238_10088935
1199 Ga0105238_10109487
1200 Ga0105249_10307808
1201 Ga0105249_10535490
1202 Ga0099796_10003116
1203 Ga0105239_10022515
1204 Ga0105239_10058045
1205 Ga0105239_10436941
1206 Ga0157370_10013258
1207 Ga0157370_10021342
1208 Ga0157369_10018648
1209 Ga0157369_10050530
1210 Ga0157369_10173351
1211 Ga0157369_10475226
1212 Ga0157374_10021557
1213 Ga0157374_10049574
1214 Ga0157374_10226054
1215 Ga0157378_10024322
1216 Ga0157378_10299303
1217 Ga0157378_10379549
1218 Ga0163162_10160155
1219 Ga0163162_10183944
1220 Ga0163162_10602555
1221 Ga0157372_10100777
1222 Ga0157372_10229748
1223 Ga0157375_10053921
1224 Ga0157375_10163180
1225 Ga0163163_10313416
1226 Ga0157380_10371022
1227 Ga0157379_10066497
1228 Ga0157376_10036968
1229 Ga0163161_10221020
1230 Ga0163161_10266945
1231 Ga0206356_11193562
1232 Ga0206353_11100446
1233 Ga0213872_10003012
1234 Ga0213872_10003019
1235 Ga0213872_10006968
1236 Ga0213872_10011539
1237 Ga0213872_10024525
1238 Ga0213872_10026435
1239 Ga0213876_10016846
1240 Ga0213875_10057382
1241 Ga0213871_10026820
1242 Ga0209564_1000865
1243 Ga0209758_1000120
1244 Ga0209758_1000267
1245 Ga0209758_1000720
1246 Ga0209758_1003178
1247 Ga0209758_1005954
1248 Ga0209758_1010377
1249 Ga0209758_1015367
1250 Ga0209758_1033211
1251 Ga0207426_1026634
1252 Ga0209257_1043208
1253 Ga0207697_10072132
1254 Ga0207656_10017228
1255 Ga0207656_10142318
1256 Ga0207653_10049560
1257 Ga0207682_10068106
1258 Ga0207692_10002181
1259 Ga0207692_10009758
1260 Ga0207692_10065282
1261 Ga0207642_10111458
1262 Ga0207710_10071162
1263 Ga0207680_10071245
1264 Ga0207685_10027658
1265 Ga0207699_10001171
1266 Ga0207699_10115073
1267 Ga0207645_10014371
1268 Ga0207705_10121553
1269 Ga0207654_10011567
1270 Ga0207654_10309633
1271 Ga0207707_10004201
1272 Ga0207707_10028716
1273 Ga0207707_10052097
1274 Ga0207707_10061385
1275 Ga0207707_10116244
1276 Ga0207695_10000163
1277 Ga0207695_10428331
1278 Ga0207671_10011282
1279 Ga0207671_10030974
1280 Ga0207671_10043463
1281 Ga0207693_10003158
1282 Ga0207693_10006713
1283 Ga0207693_10024089
1284 Ga0207693_10039929
1285 Ga0207693_10044762
1286 Ga0207693_10426772
1287 Ga0207663_10000261
1288 Ga0207663_10008702
1289 Ga0207663_10047740
1290 Ga0207663_10096533
1291 Ga0207663_10275375
1292 Ga0207660_10009640
1293 Ga0207660_10137522
1294 Ga0207660_10237550
1295 Ga0207657_10002700
1296 Ga0207657_10005124
1297 Ga0207652_10006338
1298 Ga0207652_10009869
1299 Ga0207652_10017004
1300 Ga0207652_10495896
1301 Ga0207646_10084060
1302 Ga0207694_10038223
1303 Ga0207694_10059974
1304 Ga0207694_10489088
1305 Ga0207687_10009704
1306 Ga0207687_10033220
1307 Ga0207687_10265166
1308 Ga0207700_10007733
1309 Ga0207700_10024258
1310 Ga0207700_10044654
1311 Ga0207700_10069105
1312 Ga0207700_10086075
1313 Ga0207700_10096957
1314 Ga0207664_10023451
1315 Ga0207664_10084912
1316 Ga0207664_10113811
1317 Ga0207664_10336092
1318 Ga0207664_10381981
1319 Ga0207664_10428254
1320 Ga0207644_10070982
1321 Ga0207706_10037862
1322 Ga0207686_10204562
1323 Ga0207670_10110812
1324 Ga0207704_10024462
1325 Ga0207704_10258411
1326 Ga0207665_10000280
1327 Ga0207665_10002029
1328 Ga0207665_10066558
1329 Ga0207665_10132765
1330 Ga0207691_10168950
1331 Ga0207711_10030253
1332 Ga0207711_10362277
1333 Ga0207689_10079591
1334 Ga0207661_10000532
1335 Ga0207661_10002592
1336 Ga0207661_10018698
1337 Ga0207667_10128551
1338 Ga0207667_10137958
1339 Ga0207667_10358269
1340 Ga0207651_10480525
1341 Ga0207668_10055665
1342 Ga0207640_10069450
1343 Ga0207658_10261034
1344 Ga0207677_10026809
1345 Ga0207678_10042731
1346 Ga0207678_10115319
1347 Ga0207678_10177504
1348 Ga0207708_10045881
1349 Ga0207702_10000127
1350 Ga0207702_10195945
1351 Ga0207702_10242785
1352 Ga0207641_10053496
1353 Ga0207641_10330047
1354 Ga0207648_10095226
1355 Ga0207648_10485139
1356 Ga0207674_10073279
1357 Ga0207674_10437166
1358 Ga0207675_100106446
1359 Ga0207675_100148533
1360 Ga0207683_10051817
1361 Ga0207683_10300587
1362 Ga0207698_10008740
1363 Ga0207698_10020122
1364 Ga0207698_10146869
1365 Ga0207698_10223686
1366 Ga0207698_10236000
1367 Ga0207698_10467637
1368 Ga0209389_1000186
1369 Ga0209389_1000261
1370 Ga0209589_1000006
1371 Ga0209589_1001077
1372 Ga0209489_100007
1373 Ga0209489_100176
1374 Ga0209489_112845
1375 Ga0209700_100008
1376 Ga0209700_101165
1377 Ga0209588_1000499
1378 Ga0209588_1016019
1379 Ga0268266_10002993
1380 Ga0268266_10073304
1381 Ga0268266_10074116
1382 Ga0268266_10241032
1383 Ga0268266_10263537
1384 Ga0268265_10069393
1385 Ga0268264_10000030
1386 Ga0307517_10000744
1387 Ga0307511_10097451
1388 Ga0265330_10012783
1389 Ga0265330_10093495
1390 Ga0265332_10146508
1391 Ga0265340_10006832
1392 Ga0265339_10001302
1393 Ga0265339_10093600
1394 Ga0265331_10128069
1395 Ga0265331_10128079
1396 Ga0307513_10229452
1397 Ga0307408_100007557
1398 Ga0307408_100294245
1399 Ga0265313_10113715
1400 Ga0307508_10000051
1401 Ga0265314_10001137
1402 Ga0265342_10014921
1403 Ga0265342_10017603
1404 Ga0307516_10011569
1405 Ga0307516_10209330
1406 Ga0307405_10055379
1407 Ga0307412_10170917
1408 Ga0307416_100266727
1409 Ga0307507_10006354
1410 Ga0307510_10021805
1411 Ga0307510_10038903
1412 Ga0315911_1000003
1413 Ga0373926_0001921
1414 Ga0373934_0004312
1415 Ga0373944_0088312
1416 Ga0373923_0008455
1417 Ga0373923_0111930
1418 Ga0373936_0033852
1419 Ga0373941_0004414
1420 Ga0373953_0002981
1421 Ga0373953_0066316
1422 Ga0373954_0002129
1423 Ga0373954_0042019
1424 Ga0373956_0003044
1425 Ga0373957_0000776
1426 Ga0373946_0002366
1427 Ga0373955_0004043
1428 Ga0373924_0016757
1429 Ga0373924_0025943
1430 Ga0373924_0051372
1431 Ga0373931_0001492
1432 Ga0373931_0062680
1433 Ga0373935_0006343
1434 Ga0373935_0237665
1435 Ga0373935_0257872
1436 Ga0373927_0003904
1437 Ga0373927_0005891
1438 Ga0373927_0007576
1439 Ga0373927_0034813
1440 Ga0373927_0074134
1441 Ga0373927_0152846
1442 Ga0373933_0000342
1443 Ga0373933_0013742
1444 Ga0373933_0084118
1445 Ga0373933_0114086
1446 Ga0373933_0118584
1447 Ga0373933_0168080
1448 Ga0373947_0144671
1449 Ga0373947_0202056
1450 Ga0373937_0033338
1451 Ga0373937_0047682
1452 Ga0373937_0158558
1453 Ga0373937_0260560
1454 Ga0372808_010827
1455 Ga0373925_0015751
1456 Ga0373925_0048031
1457 Ga0373925_0070092
1458 Ga0395899_0061768
1459 Ga0395900_0003599
1460 Ga0395900_0086144
1461 Ga0395900_0177363
1462 Ga0395898_0129104
1463 Ga0395898_0145864
1464 Ga0395905_0052126
1465 Ga0436364_0997829
1466 Ga0395901_0060727
1467 Ga0395901_0352152
1468 Ga0395901_0564445
1469 Ga0436365_0386944
1470 Ga0436365_0629162
1471 Ga0436365_0838985
1472 Ga0436365_0948695
1473 Ga0436360_0974952
1474 Ga0436361_0017850
1475 Ga0436361_0107745
1476 Ga0436361_0158927
1477 Ga0436361_0336033
1478 Ga0436361_0352642
1479 Ga0436361_0421829
1480 Ga0436361_0786450
1481 Ga0436361_0791494
1482 Ga0436363_0123844
1483 Ga0436363_1054182
1484 Ga0436363_1110633
1485 Ga0436362_1134339
1486 Ga0439438_023360
1487 Ga0439465_0015316
1488 Ga0450920_010714
1489 Ga0450909_007227
1490 Ga0466966_0021986
1491 Ga0466966_0053736
1492 Ga0466961_0000005
1493 Ga0466963_0142709
1494 Ga0466968_0083797
1495 Ga0466957_0021630
1496 Ga0466959_0005696
1497 Ga0466959_0062058
1498 Ga0466959_0305774
1499 Ga0466958_0000489
1500 Ga0466967_0405689
1501 Ga0495592_0006971
1502 Ga0495603_0004320
1503 Ga0495603_0011117
1504 Ga0495603_0011224
1505 Ga0495603_0055469
1506 Ga0495629_0000439
1507 Ga0495629_0008693
1508 Ga0495629_0025310
1509 Ga0495629_0100051
1510 Ga0495651_0042346
1511 Ga0495651_0250894
1512 Ga0495653_0011927
1513 Ga0495653_0023097
1514 Ga0495653_0183161
1515 Ga0495650_0071355
1516 Ga0495580_0010913
1517 Ga0495580_0063049
1518 Ga0495582_0095209
1519 Ga0495639_0063048
1520 Ga0495639_0072485
1521 Ga0495639_0129605
1522 Ga0495639_0180987
1523 Ga0495662_0002831
1524 Ga0495662_0014677
1525 Ga0495664_0013575
1526 Ga0495664_0026776
1527 Ga0495664_0177552
1528 Ga0495664_0179188
1529 Ga0495594_0005519
1530 Ga0495606_0002132
1531 Ga0495606_0033400
1532 Ga0495606_0069189
1533 Ga0495606_0191328
1534 Ga0495608_0005431
1535 Ga0495608_0034052
1536 Ga0495608_0198955
1537 Ga0495616_0022428
1538 Ga0495618_0007998
1539 Ga0495618_0014482
1540 Ga0495620_0059400
1541 Ga0495628_0013324
1542 Ga0495628_0020870
1543 Ga0495628_0029898
1544 Ga0495628_0060379
1545 Ga0495628_0182993
1546 Ga0495630_0070295
1547 Ga0495631_0030231
1548 Ga0495632_0053190
1549 Ga0495644_0016361
1550 Ga0495648_0003395
1551 Ga0495648_0015565
1552 Ga0495648_0019958
1553 Ga0495663_0069778
1554 Ga0495666_0021512
1555 Ga0495652_0060178
1556 Ga0495652_0093996
1557 Ga0495665_0005469
1558 Ga0495665_0017404
1559 Ga0495665_0073583
1560 Ga0495640_0004906
1561 Ga0495640_0092548
1562 Ga0495587_0157856
1563 Ga0495597_0025921
1564 Ga0495645_0015849
1565 Ga0495645_0114450
1566 Ga0495645_0211699
1567 Ga0495622_0047942
1568 Ga0495667_0005621
1569 Ga0495667_0094625
1570 Ga0495667_0273281
1571 Ga0495656_0041568
1572 Ga0495656_0130033
1573 Ga0495668_0061198
1574 Ga0495668_0174252
1575 Ga0495634_0003738
1576 Ga0495634_0024516
1577 Ga0495634_0034617
1578 Ga0495634_0100438
1579 Ga0495625_0089530
1580 Ga0495635_0013164
1581 Ga0495635_0016717
1582 Ga0495659_0011155
1583 Ga0495588_0009072
1584 Ga0495657_0010362
1585 Ga0495657_0013824
1586 Ga0495599_0001369
1587 Ga0495599_0033876
1588 Ga0495623_0005388
1589 Ga0495623_0014960
1590 Ga0495646_0024958
1591 Ga0495646_0026668
1592 Ga0495646_0071750
1593 Ga0495658_0003784
1594 Ga0495658_0009854
1595 Ga0495669_0049543
1596 Ga0495613_0007099
1597 Ga0495613_0063134
1598 Ga0495613_0090896
1599 Ga0495624_0026173
1600 Ga0495624_0035050
1601 Ga0495670_0069591
1602 Ga0495671_0028224
1603 Ga0495649_0053047
1604 Ga0495600_0001020
1605 Ga0495600_0012902
1606 Ga0495660_0078292
1607 Ga0495581_0041911
1608 Ga0495581_0109441
1609 Ga0495604_0013033
1610 Ga0495604_0060803
1611 Ga0495604_0160593
1612 Ga0495674_0000458
1613 Ga0495674_0083470
1614 Ga0495674_0113470
1615 Ga0495674_0268601
1616 Ga0495672_0019236
1617 Ga0495672_0086763
1618 Ga0495676_0065097
1619 Ga0495676_0164141
1620 Ga0495676_0232609
1621 Ga0495680_0013039
1622 Ga0495680_0015630
1623 Ga0495683_0021464
1624 Ga0495675_0009601
1625 Ga0495677_0054803
1626 Ga0495685_062018
1627 Ga0495673_0048299
1628 Ga0495681_0101552
1629 Ga0495684_0000340
1630 Ga0495684_0008134
1631 Ga0495684_0249755
1632 Ga0495686_0085798
1633 Ga0495593_0000687
1634 Ga0495593_0006332
1635 Ga0495602_0008226
1636 Ga0495602_0048912
1637 Ga0495602_0050554
1638 Ga0496100_0045126
1639 Ga0496100_0200943
1640 Ga0496100_0312377
1641 Ga0496101_0025700
1642 Ga0496101_0037723
1643 Ga0496101_0053981
1644 Ga0496101_0119798
1645 Ga0496101_0193485
1646 Ga0496102_0002648
1647 Ga0496102_0021600
1648 Ga0496102_0061834
1649 Ga0496102_0086214
1650 Ga0496102_0127148
1651 Ga0496102_0129305
1652 Ga0496102_0312680
1653 Ga0496103_0029358
1654 Ga0496103_0094489
1655 Ga0496104_0019459
1656 Ga0496104_0034268
1657 Ga0496104_0073979
1658 Ga0496105_0042398
1659 Ga0496105_0071133
1660 Ga0496105_0074458
1661 Ga0496106_0000740
1662 Ga0496106_0005785
1663 Ga0496106_0015920
1664 Ga0496106_0135311
1665 Ga0496107_0004783
1666 Ga0496107_0040726
1667 Ga0496107_0069367
1668 Ga0496107_0172903
1669 Ga0496107_0194884
1670 Ga0496108_0000938
1671 Ga0496108_0025718
1672 Ga0496108_0028262
1673 Ga0496108_0062145
1674 Ga0496109_0001723
1675 Ga0496109_0008707
1676 Ga0496109_0009518
1677 Ga0496109_0109705
1678 Ga0496109_0158599
1679 Ga0496109_0208576
1680 Ga0496110_0003174
1681 Ga0496110_0034357
1682 Ga0496110_0089604
1683 Ga0496110_0092353
1684 Ga0496110_0190977
1685 Ga0496110_0200331
1686 Ga0496111_0010537
1687 Ga0496111_0047341
1688 Ga0496111_0131890
1689 Ga0496112_0000045
1690 Ga0496112_0000590
1691 Ga0496112_0046726
1692 Ga0496112_0056721
1693 Ga0496112_0078909
1694 Ga0496112_0145890
1695 Ga0496112_0188229
1696 Ga0496112_0491158
1697 Ga0496113_0005714
1698 Ga0496113_0166662
1699 Ga0496114_0008753
1700 Ga0496114_0046976
1701 Ga0496115_0005155
1702 Ga0496115_0031770
1703 Ga0496115_0066606
1704 Ga0496115_0093493
1705 Ga0496116_0001982
1706 Ga0496117_0015594
1707 Ga0496117_0052468
1708 Ga0496118_0001758
1709 Ga0496118_0064473
1710 Ga0496118_0078658
1711 Ga0496119_0085714
1712 Ga0496119_0140962
1713 Ga0496121_0000089
1714 Ga0496121_0000379
1715 Ga0496121_0008678
1716 Ga0496121_0026666
1717 Ga0496121_0053419
1718 Ga0496121_0059468
1719 Ga0496121_0070283
1720 Ga0496121_0084635
1721 Ga0496121_0120205
1722 Ga0496122_0064048
1723 Ga0496122_0134727
1724 Ga0496123_0097852
1725 Ga0496124_0004074
1726 Ga0496124_0065983
1727 Ga0496124_0171525
1728 Ga0496124_0188071
1729 Ga0496125_0000199
1730 Ga0496125_0000964
1731 Ga0496125_0005864
1732 Ga0496125_0020565
1733 Ga0496126_0003657
1734 Ga0496126_0009808
1735 Ga0496126_0015287
1736 Ga0496126_0018065
1737 Ga0496126_0027947
1738 Ga0496126_0036593
1739 Ga0496126_0049668
1740 Ga0496126_0072571
1741 Ga0496126_0142847
1742 Ga0496126_0178468
1743 Ga0496126_0226970
1744 Ga0496126_0249487
1745 Ga0496126_0305230
1746 Ga0496126_0467470
1747 Ga0495678_084968
1748 Ga0495682_0042364
1749 Ga0501031_0000712
1750 Ga0501031_0007196
1751 Ga0501032_0001162
1752 Ga0501032_0012997
1753 Ga0501032_0030027
1754 Ga0501032_0239094
1755 Ga0501033_0000163
1756 Ga0501033_0003345
1757 Ga0501033_0004893
1758 Ga0501033_0040106
1759 Ga0501033_0106298
1760 Ga0501033_0259059
1761 Ga0501034_0000202
1762 Ga0501034_0232300
1763 Ga0501034_0244680
1764 Ga0501034_0274523
1765 Ga0501034_0361547
1766 Ga0501034_0364759
1767 Ga0501034_0385783
1768 Ga0501036_0000021
1769 Ga0501036_0092713
1770 Ga0501037_0001561
1771 Ga0501037_0002687
1772 Ga0501037_0158779
1773 Ga0501038_0000226
1774 Ga0501038_0008947
1775 Ga0501038_0042787
1776 Ga0501038_0050458
1777 Ga0501038_0059839
1778 Ga0501038_0294991
1779 Ga0501038_0360701
1780 Ga0501039_0001542
1781 Ga0501039_0013937
1782 Ga0501039_0071979
1783 Ga0501039_0091639
1784 Ga0501039_0209614
1785 Ga0501042_0046481
1786 Ga0501043_0000297
1787 Ga0501043_0007506
1788 Ga0501043_0157346
1789 Ga0501043_0311569
1790 Ga0501046_0000354
1791 Ga0501046_0004244
1792 Ga0501046_0055260
1793 Ga0501046_0074042
1794 Ga0501046_0097773
1795 Ga0501047_0000232
1796 Ga0501047_0024750
1797 Ga0501047_0042605
1798 Ga0501047_0077396
1799 Ga0501047_0353183
1800 Ga0501048_0000050
1801 Ga0501048_0309750
1802 Ga0501067_0033397
1803 Ga0501068_0005647
1804 Ga0501068_0099425
1805 Ga0501068_0102216
1806 Ga0501069_0013995
1807 Ga0501069_0164635
1808 Ga0501069_0257334
1809 Ga0501070_0010465
1810 Ga0501070_0012142
1811 Ga0501070_0126992
1812 Ga0501070_0146503
1813 Ga0501070_0408153
1814 Ga0501071_0007174
1815 Ga0501072_0002675
1816 Ga0501073_0000329
1817 Ga0501073_0030779
1818 Ga0501073_0078360
1819 Ga0501074_0000092
1820 Ga0501074_0058728
1821 Ga0501076_0439530
1822 Ga0501079_0003108
1823 Ga0501080_0003432
1824 Ga0501080_0010464
1825 Ga0501081_0131732
1826 Ga0501083_0001578
1827 Ga0501035_0000120
1828 Ga0501035_0006842
1829 Ga0501035_0034371
1830 Ga0501035_0052075
1831 Ga0501035_0135730
1832 Ga0501035_0207791
1833 Ga0501035_0483978
1834 Ga0501044_0000179
1835 Ga0501044_0006711
1836 Ga0501044_0011798
1837 Ga0501044_0036929
1838 Ga0501044_0067683
1839 Ga0501044_0076403
1840 Ga0501044_0341285
1841 Ga0501045_0029730
1842 Ga0501045_0070105
1843 nmdc:mga00v17_30387_c1
1844 nmdc:mga00v17_67999_c1
1845 nmdc:mga0yw44_124113_c1
1846 nmdc:mga0yw44_16058_c1
1847 nmdc:mga0yw44_78142_c1
1848 nmdc:mga0k408_122584_c1
1849 nmdc:mga06z11_246834_c1
1850 nmdc:mga06z11_5224_c1
1851 nmdc:mga07m45_24176_c1
1852 nmdc:mga07m45_30288_c1
1853 nmdc:mga0qj67_228926_c1
1854 nmdc:mga08y16_317611_c1
1855 nmdc:mga0n895_396351_c1
1856 nmdc:mga0a205_399935_c1
1857 nmdc:mga0sz30_16504_c1
1858 nmdc:mga0sz30_4339_c1
1859 Ga0495601_0035464
1860 Ga0495601_0079177
1861 Ga0495601_0189622
1862 Ga0495612_0056013
1863 Ga0495655_0027424
1864 Ga0495595_0018265
1865 Ga0495595_0055957
1866 Ga0495619_0006768
1867 Ga0495619_0009872
1868 Ga0495619_0199100
1869 Ga0500643_014733
1870 Ga0500646_0029959
1871 Ga0500647_0034601
1872 Ga0500647_0073858
1873 Ga0500651_0066979
1874 Ga0500651_0093884
1875 Ga0500566_0000046
1876 Ga0500566_0016032
1877 Ga0500640_004013
1878 Ga0500641_0001509
1879 Ga0500648_120363
1880 Ga0500556_0000003
1881 Ga0500572_000872
1882 Ga0500591_056543
1883 Ga0500592_000851
1884 Ga0500593_012453
1885 Ga0500594_0015594
1886 Ga0500595_000414
1887 Ga0500595_003094
1888 Ga0500595_012256
1889 Ga0500595_019000
1890 Ga0500595_064569
1891 Ga0500607_104657
1892 Ga0500608_003561
1893 Ga0500608_012741
1894 Ga0500618_009501
1895 Ga0500642_0000104
1896 Ga0500642_0043190
1897 Ga0500642_0099933
1898 Ga0500652_000138
1899 Ga0500559_0000117
1900 Ga0500559_0003688
1901 Ga0500559_0060606
1902 Ga0500568_0000838
1903 Ga0500568_0006686
1904 Ga0500568_0025219
1905 Ga0500573_0005299
1906 Ga0500577_0000338
1907 Ga0500586_015772
1908 Ga0500588_0005197
1909 Ga0500603_000071
1910 Ga0500603_000634
1911 Ga0500603_044551
1912 Ga0500616_0000028
1913 Ga0500616_0000033
1914 Ga0500616_0014363
1915 Ga0500616_0022356
1916 Ga0500622_0013876
1917 Ga0500624_007945
1918 Ga0500630_001587
1919 Ga0500634_0044729
1920 Ga0500639_000009
1921 Ga0500636_0003823
1922 Ga0500636_0112470
1923 Ga0500637_0001208
1924 Ga0500637_0010301
1925 Ga0500637_0098075
1926 Ga0500637_0154145
1927 Ga0500649_016624
1928 Ga0500570_086481
1929 Ga0500611_043147
1930 Ga0500596_000313
1931 Ga0500596_002297
1932 Ga0501084_0015100
1933 Ga0501084_0216475
1934 Ga0500661_000369
1935 Ga0501082_0011284
1936 Ga0501082_0098093
1937 Ga0501082_0357985
1938 Ga0466962_0051513
1939 Ga0466962_0140066
1940 2509151023
1941 2511395122
1942 2513636971
1943 2513657288
1944 2513693045
1945 2513857759
1946 2513887298
1947 2513919296
1948 2517891012
1949 2524441223
1950 2524464982
1951 2524537543
1952 2599333212
1953 2603860393
1954 2644289337
1955 2671120071
1956 2723843319
1957 2745078684
1958 2793061135
1959 2793066368
1960 2793080687
1961 2819719732
1962 2824681515
1963 2837652360
1964 2842040940
1965 2842046115
1966 2842923519
1967 2844320268
1968 2847937590
1969 2857525340
1970 2874611793
1971 2874614408
1972 2874623800
1973 2876809606
1974 2879084086
1975 2879110888
1976 2881667144
1977 2885370256
1978 2885377333
1979 2889037638
1980 2893066285
1981 2903731548
1982 2903749655
1983 2904674029
1984 2904694462
1985 2904700543
1986 2906608343
1987 2906616211
1988 2906636954
1989 2906664452
1990 2908741279
1991 2908763402
1992 2919074969
1993 2922361597
1994 2922387177
1995 2922393704
1996 2922431813
1997 2932799741
1998 2932808672
1999 2935635345
2000 2935885597
2001 2941512149
2002 2941519851
2003 2941527862
2004 2941531474
2005 3005481754
2006 3005508095
2007 3005723418
2008 8006939116
2009 8006972349
2010 8006978773
2011 8006985032
2012 8006999746
2013 8019559931
2014 8019570034
2015 8054560946
2016 8056678772
2017 8056687845
2018 8056690507

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

50

336

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ji5-assembly1.cif.gz_A crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum 0.9595 2 306
5ji5-assembly1.cif.gz_A crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum 0.9503 2 306
8szt-assembly1.cif.gz_A structure of kdac1 from acinetobacter baumannii 0.9487 2 309
8szt-assembly1.cif.gz_A structure of kdac1 from acinetobacter baumannii 0.9428 2 309
5g17-assembly1.cif.gz_B bordetella alcaligenes hdah (t101a) bound to 9,9,9-trifluoro-8,8- dihydroxy-n-phenylnonanamide. 0.9403 1 309
ID Description Score Start End Superfamily
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9595 2 306 3.40.800.20
af_A0A1D6N7T5_1_214_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9548 132 308 3.40.800.20
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9503 2 306 3.40.800.20
5g1cA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9387 2 309 3.40.800.20
5g1cA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9329 2 309 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A353CXS4-F1-model_v4 Deacetylase 0.9878 203 309 GO:0004407
GO:0040029
AF-A0A3B0RFC3-F1-model_v4 Histone deacetylase domain-containing protein 0.9837 203 309 GO:0004407
GO:0040029
AF-A0A2N3E2Q3-F1-model_v4 Acetoin utilization protein 0.9833 1 116 GO:0004407
GO:0040029
AF-A0A357V0E0-F1-model_v4 Acetoin utilization protein 0.9823 1 119 GO:0004407
GO:0040029
AF-A0A7V2RVP4-F1-model_v4 Histone deacetylase family protein 0.981 167 306 GO:0004407
GO:0040029

Map