F488086
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1009 | 493 | 2018 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10047981|Ga0070709_100479812 |
| Length | 339 |
| Sequence | LITDHPGRSPFRVADNGLDYPFVALAPGYLMTTLLLTHPASLDHVTPPGHPERPDRMRAVAEVLSDARFNSLVRDEAPEGDLDLVTLCHNEHYVTELRHIAPTSGMIYLDGDTSMSPGTWEAVMRGVGGAVSAMDAVMSGKHDNAFVAMRPPGHHAEISKPMGFCFFDNAAIAARHAQRKYGIGRAAVVDFDVHHGNGTQDIFWADPTVMYCSTHQMPLFPGTGAASERGEHDTIVNAPLASEDGSAKFRAAFENVILPQLKKFAPELIIISAGFDAHYRDPLASLNLKAEDFGWVTRKLMDVADSSAEGRIVSVLEGGYDLQGLKESVAAHVTALIGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 187 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 220 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 221 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 222 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 374 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 375 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 380 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 383 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 384 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 385 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 388 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 392 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 393 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 395 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 396 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 397 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 398 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 399 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 401 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 402 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 403 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 405 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 407 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 409 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 410 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 416 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 417 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 418 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 419 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 420 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 421 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 422 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 423 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 424 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 425 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 426 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 427 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 428 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 429 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 430 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 431 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 432 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 433 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 434 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 435 | 2791355199 | |||
| 436 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 437 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 438 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 439 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 440 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 441 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 442 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 443 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 444 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 445 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 446 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 447 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 448 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 449 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 450 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 451 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 452 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 453 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 454 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 455 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 456 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 457 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 458 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 459 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 460 | 2904699407 | |||
| 461 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 462 | 2906610324 | |||
| 463 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 464 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 465 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 466 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 467 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 468 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 469 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 470 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 471 | 2922425934 | |||
| 472 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 473 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 474 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 475 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 476 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 477 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 478 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 479 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 480 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 481 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 482 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 483 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 484 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 485 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 486 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 487 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 488 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 489 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 490 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 491 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 492 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 493 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.24 |
| Metatranscriptomes | 0.3 |
| Isolates | 7.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.91 |
| Nodule | 5.55 |
| Rhizoplane | 6.94 |
| Rhizosphere | 68.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10047981 | 3300005434 | Bacteria | 2663 |
| 2 | JGI25406J46586_10000018 | 3300003203 | Bacteria | 88860 |
| 3 | JGI25406J46586_10005340 | 3300003203 | Bacteria | 5960 |
| 4 | JGI25406J46586_10006262 | 3300003203 | Bacteria | 5491 |
| 5 | JGI25153J46596_10004213 | 3300003215 | Bacteria | 7795 |
| 6 | JGI25153J46596_10008093 | 3300003215 | Bacteria | 5070 |
| 7 | JGI25404J52841_10006165 | 3300003659 | Bacteria | 2499 |
| 8 | JGI25404J52841_10036465 | 3300003659 | Bacteria | 1046 |
| 9 | Ga0070658_10017070 | 3300005327 | Bacteria | 5809 |
| 10 | Ga0070683_100013394 | 3300005329 | Bacteria | 7151 |
| 11 | Ga0070683_100030933 | 3300005329 | Bacteria | 4864 |
| 12 | Ga0068869_100032048 | 3300005334 | Bacteria | 3701 |
| 13 | Ga0068869_100157173 | 3300005334 | Bacteria | 1767 |
| 14 | Ga0070666_10264149 | 3300005335 | Bacteria | 1221 |
| 15 | Ga0070680_100012612 | 3300005336 | Bacteria | 6570 |
| 16 | Ga0070680_100498333 | 3300005336 | Bacteria | 1042 |
| 17 | Ga0070682_100308629 | 3300005337 | Bacteria | 1164 |
| 18 | Ga0068868_100058578 | 3300005338 | Bacteria | 3044 |
| 19 | Ga0068868_100209989 | 3300005338 | Bacteria | 1627 |
| 20 | Ga0070660_100248390 | 3300005339 | Bacteria | 1450 |
| 21 | Ga0070689_100173153 | 3300005340 | Bacteria | 1750 |
| 22 | Ga0070687_100030536 | 3300005343 | Bacteria | 2635 |
| 23 | Ga0070661_100321895 | 3300005344 | Bacteria | 1208 |
| 24 | Ga0070668_100023719 | 3300005347 | Bacteria | 4643 |
| 25 | Ga0070668_100067352 | 3300005347 | Bacteria | 2781 |
| 26 | Ga0070668_100190290 | 3300005347 | Bacteria | 1680 |
| 27 | Ga0070674_100059750 | 3300005356 | Bacteria | 2654 |
| 28 | Ga0070688_100089555 | 3300005365 | Bacteria | 2008 |
| 29 | Ga0070688_100239186 | 3300005365 | Bacteria | 1288 |
| 30 | Ga0070659_100123548 | 3300005366 | Bacteria | 2099 |
| 31 | Ga0070659_100158477 | 3300005366 | Bacteria | 1850 |
| 32 | Ga0070667_100069942 | 3300005367 | Bacteria | 2987 |
| 33 | Ga0070667_100323540 | 3300005367 | Bacteria | 1392 |
| 34 | Ga0070709_10005136 | 3300005434 | Bacteria | 7082 |
| 35 | Ga0070709_10005610 | 3300005434 | Bacteria | 6792 |
| 36 | Ga0070709_10009222 | 3300005434 | Bacteria | 5432 |
| 37 | Ga0070714_100006193 | 3300005435 | Bacteria | 9201 |
| 38 | Ga0070714_100021334 | 3300005435 | Bacteria | 5301 |
| 39 | Ga0070714_100310414 | 3300005435 | Bacteria | 1472 |
| 40 | Ga0070713_100002525 | 3300005436 | Bacteria | 11957 |
| 41 | Ga0070713_100019290 | 3300005436 | Bacteria | 5202 |
| 42 | Ga0070713_100036104 | 3300005436 | Bacteria | 3986 |
| 43 | Ga0070713_100090628 | 3300005436 | Bacteria | 2629 |
| 44 | Ga0070713_100100027 | 3300005436 | Bacteria | 2509 |
| 45 | Ga0070713_100150376 | 3300005436 | Bacteria | 2070 |
| 46 | Ga0070710_10001159 | 3300005437 | Bacteria | 12475 |
| 47 | Ga0070710_10023562 | 3300005437 | Bacteria | 3237 |
| 48 | Ga0070710_10030708 | 3300005437 | Bacteria | 2893 |
| 49 | Ga0070701_10048550 | 3300005438 | Bacteria | 2191 |
| 50 | Ga0070701_10318475 | 3300005438 | Bacteria | 962 |
| 51 | Ga0070711_100002007 | 3300005439 | Bacteria | 11458 |
| 52 | Ga0070711_100004216 | 3300005439 | Bacteria | 8451 |
| 53 | Ga0070711_100010835 | 3300005439 | Bacteria | 5652 |
| 54 | Ga0070711_100067859 | 3300005439 | Bacteria | 2504 |
| 55 | Ga0070711_100086272 | 3300005439 | Bacteria | 2250 |
| 56 | Ga0070663_100035803 | 3300005455 | Bacteria | 3446 |
| 57 | Ga0070663_100129492 | 3300005455 | Bacteria | 1915 |
| 58 | Ga0070663_100288317 | 3300005455 | Bacteria | 1310 |
| 59 | Ga0070678_100040300 | 3300005456 | Bacteria | 3304 |
| 60 | Ga0070678_100056425 | 3300005456 | Bacteria | 2872 |
| 61 | Ga0070678_100142071 | 3300005456 | Bacteria | 1922 |
| 62 | Ga0070678_100391859 | 3300005456 | Bacteria | 1204 |
| 63 | Ga0070662_100036426 | 3300005457 | Bacteria | 3480 |
| 64 | Ga0070662_100090074 | 3300005457 | Bacteria | 2302 |
| 65 | Ga0070681_10007970 | 3300005458 | Bacteria | 10367 |
| 66 | Ga0070681_10016550 | 3300005458 | Bacteria | 7363 |
| 67 | Ga0070681_10088042 | 3300005458 | Bacteria | 3058 |
| 68 | Ga0070681_10177810 | 3300005458 | Bacteria | 2050 |
| 69 | Ga0070681_10201308 | 3300005458 | Bacteria | 1909 |
| 70 | Ga0068867_100017580 | 3300005459 | Bacteria | 5077 |
| 71 | Ga0068867_100147277 | 3300005459 | Bacteria | 1847 |
| 72 | Ga0070707_100165528 | 3300005468 | Bacteria | 2155 |
| 73 | Ga0070698_100027277 | 3300005471 | Bacteria | 5942 |
| 74 | Ga0070699_100314639 | 3300005518 | Bacteria | 1406 |
| 75 | Ga0070679_100013091 | 3300005530 | Bacteria | 7944 |
| 76 | Ga0070679_100047345 | 3300005530 | Bacteria | 4286 |
| 77 | Ga0070679_100187798 | 3300005530 | Bacteria | 2036 |
| 78 | Ga0070679_100260768 | 3300005530 | Bacteria | 1688 |
| 79 | Ga0070684_100005702 | 3300005535 | Bacteria | 9563 |
| 80 | Ga0070684_100007810 | 3300005535 | Bacteria | 8341 |
| 81 | Ga0068853_100231742 | 3300005539 | Bacteria | 1690 |
| 82 | Ga0070672_100037602 | 3300005543 | Bacteria | 3694 |
| 83 | Ga0070672_100174946 | 3300005543 | Bacteria | 1787 |
| 84 | Ga0070672_100273872 | 3300005543 | Bacteria | 1426 |
| 85 | Ga0070686_100109598 | 3300005544 | Bacteria | 1879 |
| 86 | Ga0070665_100027974 | 3300005548 | Bacteria | 5678 |
| 87 | Ga0070665_100040289 | 3300005548 | Bacteria | 4696 |
| 88 | Ga0070665_100101604 | 3300005548 | Bacteria | 2879 |
| 89 | Ga0070665_100174338 | 3300005548 | Bacteria | 2151 |
| 90 | Ga0070665_100177636 | 3300005548 | Bacteria | 2130 |
| 91 | Ga0068855_100028483 | 3300005563 | Bacteria | 6681 |
| 92 | Ga0068855_100145464 | 3300005563 | Bacteria | 2699 |
| 93 | Ga0068855_100200019 | 3300005563 | Bacteria | 2250 |
| 94 | Ga0068855_100249194 | 3300005563 | Bacteria | 1981 |
| 95 | Ga0068855_100310689 | 3300005563 | Bacteria | 1744 |
| 96 | Ga0068857_100419966 | 3300005577 | Bacteria | 1247 |
| 97 | Ga0068854_100071969 | 3300005578 | Bacteria | 2531 |
| 98 | Ga0068856_100000505 | 3300005614 | Bacteria | 43297 |
| 99 | Ga0068856_100079591 | 3300005614 | Bacteria | 3250 |
| 100 | Ga0068856_100205879 | 3300005614 | Bacteria | 1982 |
| 101 | Ga0068856_100209643 | 3300005614 | Bacteria | 1964 |
| 102 | Ga0068852_100012532 | 3300005616 | Bacteria | 6441 |
| 103 | Ga0068852_100014578 | 3300005616 | Bacteria | 6057 |
| 104 | Ga0068852_100106904 | 3300005616 | Bacteria | 2537 |
| 105 | Ga0068859_100112115 | 3300005617 | Bacteria | 2790 |
| 106 | Ga0068859_100212866 | 3300005617 | Bacteria | 2019 |
| 107 | Ga0068864_100154674 | 3300005618 | Bacteria | 2080 |
| 108 | Ga0068861_100054079 | 3300005719 | Bacteria | 3057 |
| 109 | Ga0068870_10220881 | 3300005840 | Bacteria | 1160 |
| 110 | Ga0068863_100521610 | 3300005841 | Bacteria | 1171 |
| 111 | Ga0068858_100131906 | 3300005842 | Bacteria | 2343 |
| 112 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 113 | Ga0068860_100054649 | 3300005843 | Bacteria | 3795 |
| 114 | Ga0068860_100151843 | 3300005843 | Bacteria | 2231 |
| 115 | Ga0068862_100068784 | 3300005844 | Bacteria | 3055 |
| 116 | Ga0068862_100101143 | 3300005844 | Bacteria | 2521 |
| 117 | Ga0068862_100257281 | 3300005844 | Bacteria | 1592 |
| 118 | Ga0068862_100318665 | 3300005844 | Bacteria | 1434 |
| 119 | Ga0081455_10005572 | 3300005937 | Bacteria | 13777 |
| 120 | Ga0081455_10005785 | 3300005937 | Bacteria | 13478 |
| 121 | Ga0081455_10006447 | 3300005937 | Bacteria | 12574 |
| 122 | Ga0081455_10021510 | 3300005937 | Bacteria | 6051 |
| 123 | Ga0081538_10107252 | 3300005981 | Bacteria | 1384 |
| 124 | Ga0081540_1002041 | 3300005983 | Bacteria | 16838 |
| 125 | Ga0081540_1003848 | 3300005983 | Bacteria | 11726 |
| 126 | Ga0081540_1007700 | 3300005983 | Bacteria | 7634 |
| 127 | Ga0081540_1011669 | 3300005983 | Bacteria | 5856 |
| 128 | Ga0081540_1014956 | 3300005983 | Bacteria | 4935 |
| 129 | Ga0081540_1019359 | 3300005983 | Bacteria | 4141 |
| 130 | Ga0081540_1045183 | 3300005983 | Bacteria | 2241 |
| 131 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 132 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 133 | Ga0081539_10032330 | 3300005985 | Bacteria | 3206 |
| 134 | Ga0081539_10100868 | 3300005985 | Bacteria | 1472 |
| 135 | Ga0081539_10151778 | 3300005985 | Bacteria | 1114 |
| 136 | Ga0070717_10001543 | 3300006028 | Bacteria | 15977 |
| 137 | Ga0070717_10067095 | 3300006028 | Bacteria | 2984 |
| 138 | Ga0070717_10069149 | 3300006028 | Bacteria | 2940 |
| 139 | Ga0075365_10011224 | 3300006038 | Bacteria | 5260 |
| 140 | Ga0075365_10040460 | 3300006038 | Bacteria | 3040 |
| 141 | Ga0075365_10090329 | 3300006038 | Bacteria | 2086 |
| 142 | Ga0075365_10093018 | 3300006038 | Bacteria | 2056 |
| 143 | Ga0075365_10121863 | 3300006038 | Bacteria | 1799 |
| 144 | Ga0075364_10036099 | 3300006051 | Bacteria | 3195 |
| 145 | Ga0075364_10072950 | 3300006051 | Bacteria | 2262 |
| 146 | Ga0070715_10000555 | 3300006163 | Bacteria | 9825 |
| 147 | Ga0070716_100006104 | 3300006173 | Bacteria | 5875 |
| 148 | Ga0070716_100028516 | 3300006173 | Bacteria | 3008 |
| 149 | Ga0070716_100060116 | 3300006173 | Bacteria | 2193 |
| 150 | Ga0070716_100099729 | 3300006173 | Bacteria | 1778 |
| 151 | Ga0070712_100007857 | 3300006175 | Bacteria | 6683 |
| 152 | Ga0070712_100012273 | 3300006175 | Bacteria | 5446 |
| 153 | Ga0070712_100016728 | 3300006175 | Bacteria | 4740 |
| 154 | Ga0070712_100097092 | 3300006175 | Bacteria | 2171 |
| 155 | Ga0075367_10050011 | 3300006178 | Bacteria | 2466 |
| 156 | Ga0075367_10192497 | 3300006178 | Bacteria | 1273 |
| 157 | Ga0075366_10029876 | 3300006195 | Bacteria | 3202 |
| 158 | Ga0075370_10046260 | 3300006353 | Bacteria | 2462 |
| 159 | Ga0075434_100422636 | 3300006871 | Bacteria | 1354 |
| 160 | Ga0075429_100439220 | 3300006880 | Bacteria | 1143 |
| 161 | Ga0068865_100214855 | 3300006881 | Bacteria | 1500 |
| 162 | Ga0097620_100112123 | 3300006931 | Bacteria | 2790 |
| 163 | Ga0097620_100212868 | 3300006931 | Bacteria | 2019 |
| 164 | Ga0099822_1000663 | 3300006943 | Bacteria | 34548 |
| 165 | Ga0099794_10013970 | 3300007265 | Bacteria | 3507 |
| 166 | Ga0099794_10033008 | 3300007265 | Bacteria | 2432 |
| 167 | Ga0105240_10004584 | 3300009093 | Bacteria | 20953 |
| 168 | Ga0105240_10200101 | 3300009093 | Bacteria | 2342 |
| 169 | Ga0105240_10365133 | 3300009093 | Bacteria | 1634 |
| 170 | Ga0105240_10446667 | 3300009093 | Bacteria | 1448 |
| 171 | Ga0111539_10467329 | 3300009094 | Bacteria | 1469 |
| 172 | Ga0105245_10014011 | 3300009098 | Bacteria | 6982 |
| 173 | Ga0105245_10125798 | 3300009098 | Bacteria | 2399 |
| 174 | Ga0105247_10182419 | 3300009101 | Bacteria | 1401 |
| 175 | Ga0114129_10240320 | 3300009147 | Bacteria | 2435 |
| 176 | Ga0105243_10019284 | 3300009148 | Bacteria | 5170 |
| 177 | Ga0105243_10065157 | 3300009148 | Bacteria | 2926 |
| 178 | Ga0105241_10036436 | 3300009174 | Bacteria | 3702 |
| 179 | Ga0105241_10047652 | 3300009174 | Bacteria | 3259 |
| 180 | Ga0105242_10193818 | 3300009176 | Bacteria | 1801 |
| 181 | Ga0105242_10335742 | 3300009176 | Bacteria | 1391 |
| 182 | Ga0105248_10036694 | 3300009177 | Bacteria | 5482 |
| 183 | Ga0105248_10126848 | 3300009177 | Bacteria | 2878 |
| 184 | Ga0105237_10017452 | 3300009545 | Bacteria | 7440 |
| 185 | Ga0105237_10086786 | 3300009545 | Bacteria | 3119 |
| 186 | Ga0105237_10090991 | 3300009545 | Bacteria | 3041 |
| 187 | Ga0105238_10003279 | 3300009551 | Bacteria | 16156 |
| 188 | Ga0105238_10015544 | 3300009551 | Bacteria | 7706 |
| 189 | Ga0105238_10088935 | 3300009551 | Bacteria | 3075 |
| 190 | Ga0105238_10109487 | 3300009551 | Bacteria | 2744 |
| 191 | Ga0105249_10307808 | 3300009553 | Bacteria | 1591 |
| 192 | Ga0105249_10535490 | 3300009553 | Bacteria | 1220 |
| 193 | Ga0099796_10003116 | 3300010159 | Bacteria | 3782 |
| 194 | Ga0105239_10022515 | 3300010375 | Bacteria | 6947 |
| 195 | Ga0105239_10058045 | 3300010375 | Bacteria | 4246 |
| 196 | Ga0105239_10436941 | 3300010375 | Bacteria | 1484 |
| 197 | Ga0157370_10013258 | 3300013104 | Bacteria | 8495 |
| 198 | Ga0157370_10021342 | 3300013104 | Bacteria | 6453 |
| 199 | Ga0157369_10018648 | 3300013105 | Bacteria | 7780 |
| 200 | Ga0157369_10050530 | 3300013105 | Bacteria | 4502 |
| 201 | Ga0157369_10173351 | 3300013105 | Bacteria | 2272 |
| 202 | Ga0157369_10475226 | 3300013105 | Bacteria | 1294 |
| 203 | Ga0157374_10021557 | 3300013296 | Bacteria | 5735 |
| 204 | Ga0157374_10049574 | 3300013296 | Bacteria | 3901 |
| 205 | Ga0157374_10226054 | 3300013296 | Bacteria | 1838 |
| 206 | Ga0157378_10024322 | 3300013297 | Bacteria | 5327 |
| 207 | Ga0157378_10299303 | 3300013297 | Bacteria | 1556 |
| 208 | Ga0157378_10379549 | 3300013297 | Bacteria | 1388 |
| 209 | Ga0163162_10160155 | 3300013306 | Bacteria | 2372 |
| 210 | Ga0163162_10183944 | 3300013306 | Bacteria | 2216 |
| 211 | Ga0163162_10602555 | 3300013306 | Bacteria | 1225 |
| 212 | Ga0157372_10100777 | 3300013307 | Bacteria | 3296 |
| 213 | Ga0157372_10229748 | 3300013307 | Bacteria | 2151 |
| 214 | Ga0157375_10053921 | 3300013308 | Bacteria | 3959 |
| 215 | Ga0157375_10163180 | 3300013308 | Bacteria | 2371 |
| 216 | Ga0163163_10313416 | 3300014325 | Bacteria | 1622 |
| 217 | Ga0157380_10371022 | 3300014326 | Bacteria | 1347 |
| 218 | Ga0157379_10066497 | 3300014968 | Bacteria | 3222 |
| 219 | Ga0157376_10036968 | 3300014969 | Bacteria | 3959 |
| 220 | Ga0163161_10221020 | 3300017792 | Bacteria | 1467 |
| 221 | Ga0163161_10266945 | 3300017792 | Bacteria | 1338 |
| 222 | Ga0206356_11193562 | 3300020070 | Bacteria | 1792 |
| 223 | Ga0206353_11100446 | 3300020082 | Bacteria | 1106 |
| 224 | Ga0213872_10003012 | 3300021361 | Bacteria | 9521 |
| 225 | Ga0213872_10003019 | 3300021361 | Bacteria | 9506 |
| 226 | Ga0213872_10006968 | 3300021361 | Bacteria | 5608 |
| 227 | Ga0213872_10011539 | 3300021361 | Bacteria | 4178 |
| 228 | Ga0213872_10024525 | 3300021361 | Bacteria | 2774 |
| 229 | Ga0213872_10026435 | 3300021361 | Bacteria | 2666 |
| 230 | Ga0213876_10016846 | 3300021384 | Bacteria | 3860 |
| 231 | Ga0213875_10057382 | 3300021388 | Bacteria | 1824 |
| 232 | Ga0213871_10026820 | 3300021441 | Bacteria | 1476 |
| 233 | Ga0209564_1000865 | 3300025295 | Bacteria | 40348 |
| 234 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 235 | Ga0209758_1000267 | 3300025297 | Bacteria | 103340 |
| 236 | Ga0209758_1000720 | 3300025297 | Bacteria | 48767 |
| 237 | Ga0209758_1003178 | 3300025297 | Bacteria | 15387 |
| 238 | Ga0209758_1005954 | 3300025297 | Bacteria | 9038 |
| 239 | Ga0209758_1010377 | 3300025297 | Bacteria | 5585 |
| 240 | Ga0209758_1015367 | 3300025297 | Bacteria | 3971 |
| 241 | Ga0209758_1033211 | 3300025297 | Bacteria | 2078 |
| 242 | Ga0207426_1026634 | 3300025302 | Bacteria | 1934 |
| 243 | Ga0209257_1043208 | 3300025304 | Bacteria | 1323 |
| 244 | Ga0207697_10072132 | 3300025315 | Bacteria | 1448 |
| 245 | Ga0207656_10017228 | 3300025321 | Bacteria | 2826 |
| 246 | Ga0207656_10142318 | 3300025321 | Bacteria | 1131 |
| 247 | Ga0207653_10049560 | 3300025885 | Bacteria | 1394 |
| 248 | Ga0207682_10068106 | 3300025893 | Bacteria | 1504 |
| 249 | Ga0207692_10002181 | 3300025898 | Bacteria | 7480 |
| 250 | Ga0207692_10009758 | 3300025898 | Bacteria | 4021 |
| 251 | Ga0207692_10065282 | 3300025898 | Bacteria | 1898 |
| 252 | Ga0207642_10111458 | 3300025899 | Bacteria | 1394 |
| 253 | Ga0207710_10071162 | 3300025900 | Bacteria | 1595 |
| 254 | Ga0207680_10071245 | 3300025903 | Bacteria | 2154 |
| 255 | Ga0207685_10027658 | 3300025905 | Bacteria | 1988 |
| 256 | Ga0207699_10001171 | 3300025906 | Bacteria | 12393 |
| 257 | Ga0207699_10115073 | 3300025906 | Bacteria | 1730 |
| 258 | Ga0207645_10014371 | 3300025907 | Bacteria | 5298 |
| 259 | Ga0207705_10121553 | 3300025909 | Bacteria | 1938 |
| 260 | Ga0207654_10011567 | 3300025911 | Bacteria | 4503 |
| 261 | Ga0207654_10309633 | 3300025911 | Bacteria | 1076 |
| 262 | Ga0207707_10004201 | 3300025912 | Bacteria | 12753 |
| 263 | Ga0207707_10028716 | 3300025912 | Bacteria | 4860 |
| 264 | Ga0207707_10052097 | 3300025912 | Bacteria | 3564 |
| 265 | Ga0207707_10061385 | 3300025912 | Bacteria | 3270 |
| 266 | Ga0207707_10116244 | 3300025912 | Bacteria | 2337 |
| 267 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 268 | Ga0207695_10428331 | 3300025913 | Bacteria | 1207 |
| 269 | Ga0207671_10011282 | 3300025914 | Bacteria | 7288 |
| 270 | Ga0207671_10030974 | 3300025914 | Bacteria | 3988 |
| 271 | Ga0207671_10043463 | 3300025914 | Bacteria | 3323 |
| 272 | Ga0207693_10003158 | 3300025915 | Bacteria | 14168 |
| 273 | Ga0207693_10006713 | 3300025915 | Bacteria | 9501 |
| 274 | Ga0207693_10024089 | 3300025915 | Bacteria | 4832 |
| 275 | Ga0207693_10039929 | 3300025915 | Bacteria | 3695 |
| 276 | Ga0207693_10044762 | 3300025915 | Bacteria | 3478 |
| 277 | Ga0207693_10426772 | 3300025915 | Bacteria | 1036 |
| 278 | Ga0207663_10000261 | 3300025916 | Bacteria | 22957 |
| 279 | Ga0207663_10008702 | 3300025916 | Bacteria | 5327 |
| 280 | Ga0207663_10047740 | 3300025916 | Bacteria | 2645 |
| 281 | Ga0207663_10096533 | 3300025916 | Bacteria | 1974 |
| 282 | Ga0207663_10275375 | 3300025916 | Bacteria | 1248 |
| 283 | Ga0207660_10009640 | 3300025917 | Bacteria | 6251 |
| 284 | Ga0207660_10137522 | 3300025917 | Bacteria | 1865 |
| 285 | Ga0207660_10237550 | 3300025917 | Bacteria | 1435 |
| 286 | Ga0207657_10002700 | 3300025919 | Bacteria | 19128 |
| 287 | Ga0207657_10005124 | 3300025919 | Bacteria | 13731 |
| 288 | Ga0207652_10006338 | 3300025921 | Bacteria | 9558 |
| 289 | Ga0207652_10009869 | 3300025921 | Bacteria | 7683 |
| 290 | Ga0207652_10017004 | 3300025921 | Bacteria | 5949 |
| 291 | Ga0207652_10495896 | 3300025921 | Bacteria | 1100 |
| 292 | Ga0207646_10084060 | 3300025922 | Bacteria | 2847 |
| 293 | Ga0207694_10038223 | 3300025924 | Bacteria | 3690 |
| 294 | Ga0207694_10059974 | 3300025924 | Bacteria | 2960 |
| 295 | Ga0207694_10489088 | 3300025924 | Bacteria | 1030 |
| 296 | Ga0207687_10009704 | 3300025927 | Bacteria | 6296 |
| 297 | Ga0207687_10033220 | 3300025927 | Bacteria | 3499 |
| 298 | Ga0207687_10265166 | 3300025927 | Bacteria | 1371 |
| 299 | Ga0207700_10007733 | 3300025928 | Bacteria | 6602 |
| 300 | Ga0207700_10024258 | 3300025928 | Bacteria | 4195 |
| 301 | Ga0207700_10044654 | 3300025928 | Bacteria | 3264 |
| 302 | Ga0207700_10069105 | 3300025928 | Bacteria | 2710 |
| 303 | Ga0207700_10086075 | 3300025928 | Bacteria | 2469 |
| 304 | Ga0207700_10096957 | 3300025928 | Bacteria | 2343 |
| 305 | Ga0207664_10023451 | 3300025929 | Bacteria | 4624 |
| 306 | Ga0207664_10084912 | 3300025929 | Bacteria | 2583 |
| 307 | Ga0207664_10113811 | 3300025929 | Bacteria | 2254 |
| 308 | Ga0207664_10336092 | 3300025929 | Bacteria | 1335 |
| 309 | Ga0207664_10381981 | 3300025929 | Bacteria | 1250 |
| 310 | Ga0207664_10428254 | 3300025929 | Bacteria | 1179 |
| 311 | Ga0207644_10070982 | 3300025931 | Bacteria | 2547 |
| 312 | Ga0207706_10037862 | 3300025933 | Bacteria | 4280 |
| 313 | Ga0207686_10204562 | 3300025934 | Bacteria | 1416 |
| 314 | Ga0207670_10110812 | 3300025936 | Bacteria | 1978 |
| 315 | Ga0207704_10024462 | 3300025938 | Bacteria | 3276 |
| 316 | Ga0207704_10258411 | 3300025938 | Bacteria | 1312 |
| 317 | Ga0207665_10000280 | 3300025939 | Bacteria | 35528 |
| 318 | Ga0207665_10002029 | 3300025939 | Bacteria | 13628 |
| 319 | Ga0207665_10066558 | 3300025939 | Bacteria | 2452 |
| 320 | Ga0207665_10132765 | 3300025939 | Bacteria | 1769 |
| 321 | Ga0207691_10168950 | 3300025940 | Bacteria | 1916 |
| 322 | Ga0207711_10030253 | 3300025941 | Bacteria | 4567 |
| 323 | Ga0207711_10362277 | 3300025941 | Bacteria | 1343 |
| 324 | Ga0207689_10079591 | 3300025942 | Bacteria | 2693 |
| 325 | Ga0207661_10000532 | 3300025944 | Bacteria | 24432 |
| 326 | Ga0207661_10002592 | 3300025944 | Bacteria | 12429 |
| 327 | Ga0207661_10018698 | 3300025944 | Bacteria | 5152 |
| 328 | Ga0207667_10128551 | 3300025949 | Bacteria | 2610 |
| 329 | Ga0207667_10137958 | 3300025949 | Bacteria | 2511 |
| 330 | Ga0207667_10358269 | 3300025949 | Bacteria | 1488 |
| 331 | Ga0207651_10480525 | 3300025960 | Bacteria | 1071 |
| 332 | Ga0207668_10055665 | 3300025972 | Bacteria | 2751 |
| 333 | Ga0207640_10069450 | 3300025981 | Bacteria | 2365 |
| 334 | Ga0207658_10261034 | 3300025986 | Bacteria | 1476 |
| 335 | Ga0207677_10026809 | 3300026023 | Bacteria | 3619 |
| 336 | Ga0207678_10042731 | 3300026067 | Bacteria | 3924 |
| 337 | Ga0207678_10115319 | 3300026067 | Bacteria | 2292 |
| 338 | Ga0207678_10177504 | 3300026067 | Bacteria | 1819 |
| 339 | Ga0207708_10045881 | 3300026075 | Bacteria | 3330 |
| 340 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 341 | Ga0207702_10195945 | 3300026078 | Bacteria | 1870 |
| 342 | Ga0207702_10242785 | 3300026078 | Bacteria | 1688 |
| 343 | Ga0207641_10053496 | 3300026088 | Bacteria | 3423 |
| 344 | Ga0207641_10330047 | 3300026088 | Bacteria | 1449 |
| 345 | Ga0207648_10095226 | 3300026089 | Bacteria | 2604 |
| 346 | Ga0207648_10485139 | 3300026089 | Bacteria | 1129 |
| 347 | Ga0207674_10073279 | 3300026116 | Bacteria | 3438 |
| 348 | Ga0207674_10437166 | 3300026116 | Bacteria | 1264 |
| 349 | Ga0207675_100106446 | 3300026118 | Bacteria | 2644 |
| 350 | Ga0207675_100148533 | 3300026118 | Bacteria | 2230 |
| 351 | Ga0207683_10051817 | 3300026121 | Bacteria | 3596 |
| 352 | Ga0207683_10300587 | 3300026121 | Bacteria | 1468 |
| 353 | Ga0207698_10008740 | 3300026142 | Bacteria | 6422 |
| 354 | Ga0207698_10020122 | 3300026142 | Bacteria | 4588 |
| 355 | Ga0207698_10146869 | 3300026142 | Bacteria | 2040 |
| 356 | Ga0207698_10223686 | 3300026142 | Bacteria | 1703 |
| 357 | Ga0207698_10236000 | 3300026142 | Bacteria | 1663 |
| 358 | Ga0207698_10467637 | 3300026142 | Bacteria | 1221 |
| 359 | Ga0209389_1000186 | 3300027296 | Bacteria | 47149 |
| 360 | Ga0209389_1000261 | 3300027296 | Bacteria | 33507 |
| 361 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 362 | Ga0209589_1001077 | 3300027357 | Bacteria | 43273 |
| 363 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 364 | Ga0209489_100176 | 3300027361 | Bacteria | 100053 |
| 365 | Ga0209489_112845 | 3300027361 | Bacteria | 7271 |
| 366 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 367 | Ga0209700_101165 | 3300027363 | Bacteria | 53492 |
| 368 | Ga0209588_1000499 | 3300027671 | Bacteria | 10047 |
| 369 | Ga0209588_1016019 | 3300027671 | Bacteria | 2309 |
| 370 | Ga0268266_10002993 | 3300028379 | Bacteria | 17411 |
| 371 | Ga0268266_10073304 | 3300028379 | Bacteria | 2971 |
| 372 | Ga0268266_10074116 | 3300028379 | Bacteria | 2955 |
| 373 | Ga0268266_10241032 | 3300028379 | Bacteria | 1669 |
| 374 | Ga0268266_10263537 | 3300028379 | Bacteria | 1598 |
| 375 | Ga0268265_10069393 | 3300028380 | Bacteria | 2736 |
| 376 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 377 | Ga0307517_10000744 | 3300028786 | Bacteria | 56253 |
| 378 | Ga0307511_10097451 | 3300030521 | Bacteria | 1952 |
| 379 | Ga0265330_10012783 | 3300031235 | Bacteria | 3918 |
| 380 | Ga0265330_10093495 | 3300031235 | Bacteria | 1290 |
| 381 | Ga0265332_10146508 | 3300031238 | Bacteria | 988 |
| 382 | Ga0265340_10006832 | 3300031247 | Bacteria | 6242 |
| 383 | Ga0265339_10001302 | 3300031249 | Bacteria | 18677 |
| 384 | Ga0265339_10093600 | 3300031249 | Bacteria | 1572 |
| 385 | Ga0265331_10128069 | 3300031250 | Bacteria | 1159 |
| 386 | Ga0265331_10128079 | 3300031250 | Bacteria | 1159 |
| 387 | Ga0307513_10229452 | 3300031456 | Bacteria | 1670 |
| 388 | Ga0307408_100007557 | 3300031548 | Bacteria | 7186 |
| 389 | Ga0307408_100294245 | 3300031548 | Bacteria | 1357 |
| 390 | Ga0265313_10113715 | 3300031595 | Bacteria | 1188 |
| 391 | Ga0307508_10000051 | 3300031616 | Bacteria | 134500 |
| 392 | Ga0265314_10001137 | 3300031711 | Bacteria | 30830 |
| 393 | Ga0265342_10014921 | 3300031712 | Bacteria | 5135 |
| 394 | Ga0265342_10017603 | 3300031712 | Bacteria | 4644 |
| 395 | Ga0307516_10011569 | 3300031730 | Bacteria | 9575 |
| 396 | Ga0307516_10209330 | 3300031730 | Bacteria | 1665 |
| 397 | Ga0307405_10055379 | 3300031731 | Bacteria | 2482 |
| 398 | Ga0307412_10170917 | 3300031911 | Bacteria | 1625 |
| 399 | Ga0307416_100266727 | 3300032002 | Bacteria | 1678 |
| 400 | Ga0307507_10006354 | 3300033179 | Bacteria | 18224 |
| 401 | Ga0307510_10021805 | 3300033180 | Bacteria | 7456 |
| 402 | Ga0307510_10038903 | 3300033180 | Bacteria | 5250 |
| 403 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 404 | Ga0373926_0001921 | 3300035083 | Bacteria | 6498 |
| 405 | Ga0373934_0004312 | 3300035086 | Bacteria | 5252 |
| 406 | Ga0373944_0088312 | 3300035089 | Bacteria | 1033 |
| 407 | Ga0373923_0008455 | 3300035111 | Bacteria | 3671 |
| 408 | Ga0373923_0111930 | 3300035111 | Bacteria | 1213 |
| 409 | Ga0373936_0033852 | 3300035113 | Bacteria | 2027 |
| 410 | Ga0373941_0004414 | 3300035115 | Bacteria | 3250 |
| 411 | Ga0373953_0002981 | 3300035117 | Bacteria | 5177 |
| 412 | Ga0373953_0066316 | 3300035117 | Bacteria | 1483 |
| 413 | Ga0373954_0002129 | 3300035118 | Bacteria | 8219 |
| 414 | Ga0373954_0042019 | 3300035118 | Bacteria | 2132 |
| 415 | Ga0373956_0003044 | 3300035119 | Bacteria | 6786 |
| 416 | Ga0373957_0000776 | 3300035120 | Bacteria | 8304 |
| 417 | Ga0373946_0002366 | 3300035171 | Bacteria | 6671 |
| 418 | Ga0373955_0004043 | 3300035172 | Bacteria | 6474 |
| 419 | Ga0373924_0016757 | 3300035410 | Bacteria | 2802 |
| 420 | Ga0373924_0025943 | 3300035410 | Bacteria | 2320 |
| 421 | Ga0373924_0051372 | 3300035410 | Bacteria | 1709 |
| 422 | Ga0373931_0001492 | 3300035691 | Bacteria | 10065 |
| 423 | Ga0373931_0062680 | 3300035691 | Bacteria | 2008 |
| 424 | Ga0373935_0006343 | 3300035692 | Bacteria | 7054 |
| 425 | Ga0373935_0237665 | 3300035692 | Bacteria | 1271 |
| 426 | Ga0373935_0257872 | 3300035692 | Bacteria | 1222 |
| 427 | Ga0373927_0003904 | 3300035695 | Bacteria | 10572 |
| 428 | Ga0373927_0005891 | 3300035695 | Bacteria | 8398 |
| 429 | Ga0373927_0007576 | 3300035695 | Bacteria | 7347 |
| 430 | Ga0373927_0034813 | 3300035695 | Bacteria | 3275 |
| 431 | Ga0373927_0074134 | 3300035695 | Bacteria | 2203 |
| 432 | Ga0373927_0152846 | 3300035695 | Bacteria | 1511 |
| 433 | Ga0373933_0000342 | 3300035724 | Bacteria | 29960 |
| 434 | Ga0373933_0013742 | 3300035724 | Bacteria | 4492 |
| 435 | Ga0373933_0084118 | 3300035724 | Bacteria | 1955 |
| 436 | Ga0373933_0114086 | 3300035724 | Bacteria | 1687 |
| 437 | Ga0373933_0118584 | 3300035724 | Bacteria | 1656 |
| 438 | Ga0373933_0168080 | 3300035724 | Bacteria | 1395 |
| 439 | Ga0373947_0144671 | 3300035725 | Bacteria | 1527 |
| 440 | Ga0373947_0202056 | 3300035725 | Bacteria | 1300 |
| 441 | Ga0373937_0033338 | 3300036401 | Bacteria | 4675 |
| 442 | Ga0373937_0047682 | 3300036401 | Bacteria | 3921 |
| 443 | Ga0373937_0158558 | 3300036401 | Bacteria | 2121 |
| 444 | Ga0373937_0260560 | 3300036401 | Bacteria | 1635 |
| 445 | Ga0372808_010827 | 3300036459 | Bacteria | 1287 |
| 446 | Ga0373925_0015751 | 3300037068 | Bacteria | 5472 |
| 447 | Ga0373925_0048031 | 3300037068 | Bacteria | 3179 |
| 448 | Ga0373925_0070092 | 3300037068 | Bacteria | 2649 |
| 449 | Ga0395899_0061768 | 3300037312 | Bacteria | 2759 |
| 450 | Ga0395900_0003599 | 3300037418 | Bacteria | 16656 |
| 451 | Ga0395900_0086144 | 3300037418 | Bacteria | 3228 |
| 452 | Ga0395900_0177363 | 3300037418 | Bacteria | 2167 |
| 453 | Ga0395898_0129104 | 3300037466 | Bacteria | 2421 |
| 454 | Ga0395898_0145864 | 3300037466 | Bacteria | 2265 |
| 455 | Ga0395905_0052126 | 3300037471 | Bacteria | 3832 |
| 456 | Ga0436364_0997829 | 3300037853 | Bacteria | 3081 |
| 457 | Ga0395901_0060727 | 3300038443 | Bacteria | 3934 |
| 458 | Ga0395901_0352152 | 3300038443 | Bacteria | 1519 |
| 459 | Ga0395901_0564445 | 3300038443 | Bacteria | 1152 |
| 460 | Ga0436365_0386944 | 3300039437 | Bacteria | 1591 |
| 461 | Ga0436365_0629162 | 3300039437 | Bacteria | 1413 |
| 462 | Ga0436365_0838985 | 3300039437 | Bacteria | 7476 |
| 463 | Ga0436365_0948695 | 3300039437 | Bacteria | 2565 |
| 464 | Ga0436360_0974952 | 3300039438 | Bacteria | 1712 |
| 465 | Ga0436361_0017850 | 3300039447 | Bacteria | 11403 |
| 466 | Ga0436361_0107745 | 3300039447 | Bacteria | 4065 |
| 467 | Ga0436361_0158927 | 3300039447 | Bacteria | 13531 |
| 468 | Ga0436361_0336033 | 3300039447 | Bacteria | 4187 |
| 469 | Ga0436361_0352642 | 3300039447 | Bacteria | 8388 |
| 470 | Ga0436361_0421829 | 3300039447 | Bacteria | 4324 |
| 471 | Ga0436361_0786450 | 3300039447 | Bacteria | 2409 |
| 472 | Ga0436361_0791494 | 3300039447 | Bacteria | 1452 |
| 473 | Ga0436363_0123844 | 3300039450 | Bacteria | 1194 |
| 474 | Ga0436363_1054182 | 3300039450 | Bacteria | 2916 |
| 475 | Ga0436363_1110633 | 3300039450 | Bacteria | 5127 |
| 476 | Ga0436362_1134339 | 3300039453 | Bacteria | 4484 |
| 477 | Ga0439438_023360 | 3300041405 | Bacteria | 1705 |
| 478 | Ga0439465_0015316 | 3300041413 | Bacteria | 2392 |
| 479 | Ga0450920_010714 | 3300042122 | Bacteria | 1703 |
| 480 | Ga0450909_007227 | 3300042185 | Bacteria | 1605 |
| 481 | Ga0466966_0021986 | 3300044684 | Bacteria | 4188 |
| 482 | Ga0466966_0053736 | 3300044684 | Bacteria | 2555 |
| 483 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 484 | Ga0466963_0142709 | 3300044694 | Bacteria | 1660 |
| 485 | Ga0466968_0083797 | 3300044735 | Bacteria | 1405 |
| 486 | Ga0466957_0021630 | 3300044842 | Bacteria | 3792 |
| 487 | Ga0466959_0005696 | 3300045049 | Bacteria | 8573 |
| 488 | Ga0466959_0062058 | 3300045049 | Bacteria | 2717 |
| 489 | Ga0466959_0305774 | 3300045049 | Bacteria | 1088 |
| 490 | Ga0466958_0000489 | 3300045836 | Bacteria | 16548 |
| 491 | Ga0466967_0405689 | 3300045976 | Bacteria | 1327 |
| 492 | Ga0495592_0006971 | 3300046454 | Bacteria | 8443 |
| 493 | Ga0495603_0004320 | 3300046455 | Bacteria | 8476 |
| 494 | Ga0495603_0011117 | 3300046455 | Bacteria | 5457 |
| 495 | Ga0495603_0011224 | 3300046455 | Bacteria | 5426 |
| 496 | Ga0495603_0055469 | 3300046455 | Bacteria | 2348 |
| 497 | Ga0495629_0000439 | 3300046459 | Bacteria | 34692 |
| 498 | Ga0495629_0008693 | 3300046459 | Bacteria | 7475 |
| 499 | Ga0495629_0025310 | 3300046459 | Bacteria | 4220 |
| 500 | Ga0495629_0100051 | 3300046459 | Bacteria | 2023 |
| 501 | Ga0495651_0042346 | 3300046462 | Bacteria | 3535 |
| 502 | Ga0495651_0250894 | 3300046462 | Bacteria | 1208 |
| 503 | Ga0495653_0011927 | 3300046463 | Bacteria | 7098 |
| 504 | Ga0495653_0023097 | 3300046463 | Bacteria | 5029 |
| 505 | Ga0495653_0183161 | 3300046463 | Bacteria | 1435 |
| 506 | Ga0495650_0071355 | 3300046471 | Bacteria | 1362 |
| 507 | Ga0495580_0010913 | 3300046472 | Bacteria | 7047 |
| 508 | Ga0495580_0063049 | 3300046472 | Bacteria | 2600 |
| 509 | Ga0495582_0095209 | 3300046473 | Bacteria | 1663 |
| 510 | Ga0495639_0063048 | 3300046475 | Bacteria | 1701 |
| 511 | Ga0495639_0072485 | 3300046475 | Bacteria | 1592 |
| 512 | Ga0495639_0129605 | 3300046475 | Bacteria | 1207 |
| 513 | Ga0495639_0180987 | 3300046475 | Bacteria | 1026 |
| 514 | Ga0495662_0002831 | 3300046476 | Bacteria | 8772 |
| 515 | Ga0495662_0014677 | 3300046476 | Bacteria | 3808 |
| 516 | Ga0495664_0013575 | 3300046477 | Bacteria | 4620 |
| 517 | Ga0495664_0026776 | 3300046477 | Bacteria | 3359 |
| 518 | Ga0495664_0177552 | 3300046477 | Bacteria | 1291 |
| 519 | Ga0495664_0179188 | 3300046477 | Bacteria | 1285 |
| 520 | Ga0495594_0005519 | 3300046499 | Bacteria | 6494 |
| 521 | Ga0495606_0002132 | 3300046507 | Bacteria | 23896 |
| 522 | Ga0495606_0033400 | 3300046507 | Bacteria | 3548 |
| 523 | Ga0495606_0069189 | 3300046507 | Bacteria | 2230 |
| 524 | Ga0495606_0191328 | 3300046507 | Bacteria | 1173 |
| 525 | Ga0495608_0005431 | 3300046511 | Bacteria | 9112 |
| 526 | Ga0495608_0034052 | 3300046511 | Bacteria | 3440 |
| 527 | Ga0495608_0198955 | 3300046511 | Bacteria | 1263 |
| 528 | Ga0495616_0022428 | 3300046513 | Bacteria | 3410 |
| 529 | Ga0495618_0007998 | 3300046514 | Bacteria | 6401 |
| 530 | Ga0495618_0014482 | 3300046514 | Bacteria | 4805 |
| 531 | Ga0495620_0059400 | 3300046515 | Bacteria | 1598 |
| 532 | Ga0495628_0013324 | 3300046516 | Bacteria | 6918 |
| 533 | Ga0495628_0020870 | 3300046516 | Bacteria | 5396 |
| 534 | Ga0495628_0029898 | 3300046516 | Bacteria | 4414 |
| 535 | Ga0495628_0060379 | 3300046516 | Bacteria | 2975 |
| 536 | Ga0495628_0182993 | 3300046516 | Bacteria | 1584 |
| 537 | Ga0495630_0070295 | 3300046517 | Bacteria | 2634 |
| 538 | Ga0495631_0030231 | 3300046518 | Bacteria | 2458 |
| 539 | Ga0495632_0053190 | 3300046519 | Bacteria | 1989 |
| 540 | Ga0495644_0016361 | 3300046523 | Bacteria | 2838 |
| 541 | Ga0495648_0003395 | 3300046524 | Bacteria | 13998 |
| 542 | Ga0495648_0015565 | 3300046524 | Bacteria | 5518 |
| 543 | Ga0495648_0019958 | 3300046524 | Bacteria | 4689 |
| 544 | Ga0495663_0069778 | 3300046525 | Bacteria | 1117 |
| 545 | Ga0495666_0021512 | 3300046526 | Bacteria | 3193 |
| 546 | Ga0495652_0060178 | 3300046529 | Bacteria | 3210 |
| 547 | Ga0495652_0093996 | 3300046529 | Bacteria | 2446 |
| 548 | Ga0495665_0005469 | 3300046531 | Bacteria | 6842 |
| 549 | Ga0495665_0017404 | 3300046531 | Bacteria | 3866 |
| 550 | Ga0495665_0073583 | 3300046531 | Bacteria | 1799 |
| 551 | Ga0495640_0004906 | 3300046533 | Bacteria | 10629 |
| 552 | Ga0495640_0092548 | 3300046533 | Bacteria | 1994 |
| 553 | Ga0495587_0157856 | 3300046536 | Bacteria | 1291 |
| 554 | Ga0495597_0025921 | 3300046542 | Bacteria | 2696 |
| 555 | Ga0495645_0015849 | 3300046543 | Bacteria | 5367 |
| 556 | Ga0495645_0114450 | 3300046543 | Bacteria | 1906 |
| 557 | Ga0495645_0211699 | 3300046543 | Bacteria | 1308 |
| 558 | Ga0495622_0047942 | 3300046557 | Bacteria | 1985 |
| 559 | Ga0495667_0005621 | 3300046559 | Bacteria | 8473 |
| 560 | Ga0495667_0094625 | 3300046559 | Bacteria | 1934 |
| 561 | Ga0495667_0273281 | 3300046559 | Bacteria | 1073 |
| 562 | Ga0495656_0041568 | 3300046615 | Bacteria | 1921 |
| 563 | Ga0495656_0130033 | 3300046615 | Bacteria | 1197 |
| 564 | Ga0495668_0061198 | 3300046616 | Bacteria | 2077 |
| 565 | Ga0495668_0174252 | 3300046616 | Bacteria | 1178 |
| 566 | Ga0495634_0003738 | 3300046642 | Bacteria | 12123 |
| 567 | Ga0495634_0024516 | 3300046642 | Bacteria | 4232 |
| 568 | Ga0495634_0034617 | 3300046642 | Bacteria | 3465 |
| 569 | Ga0495634_0100438 | 3300046642 | Bacteria | 1870 |
| 570 | Ga0495625_0089530 | 3300046660 | Bacteria | 2130 |
| 571 | Ga0495635_0013164 | 3300046663 | Bacteria | 5791 |
| 572 | Ga0495635_0016717 | 3300046663 | Bacteria | 5125 |
| 573 | Ga0495659_0011155 | 3300046664 | Bacteria | 2895 |
| 574 | Ga0495588_0009072 | 3300046674 | Bacteria | 4583 |
| 575 | Ga0495657_0010362 | 3300046675 | Bacteria | 7014 |
| 576 | Ga0495657_0013824 | 3300046675 | Bacteria | 5941 |
| 577 | Ga0495599_0001369 | 3300046678 | Bacteria | 13928 |
| 578 | Ga0495599_0033876 | 3300046678 | Bacteria | 3211 |
| 579 | Ga0495623_0005388 | 3300046679 | Bacteria | 8375 |
| 580 | Ga0495623_0014960 | 3300046679 | Bacteria | 5015 |
| 581 | Ga0495646_0024958 | 3300046680 | Bacteria | 3761 |
| 582 | Ga0495646_0026668 | 3300046680 | Bacteria | 3627 |
| 583 | Ga0495646_0071750 | 3300046680 | Bacteria | 2037 |
| 584 | Ga0495658_0003784 | 3300046683 | Bacteria | 7489 |
| 585 | Ga0495658_0009854 | 3300046683 | Bacteria | 4766 |
| 586 | Ga0495669_0049543 | 3300046684 | Bacteria | 1881 |
| 587 | Ga0495613_0007099 | 3300046689 | Bacteria | 8338 |
| 588 | Ga0495613_0063134 | 3300046689 | Bacteria | 2710 |
| 589 | Ga0495613_0090896 | 3300046689 | Bacteria | 2211 |
| 590 | Ga0495624_0026173 | 3300046690 | Bacteria | 3823 |
| 591 | Ga0495624_0035050 | 3300046690 | Bacteria | 3241 |
| 592 | Ga0495670_0069591 | 3300046691 | Bacteria | 1779 |
| 593 | Ga0495671_0028224 | 3300046692 | Bacteria | 2893 |
| 594 | Ga0495649_0053047 | 3300046694 | Bacteria | 2196 |
| 595 | Ga0495600_0001020 | 3300046809 | Bacteria | 15122 |
| 596 | Ga0495600_0012902 | 3300046809 | Bacteria | 5236 |
| 597 | Ga0495660_0078292 | 3300046810 | Bacteria | 1738 |
| 598 | Ga0495581_0041911 | 3300047315 | Bacteria | 2649 |
| 599 | Ga0495581_0109441 | 3300047315 | Bacteria | 1606 |
| 600 | Ga0495604_0013033 | 3300047317 | Bacteria | 6623 |
| 601 | Ga0495604_0060803 | 3300047317 | Bacteria | 2891 |
| 602 | Ga0495604_0160593 | 3300047317 | Bacteria | 1588 |
| 603 | Ga0495674_0000458 | 3300047319 | Bacteria | 36828 |
| 604 | Ga0495674_0083470 | 3300047319 | Bacteria | 2738 |
| 605 | Ga0495674_0113470 | 3300047319 | Bacteria | 2295 |
| 606 | Ga0495674_0268601 | 3300047319 | Bacteria | 1400 |
| 607 | Ga0495672_0019236 | 3300047320 | Bacteria | 4509 |
| 608 | Ga0495672_0086763 | 3300047320 | Bacteria | 1730 |
| 609 | Ga0495676_0065097 | 3300047321 | Bacteria | 2831 |
| 610 | Ga0495676_0164141 | 3300047321 | Bacteria | 1569 |
| 611 | Ga0495676_0232609 | 3300047321 | Bacteria | 1265 |
| 612 | Ga0495680_0013039 | 3300047322 | Bacteria | 7270 |
| 613 | Ga0495680_0015630 | 3300047322 | Bacteria | 6542 |
| 614 | Ga0495683_0021464 | 3300047323 | Bacteria | 3328 |
| 615 | Ga0495675_0009601 | 3300047444 | Bacteria | 6025 |
| 616 | Ga0495677_0054803 | 3300047445 | Bacteria | 1471 |
| 617 | Ga0495685_062018 | 3300047447 | Bacteria | 1259 |
| 618 | Ga0495673_0048299 | 3300047469 | Bacteria | 1877 |
| 619 | Ga0495681_0101552 | 3300047470 | Bacteria | 1257 |
| 620 | Ga0495684_0000340 | 3300047471 | Bacteria | 37592 |
| 621 | Ga0495684_0008134 | 3300047471 | Bacteria | 8111 |
| 622 | Ga0495684_0249755 | 3300047471 | Bacteria | 1291 |
| 623 | Ga0495686_0085798 | 3300047472 | Bacteria | 1916 |
| 624 | Ga0495593_0000687 | 3300047673 | Bacteria | 19500 |
| 625 | Ga0495593_0006332 | 3300047673 | Bacteria | 6945 |
| 626 | Ga0495602_0008226 | 3300048088 | Bacteria | 10893 |
| 627 | Ga0495602_0048912 | 3300048088 | Bacteria | 3793 |
| 628 | Ga0495602_0050554 | 3300048088 | Bacteria | 3712 |
| 629 | Ga0496100_0045126 | 3300048903 | Bacteria | 2827 |
| 630 | Ga0496100_0200943 | 3300048903 | Bacteria | 1453 |
| 631 | Ga0496100_0312377 | 3300048903 | Bacteria | 1179 |
| 632 | Ga0496101_0025700 | 3300048904 | Bacteria | 4087 |
| 633 | Ga0496101_0037723 | 3300048904 | Bacteria | 3430 |
| 634 | Ga0496101_0053981 | 3300048904 | Bacteria | 2901 |
| 635 | Ga0496101_0119798 | 3300048904 | Bacteria | 1989 |
| 636 | Ga0496101_0193485 | 3300048904 | Bacteria | 1570 |
| 637 | Ga0496102_0002648 | 3300048905 | Bacteria | 15215 |
| 638 | Ga0496102_0021600 | 3300048905 | Bacteria | 5693 |
| 639 | Ga0496102_0061834 | 3300048905 | Bacteria | 3428 |
| 640 | Ga0496102_0086214 | 3300048905 | Bacteria | 2900 |
| 641 | Ga0496102_0127148 | 3300048905 | Bacteria | 2383 |
| 642 | Ga0496102_0129305 | 3300048905 | Bacteria | 2363 |
| 643 | Ga0496102_0312680 | 3300048905 | Bacteria | 1480 |
| 644 | Ga0496103_0029358 | 3300048906 | Bacteria | 3342 |
| 645 | Ga0496103_0094489 | 3300048906 | Bacteria | 1889 |
| 646 | Ga0496104_0019459 | 3300048907 | Bacteria | 6212 |
| 647 | Ga0496104_0034268 | 3300048907 | Bacteria | 4732 |
| 648 | Ga0496104_0073979 | 3300048907 | Bacteria | 3243 |
| 649 | Ga0496105_0042398 | 3300048908 | Bacteria | 3751 |
| 650 | Ga0496105_0071133 | 3300048908 | Bacteria | 2875 |
| 651 | Ga0496105_0074458 | 3300048908 | Bacteria | 2805 |
| 652 | Ga0496106_0000740 | 3300048909 | Bacteria | 23552 |
| 653 | Ga0496106_0005785 | 3300048909 | Bacteria | 9143 |
| 654 | Ga0496106_0015920 | 3300048909 | Bacteria | 5562 |
| 655 | Ga0496106_0135311 | 3300048909 | Bacteria | 1935 |
| 656 | Ga0496107_0004783 | 3300048910 | Bacteria | 9200 |
| 657 | Ga0496107_0040726 | 3300048910 | Bacteria | 3335 |
| 658 | Ga0496107_0069367 | 3300048910 | Bacteria | 2559 |
| 659 | Ga0496107_0172903 | 3300048910 | Bacteria | 1603 |
| 660 | Ga0496107_0194884 | 3300048910 | Bacteria | 1506 |
| 661 | Ga0496108_0000938 | 3300048911 | Bacteria | 22748 |
| 662 | Ga0496108_0025718 | 3300048911 | Bacteria | 4853 |
| 663 | Ga0496108_0028262 | 3300048911 | Bacteria | 4640 |
| 664 | Ga0496108_0062145 | 3300048911 | Bacteria | 3145 |
| 665 | Ga0496109_0001723 | 3300048912 | Bacteria | 18237 |
| 666 | Ga0496109_0008707 | 3300048912 | Bacteria | 8639 |
| 667 | Ga0496109_0009518 | 3300048912 | Bacteria | 8282 |
| 668 | Ga0496109_0109705 | 3300048912 | Bacteria | 2565 |
| 669 | Ga0496109_0158599 | 3300048912 | Bacteria | 2119 |
| 670 | Ga0496109_0208576 | 3300048912 | Bacteria | 1837 |
| 671 | Ga0496110_0003174 | 3300048913 | Bacteria | 12507 |
| 672 | Ga0496110_0034357 | 3300048913 | Bacteria | 4392 |
| 673 | Ga0496110_0089604 | 3300048913 | Bacteria | 2749 |
| 674 | Ga0496110_0092353 | 3300048913 | Bacteria | 2709 |
| 675 | Ga0496110_0190977 | 3300048913 | Bacteria | 1860 |
| 676 | Ga0496110_0200331 | 3300048913 | Bacteria | 1814 |
| 677 | Ga0496111_0010537 | 3300048914 | Bacteria | 6210 |
| 678 | Ga0496111_0047341 | 3300048914 | Bacteria | 3097 |
| 679 | Ga0496111_0131890 | 3300048914 | Bacteria | 1849 |
| 680 | Ga0496112_0000045 | 3300048915 | Bacteria | 85873 |
| 681 | Ga0496112_0000590 | 3300048915 | Bacteria | 24921 |
| 682 | Ga0496112_0046726 | 3300048915 | Bacteria | 4247 |
| 683 | Ga0496112_0056721 | 3300048915 | Bacteria | 3856 |
| 684 | Ga0496112_0078909 | 3300048915 | Bacteria | 3255 |
| 685 | Ga0496112_0145890 | 3300048915 | Bacteria | 2335 |
| 686 | Ga0496112_0188229 | 3300048915 | Bacteria | 2027 |
| 687 | Ga0496112_0491158 | 3300048915 | Bacteria | 1163 |
| 688 | Ga0496113_0005714 | 3300048916 | Bacteria | 7791 |
| 689 | Ga0496113_0166662 | 3300048916 | Bacteria | 1743 |
| 690 | Ga0496114_0008753 | 3300048917 | Bacteria | 8017 |
| 691 | Ga0496114_0046976 | 3300048917 | Bacteria | 3589 |
| 692 | Ga0496115_0005155 | 3300048918 | Bacteria | 9509 |
| 693 | Ga0496115_0031770 | 3300048918 | Bacteria | 4162 |
| 694 | Ga0496115_0066606 | 3300048918 | Bacteria | 2911 |
| 695 | Ga0496115_0093493 | 3300048918 | Bacteria | 2459 |
| 696 | Ga0496116_0001982 | 3300048919 | Bacteria | 22049 |
| 697 | Ga0496117_0015594 | 3300048920 | Bacteria | 6465 |
| 698 | Ga0496117_0052468 | 3300048920 | Bacteria | 2872 |
| 699 | Ga0496118_0001758 | 3300048921 | Bacteria | 31406 |
| 700 | Ga0496118_0064473 | 3300048921 | Bacteria | 2688 |
| 701 | Ga0496118_0078658 | 3300048921 | Bacteria | 2332 |
| 702 | Ga0496119_0085714 | 3300048922 | Bacteria | 1803 |
| 703 | Ga0496119_0140962 | 3300048922 | Bacteria | 1302 |
| 704 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 705 | Ga0496121_0000379 | 3300048924 | Bacteria | 91131 |
| 706 | Ga0496121_0008678 | 3300048924 | Bacteria | 11871 |
| 707 | Ga0496121_0026666 | 3300048924 | Bacteria | 5434 |
| 708 | Ga0496121_0053419 | 3300048924 | Bacteria | 3385 |
| 709 | Ga0496121_0059468 | 3300048924 | Bacteria | 3150 |
| 710 | Ga0496121_0070283 | 3300048924 | Bacteria | 2821 |
| 711 | Ga0496121_0084635 | 3300048924 | Bacteria | 2499 |
| 712 | Ga0496121_0120205 | 3300048924 | Bacteria | 1985 |
| 713 | Ga0496122_0064048 | 3300048925 | Bacteria | 2677 |
| 714 | Ga0496122_0134727 | 3300048925 | Bacteria | 1560 |
| 715 | Ga0496123_0097852 | 3300048926 | Bacteria | 1717 |
| 716 | Ga0496124_0004074 | 3300048927 | Bacteria | 17311 |
| 717 | Ga0496124_0065983 | 3300048927 | Bacteria | 3016 |
| 718 | Ga0496124_0171525 | 3300048927 | Bacteria | 1679 |
| 719 | Ga0496124_0188071 | 3300048927 | Bacteria | 1583 |
| 720 | Ga0496125_0000199 | 3300048928 | Bacteria | 126676 |
| 721 | Ga0496125_0000964 | 3300048928 | Bacteria | 45175 |
| 722 | Ga0496125_0005864 | 3300048928 | Bacteria | 13489 |
| 723 | Ga0496125_0020565 | 3300048928 | Bacteria | 6192 |
| 724 | Ga0496126_0003657 | 3300048929 | Bacteria | 19210 |
| 725 | Ga0496126_0009808 | 3300048929 | Bacteria | 10138 |
| 726 | Ga0496126_0015287 | 3300048929 | Bacteria | 7726 |
| 727 | Ga0496126_0018065 | 3300048929 | Bacteria | 7005 |
| 728 | Ga0496126_0027947 | 3300048929 | Bacteria | 5379 |
| 729 | Ga0496126_0036593 | 3300048929 | Bacteria | 4587 |
| 730 | Ga0496126_0049668 | 3300048929 | Bacteria | 3828 |
| 731 | Ga0496126_0072571 | 3300048929 | Bacteria | 3062 |
| 732 | Ga0496126_0142847 | 3300048929 | Bacteria | 2059 |
| 733 | Ga0496126_0178468 | 3300048929 | Bacteria | 1805 |
| 734 | Ga0496126_0226970 | 3300048929 | Bacteria | 1566 |
| 735 | Ga0496126_0249487 | 3300048929 | Bacteria | 1480 |
| 736 | Ga0496126_0305230 | 3300048929 | Bacteria | 1312 |
| 737 | Ga0496126_0467470 | 3300048929 | Bacteria | 1013 |
| 738 | Ga0495678_084968 | 3300049459 | Bacteria | 1128 |
| 739 | Ga0495682_0042364 | 3300049460 | Bacteria | 1668 |
| 740 | Ga0501031_0000712 | 3300049568 | Bacteria | 19893 |
| 741 | Ga0501031_0007196 | 3300049568 | Bacteria | 7260 |
| 742 | Ga0501032_0001162 | 3300049569 | Bacteria | 21118 |
| 743 | Ga0501032_0012997 | 3300049569 | Bacteria | 5929 |
| 744 | Ga0501032_0030027 | 3300049569 | Bacteria | 3729 |
| 745 | Ga0501032_0239094 | 3300049569 | Bacteria | 1180 |
| 746 | Ga0501033_0000163 | 3300049570 | Bacteria | 63913 |
| 747 | Ga0501033_0003345 | 3300049570 | Bacteria | 13239 |
| 748 | Ga0501033_0004893 | 3300049570 | Bacteria | 10660 |
| 749 | Ga0501033_0040106 | 3300049570 | Bacteria | 3496 |
| 750 | Ga0501033_0106298 | 3300049570 | Bacteria | 2044 |
| 751 | Ga0501033_0259059 | 3300049570 | Bacteria | 1231 |
| 752 | Ga0501034_0000202 | 3300049571 | Bacteria | 112985 |
| 753 | Ga0501034_0232300 | 3300049571 | Bacteria | 1793 |
| 754 | Ga0501034_0244680 | 3300049571 | Bacteria | 1739 |
| 755 | Ga0501034_0274523 | 3300049571 | Bacteria | 1626 |
| 756 | Ga0501034_0361547 | 3300049571 | Bacteria | 1378 |
| 757 | Ga0501034_0364759 | 3300049571 | Bacteria | 1371 |
| 758 | Ga0501034_0385783 | 3300049571 | Bacteria | 1325 |
| 759 | Ga0501036_0000021 | 3300049572 | Bacteria | 114136 |
| 760 | Ga0501036_0092713 | 3300049572 | Bacteria | 2552 |
| 761 | Ga0501037_0001561 | 3300049573 | Bacteria | 16713 |
| 762 | Ga0501037_0002687 | 3300049573 | Bacteria | 12835 |
| 763 | Ga0501037_0158779 | 3300049573 | Bacteria | 1613 |
| 764 | Ga0501038_0000226 | 3300049574 | Bacteria | 47831 |
| 765 | Ga0501038_0008947 | 3300049574 | Bacteria | 9185 |
| 766 | Ga0501038_0042787 | 3300049574 | Bacteria | 3943 |
| 767 | Ga0501038_0050458 | 3300049574 | Bacteria | 3594 |
| 768 | Ga0501038_0059839 | 3300049574 | Bacteria | 3262 |
| 769 | Ga0501038_0294991 | 3300049574 | Bacteria | 1273 |
| 770 | Ga0501038_0360701 | 3300049574 | Bacteria | 1130 |
| 771 | Ga0501039_0001542 | 3300049575 | Bacteria | 16931 |
| 772 | Ga0501039_0013937 | 3300049575 | Bacteria | 6150 |
| 773 | Ga0501039_0071979 | 3300049575 | Bacteria | 2686 |
| 774 | Ga0501039_0091639 | 3300049575 | Bacteria | 2369 |
| 775 | Ga0501039_0209614 | 3300049575 | Bacteria | 1532 |
| 776 | Ga0501042_0046481 | 3300049578 | Bacteria | 3095 |
| 777 | Ga0501043_0000297 | 3300049579 | Bacteria | 44905 |
| 778 | Ga0501043_0007506 | 3300049579 | Bacteria | 8659 |
| 779 | Ga0501043_0157346 | 3300049579 | Bacteria | 1777 |
| 780 | Ga0501043_0311569 | 3300049579 | Bacteria | 1201 |
| 781 | Ga0501046_0000354 | 3300049580 | Bacteria | 46165 |
| 782 | Ga0501046_0004244 | 3300049580 | Bacteria | 13045 |
| 783 | Ga0501046_0055260 | 3300049580 | Bacteria | 3121 |
| 784 | Ga0501046_0074042 | 3300049580 | Bacteria | 2642 |
| 785 | Ga0501046_0097773 | 3300049580 | Bacteria | 2255 |
| 786 | Ga0501047_0000232 | 3300049581 | Bacteria | 66245 |
| 787 | Ga0501047_0024750 | 3300049581 | Bacteria | 5763 |
| 788 | Ga0501047_0042605 | 3300049581 | Bacteria | 4386 |
| 789 | Ga0501047_0077396 | 3300049581 | Bacteria | 3200 |
| 790 | Ga0501047_0353183 | 3300049581 | Bacteria | 1306 |
| 791 | Ga0501048_0000050 | 3300049582 | Bacteria | 57921 |
| 792 | Ga0501048_0309750 | 3300049582 | Bacteria | 1124 |
| 793 | Ga0501067_0033397 | 3300049583 | Bacteria | 2855 |
| 794 | Ga0501068_0005647 | 3300049584 | Bacteria | 6852 |
| 795 | Ga0501068_0099425 | 3300049584 | Bacteria | 1802 |
| 796 | Ga0501068_0102216 | 3300049584 | Bacteria | 1777 |
| 797 | Ga0501069_0013995 | 3300049585 | Bacteria | 4285 |
| 798 | Ga0501069_0164635 | 3300049585 | Bacteria | 1278 |
| 799 | Ga0501069_0257334 | 3300049585 | Bacteria | 1019 |
| 800 | Ga0501070_0010465 | 3300049586 | Bacteria | 7843 |
| 801 | Ga0501070_0012142 | 3300049586 | Bacteria | 7269 |
| 802 | Ga0501070_0126992 | 3300049586 | Bacteria | 2107 |
| 803 | Ga0501070_0146503 | 3300049586 | Bacteria | 1949 |
| 804 | Ga0501070_0408153 | 3300049586 | Bacteria | 1098 |
| 805 | Ga0501071_0007174 | 3300049587 | Bacteria | 7290 |
| 806 | Ga0501072_0002675 | 3300049588 | Bacteria | 13364 |
| 807 | Ga0501073_0000329 | 3300049589 | Bacteria | 31824 |
| 808 | Ga0501073_0030779 | 3300049589 | Bacteria | 3832 |
| 809 | Ga0501073_0078360 | 3300049589 | Bacteria | 2299 |
| 810 | Ga0501074_0000092 | 3300049590 | Bacteria | 43073 |
| 811 | Ga0501074_0058728 | 3300049590 | Bacteria | 2771 |
| 812 | Ga0501076_0439530 | 3300049592 | Bacteria | 1074 |
| 813 | Ga0501079_0003108 | 3300049741 | Bacteria | 12164 |
| 814 | Ga0501080_0003432 | 3300049742 | Bacteria | 13983 |
| 815 | Ga0501080_0010464 | 3300049742 | Bacteria | 8493 |
| 816 | Ga0501081_0131732 | 3300049743 | Bacteria | 1787 |
| 817 | Ga0501083_0001578 | 3300049744 | Bacteria | 15557 |
| 818 | Ga0501035_0000120 | 3300049822 | Bacteria | 94532 |
| 819 | Ga0501035_0006842 | 3300049822 | Bacteria | 10654 |
| 820 | Ga0501035_0034371 | 3300049822 | Bacteria | 4606 |
| 821 | Ga0501035_0052075 | 3300049822 | Bacteria | 3664 |
| 822 | Ga0501035_0135730 | 3300049822 | Bacteria | 2142 |
| 823 | Ga0501035_0207791 | 3300049822 | Bacteria | 1676 |
| 824 | Ga0501035_0483978 | 3300049822 | Bacteria | 1020 |
| 825 | Ga0501044_0000179 | 3300049823 | Bacteria | 78633 |
| 826 | Ga0501044_0006711 | 3300049823 | Bacteria | 12684 |
| 827 | Ga0501044_0011798 | 3300049823 | Bacteria | 9467 |
| 828 | Ga0501044_0036929 | 3300049823 | Bacteria | 5109 |
| 829 | Ga0501044_0067683 | 3300049823 | Bacteria | 3638 |
| 830 | Ga0501044_0076403 | 3300049823 | Bacteria | 3399 |
| 831 | Ga0501044_0341285 | 3300049823 | Bacteria | 1419 |
| 832 | Ga0501045_0029730 | 3300049824 | Bacteria | 3951 |
| 833 | Ga0501045_0070105 | 3300049824 | Bacteria | 2578 |
| 834 | nmdc:mga00v17_30387_c1 | 3300050491 | Bacteria | 3179 |
| 835 | nmdc:mga00v17_67999_c1 | 3300050491 | Bacteria | 2202 |
| 836 | nmdc:mga0yw44_124113_c1 | 3300050492 | Bacteria | 1666 |
| 837 | nmdc:mga0yw44_16058_c1 | 3300050492 | Bacteria | 4034 |
| 838 | nmdc:mga0yw44_78142_c1 | 3300050492 | Bacteria | 2069 |
| 839 | nmdc:mga0k408_122584_c1 | 3300050493 | Bacteria | 1540 |
| 840 | nmdc:mga06z11_246834_c1 | 3300050494 | Bacteria | 1050 |
| 841 | nmdc:mga06z11_5224_c1 | 3300050494 | Bacteria | 5189 |
| 842 | nmdc:mga07m45_24176_c1 | 3300050496 | Bacteria | 3326 |
| 843 | nmdc:mga07m45_30288_c1 | 3300050496 | Bacteria | 2996 |
| 844 | nmdc:mga0qj67_228926_c1 | 3300050509 | Bacteria | 1508 |
| 845 | nmdc:mga08y16_317611_c1 | 3300050511 | Bacteria | 1604 |
| 846 | nmdc:mga0n895_396351_c1 | 3300050512 | Bacteria | 1396 |
| 847 | nmdc:mga0a205_399935_c1 | 3300050515 | Bacteria | 1237 |
| 848 | nmdc:mga0sz30_16504_c1 | 3300050516 | Bacteria | 2934 |
| 849 | nmdc:mga0sz30_4339_c1 | 3300050516 | Bacteria | 5118 |
| 850 | Ga0495601_0035464 | 3300053077 | Bacteria | 3114 |
| 851 | Ga0495601_0079177 | 3300053077 | Bacteria | 2106 |
| 852 | Ga0495601_0189622 | 3300053077 | Bacteria | 1344 |
| 853 | Ga0495612_0056013 | 3300053078 | Bacteria | 1626 |
| 854 | Ga0495655_0027424 | 3300053083 | Bacteria | 1351 |
| 855 | Ga0495595_0018265 | 3300053084 | Bacteria | 3029 |
| 856 | Ga0495595_0055957 | 3300053084 | Bacteria | 1837 |
| 857 | Ga0495619_0006768 | 3300053085 | Bacteria | 7250 |
| 858 | Ga0495619_0009872 | 3300053085 | Bacteria | 6017 |
| 859 | Ga0495619_0199100 | 3300053085 | Bacteria | 1386 |
| 860 | Ga0500643_014733 | 3300053087 | Bacteria | 2705 |
| 861 | Ga0500646_0029959 | 3300053090 | Bacteria | 1492 |
| 862 | Ga0500647_0034601 | 3300053091 | Bacteria | 2412 |
| 863 | Ga0500647_0073858 | 3300053091 | Bacteria | 1636 |
| 864 | Ga0500651_0066979 | 3300053093 | Bacteria | 2236 |
| 865 | Ga0500651_0093884 | 3300053093 | Bacteria | 1844 |
| 866 | Ga0500566_0000046 | 3300053094 | Bacteria | 59187 |
| 867 | Ga0500566_0016032 | 3300053094 | Bacteria | 4401 |
| 868 | Ga0500640_004013 | 3300053095 | Bacteria | 5279 |
| 869 | Ga0500641_0001509 | 3300053096 | Bacteria | 8318 |
| 870 | Ga0500648_120363 | 3300053097 | Bacteria | 1438 |
| 871 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 872 | Ga0500572_000872 | 3300053111 | Bacteria | 9361 |
| 873 | Ga0500591_056543 | 3300053115 | Bacteria | 1822 |
| 874 | Ga0500592_000851 | 3300053116 | Bacteria | 4973 |
| 875 | Ga0500593_012453 | 3300053117 | Bacteria | 3608 |
| 876 | Ga0500594_0015594 | 3300053118 | Bacteria | 1834 |
| 877 | Ga0500595_000414 | 3300053119 | Bacteria | 27179 |
| 878 | Ga0500595_003094 | 3300053119 | Bacteria | 7875 |
| 879 | Ga0500595_012256 | 3300053119 | Bacteria | 3322 |
| 880 | Ga0500595_019000 | 3300053119 | Bacteria | 2500 |
| 881 | Ga0500595_064569 | 3300053119 | Bacteria | 1097 |
| 882 | Ga0500607_104657 | 3300053121 | Bacteria | 1399 |
| 883 | Ga0500608_003561 | 3300053122 | Bacteria | 5864 |
| 884 | Ga0500608_012741 | 3300053122 | Bacteria | 3698 |
| 885 | Ga0500618_009501 | 3300053125 | Bacteria | 2651 |
| 886 | Ga0500642_0000104 | 3300053130 | Bacteria | 40747 |
| 887 | Ga0500642_0043190 | 3300053130 | Bacteria | 1957 |
| 888 | Ga0500642_0099933 | 3300053130 | Bacteria | 1348 |
| 889 | Ga0500652_000138 | 3300053131 | Bacteria | 27584 |
| 890 | Ga0500559_0000117 | 3300053136 | Bacteria | 62940 |
| 891 | Ga0500559_0003688 | 3300053136 | Bacteria | 7469 |
| 892 | Ga0500559_0060606 | 3300053136 | Bacteria | 1686 |
| 893 | Ga0500568_0000838 | 3300053139 | Bacteria | 21617 |
| 894 | Ga0500568_0006686 | 3300053139 | Bacteria | 5763 |
| 895 | Ga0500568_0025219 | 3300053139 | Bacteria | 2511 |
| 896 | Ga0500573_0005299 | 3300053140 | Bacteria | 6895 |
| 897 | Ga0500577_0000338 | 3300053142 | Bacteria | 12057 |
| 898 | Ga0500586_015772 | 3300053145 | Bacteria | 2277 |
| 899 | Ga0500588_0005197 | 3300053146 | Bacteria | 2875 |
| 900 | Ga0500603_000071 | 3300053150 | Bacteria | 23487 |
| 901 | Ga0500603_000634 | 3300053150 | Bacteria | 8611 |
| 902 | Ga0500603_044551 | 3300053150 | Bacteria | 1195 |
| 903 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 904 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 905 | Ga0500616_0014363 | 3300053153 | Bacteria | 4553 |
| 906 | Ga0500616_0022356 | 3300053153 | Bacteria | 3531 |
| 907 | Ga0500622_0013876 | 3300053156 | Bacteria | 4338 |
| 908 | Ga0500624_007945 | 3300053157 | Bacteria | 1474 |
| 909 | Ga0500630_001587 | 3300053159 | Bacteria | 10874 |
| 910 | Ga0500634_0044729 | 3300053161 | Bacteria | 2397 |
| 911 | Ga0500639_000009 | 3300053163 | Bacteria | 139043 |
| 912 | Ga0500636_0003823 | 3300053177 | Bacteria | 8511 |
| 913 | Ga0500636_0112470 | 3300053177 | Bacteria | 1537 |
| 914 | Ga0500637_0001208 | 3300053178 | Bacteria | 10778 |
| 915 | Ga0500637_0010301 | 3300053178 | Bacteria | 4788 |
| 916 | Ga0500637_0098075 | 3300053178 | Bacteria | 1699 |
| 917 | Ga0500637_0154145 | 3300053178 | Bacteria | 1326 |
| 918 | Ga0500649_016624 | 3300053722 | Bacteria | 2928 |
| 919 | Ga0500570_086481 | 3300053724 | Bacteria | 1386 |
| 920 | Ga0500611_043147 | 3300053727 | Bacteria | 1001 |
| 921 | Ga0500596_000313 | 3300053735 | Bacteria | 8675 |
| 922 | Ga0500596_002297 | 3300053735 | Bacteria | 3784 |
| 923 | Ga0501084_0015100 | 3300054114 | Bacteria | 6405 |
| 924 | Ga0501084_0216475 | 3300054114 | Bacteria | 1616 |
| 925 | Ga0500661_000369 | 3300055283 | Bacteria | 8304 |
| 926 | Ga0501082_0011284 | 3300060353 | Bacteria | 7680 |
| 927 | Ga0501082_0098093 | 3300060353 | Bacteria | 2534 |
| 928 | Ga0501082_0357985 | 3300060353 | Bacteria | 1273 |
| 929 | Ga0466962_0051513 | 3300061719 | Bacteria | 1968 |
| 930 | Ga0466962_0140066 | 3300061719 | Bacteria | 1172 |
| 931 | 2509151023 | 2508501128 | Bacteria | 8613869 |
| 932 | 2511395122 | 2511231028 | Bacteria | 8046582 |
| 933 | 2513636971 | 2513237094 | Bacteria | 8789602 |
| 934 | 2513657288 | 2513237096 | Bacteria | 8722461 |
| 935 | 2513693045 | 2513237101 | Bacteria | 7952346 |
| 936 | 2513857759 | 2513237137 | Bacteria | 9558895 |
| 937 | 2513887298 | 2513237141 | Bacteria | 8496279 |
| 938 | 2513919296 | 2513237145 | Bacteria | 8979722 |
| 939 | 2517891012 | 2517572143 | Bacteria | 9484767 |
| 940 | 2524441223 | 2524023205 | Bacteria | 8918781 |
| 941 | 2524464982 | 2524023210 | Bacteria | 9029266 |
| 942 | 2524537543 | 2524023228 | Bacteria | 10118060 |
| 943 | 2599333212 | 2599185156 | Bacteria | 5403036 |
| 944 | 2603860393 | 2602042107 | Bacteria | 6226103 |
| 945 | 2644289337 | 2643221651 | Bacteria | 4798932 |
| 946 | 2671120071 | 2667528175 | Bacteria | 7532676 |
| 947 | 2723843319 | 2721755755 | Bacteria | 8322773 |
| 948 | 2745078684 | 2744054633 | Bacteria | 8678936 |
| 949 | 2793061135 | 2791355196 | Bacteria | 7323613 |
| 950 | 2793066368 | 2791355197 | Bacteria | 8420563 |
| 951 | 2793080687 | |||
| 952 | 2819719732 | 2818991467 | Bacteria | 5893227 |
| 953 | 2824681515 | 2824679649 | Bacteria | 8248951 |
| 954 | 2837652360 | 2837651117 | Bacteria | 3772164 |
| 955 | 2842040940 | 2842038055 | Bacteria | 8002051 |
| 956 | 2842046115 | 2842045827 | Bacteria | 8006841 |
| 957 | 2842923519 | 2842922631 | Bacteria | 5824079 |
| 958 | 2844320268 | 2844315083 | Bacteria | 8138177 |
| 959 | 2847937590 | 2847930680 | Bacteria | 9342022 |
| 960 | 2857525340 | 2857524615 | Bacteria | 6615449 |
| 961 | 2874611793 | 2874604998 | Bacteria | 7834745 |
| 962 | 2874614408 | 2874612657 | Bacteria | 8252029 |
| 963 | 2874623800 | 2874620515 | Bacteria | 8290088 |
| 964 | 2876809606 | 2876808645 | Bacteria | 8824342 |
| 965 | 2879084086 | 2879083081 | Bacteria | 8587928 |
| 966 | 2879110888 | 2879110137 | Bacteria | 8907982 |
| 967 | 2881667144 | 2881665667 | Bacteria | 8175609 |
| 968 | 2885370256 | 2885366525 | Bacteria | 8326213 |
| 969 | 2885377333 | 2885374607 | Bacteria | 8927485 |
| 970 | 2889037638 | 2889033259 | Bacteria | 9099371 |
| 971 | 2893066285 | 2893066018 | Bacteria | 6158120 |
| 972 | 2903731548 | 2903727486 | Bacteria | 8281579 |
| 973 | 2903749655 | 2903748898 | Bacteria | 9972761 |
| 974 | 2904674029 | 2904666416 | Bacteria | 8226587 |
| 975 | 2904694462 | 2904690495 | Bacteria | 9412302 |
| 976 | 2904700543 | |||
| 977 | 2906608343 | 2906602504 | Bacteria | 8295279 |
| 978 | 2906616211 | |||
| 979 | 2906636954 | 2906635258 | Bacteria | 8601019 |
| 980 | 2906664452 | 2906660503 | Bacteria | 8595048 |
| 981 | 2908741279 | 2908739725 | Bacteria | 8628932 |
| 982 | 2908763402 | 2908756301 | Bacteria | 8864324 |
| 983 | 2919074969 | 2919073203 | Bacteria | 6531949 |
| 984 | 2922361597 | 2922361189 | Bacteria | 7436256 |
| 985 | 2922387177 | 2922386360 | Bacteria | 7017218 |
| 986 | 2922393704 | 2922393267 | Bacteria | 8285685 |
| 987 | 2922431813 | |||
| 988 | 2932799741 | 2932794094 | Bacteria | 7915132 |
| 989 | 2932808672 | 2932801729 | Bacteria | 7987968 |
| 990 | 2935635345 | 2935630451 | Bacteria | 8169952 |
| 991 | 2935885597 | 2935883170 | Bacteria | 7964738 |
| 992 | 2941512149 | 2941507105 | Bacteria | 8166816 |
| 993 | 2941519851 | 2941515067 | Bacteria | 8166720 |
| 994 | 2941527862 | 2941523033 | Bacteria | 8169134 |
| 995 | 2941531474 | 2941531003 | Bacteria | 7653939 |
| 996 | 3005481754 | 3005474847 | Bacteria | 9259049 |
| 997 | 3005508095 | 3005506211 | Bacteria | 6943378 |
| 998 | 3005723418 | 3005718088 | Bacteria | 8283608 |
| 999 | 8006939116 | 8006933436 | Bacteria | 10410654 |
| 1000 | 8006972349 | 8006964411 | Bacteria | 8966052 |
| 1001 | 8006978773 | 8006973647 | Bacteria | 10679141 |
| 1002 | 8006985032 | 8006984368 | Bacteria | 9651211 |
| 1003 | 8006999746 | 8006994254 | Bacteria | 8309700 |
| 1004 | 8019559931 | 8019555841 | Bacteria | 9642137 |
| 1005 | 8019570034 | 8019565922 | Bacteria | 9639779 |
| 1006 | 8054560946 | 8054558443 | Bacteria | 5204801 |
| 1007 | 8056678772 | 8056673599 | Bacteria | 7871253 |
| 1008 | 8056687845 | 8056681323 | Bacteria | 8472857 |
| 1009 | 8056690507 | 8056689827 | Bacteria | 6712655 |
| 1010 | Ga0070709_10047981 | |||
| 1011 | JGI25406J46586_10000018 | |||
| 1012 | JGI25406J46586_10005340 | |||
| 1013 | JGI25406J46586_10006262 | |||
| 1014 | JGI25153J46596_10004213 | |||
| 1015 | JGI25153J46596_10008093 | |||
| 1016 | JGI25404J52841_10006165 | |||
| 1017 | JGI25404J52841_10036465 | |||
| 1018 | Ga0070658_10017070 | |||
| 1019 | Ga0070683_100013394 | |||
| 1020 | Ga0070683_100030933 | |||
| 1021 | Ga0068869_100032048 | |||
| 1022 | Ga0068869_100157173 | |||
| 1023 | Ga0070666_10264149 | |||
| 1024 | Ga0070680_100012612 | |||
| 1025 | Ga0070680_100498333 | |||
| 1026 | Ga0070682_100308629 | |||
| 1027 | Ga0068868_100058578 | |||
| 1028 | Ga0068868_100209989 | |||
| 1029 | Ga0070660_100248390 | |||
| 1030 | Ga0070689_100173153 | |||
| 1031 | Ga0070687_100030536 | |||
| 1032 | Ga0070661_100321895 | |||
| 1033 | Ga0070668_100023719 | |||
| 1034 | Ga0070668_100067352 | |||
| 1035 | Ga0070668_100190290 | |||
| 1036 | Ga0070674_100059750 | |||
| 1037 | Ga0070688_100089555 | |||
| 1038 | Ga0070688_100239186 | |||
| 1039 | Ga0070659_100123548 | |||
| 1040 | Ga0070659_100158477 | |||
| 1041 | Ga0070667_100069942 | |||
| 1042 | Ga0070667_100323540 | |||
| 1043 | Ga0070709_10005136 | |||
| 1044 | Ga0070709_10005610 | |||
| 1045 | Ga0070709_10009222 | |||
| 1046 | Ga0070714_100006193 | |||
| 1047 | Ga0070714_100021334 | |||
| 1048 | Ga0070714_100310414 | |||
| 1049 | Ga0070713_100002525 | |||
| 1050 | Ga0070713_100019290 | |||
| 1051 | Ga0070713_100036104 | |||
| 1052 | Ga0070713_100090628 | |||
| 1053 | Ga0070713_100100027 | |||
| 1054 | Ga0070713_100150376 | |||
| 1055 | Ga0070710_10001159 | |||
| 1056 | Ga0070710_10023562 | |||
| 1057 | Ga0070710_10030708 | |||
| 1058 | Ga0070701_10048550 | |||
| 1059 | Ga0070701_10318475 | |||
| 1060 | Ga0070711_100002007 | |||
| 1061 | Ga0070711_100004216 | |||
| 1062 | Ga0070711_100010835 | |||
| 1063 | Ga0070711_100067859 | |||
| 1064 | Ga0070711_100086272 | |||
| 1065 | Ga0070663_100035803 | |||
| 1066 | Ga0070663_100129492 | |||
| 1067 | Ga0070663_100288317 | |||
| 1068 | Ga0070678_100040300 | |||
| 1069 | Ga0070678_100056425 | |||
| 1070 | Ga0070678_100142071 | |||
| 1071 | Ga0070678_100391859 | |||
| 1072 | Ga0070662_100036426 | |||
| 1073 | Ga0070662_100090074 | |||
| 1074 | Ga0070681_10007970 | |||
| 1075 | Ga0070681_10016550 | |||
| 1076 | Ga0070681_10088042 | |||
| 1077 | Ga0070681_10177810 | |||
| 1078 | Ga0070681_10201308 | |||
| 1079 | Ga0068867_100017580 | |||
| 1080 | Ga0068867_100147277 | |||
| 1081 | Ga0070707_100165528 | |||
| 1082 | Ga0070698_100027277 | |||
| 1083 | Ga0070699_100314639 | |||
| 1084 | Ga0070679_100013091 | |||
| 1085 | Ga0070679_100047345 | |||
| 1086 | Ga0070679_100187798 | |||
| 1087 | Ga0070679_100260768 | |||
| 1088 | Ga0070684_100005702 | |||
| 1089 | Ga0070684_100007810 | |||
| 1090 | Ga0068853_100231742 | |||
| 1091 | Ga0070672_100037602 | |||
| 1092 | Ga0070672_100174946 | |||
| 1093 | Ga0070672_100273872 | |||
| 1094 | Ga0070686_100109598 | |||
| 1095 | Ga0070665_100027974 | |||
| 1096 | Ga0070665_100040289 | |||
| 1097 | Ga0070665_100101604 | |||
| 1098 | Ga0070665_100174338 | |||
| 1099 | Ga0070665_100177636 | |||
| 1100 | Ga0068855_100028483 | |||
| 1101 | Ga0068855_100145464 | |||
| 1102 | Ga0068855_100200019 | |||
| 1103 | Ga0068855_100249194 | |||
| 1104 | Ga0068855_100310689 | |||
| 1105 | Ga0068857_100419966 | |||
| 1106 | Ga0068854_100071969 | |||
| 1107 | Ga0068856_100000505 | |||
| 1108 | Ga0068856_100079591 | |||
| 1109 | Ga0068856_100205879 | |||
| 1110 | Ga0068856_100209643 | |||
| 1111 | Ga0068852_100012532 | |||
| 1112 | Ga0068852_100014578 | |||
| 1113 | Ga0068852_100106904 | |||
| 1114 | Ga0068859_100112115 | |||
| 1115 | Ga0068859_100212866 | |||
| 1116 | Ga0068864_100154674 | |||
| 1117 | Ga0068861_100054079 | |||
| 1118 | Ga0068870_10220881 | |||
| 1119 | Ga0068863_100521610 | |||
| 1120 | Ga0068858_100131906 | |||
| 1121 | Ga0068860_100000101 | |||
| 1122 | Ga0068860_100054649 | |||
| 1123 | Ga0068860_100151843 | |||
| 1124 | Ga0068862_100068784 | |||
| 1125 | Ga0068862_100101143 | |||
| 1126 | Ga0068862_100257281 | |||
| 1127 | Ga0068862_100318665 | |||
| 1128 | Ga0081455_10005572 | |||
| 1129 | Ga0081455_10005785 | |||
| 1130 | Ga0081455_10006447 | |||
| 1131 | Ga0081455_10021510 | |||
| 1132 | Ga0081538_10107252 | |||
| 1133 | Ga0081540_1002041 | |||
| 1134 | Ga0081540_1003848 | |||
| 1135 | Ga0081540_1007700 | |||
| 1136 | Ga0081540_1011669 | |||
| 1137 | Ga0081540_1014956 | |||
| 1138 | Ga0081540_1019359 | |||
| 1139 | Ga0081540_1045183 | |||
| 1140 | Ga0081539_10000003 | |||
| 1141 | Ga0081539_10000199 | |||
| 1142 | Ga0081539_10032330 | |||
| 1143 | Ga0081539_10100868 | |||
| 1144 | Ga0081539_10151778 | |||
| 1145 | Ga0070717_10001543 | |||
| 1146 | Ga0070717_10067095 | |||
| 1147 | Ga0070717_10069149 | |||
| 1148 | Ga0075365_10011224 | |||
| 1149 | Ga0075365_10040460 | |||
| 1150 | Ga0075365_10090329 | |||
| 1151 | Ga0075365_10093018 | |||
| 1152 | Ga0075365_10121863 | |||
| 1153 | Ga0075364_10036099 | |||
| 1154 | Ga0075364_10072950 | |||
| 1155 | Ga0070715_10000555 | |||
| 1156 | Ga0070716_100006104 | |||
| 1157 | Ga0070716_100028516 | |||
| 1158 | Ga0070716_100060116 | |||
| 1159 | Ga0070716_100099729 | |||
| 1160 | Ga0070712_100007857 | |||
| 1161 | Ga0070712_100012273 | |||
| 1162 | Ga0070712_100016728 | |||
| 1163 | Ga0070712_100097092 | |||
| 1164 | Ga0075367_10050011 | |||
| 1165 | Ga0075367_10192497 | |||
| 1166 | Ga0075366_10029876 | |||
| 1167 | Ga0075370_10046260 | |||
| 1168 | Ga0075434_100422636 | |||
| 1169 | Ga0075429_100439220 | |||
| 1170 | Ga0068865_100214855 | |||
| 1171 | Ga0097620_100112123 | |||
| 1172 | Ga0097620_100212868 | |||
| 1173 | Ga0099822_1000663 | |||
| 1174 | Ga0099794_10013970 | |||
| 1175 | Ga0099794_10033008 | |||
| 1176 | Ga0105240_10004584 | |||
| 1177 | Ga0105240_10200101 | |||
| 1178 | Ga0105240_10365133 | |||
| 1179 | Ga0105240_10446667 | |||
| 1180 | Ga0111539_10467329 | |||
| 1181 | Ga0105245_10014011 | |||
| 1182 | Ga0105245_10125798 | |||
| 1183 | Ga0105247_10182419 | |||
| 1184 | Ga0114129_10240320 | |||
| 1185 | Ga0105243_10019284 | |||
| 1186 | Ga0105243_10065157 | |||
| 1187 | Ga0105241_10036436 | |||
| 1188 | Ga0105241_10047652 | |||
| 1189 | Ga0105242_10193818 | |||
| 1190 | Ga0105242_10335742 | |||
| 1191 | Ga0105248_10036694 | |||
| 1192 | Ga0105248_10126848 | |||
| 1193 | Ga0105237_10017452 | |||
| 1194 | Ga0105237_10086786 | |||
| 1195 | Ga0105237_10090991 | |||
| 1196 | Ga0105238_10003279 | |||
| 1197 | Ga0105238_10015544 | |||
| 1198 | Ga0105238_10088935 | |||
| 1199 | Ga0105238_10109487 | |||
| 1200 | Ga0105249_10307808 | |||
| 1201 | Ga0105249_10535490 | |||
| 1202 | Ga0099796_10003116 | |||
| 1203 | Ga0105239_10022515 | |||
| 1204 | Ga0105239_10058045 | |||
| 1205 | Ga0105239_10436941 | |||
| 1206 | Ga0157370_10013258 | |||
| 1207 | Ga0157370_10021342 | |||
| 1208 | Ga0157369_10018648 | |||
| 1209 | Ga0157369_10050530 | |||
| 1210 | Ga0157369_10173351 | |||
| 1211 | Ga0157369_10475226 | |||
| 1212 | Ga0157374_10021557 | |||
| 1213 | Ga0157374_10049574 | |||
| 1214 | Ga0157374_10226054 | |||
| 1215 | Ga0157378_10024322 | |||
| 1216 | Ga0157378_10299303 | |||
| 1217 | Ga0157378_10379549 | |||
| 1218 | Ga0163162_10160155 | |||
| 1219 | Ga0163162_10183944 | |||
| 1220 | Ga0163162_10602555 | |||
| 1221 | Ga0157372_10100777 | |||
| 1222 | Ga0157372_10229748 | |||
| 1223 | Ga0157375_10053921 | |||
| 1224 | Ga0157375_10163180 | |||
| 1225 | Ga0163163_10313416 | |||
| 1226 | Ga0157380_10371022 | |||
| 1227 | Ga0157379_10066497 | |||
| 1228 | Ga0157376_10036968 | |||
| 1229 | Ga0163161_10221020 | |||
| 1230 | Ga0163161_10266945 | |||
| 1231 | Ga0206356_11193562 | |||
| 1232 | Ga0206353_11100446 | |||
| 1233 | Ga0213872_10003012 | |||
| 1234 | Ga0213872_10003019 | |||
| 1235 | Ga0213872_10006968 | |||
| 1236 | Ga0213872_10011539 | |||
| 1237 | Ga0213872_10024525 | |||
| 1238 | Ga0213872_10026435 | |||
| 1239 | Ga0213876_10016846 | |||
| 1240 | Ga0213875_10057382 | |||
| 1241 | Ga0213871_10026820 | |||
| 1242 | Ga0209564_1000865 | |||
| 1243 | Ga0209758_1000120 | |||
| 1244 | Ga0209758_1000267 | |||
| 1245 | Ga0209758_1000720 | |||
| 1246 | Ga0209758_1003178 | |||
| 1247 | Ga0209758_1005954 | |||
| 1248 | Ga0209758_1010377 | |||
| 1249 | Ga0209758_1015367 | |||
| 1250 | Ga0209758_1033211 | |||
| 1251 | Ga0207426_1026634 | |||
| 1252 | Ga0209257_1043208 | |||
| 1253 | Ga0207697_10072132 | |||
| 1254 | Ga0207656_10017228 | |||
| 1255 | Ga0207656_10142318 | |||
| 1256 | Ga0207653_10049560 | |||
| 1257 | Ga0207682_10068106 | |||
| 1258 | Ga0207692_10002181 | |||
| 1259 | Ga0207692_10009758 | |||
| 1260 | Ga0207692_10065282 | |||
| 1261 | Ga0207642_10111458 | |||
| 1262 | Ga0207710_10071162 | |||
| 1263 | Ga0207680_10071245 | |||
| 1264 | Ga0207685_10027658 | |||
| 1265 | Ga0207699_10001171 | |||
| 1266 | Ga0207699_10115073 | |||
| 1267 | Ga0207645_10014371 | |||
| 1268 | Ga0207705_10121553 | |||
| 1269 | Ga0207654_10011567 | |||
| 1270 | Ga0207654_10309633 | |||
| 1271 | Ga0207707_10004201 | |||
| 1272 | Ga0207707_10028716 | |||
| 1273 | Ga0207707_10052097 | |||
| 1274 | Ga0207707_10061385 | |||
| 1275 | Ga0207707_10116244 | |||
| 1276 | Ga0207695_10000163 | |||
| 1277 | Ga0207695_10428331 | |||
| 1278 | Ga0207671_10011282 | |||
| 1279 | Ga0207671_10030974 | |||
| 1280 | Ga0207671_10043463 | |||
| 1281 | Ga0207693_10003158 | |||
| 1282 | Ga0207693_10006713 | |||
| 1283 | Ga0207693_10024089 | |||
| 1284 | Ga0207693_10039929 | |||
| 1285 | Ga0207693_10044762 | |||
| 1286 | Ga0207693_10426772 | |||
| 1287 | Ga0207663_10000261 | |||
| 1288 | Ga0207663_10008702 | |||
| 1289 | Ga0207663_10047740 | |||
| 1290 | Ga0207663_10096533 | |||
| 1291 | Ga0207663_10275375 | |||
| 1292 | Ga0207660_10009640 | |||
| 1293 | Ga0207660_10137522 | |||
| 1294 | Ga0207660_10237550 | |||
| 1295 | Ga0207657_10002700 | |||
| 1296 | Ga0207657_10005124 | |||
| 1297 | Ga0207652_10006338 | |||
| 1298 | Ga0207652_10009869 | |||
| 1299 | Ga0207652_10017004 | |||
| 1300 | Ga0207652_10495896 | |||
| 1301 | Ga0207646_10084060 | |||
| 1302 | Ga0207694_10038223 | |||
| 1303 | Ga0207694_10059974 | |||
| 1304 | Ga0207694_10489088 | |||
| 1305 | Ga0207687_10009704 | |||
| 1306 | Ga0207687_10033220 | |||
| 1307 | Ga0207687_10265166 | |||
| 1308 | Ga0207700_10007733 | |||
| 1309 | Ga0207700_10024258 | |||
| 1310 | Ga0207700_10044654 | |||
| 1311 | Ga0207700_10069105 | |||
| 1312 | Ga0207700_10086075 | |||
| 1313 | Ga0207700_10096957 | |||
| 1314 | Ga0207664_10023451 | |||
| 1315 | Ga0207664_10084912 | |||
| 1316 | Ga0207664_10113811 | |||
| 1317 | Ga0207664_10336092 | |||
| 1318 | Ga0207664_10381981 | |||
| 1319 | Ga0207664_10428254 | |||
| 1320 | Ga0207644_10070982 | |||
| 1321 | Ga0207706_10037862 | |||
| 1322 | Ga0207686_10204562 | |||
| 1323 | Ga0207670_10110812 | |||
| 1324 | Ga0207704_10024462 | |||
| 1325 | Ga0207704_10258411 | |||
| 1326 | Ga0207665_10000280 | |||
| 1327 | Ga0207665_10002029 | |||
| 1328 | Ga0207665_10066558 | |||
| 1329 | Ga0207665_10132765 | |||
| 1330 | Ga0207691_10168950 | |||
| 1331 | Ga0207711_10030253 | |||
| 1332 | Ga0207711_10362277 | |||
| 1333 | Ga0207689_10079591 | |||
| 1334 | Ga0207661_10000532 | |||
| 1335 | Ga0207661_10002592 | |||
| 1336 | Ga0207661_10018698 | |||
| 1337 | Ga0207667_10128551 | |||
| 1338 | Ga0207667_10137958 | |||
| 1339 | Ga0207667_10358269 | |||
| 1340 | Ga0207651_10480525 | |||
| 1341 | Ga0207668_10055665 | |||
| 1342 | Ga0207640_10069450 | |||
| 1343 | Ga0207658_10261034 | |||
| 1344 | Ga0207677_10026809 | |||
| 1345 | Ga0207678_10042731 | |||
| 1346 | Ga0207678_10115319 | |||
| 1347 | Ga0207678_10177504 | |||
| 1348 | Ga0207708_10045881 | |||
| 1349 | Ga0207702_10000127 | |||
| 1350 | Ga0207702_10195945 | |||
| 1351 | Ga0207702_10242785 | |||
| 1352 | Ga0207641_10053496 | |||
| 1353 | Ga0207641_10330047 | |||
| 1354 | Ga0207648_10095226 | |||
| 1355 | Ga0207648_10485139 | |||
| 1356 | Ga0207674_10073279 | |||
| 1357 | Ga0207674_10437166 | |||
| 1358 | Ga0207675_100106446 | |||
| 1359 | Ga0207675_100148533 | |||
| 1360 | Ga0207683_10051817 | |||
| 1361 | Ga0207683_10300587 | |||
| 1362 | Ga0207698_10008740 | |||
| 1363 | Ga0207698_10020122 | |||
| 1364 | Ga0207698_10146869 | |||
| 1365 | Ga0207698_10223686 | |||
| 1366 | Ga0207698_10236000 | |||
| 1367 | Ga0207698_10467637 | |||
| 1368 | Ga0209389_1000186 | |||
| 1369 | Ga0209389_1000261 | |||
| 1370 | Ga0209589_1000006 | |||
| 1371 | Ga0209589_1001077 | |||
| 1372 | Ga0209489_100007 | |||
| 1373 | Ga0209489_100176 | |||
| 1374 | Ga0209489_112845 | |||
| 1375 | Ga0209700_100008 | |||
| 1376 | Ga0209700_101165 | |||
| 1377 | Ga0209588_1000499 | |||
| 1378 | Ga0209588_1016019 | |||
| 1379 | Ga0268266_10002993 | |||
| 1380 | Ga0268266_10073304 | |||
| 1381 | Ga0268266_10074116 | |||
| 1382 | Ga0268266_10241032 | |||
| 1383 | Ga0268266_10263537 | |||
| 1384 | Ga0268265_10069393 | |||
| 1385 | Ga0268264_10000030 | |||
| 1386 | Ga0307517_10000744 | |||
| 1387 | Ga0307511_10097451 | |||
| 1388 | Ga0265330_10012783 | |||
| 1389 | Ga0265330_10093495 | |||
| 1390 | Ga0265332_10146508 | |||
| 1391 | Ga0265340_10006832 | |||
| 1392 | Ga0265339_10001302 | |||
| 1393 | Ga0265339_10093600 | |||
| 1394 | Ga0265331_10128069 | |||
| 1395 | Ga0265331_10128079 | |||
| 1396 | Ga0307513_10229452 | |||
| 1397 | Ga0307408_100007557 | |||
| 1398 | Ga0307408_100294245 | |||
| 1399 | Ga0265313_10113715 | |||
| 1400 | Ga0307508_10000051 | |||
| 1401 | Ga0265314_10001137 | |||
| 1402 | Ga0265342_10014921 | |||
| 1403 | Ga0265342_10017603 | |||
| 1404 | Ga0307516_10011569 | |||
| 1405 | Ga0307516_10209330 | |||
| 1406 | Ga0307405_10055379 | |||
| 1407 | Ga0307412_10170917 | |||
| 1408 | Ga0307416_100266727 | |||
| 1409 | Ga0307507_10006354 | |||
| 1410 | Ga0307510_10021805 | |||
| 1411 | Ga0307510_10038903 | |||
| 1412 | Ga0315911_1000003 | |||
| 1413 | Ga0373926_0001921 | |||
| 1414 | Ga0373934_0004312 | |||
| 1415 | Ga0373944_0088312 | |||
| 1416 | Ga0373923_0008455 | |||
| 1417 | Ga0373923_0111930 | |||
| 1418 | Ga0373936_0033852 | |||
| 1419 | Ga0373941_0004414 | |||
| 1420 | Ga0373953_0002981 | |||
| 1421 | Ga0373953_0066316 | |||
| 1422 | Ga0373954_0002129 | |||
| 1423 | Ga0373954_0042019 | |||
| 1424 | Ga0373956_0003044 | |||
| 1425 | Ga0373957_0000776 | |||
| 1426 | Ga0373946_0002366 | |||
| 1427 | Ga0373955_0004043 | |||
| 1428 | Ga0373924_0016757 | |||
| 1429 | Ga0373924_0025943 | |||
| 1430 | Ga0373924_0051372 | |||
| 1431 | Ga0373931_0001492 | |||
| 1432 | Ga0373931_0062680 | |||
| 1433 | Ga0373935_0006343 | |||
| 1434 | Ga0373935_0237665 | |||
| 1435 | Ga0373935_0257872 | |||
| 1436 | Ga0373927_0003904 | |||
| 1437 | Ga0373927_0005891 | |||
| 1438 | Ga0373927_0007576 | |||
| 1439 | Ga0373927_0034813 | |||
| 1440 | Ga0373927_0074134 | |||
| 1441 | Ga0373927_0152846 | |||
| 1442 | Ga0373933_0000342 | |||
| 1443 | Ga0373933_0013742 | |||
| 1444 | Ga0373933_0084118 | |||
| 1445 | Ga0373933_0114086 | |||
| 1446 | Ga0373933_0118584 | |||
| 1447 | Ga0373933_0168080 | |||
| 1448 | Ga0373947_0144671 | |||
| 1449 | Ga0373947_0202056 | |||
| 1450 | Ga0373937_0033338 | |||
| 1451 | Ga0373937_0047682 | |||
| 1452 | Ga0373937_0158558 | |||
| 1453 | Ga0373937_0260560 | |||
| 1454 | Ga0372808_010827 | |||
| 1455 | Ga0373925_0015751 | |||
| 1456 | Ga0373925_0048031 | |||
| 1457 | Ga0373925_0070092 | |||
| 1458 | Ga0395899_0061768 | |||
| 1459 | Ga0395900_0003599 | |||
| 1460 | Ga0395900_0086144 | |||
| 1461 | Ga0395900_0177363 | |||
| 1462 | Ga0395898_0129104 | |||
| 1463 | Ga0395898_0145864 | |||
| 1464 | Ga0395905_0052126 | |||
| 1465 | Ga0436364_0997829 | |||
| 1466 | Ga0395901_0060727 | |||
| 1467 | Ga0395901_0352152 | |||
| 1468 | Ga0395901_0564445 | |||
| 1469 | Ga0436365_0386944 | |||
| 1470 | Ga0436365_0629162 | |||
| 1471 | Ga0436365_0838985 | |||
| 1472 | Ga0436365_0948695 | |||
| 1473 | Ga0436360_0974952 | |||
| 1474 | Ga0436361_0017850 | |||
| 1475 | Ga0436361_0107745 | |||
| 1476 | Ga0436361_0158927 | |||
| 1477 | Ga0436361_0336033 | |||
| 1478 | Ga0436361_0352642 | |||
| 1479 | Ga0436361_0421829 | |||
| 1480 | Ga0436361_0786450 | |||
| 1481 | Ga0436361_0791494 | |||
| 1482 | Ga0436363_0123844 | |||
| 1483 | Ga0436363_1054182 | |||
| 1484 | Ga0436363_1110633 | |||
| 1485 | Ga0436362_1134339 | |||
| 1486 | Ga0439438_023360 | |||
| 1487 | Ga0439465_0015316 | |||
| 1488 | Ga0450920_010714 | |||
| 1489 | Ga0450909_007227 | |||
| 1490 | Ga0466966_0021986 | |||
| 1491 | Ga0466966_0053736 | |||
| 1492 | Ga0466961_0000005 | |||
| 1493 | Ga0466963_0142709 | |||
| 1494 | Ga0466968_0083797 | |||
| 1495 | Ga0466957_0021630 | |||
| 1496 | Ga0466959_0005696 | |||
| 1497 | Ga0466959_0062058 | |||
| 1498 | Ga0466959_0305774 | |||
| 1499 | Ga0466958_0000489 | |||
| 1500 | Ga0466967_0405689 | |||
| 1501 | Ga0495592_0006971 | |||
| 1502 | Ga0495603_0004320 | |||
| 1503 | Ga0495603_0011117 | |||
| 1504 | Ga0495603_0011224 | |||
| 1505 | Ga0495603_0055469 | |||
| 1506 | Ga0495629_0000439 | |||
| 1507 | Ga0495629_0008693 | |||
| 1508 | Ga0495629_0025310 | |||
| 1509 | Ga0495629_0100051 | |||
| 1510 | Ga0495651_0042346 | |||
| 1511 | Ga0495651_0250894 | |||
| 1512 | Ga0495653_0011927 | |||
| 1513 | Ga0495653_0023097 | |||
| 1514 | Ga0495653_0183161 | |||
| 1515 | Ga0495650_0071355 | |||
| 1516 | Ga0495580_0010913 | |||
| 1517 | Ga0495580_0063049 | |||
| 1518 | Ga0495582_0095209 | |||
| 1519 | Ga0495639_0063048 | |||
| 1520 | Ga0495639_0072485 | |||
| 1521 | Ga0495639_0129605 | |||
| 1522 | Ga0495639_0180987 | |||
| 1523 | Ga0495662_0002831 | |||
| 1524 | Ga0495662_0014677 | |||
| 1525 | Ga0495664_0013575 | |||
| 1526 | Ga0495664_0026776 | |||
| 1527 | Ga0495664_0177552 | |||
| 1528 | Ga0495664_0179188 | |||
| 1529 | Ga0495594_0005519 | |||
| 1530 | Ga0495606_0002132 | |||
| 1531 | Ga0495606_0033400 | |||
| 1532 | Ga0495606_0069189 | |||
| 1533 | Ga0495606_0191328 | |||
| 1534 | Ga0495608_0005431 | |||
| 1535 | Ga0495608_0034052 | |||
| 1536 | Ga0495608_0198955 | |||
| 1537 | Ga0495616_0022428 | |||
| 1538 | Ga0495618_0007998 | |||
| 1539 | Ga0495618_0014482 | |||
| 1540 | Ga0495620_0059400 | |||
| 1541 | Ga0495628_0013324 | |||
| 1542 | Ga0495628_0020870 | |||
| 1543 | Ga0495628_0029898 | |||
| 1544 | Ga0495628_0060379 | |||
| 1545 | Ga0495628_0182993 | |||
| 1546 | Ga0495630_0070295 | |||
| 1547 | Ga0495631_0030231 | |||
| 1548 | Ga0495632_0053190 | |||
| 1549 | Ga0495644_0016361 | |||
| 1550 | Ga0495648_0003395 | |||
| 1551 | Ga0495648_0015565 | |||
| 1552 | Ga0495648_0019958 | |||
| 1553 | Ga0495663_0069778 | |||
| 1554 | Ga0495666_0021512 | |||
| 1555 | Ga0495652_0060178 | |||
| 1556 | Ga0495652_0093996 | |||
| 1557 | Ga0495665_0005469 | |||
| 1558 | Ga0495665_0017404 | |||
| 1559 | Ga0495665_0073583 | |||
| 1560 | Ga0495640_0004906 | |||
| 1561 | Ga0495640_0092548 | |||
| 1562 | Ga0495587_0157856 | |||
| 1563 | Ga0495597_0025921 | |||
| 1564 | Ga0495645_0015849 | |||
| 1565 | Ga0495645_0114450 | |||
| 1566 | Ga0495645_0211699 | |||
| 1567 | Ga0495622_0047942 | |||
| 1568 | Ga0495667_0005621 | |||
| 1569 | Ga0495667_0094625 | |||
| 1570 | Ga0495667_0273281 | |||
| 1571 | Ga0495656_0041568 | |||
| 1572 | Ga0495656_0130033 | |||
| 1573 | Ga0495668_0061198 | |||
| 1574 | Ga0495668_0174252 | |||
| 1575 | Ga0495634_0003738 | |||
| 1576 | Ga0495634_0024516 | |||
| 1577 | Ga0495634_0034617 | |||
| 1578 | Ga0495634_0100438 | |||
| 1579 | Ga0495625_0089530 | |||
| 1580 | Ga0495635_0013164 | |||
| 1581 | Ga0495635_0016717 | |||
| 1582 | Ga0495659_0011155 | |||
| 1583 | Ga0495588_0009072 | |||
| 1584 | Ga0495657_0010362 | |||
| 1585 | Ga0495657_0013824 | |||
| 1586 | Ga0495599_0001369 | |||
| 1587 | Ga0495599_0033876 | |||
| 1588 | Ga0495623_0005388 | |||
| 1589 | Ga0495623_0014960 | |||
| 1590 | Ga0495646_0024958 | |||
| 1591 | Ga0495646_0026668 | |||
| 1592 | Ga0495646_0071750 | |||
| 1593 | Ga0495658_0003784 | |||
| 1594 | Ga0495658_0009854 | |||
| 1595 | Ga0495669_0049543 | |||
| 1596 | Ga0495613_0007099 | |||
| 1597 | Ga0495613_0063134 | |||
| 1598 | Ga0495613_0090896 | |||
| 1599 | Ga0495624_0026173 | |||
| 1600 | Ga0495624_0035050 | |||
| 1601 | Ga0495670_0069591 | |||
| 1602 | Ga0495671_0028224 | |||
| 1603 | Ga0495649_0053047 | |||
| 1604 | Ga0495600_0001020 | |||
| 1605 | Ga0495600_0012902 | |||
| 1606 | Ga0495660_0078292 | |||
| 1607 | Ga0495581_0041911 | |||
| 1608 | Ga0495581_0109441 | |||
| 1609 | Ga0495604_0013033 | |||
| 1610 | Ga0495604_0060803 | |||
| 1611 | Ga0495604_0160593 | |||
| 1612 | Ga0495674_0000458 | |||
| 1613 | Ga0495674_0083470 | |||
| 1614 | Ga0495674_0113470 | |||
| 1615 | Ga0495674_0268601 | |||
| 1616 | Ga0495672_0019236 | |||
| 1617 | Ga0495672_0086763 | |||
| 1618 | Ga0495676_0065097 | |||
| 1619 | Ga0495676_0164141 | |||
| 1620 | Ga0495676_0232609 | |||
| 1621 | Ga0495680_0013039 | |||
| 1622 | Ga0495680_0015630 | |||
| 1623 | Ga0495683_0021464 | |||
| 1624 | Ga0495675_0009601 | |||
| 1625 | Ga0495677_0054803 | |||
| 1626 | Ga0495685_062018 | |||
| 1627 | Ga0495673_0048299 | |||
| 1628 | Ga0495681_0101552 | |||
| 1629 | Ga0495684_0000340 | |||
| 1630 | Ga0495684_0008134 | |||
| 1631 | Ga0495684_0249755 | |||
| 1632 | Ga0495686_0085798 | |||
| 1633 | Ga0495593_0000687 | |||
| 1634 | Ga0495593_0006332 | |||
| 1635 | Ga0495602_0008226 | |||
| 1636 | Ga0495602_0048912 | |||
| 1637 | Ga0495602_0050554 | |||
| 1638 | Ga0496100_0045126 | |||
| 1639 | Ga0496100_0200943 | |||
| 1640 | Ga0496100_0312377 | |||
| 1641 | Ga0496101_0025700 | |||
| 1642 | Ga0496101_0037723 | |||
| 1643 | Ga0496101_0053981 | |||
| 1644 | Ga0496101_0119798 | |||
| 1645 | Ga0496101_0193485 | |||
| 1646 | Ga0496102_0002648 | |||
| 1647 | Ga0496102_0021600 | |||
| 1648 | Ga0496102_0061834 | |||
| 1649 | Ga0496102_0086214 | |||
| 1650 | Ga0496102_0127148 | |||
| 1651 | Ga0496102_0129305 | |||
| 1652 | Ga0496102_0312680 | |||
| 1653 | Ga0496103_0029358 | |||
| 1654 | Ga0496103_0094489 | |||
| 1655 | Ga0496104_0019459 | |||
| 1656 | Ga0496104_0034268 | |||
| 1657 | Ga0496104_0073979 | |||
| 1658 | Ga0496105_0042398 | |||
| 1659 | Ga0496105_0071133 | |||
| 1660 | Ga0496105_0074458 | |||
| 1661 | Ga0496106_0000740 | |||
| 1662 | Ga0496106_0005785 | |||
| 1663 | Ga0496106_0015920 | |||
| 1664 | Ga0496106_0135311 | |||
| 1665 | Ga0496107_0004783 | |||
| 1666 | Ga0496107_0040726 | |||
| 1667 | Ga0496107_0069367 | |||
| 1668 | Ga0496107_0172903 | |||
| 1669 | Ga0496107_0194884 | |||
| 1670 | Ga0496108_0000938 | |||
| 1671 | Ga0496108_0025718 | |||
| 1672 | Ga0496108_0028262 | |||
| 1673 | Ga0496108_0062145 | |||
| 1674 | Ga0496109_0001723 | |||
| 1675 | Ga0496109_0008707 | |||
| 1676 | Ga0496109_0009518 | |||
| 1677 | Ga0496109_0109705 | |||
| 1678 | Ga0496109_0158599 | |||
| 1679 | Ga0496109_0208576 | |||
| 1680 | Ga0496110_0003174 | |||
| 1681 | Ga0496110_0034357 | |||
| 1682 | Ga0496110_0089604 | |||
| 1683 | Ga0496110_0092353 | |||
| 1684 | Ga0496110_0190977 | |||
| 1685 | Ga0496110_0200331 | |||
| 1686 | Ga0496111_0010537 | |||
| 1687 | Ga0496111_0047341 | |||
| 1688 | Ga0496111_0131890 | |||
| 1689 | Ga0496112_0000045 | |||
| 1690 | Ga0496112_0000590 | |||
| 1691 | Ga0496112_0046726 | |||
| 1692 | Ga0496112_0056721 | |||
| 1693 | Ga0496112_0078909 | |||
| 1694 | Ga0496112_0145890 | |||
| 1695 | Ga0496112_0188229 | |||
| 1696 | Ga0496112_0491158 | |||
| 1697 | Ga0496113_0005714 | |||
| 1698 | Ga0496113_0166662 | |||
| 1699 | Ga0496114_0008753 | |||
| 1700 | Ga0496114_0046976 | |||
| 1701 | Ga0496115_0005155 | |||
| 1702 | Ga0496115_0031770 | |||
| 1703 | Ga0496115_0066606 | |||
| 1704 | Ga0496115_0093493 | |||
| 1705 | Ga0496116_0001982 | |||
| 1706 | Ga0496117_0015594 | |||
| 1707 | Ga0496117_0052468 | |||
| 1708 | Ga0496118_0001758 | |||
| 1709 | Ga0496118_0064473 | |||
| 1710 | Ga0496118_0078658 | |||
| 1711 | Ga0496119_0085714 | |||
| 1712 | Ga0496119_0140962 | |||
| 1713 | Ga0496121_0000089 | |||
| 1714 | Ga0496121_0000379 | |||
| 1715 | Ga0496121_0008678 | |||
| 1716 | Ga0496121_0026666 | |||
| 1717 | Ga0496121_0053419 | |||
| 1718 | Ga0496121_0059468 | |||
| 1719 | Ga0496121_0070283 | |||
| 1720 | Ga0496121_0084635 | |||
| 1721 | Ga0496121_0120205 | |||
| 1722 | Ga0496122_0064048 | |||
| 1723 | Ga0496122_0134727 | |||
| 1724 | Ga0496123_0097852 | |||
| 1725 | Ga0496124_0004074 | |||
| 1726 | Ga0496124_0065983 | |||
| 1727 | Ga0496124_0171525 | |||
| 1728 | Ga0496124_0188071 | |||
| 1729 | Ga0496125_0000199 | |||
| 1730 | Ga0496125_0000964 | |||
| 1731 | Ga0496125_0005864 | |||
| 1732 | Ga0496125_0020565 | |||
| 1733 | Ga0496126_0003657 | |||
| 1734 | Ga0496126_0009808 | |||
| 1735 | Ga0496126_0015287 | |||
| 1736 | Ga0496126_0018065 | |||
| 1737 | Ga0496126_0027947 | |||
| 1738 | Ga0496126_0036593 | |||
| 1739 | Ga0496126_0049668 | |||
| 1740 | Ga0496126_0072571 | |||
| 1741 | Ga0496126_0142847 | |||
| 1742 | Ga0496126_0178468 | |||
| 1743 | Ga0496126_0226970 | |||
| 1744 | Ga0496126_0249487 | |||
| 1745 | Ga0496126_0305230 | |||
| 1746 | Ga0496126_0467470 | |||
| 1747 | Ga0495678_084968 | |||
| 1748 | Ga0495682_0042364 | |||
| 1749 | Ga0501031_0000712 | |||
| 1750 | Ga0501031_0007196 | |||
| 1751 | Ga0501032_0001162 | |||
| 1752 | Ga0501032_0012997 | |||
| 1753 | Ga0501032_0030027 | |||
| 1754 | Ga0501032_0239094 | |||
| 1755 | Ga0501033_0000163 | |||
| 1756 | Ga0501033_0003345 | |||
| 1757 | Ga0501033_0004893 | |||
| 1758 | Ga0501033_0040106 | |||
| 1759 | Ga0501033_0106298 | |||
| 1760 | Ga0501033_0259059 | |||
| 1761 | Ga0501034_0000202 | |||
| 1762 | Ga0501034_0232300 | |||
| 1763 | Ga0501034_0244680 | |||
| 1764 | Ga0501034_0274523 | |||
| 1765 | Ga0501034_0361547 | |||
| 1766 | Ga0501034_0364759 | |||
| 1767 | Ga0501034_0385783 | |||
| 1768 | Ga0501036_0000021 | |||
| 1769 | Ga0501036_0092713 | |||
| 1770 | Ga0501037_0001561 | |||
| 1771 | Ga0501037_0002687 | |||
| 1772 | Ga0501037_0158779 | |||
| 1773 | Ga0501038_0000226 | |||
| 1774 | Ga0501038_0008947 | |||
| 1775 | Ga0501038_0042787 | |||
| 1776 | Ga0501038_0050458 | |||
| 1777 | Ga0501038_0059839 | |||
| 1778 | Ga0501038_0294991 | |||
| 1779 | Ga0501038_0360701 | |||
| 1780 | Ga0501039_0001542 | |||
| 1781 | Ga0501039_0013937 | |||
| 1782 | Ga0501039_0071979 | |||
| 1783 | Ga0501039_0091639 | |||
| 1784 | Ga0501039_0209614 | |||
| 1785 | Ga0501042_0046481 | |||
| 1786 | Ga0501043_0000297 | |||
| 1787 | Ga0501043_0007506 | |||
| 1788 | Ga0501043_0157346 | |||
| 1789 | Ga0501043_0311569 | |||
| 1790 | Ga0501046_0000354 | |||
| 1791 | Ga0501046_0004244 | |||
| 1792 | Ga0501046_0055260 | |||
| 1793 | Ga0501046_0074042 | |||
| 1794 | Ga0501046_0097773 | |||
| 1795 | Ga0501047_0000232 | |||
| 1796 | Ga0501047_0024750 | |||
| 1797 | Ga0501047_0042605 | |||
| 1798 | Ga0501047_0077396 | |||
| 1799 | Ga0501047_0353183 | |||
| 1800 | Ga0501048_0000050 | |||
| 1801 | Ga0501048_0309750 | |||
| 1802 | Ga0501067_0033397 | |||
| 1803 | Ga0501068_0005647 | |||
| 1804 | Ga0501068_0099425 | |||
| 1805 | Ga0501068_0102216 | |||
| 1806 | Ga0501069_0013995 | |||
| 1807 | Ga0501069_0164635 | |||
| 1808 | Ga0501069_0257334 | |||
| 1809 | Ga0501070_0010465 | |||
| 1810 | Ga0501070_0012142 | |||
| 1811 | Ga0501070_0126992 | |||
| 1812 | Ga0501070_0146503 | |||
| 1813 | Ga0501070_0408153 | |||
| 1814 | Ga0501071_0007174 | |||
| 1815 | Ga0501072_0002675 | |||
| 1816 | Ga0501073_0000329 | |||
| 1817 | Ga0501073_0030779 | |||
| 1818 | Ga0501073_0078360 | |||
| 1819 | Ga0501074_0000092 | |||
| 1820 | Ga0501074_0058728 | |||
| 1821 | Ga0501076_0439530 | |||
| 1822 | Ga0501079_0003108 | |||
| 1823 | Ga0501080_0003432 | |||
| 1824 | Ga0501080_0010464 | |||
| 1825 | Ga0501081_0131732 | |||
| 1826 | Ga0501083_0001578 | |||
| 1827 | Ga0501035_0000120 | |||
| 1828 | Ga0501035_0006842 | |||
| 1829 | Ga0501035_0034371 | |||
| 1830 | Ga0501035_0052075 | |||
| 1831 | Ga0501035_0135730 | |||
| 1832 | Ga0501035_0207791 | |||
| 1833 | Ga0501035_0483978 | |||
| 1834 | Ga0501044_0000179 | |||
| 1835 | Ga0501044_0006711 | |||
| 1836 | Ga0501044_0011798 | |||
| 1837 | Ga0501044_0036929 | |||
| 1838 | Ga0501044_0067683 | |||
| 1839 | Ga0501044_0076403 | |||
| 1840 | Ga0501044_0341285 | |||
| 1841 | Ga0501045_0029730 | |||
| 1842 | Ga0501045_0070105 | |||
| 1843 | nmdc:mga00v17_30387_c1 | |||
| 1844 | nmdc:mga00v17_67999_c1 | |||
| 1845 | nmdc:mga0yw44_124113_c1 | |||
| 1846 | nmdc:mga0yw44_16058_c1 | |||
| 1847 | nmdc:mga0yw44_78142_c1 | |||
| 1848 | nmdc:mga0k408_122584_c1 | |||
| 1849 | nmdc:mga06z11_246834_c1 | |||
| 1850 | nmdc:mga06z11_5224_c1 | |||
| 1851 | nmdc:mga07m45_24176_c1 | |||
| 1852 | nmdc:mga07m45_30288_c1 | |||
| 1853 | nmdc:mga0qj67_228926_c1 | |||
| 1854 | nmdc:mga08y16_317611_c1 | |||
| 1855 | nmdc:mga0n895_396351_c1 | |||
| 1856 | nmdc:mga0a205_399935_c1 | |||
| 1857 | nmdc:mga0sz30_16504_c1 | |||
| 1858 | nmdc:mga0sz30_4339_c1 | |||
| 1859 | Ga0495601_0035464 | |||
| 1860 | Ga0495601_0079177 | |||
| 1861 | Ga0495601_0189622 | |||
| 1862 | Ga0495612_0056013 | |||
| 1863 | Ga0495655_0027424 | |||
| 1864 | Ga0495595_0018265 | |||
| 1865 | Ga0495595_0055957 | |||
| 1866 | Ga0495619_0006768 | |||
| 1867 | Ga0495619_0009872 | |||
| 1868 | Ga0495619_0199100 | |||
| 1869 | Ga0500643_014733 | |||
| 1870 | Ga0500646_0029959 | |||
| 1871 | Ga0500647_0034601 | |||
| 1872 | Ga0500647_0073858 | |||
| 1873 | Ga0500651_0066979 | |||
| 1874 | Ga0500651_0093884 | |||
| 1875 | Ga0500566_0000046 | |||
| 1876 | Ga0500566_0016032 | |||
| 1877 | Ga0500640_004013 | |||
| 1878 | Ga0500641_0001509 | |||
| 1879 | Ga0500648_120363 | |||
| 1880 | Ga0500556_0000003 | |||
| 1881 | Ga0500572_000872 | |||
| 1882 | Ga0500591_056543 | |||
| 1883 | Ga0500592_000851 | |||
| 1884 | Ga0500593_012453 | |||
| 1885 | Ga0500594_0015594 | |||
| 1886 | Ga0500595_000414 | |||
| 1887 | Ga0500595_003094 | |||
| 1888 | Ga0500595_012256 | |||
| 1889 | Ga0500595_019000 | |||
| 1890 | Ga0500595_064569 | |||
| 1891 | Ga0500607_104657 | |||
| 1892 | Ga0500608_003561 | |||
| 1893 | Ga0500608_012741 | |||
| 1894 | Ga0500618_009501 | |||
| 1895 | Ga0500642_0000104 | |||
| 1896 | Ga0500642_0043190 | |||
| 1897 | Ga0500642_0099933 | |||
| 1898 | Ga0500652_000138 | |||
| 1899 | Ga0500559_0000117 | |||
| 1900 | Ga0500559_0003688 | |||
| 1901 | Ga0500559_0060606 | |||
| 1902 | Ga0500568_0000838 | |||
| 1903 | Ga0500568_0006686 | |||
| 1904 | Ga0500568_0025219 | |||
| 1905 | Ga0500573_0005299 | |||
| 1906 | Ga0500577_0000338 | |||
| 1907 | Ga0500586_015772 | |||
| 1908 | Ga0500588_0005197 | |||
| 1909 | Ga0500603_000071 | |||
| 1910 | Ga0500603_000634 | |||
| 1911 | Ga0500603_044551 | |||
| 1912 | Ga0500616_0000028 | |||
| 1913 | Ga0500616_0000033 | |||
| 1914 | Ga0500616_0014363 | |||
| 1915 | Ga0500616_0022356 | |||
| 1916 | Ga0500622_0013876 | |||
| 1917 | Ga0500624_007945 | |||
| 1918 | Ga0500630_001587 | |||
| 1919 | Ga0500634_0044729 | |||
| 1920 | Ga0500639_000009 | |||
| 1921 | Ga0500636_0003823 | |||
| 1922 | Ga0500636_0112470 | |||
| 1923 | Ga0500637_0001208 | |||
| 1924 | Ga0500637_0010301 | |||
| 1925 | Ga0500637_0098075 | |||
| 1926 | Ga0500637_0154145 | |||
| 1927 | Ga0500649_016624 | |||
| 1928 | Ga0500570_086481 | |||
| 1929 | Ga0500611_043147 | |||
| 1930 | Ga0500596_000313 | |||
| 1931 | Ga0500596_002297 | |||
| 1932 | Ga0501084_0015100 | |||
| 1933 | Ga0501084_0216475 | |||
| 1934 | Ga0500661_000369 | |||
| 1935 | Ga0501082_0011284 | |||
| 1936 | Ga0501082_0098093 | |||
| 1937 | Ga0501082_0357985 | |||
| 1938 | Ga0466962_0051513 | |||
| 1939 | Ga0466962_0140066 | |||
| 1940 | 2509151023 | |||
| 1941 | 2511395122 | |||
| 1942 | 2513636971 | |||
| 1943 | 2513657288 | |||
| 1944 | 2513693045 | |||
| 1945 | 2513857759 | |||
| 1946 | 2513887298 | |||
| 1947 | 2513919296 | |||
| 1948 | 2517891012 | |||
| 1949 | 2524441223 | |||
| 1950 | 2524464982 | |||
| 1951 | 2524537543 | |||
| 1952 | 2599333212 | |||
| 1953 | 2603860393 | |||
| 1954 | 2644289337 | |||
| 1955 | 2671120071 | |||
| 1956 | 2723843319 | |||
| 1957 | 2745078684 | |||
| 1958 | 2793061135 | |||
| 1959 | 2793066368 | |||
| 1960 | 2793080687 | |||
| 1961 | 2819719732 | |||
| 1962 | 2824681515 | |||
| 1963 | 2837652360 | |||
| 1964 | 2842040940 | |||
| 1965 | 2842046115 | |||
| 1966 | 2842923519 | |||
| 1967 | 2844320268 | |||
| 1968 | 2847937590 | |||
| 1969 | 2857525340 | |||
| 1970 | 2874611793 | |||
| 1971 | 2874614408 | |||
| 1972 | 2874623800 | |||
| 1973 | 2876809606 | |||
| 1974 | 2879084086 | |||
| 1975 | 2879110888 | |||
| 1976 | 2881667144 | |||
| 1977 | 2885370256 | |||
| 1978 | 2885377333 | |||
| 1979 | 2889037638 | |||
| 1980 | 2893066285 | |||
| 1981 | 2903731548 | |||
| 1982 | 2903749655 | |||
| 1983 | 2904674029 | |||
| 1984 | 2904694462 | |||
| 1985 | 2904700543 | |||
| 1986 | 2906608343 | |||
| 1987 | 2906616211 | |||
| 1988 | 2906636954 | |||
| 1989 | 2906664452 | |||
| 1990 | 2908741279 | |||
| 1991 | 2908763402 | |||
| 1992 | 2919074969 | |||
| 1993 | 2922361597 | |||
| 1994 | 2922387177 | |||
| 1995 | 2922393704 | |||
| 1996 | 2922431813 | |||
| 1997 | 2932799741 | |||
| 1998 | 2932808672 | |||
| 1999 | 2935635345 | |||
| 2000 | 2935885597 | |||
| 2001 | 2941512149 | |||
| 2002 | 2941519851 | |||
| 2003 | 2941527862 | |||
| 2004 | 2941531474 | |||
| 2005 | 3005481754 | |||
| 2006 | 3005508095 | |||
| 2007 | 3005723418 | |||
| 2008 | 8006939116 | |||
| 2009 | 8006972349 | |||
| 2010 | 8006978773 | |||
| 2011 | 8006985032 | |||
| 2012 | 8006999746 | |||
| 2013 | 8019559931 | |||
| 2014 | 8019570034 | |||
| 2015 | 8054560946 | |||
| 2016 | 8056678772 | |||
| 2017 | 8056687845 | |||
| 2018 | 8056690507 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ji5-assembly1.cif.gz_A | crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum | 0.9595 | 2 | 306 |
| 5ji5-assembly1.cif.gz_A | crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum | 0.9503 | 2 | 306 |
| 8szt-assembly1.cif.gz_A | structure of kdac1 from acinetobacter baumannii | 0.9487 | 2 | 309 |
| 8szt-assembly1.cif.gz_A | structure of kdac1 from acinetobacter baumannii | 0.9428 | 2 | 309 |
| 5g17-assembly1.cif.gz_B | bordetella alcaligenes hdah (t101a) bound to 9,9,9-trifluoro-8,8- dihydroxy-n-phenylnonanamide. | 0.9403 | 1 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ji5A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9595 | 2 | 306 | 3.40.800.20 |
| af_A0A1D6N7T5_1_214_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9548 | 132 | 308 | 3.40.800.20 |
| 5ji5A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9503 | 2 | 306 | 3.40.800.20 |
| 5g1cA00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9387 | 2 | 309 | 3.40.800.20 |
| 5g1cA00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9329 | 2 | 309 | 3.40.800.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353CXS4-F1-model_v4 | Deacetylase | 0.9878 | 203 | 309 |
GO:0004407
GO:0040029 |
| AF-A0A3B0RFC3-F1-model_v4 | Histone deacetylase domain-containing protein | 0.9837 | 203 | 309 |
GO:0004407
GO:0040029 |
| AF-A0A2N3E2Q3-F1-model_v4 | Acetoin utilization protein | 0.9833 | 1 | 116 |
GO:0004407
GO:0040029 |
| AF-A0A357V0E0-F1-model_v4 | Acetoin utilization protein | 0.9823 | 1 | 119 |
GO:0004407
GO:0040029 |
| AF-A0A7V2RVP4-F1-model_v4 | Histone deacetylase family protein | 0.981 | 167 | 306 |
GO:0004407
GO:0040029 |