F488085
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1009 | 424 | 1002 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10037444|Ga0070658_100374445 |
| Length | 96 |
| Sequence | MAHKKSGGSSRNGRDSAGQRLGVKKFGGEAVLAGNILVRQRGTKFWPGDNVGLGRDHTLFATATGAVKFITKRDDRTYVNVVPATAAADQMNAKTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 2 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 3 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 4 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 5 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 6 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 7 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 8 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 231 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 249 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 382 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 383 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 390 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 391 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 392 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 398 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 399 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.65 |
| Metatranscriptomes | 4.66 |
| Isolates | 0.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.55 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 85.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1012637 | 3300000531 | Bacteria | 529 |
| 2 | JGI24746J21847_1000324 | 3300001977 | Bacteria | 6853 |
| 3 | rootH1_10216558 | 3300003323 | Bacteria | 1111 |
| 4 | Ga0065715_10354226 | 3300005293 | Bacteria | 946 |
| 5 | Ga0070658_10037444 | 3300005327 | Bacteria | 3911 |
| 6 | Ga0070658_10038677 | 3300005327 | Bacteria | 3847 |
| 7 | Ga0070658_10648962 | 3300005327 | Bacteria | 916 |
| 8 | Ga0070658_10875618 | 3300005327 | Bacteria | 781 |
| 9 | Ga0070658_11153827 | 3300005327 | Bacteria | 674 |
| 10 | Ga0070683_100016420 | 3300005329 | Bacteria | 6531 |
| 11 | Ga0070683_100063549 | 3300005329 | Bacteria | 3434 |
| 12 | Ga0070683_100166154 | 3300005329 | Bacteria | 2094 |
| 13 | Ga0070683_100616227 | 3300005329 | Bacteria | 1039 |
| 14 | Ga0070683_100710425 | 3300005329 | Bacteria | 963 |
| 15 | Ga0070683_100714760 | 3300005329 | Bacteria | 960 |
| 16 | Ga0070683_100932775 | 3300005329 | Bacteria | 833 |
| 17 | Ga0070670_100047898 | 3300005331 | Bacteria | 3679 |
| 18 | Ga0070670_100331041 | 3300005331 | Bacteria | 1336 |
| 19 | Ga0070670_100730249 | 3300005331 | Bacteria | 892 |
| 20 | Ga0068869_100184472 | 3300005334 | Bacteria | 1637 |
| 21 | Ga0068869_100416965 | 3300005334 | Bacteria | 1107 |
| 22 | Ga0070666_10011180 | 3300005335 | Bacteria | 5626 |
| 23 | Ga0070666_10293043 | 3300005335 | Bacteria | 1158 |
| 24 | Ga0070666_10299046 | 3300005335 | Bacteria | 1146 |
| 25 | Ga0070680_100012704 | 3300005336 | Bacteria | 6545 |
| 26 | Ga0070680_100029823 | 3300005336 | Bacteria | 4379 |
| 27 | Ga0070682_101453512 | 3300005337 | Bacteria | 588 |
| 28 | Ga0070682_101523012 | 3300005337 | Bacteria | 576 |
| 29 | Ga0068868_100002347 | 3300005338 | Bacteria | 13098 |
| 30 | Ga0068868_100542997 | 3300005338 | Bacteria | 1023 |
| 31 | Ga0070660_100329886 | 3300005339 | Bacteria | 1254 |
| 32 | Ga0070660_100349902 | 3300005339 | Bacteria | 1217 |
| 33 | Ga0070660_101159559 | 3300005339 | Bacteria | 655 |
| 34 | Ga0070689_100433727 | 3300005340 | Bacteria | 1116 |
| 35 | Ga0070689_101892303 | 3300005340 | Bacteria | 545 |
| 36 | Ga0070691_10005831 | 3300005341 | Bacteria | 5621 |
| 37 | Ga0070691_10597617 | 3300005341 | Bacteria | 651 |
| 38 | Ga0070661_100284810 | 3300005344 | Bacteria | 1283 |
| 39 | Ga0070661_100713913 | 3300005344 | Bacteria | 818 |
| 40 | Ga0070661_100721965 | 3300005344 | Bacteria | 813 |
| 41 | Ga0070661_101234163 | 3300005344 | Bacteria | 626 |
| 42 | Ga0070668_100000042 | 3300005347 | Bacteria | 78694 |
| 43 | Ga0070668_100003919 | 3300005347 | Bacteria | 10993 |
| 44 | Ga0070668_100011777 | 3300005347 | Bacteria | 6513 |
| 45 | Ga0070668_100022321 | 3300005347 | Bacteria | 4783 |
| 46 | Ga0070668_101902611 | 3300005347 | Bacteria | 548 |
| 47 | Ga0070669_100057999 | 3300005353 | Bacteria | 2841 |
| 48 | Ga0070669_100275924 | 3300005353 | Bacteria | 1346 |
| 49 | Ga0070675_100000028 | 3300005354 | Bacteria | 103914 |
| 50 | Ga0070675_100340652 | 3300005354 | Bacteria | 1328 |
| 51 | Ga0070671_100002736 | 3300005355 | Bacteria | 13694 |
| 52 | Ga0070671_100613538 | 3300005355 | Bacteria | 940 |
| 53 | Ga0070671_100912813 | 3300005355 | Bacteria | 767 |
| 54 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 55 | Ga0070673_100088435 | 3300005364 | Bacteria | 2527 |
| 56 | Ga0070673_100227069 | 3300005364 | Bacteria | 1618 |
| 57 | Ga0070673_100787119 | 3300005364 | Bacteria | 877 |
| 58 | Ga0070673_101401080 | 3300005364 | Bacteria | 658 |
| 59 | Ga0070673_101684586 | 3300005364 | Bacteria | 600 |
| 60 | Ga0070688_100454848 | 3300005365 | Bacteria | 958 |
| 61 | Ga0070659_100009501 | 3300005366 | Bacteria | 7145 |
| 62 | Ga0070659_100594061 | 3300005366 | Bacteria | 951 |
| 63 | Ga0070659_100976467 | 3300005366 | Bacteria | 743 |
| 64 | Ga0070667_100000508 | 3300005367 | Bacteria | 39312 |
| 65 | Ga0070667_100008242 | 3300005367 | Bacteria | 8637 |
| 66 | Ga0070667_100016906 | 3300005367 | Bacteria | 6037 |
| 67 | Ga0070667_100030728 | 3300005367 | Bacteria | 4479 |
| 68 | Ga0070667_100325131 | 3300005367 | Bacteria | 1388 |
| 69 | Ga0070667_100728170 | 3300005367 | Bacteria | 919 |
| 70 | Ga0070713_100000058 | 3300005436 | Bacteria | 70009 |
| 71 | Ga0070705_101290225 | 3300005440 | Bacteria | 605 |
| 72 | Ga0070700_100071247 | 3300005441 | Bacteria | 2219 |
| 73 | Ga0070700_100076081 | 3300005441 | Bacteria | 2155 |
| 74 | Ga0070663_100625906 | 3300005455 | Bacteria | 908 |
| 75 | Ga0070663_100886956 | 3300005455 | Bacteria | 770 |
| 76 | Ga0070663_101919697 | 3300005455 | Bacteria | 532 |
| 77 | Ga0070678_100008208 | 3300005456 | Bacteria | 6243 |
| 78 | Ga0070678_100951193 | 3300005456 | Bacteria | 787 |
| 79 | Ga0070678_101403683 | 3300005456 | Bacteria | 652 |
| 80 | Ga0070678_101783160 | 3300005456 | Bacteria | 580 |
| 81 | Ga0070662_100023925 | 3300005457 | Bacteria | 4203 |
| 82 | Ga0070681_10002805 | 3300005458 | Bacteria | 16089 |
| 83 | Ga0070681_10013326 | 3300005458 | Bacteria | 8171 |
| 84 | Ga0070681_10115729 | 3300005458 | Bacteria | 2619 |
| 85 | Ga0070681_10297309 | 3300005458 | Bacteria | 1524 |
| 86 | Ga0068867_100697246 | 3300005459 | Bacteria | 896 |
| 87 | Ga0068867_100929217 | 3300005459 | Bacteria | 784 |
| 88 | Ga0070685_10158172 | 3300005466 | Bacteria | 1442 |
| 89 | Ga0070685_10215289 | 3300005466 | Bacteria | 1256 |
| 90 | Ga0070706_100245176 | 3300005467 | Bacteria | 1673 |
| 91 | Ga0070706_100844196 | 3300005467 | Bacteria | 847 |
| 92 | Ga0070679_100000461 | 3300005530 | Bacteria | 34593 |
| 93 | Ga0070679_100031245 | 3300005530 | Bacteria | 5260 |
| 94 | Ga0070679_101377108 | 3300005530 | Bacteria | 651 |
| 95 | Ga0070684_100009565 | 3300005535 | Bacteria | 7637 |
| 96 | Ga0070684_100017638 | 3300005535 | Bacteria | 5865 |
| 97 | Ga0070684_100890659 | 3300005535 | Bacteria | 834 |
| 98 | Ga0070684_101263314 | 3300005535 | Bacteria | 695 |
| 99 | Ga0068853_100037066 | 3300005539 | Bacteria | 4147 |
| 100 | Ga0068853_100048939 | 3300005539 | Bacteria | 3631 |
| 101 | Ga0068853_100171967 | 3300005539 | Bacteria | 1960 |
| 102 | Ga0068853_101301087 | 3300005539 | Bacteria | 703 |
| 103 | Ga0068853_101872118 | 3300005539 | Bacteria | 582 |
| 104 | Ga0070672_101136985 | 3300005543 | Bacteria | 695 |
| 105 | Ga0070686_100219355 | 3300005544 | Bacteria | 1373 |
| 106 | Ga0070686_100681904 | 3300005544 | Bacteria | 818 |
| 107 | Ga0070695_100862319 | 3300005545 | Bacteria | 729 |
| 108 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 109 | Ga0070665_100000418 | 3300005548 | Bacteria | 62048 |
| 110 | Ga0070665_100000691 | 3300005548 | Bacteria | 44984 |
| 111 | Ga0070665_100001884 | 3300005548 | Bacteria | 23770 |
| 112 | Ga0070665_100004723 | 3300005548 | Bacteria | 14190 |
| 113 | Ga0070665_100011815 | 3300005548 | Bacteria | 8819 |
| 114 | Ga0070665_100017881 | 3300005548 | Bacteria | 7118 |
| 115 | Ga0070665_100018730 | 3300005548 | Bacteria | 6941 |
| 116 | Ga0070665_100038239 | 3300005548 | Bacteria | 4824 |
| 117 | Ga0068855_100005017 | 3300005563 | Bacteria | 16158 |
| 118 | Ga0068855_100023693 | 3300005563 | Bacteria | 7350 |
| 119 | Ga0068855_100115879 | 3300005563 | Bacteria | 3071 |
| 120 | Ga0068855_100508201 | 3300005563 | Bacteria | 1309 |
| 121 | Ga0068855_100897910 | 3300005563 | Bacteria | 936 |
| 122 | Ga0068855_101163494 | 3300005563 | Bacteria | 804 |
| 123 | Ga0068855_101717364 | 3300005563 | Bacteria | 640 |
| 124 | Ga0068855_102601919 | 3300005563 | Bacteria | 502 |
| 125 | Ga0070664_100263642 | 3300005564 | Bacteria | 1551 |
| 126 | Ga0070664_100359490 | 3300005564 | Bacteria | 1326 |
| 127 | Ga0068857_100030398 | 3300005577 | Bacteria | 4770 |
| 128 | Ga0068857_100052533 | 3300005577 | Bacteria | 3616 |
| 129 | Ga0068857_100540747 | 3300005577 | Bacteria | 1097 |
| 130 | Ga0068857_101955562 | 3300005577 | Bacteria | 575 |
| 131 | Ga0068854_100131599 | 3300005578 | Bacteria | 1911 |
| 132 | Ga0068854_100241760 | 3300005578 | Bacteria | 1438 |
| 133 | Ga0068854_100333838 | 3300005578 | Bacteria | 1236 |
| 134 | Ga0068856_100006911 | 3300005614 | Bacteria | 11099 |
| 135 | Ga0068856_100187737 | 3300005614 | Bacteria | 2081 |
| 136 | Ga0068856_100192860 | 3300005614 | Bacteria | 2051 |
| 137 | Ga0068856_100423337 | 3300005614 | Bacteria | 1351 |
| 138 | Ga0068856_101090815 | 3300005614 | Bacteria | 816 |
| 139 | Ga0068856_102184620 | 3300005614 | Bacteria | 563 |
| 140 | Ga0068856_102278804 | 3300005614 | Bacteria | 550 |
| 141 | Ga0068856_102327512 | 3300005614 | Bacteria | 544 |
| 142 | Ga0068856_102409057 | 3300005614 | Bacteria | 534 |
| 143 | Ga0068852_100000539 | 3300005616 | Bacteria | 24879 |
| 144 | Ga0068852_100282530 | 3300005616 | Bacteria | 1600 |
| 145 | Ga0068852_101654697 | 3300005616 | Bacteria | 662 |
| 146 | Ga0068852_101834273 | 3300005616 | Bacteria | 629 |
| 147 | Ga0068852_101935920 | 3300005616 | Bacteria | 612 |
| 148 | Ga0068859_100001582 | 3300005617 | Bacteria | 23209 |
| 149 | Ga0068859_100159602 | 3300005617 | Bacteria | 2334 |
| 150 | Ga0068859_100279829 | 3300005617 | Bacteria | 1761 |
| 151 | Ga0068859_100500762 | 3300005617 | Bacteria | 1310 |
| 152 | Ga0068859_101368042 | 3300005617 | Bacteria | 781 |
| 153 | Ga0068864_100000757 | 3300005618 | Bacteria | 27175 |
| 154 | Ga0068864_100135302 | 3300005618 | Bacteria | 2218 |
| 155 | Ga0068864_100311255 | 3300005618 | Bacteria | 1476 |
| 156 | Ga0068864_100323202 | 3300005618 | Bacteria | 1449 |
| 157 | Ga0068864_102134671 | 3300005618 | Bacteria | 567 |
| 158 | Ga0068866_10000036 | 3300005718 | Bacteria | 51111 |
| 159 | Ga0068861_101135889 | 3300005719 | Bacteria | 752 |
| 160 | Ga0068861_101607137 | 3300005719 | Bacteria | 640 |
| 161 | Ga0068861_101610348 | 3300005719 | Bacteria | 640 |
| 162 | Ga0068870_10119561 | 3300005840 | Bacteria | 1516 |
| 163 | Ga0068870_10790524 | 3300005840 | Bacteria | 662 |
| 164 | Ga0068863_100000107 | 3300005841 | Bacteria | 88879 |
| 165 | Ga0068863_100000119 | 3300005841 | Bacteria | 82539 |
| 166 | Ga0068863_100004097 | 3300005841 | Bacteria | 14400 |
| 167 | Ga0068863_100213206 | 3300005841 | Bacteria | 1859 |
| 168 | Ga0068863_100309374 | 3300005841 | Bacteria | 1533 |
| 169 | Ga0068863_101305412 | 3300005841 | Bacteria | 732 |
| 170 | Ga0068858_100000069 | 3300005842 | Bacteria | 105617 |
| 171 | Ga0068858_100000526 | 3300005842 | Bacteria | 40242 |
| 172 | Ga0068858_100006690 | 3300005842 | Bacteria | 11215 |
| 173 | Ga0068858_100133716 | 3300005842 | Bacteria | 2326 |
| 174 | Ga0068858_101112043 | 3300005842 | Bacteria | 776 |
| 175 | Ga0068860_100000133 | 3300005843 | Bacteria | 120382 |
| 176 | Ga0068860_100000212 | 3300005843 | Bacteria | 91248 |
| 177 | Ga0068860_100124911 | 3300005843 | Bacteria | 2466 |
| 178 | Ga0068860_100292278 | 3300005843 | Bacteria | 1595 |
| 179 | Ga0068860_100775126 | 3300005843 | Bacteria | 972 |
| 180 | Ga0068862_100000619 | 3300005844 | Bacteria | 36984 |
| 181 | Ga0068862_100012644 | 3300005844 | Bacteria | 6986 |
| 182 | Ga0068862_100042579 | 3300005844 | Bacteria | 3868 |
| 183 | Ga0068862_100314277 | 3300005844 | Bacteria | 1444 |
| 184 | Ga0068862_100435154 | 3300005844 | Bacteria | 1234 |
| 185 | Ga0068862_100569443 | 3300005844 | Bacteria | 1084 |
| 186 | Ga0068862_100934228 | 3300005844 | Bacteria | 854 |
| 187 | Ga0068862_101546090 | 3300005844 | Bacteria | 670 |
| 188 | Ga0081455_10016739 | 3300005937 | Bacteria | 7061 |
| 189 | Ga0081455_10634994 | 3300005937 | Bacteria | 690 |
| 190 | Ga0081539_10071037 | 3300005985 | Bacteria | 1866 |
| 191 | Ga0081539_10208170 | 3300005985 | Bacteria | 898 |
| 192 | Ga0070717_11024276 | 3300006028 | Bacteria | 752 |
| 193 | Ga0075368_10002212 | 3300006042 | Bacteria | 6312 |
| 194 | Ga0075363_100108203 | 3300006048 | Bacteria | 1543 |
| 195 | Ga0075364_10008150 | 3300006051 | Bacteria | 6252 |
| 196 | Ga0070716_100014183 | 3300006173 | Bacteria | 4078 |
| 197 | Ga0070716_100352737 | 3300006173 | Bacteria | 1042 |
| 198 | Ga0070712_100002000 | 3300006175 | Bacteria | 12482 |
| 199 | Ga0075367_10008101 | 3300006178 | Bacteria | 5425 |
| 200 | Ga0075366_10133687 | 3300006195 | Bacteria | 1497 |
| 201 | Ga0097621_101532608 | 3300006237 | Unclassified | 633 |
| 202 | Ga0075370_10108116 | 3300006353 | Bacteria | 1613 |
| 203 | Ga0068871_100486484 | 3300006358 | Bacteria | 1111 |
| 204 | Ga0075430_101679919 | 3300006846 | Bacteria | 521 |
| 205 | Ga0068865_100001766 | 3300006881 | Bacteria | 12693 |
| 206 | Ga0068865_100295944 | 3300006881 | Bacteria | 1293 |
| 207 | Ga0068865_100356363 | 3300006881 | Bacteria | 1187 |
| 208 | Ga0068865_101464000 | 3300006881 | Bacteria | 611 |
| 209 | Ga0097620_100001582 | 3300006931 | Bacteria | 23209 |
| 210 | Ga0097620_100159599 | 3300006931 | Bacteria | 2334 |
| 211 | Ga0097620_100279830 | 3300006931 | Bacteria | 1761 |
| 212 | Ga0097620_100500837 | 3300006931 | Bacteria | 1310 |
| 213 | Ga0097620_101368029 | 3300006931 | Bacteria | 781 |
| 214 | Ga0105251_10092099 | 3300009011 | Bacteria | 1392 |
| 215 | Ga0105240_10000679 | 3300009093 | Bacteria | 62613 |
| 216 | Ga0105240_10003732 | 3300009093 | Bacteria | 23537 |
| 217 | Ga0105240_10061517 | 3300009093 | Bacteria | 4679 |
| 218 | Ga0105240_10228697 | 3300009093 | Bacteria | 2163 |
| 219 | Ga0105240_10286498 | 3300009093 | Bacteria | 1890 |
| 220 | Ga0105240_10529912 | 3300009093 | Bacteria | 1306 |
| 221 | Ga0105240_11258726 | 3300009093 | Bacteria | 782 |
| 222 | Ga0105240_12322411 | 3300009093 | Bacteria | 555 |
| 223 | Ga0105245_10000310 | 3300009098 | Bacteria | 46567 |
| 224 | Ga0105245_10766221 | 3300009098 | Bacteria | 1001 |
| 225 | Ga0105245_11223792 | 3300009098 | Bacteria | 799 |
| 226 | Ga0105245_11876879 | 3300009098 | Bacteria | 652 |
| 227 | Ga0105245_12491889 | 3300009098 | Bacteria | 571 |
| 228 | Ga0105247_10032337 | 3300009101 | Bacteria | 3179 |
| 229 | Ga0105247_10212029 | 3300009101 | Bacteria | 1307 |
| 230 | Ga0105247_10404660 | 3300009101 | Bacteria | 973 |
| 231 | Ga0105247_11218550 | 3300009101 | Bacteria | 600 |
| 232 | Ga0105243_10069020 | 3300009148 | Bacteria | 2850 |
| 233 | Ga0105243_11653481 | 3300009148 | Bacteria | 668 |
| 234 | Ga0105243_11788017 | 3300009148 | Bacteria | 645 |
| 235 | Ga0105243_12111823 | 3300009148 | Bacteria | 599 |
| 236 | Ga0105241_10423518 | 3300009174 | Bacteria | 1172 |
| 237 | Ga0105241_10796834 | 3300009174 | Bacteria | 870 |
| 238 | Ga0105242_10256474 | 3300009176 | Bacteria | 1578 |
| 239 | Ga0105242_10839100 | 3300009176 | Bacteria | 913 |
| 240 | Ga0105242_11228048 | 3300009176 | Bacteria | 770 |
| 241 | Ga0105242_12039340 | 3300009176 | Bacteria | 617 |
| 242 | Ga0105242_12105949 | 3300009176 | Bacteria | 608 |
| 243 | Ga0105248_10000175 | 3300009177 | Bacteria | 74795 |
| 244 | Ga0105248_10004488 | 3300009177 | Bacteria | 15447 |
| 245 | Ga0105248_10005017 | 3300009177 | Bacteria | 14619 |
| 246 | Ga0105248_10063658 | 3300009177 | Bacteria | 4140 |
| 247 | Ga0105248_10523874 | 3300009177 | Bacteria | 1337 |
| 248 | Ga0105248_10689378 | 3300009177 | Bacteria | 1152 |
| 249 | Ga0105248_11078655 | 3300009177 | Unclassified | 908 |
| 250 | Ga0105248_11654977 | 3300009177 | Bacteria | 725 |
| 251 | Ga0105248_12515633 | 3300009177 | Bacteria | 587 |
| 252 | Ga0105237_10555144 | 3300009545 | Bacteria | 1155 |
| 253 | Ga0105237_10561436 | 3300009545 | Bacteria | 1148 |
| 254 | Ga0105237_11270995 | 3300009545 | Bacteria | 742 |
| 255 | Ga0105237_11503065 | 3300009545 | Bacteria | 680 |
| 256 | Ga0105238_10089409 | 3300009551 | Bacteria | 3066 |
| 257 | Ga0105238_10105565 | 3300009551 | Bacteria | 2799 |
| 258 | Ga0105238_10144704 | 3300009551 | Bacteria | 2353 |
| 259 | Ga0105238_10187590 | 3300009551 | Bacteria | 2044 |
| 260 | Ga0105238_10316772 | 3300009551 | Bacteria | 1545 |
| 261 | Ga0105238_10327059 | 3300009551 | Bacteria | 1519 |
| 262 | Ga0105238_10333177 | 3300009551 | Bacteria | 1505 |
| 263 | Ga0105238_10345064 | 3300009551 | Bacteria | 1477 |
| 264 | Ga0105238_11130117 | 3300009551 | Bacteria | 807 |
| 265 | Ga0105249_10009609 | 3300009553 | Bacteria | 8475 |
| 266 | Ga0105249_10017801 | 3300009553 | Bacteria | 6313 |
| 267 | Ga0105249_10397947 | 3300009553 | Bacteria | 1407 |
| 268 | Ga0105249_10414920 | 3300009553 | Bacteria | 1379 |
| 269 | Ga0105249_10876021 | 3300009553 | Bacteria | 964 |
| 270 | Ga0105249_11764683 | 3300009553 | Bacteria | 691 |
| 271 | Ga0105249_13278100 | 3300009553 | Bacteria | 521 |
| 272 | Ga0105239_10221492 | 3300010375 | Bacteria | 2122 |
| 273 | Ga0105239_10770120 | 3300010375 | Bacteria | 1102 |
| 274 | Ga0105239_10820725 | 3300010375 | Bacteria | 1066 |
| 275 | Ga0105239_11806958 | 3300010375 | Bacteria | 708 |
| 276 | Ga0105239_12463115 | 3300010375 | Bacteria | 606 |
| 277 | Ga0157320_1016578 | 3300012481 | Bacteria | 634 |
| 278 | Ga0157373_10002536 | 3300013100 | Bacteria | 13905 |
| 279 | Ga0157373_10827430 | 3300013100 | Bacteria | 684 |
| 280 | Ga0157370_10003852 | 3300013104 | Bacteria | 17496 |
| 281 | Ga0157370_10109059 | 3300013104 | Bacteria | 2588 |
| 282 | Ga0157370_10301379 | 3300013104 | Bacteria | 1479 |
| 283 | Ga0157370_10334409 | 3300013104 | Bacteria | 1396 |
| 284 | Ga0157370_10440303 | 3300013104 | Bacteria | 1198 |
| 285 | Ga0157370_10479742 | 3300013104 | Bacteria | 1143 |
| 286 | Ga0157370_11102487 | 3300013104 | Bacteria | 717 |
| 287 | Ga0157370_11546511 | 3300013104 | Bacteria | 596 |
| 288 | Ga0157370_11990422 | 3300013104 | Bacteria | 521 |
| 289 | Ga0157369_10887202 | 3300013105 | Bacteria | 915 |
| 290 | Ga0157374_10004652 | 3300013296 | Bacteria | 11508 |
| 291 | Ga0157374_10098882 | 3300013296 | Bacteria | 2794 |
| 292 | Ga0157374_12378826 | 3300013296 | Bacteria | 557 |
| 293 | Ga0157378_10005783 | 3300013297 | Bacteria | 10838 |
| 294 | Ga0157378_11220927 | 3300013297 | Bacteria | 792 |
| 295 | Ga0163162_10043181 | 3300013306 | Bacteria | 4514 |
| 296 | Ga0163162_10059611 | 3300013306 | Bacteria | 3849 |
| 297 | Ga0163162_10189403 | 3300013306 | Bacteria | 2184 |
| 298 | Ga0163162_11358862 | 3300013306 | Bacteria | 808 |
| 299 | Ga0163162_12398190 | 3300013306 | Bacteria | 606 |
| 300 | Ga0163162_12415827 | 3300013306 | Bacteria | 604 |
| 301 | Ga0157372_10093929 | 3300013307 | Bacteria | 3414 |
| 302 | Ga0157372_13047628 | 3300013307 | Bacteria | 535 |
| 303 | Ga0157375_10000137 | 3300013308 | Bacteria | 72720 |
| 304 | Ga0157375_10234488 | 3300013308 | Bacteria | 1994 |
| 305 | Ga0157375_10329398 | 3300013308 | Bacteria | 1692 |
| 306 | Ga0157375_10618834 | 3300013308 | Bacteria | 1241 |
| 307 | Ga0157375_11013469 | 3300013308 | Bacteria | 970 |
| 308 | Ga0157375_11762204 | 3300013308 | Bacteria | 734 |
| 309 | Ga0163163_10000780 | 3300014325 | Bacteria | 27061 |
| 310 | Ga0163163_10372208 | 3300014325 | Bacteria | 1486 |
| 311 | Ga0163163_10448826 | 3300014325 | Bacteria | 1350 |
| 312 | Ga0163163_10468208 | 3300014325 | Bacteria | 1321 |
| 313 | Ga0163163_10641795 | 3300014325 | Bacteria | 1125 |
| 314 | Ga0163163_10897577 | 3300014325 | Bacteria | 950 |
| 315 | Ga0163163_10932181 | 3300014325 | Bacteria | 932 |
| 316 | Ga0157380_10007574 | 3300014326 | Bacteria | 7714 |
| 317 | Ga0157380_11825896 | 3300014326 | Bacteria | 667 |
| 318 | Ga0157380_11932763 | 3300014326 | Bacteria | 651 |
| 319 | Ga0182008_10955409 | 3300014497 | Bacteria | 508 |
| 320 | Ga0157377_10349866 | 3300014745 | Bacteria | 991 |
| 321 | Ga0157379_10000947 | 3300014968 | Bacteria | 23530 |
| 322 | Ga0157379_10003056 | 3300014968 | Bacteria | 14141 |
| 323 | Ga0157379_10019721 | 3300014968 | Bacteria | 5958 |
| 324 | Ga0157379_10086911 | 3300014968 | Bacteria | 2803 |
| 325 | Ga0157379_10486049 | 3300014968 | Bacteria | 1143 |
| 326 | Ga0157379_11076522 | 3300014968 | Bacteria | 769 |
| 327 | Ga0157376_10147350 | 3300014969 | Bacteria | 2119 |
| 328 | Ga0157376_10264369 | 3300014969 | Bacteria | 1613 |
| 329 | Ga0157376_12943750 | 3300014969 | Bacteria | 515 |
| 330 | Ga0163161_10000027 | 3300017792 | Bacteria | 197774 |
| 331 | Ga0163161_10126978 | 3300017792 | Bacteria | 1921 |
| 332 | Ga0163161_10285686 | 3300017792 | Bacteria | 1295 |
| 333 | Ga0163161_10918988 | 3300017792 | Bacteria | 742 |
| 334 | Ga0206356_11355552 | 3300020070 | Bacteria | 2762 |
| 335 | Ga0206352_10973552 | 3300020078 | Bacteria | 734 |
| 336 | Ga0213873_10125109 | 3300021358 | Bacteria | 758 |
| 337 | Ga0213874_10129590 | 3300021377 | Bacteria | 865 |
| 338 | Ga0213874_10180478 | 3300021377 | Bacteria | 751 |
| 339 | Ga0213874_10349288 | 3300021377 | Bacteria | 566 |
| 340 | Ga0213876_10000568 | 3300021384 | Bacteria | 27555 |
| 341 | Ga0213876_10032943 | 3300021384 | Bacteria | 2732 |
| 342 | Ga0213876_10291320 | 3300021384 | Bacteria | 867 |
| 343 | Ga0213876_10641129 | 3300021384 | Bacteria | 565 |
| 344 | Ga0213875_10367830 | 3300021388 | Bacteria | 684 |
| 345 | Ga0213871_10005996 | 3300021441 | Bacteria | 2546 |
| 346 | Ga0213871_10012129 | 3300021441 | Bacteria | 1994 |
| 347 | Ga0224712_10018482 | 3300022467 | Bacteria | 2331 |
| 348 | Ga0224712_10188353 | 3300022467 | Bacteria | 933 |
| 349 | Ga0209148_1006910 | 3300025254 | Bacteria | 2409 |
| 350 | Ga0209148_1018139 | 3300025254 | Bacteria | 1186 |
| 351 | Ga0209455_1054995 | 3300025272 | Bacteria | 541 |
| 352 | Ga0207697_10275067 | 3300025315 | Bacteria | 746 |
| 353 | Ga0207656_10447104 | 3300025321 | Bacteria | 653 |
| 354 | Ga0207642_10000060 | 3300025899 | Bacteria | 32182 |
| 355 | Ga0207710_10402607 | 3300025900 | Bacteria | 702 |
| 356 | Ga0207710_10506290 | 3300025900 | Bacteria | 627 |
| 357 | Ga0207688_10452551 | 3300025901 | Bacteria | 800 |
| 358 | Ga0207680_10004412 | 3300025903 | Bacteria | 6670 |
| 359 | Ga0207680_10266568 | 3300025903 | Bacteria | 1187 |
| 360 | Ga0207680_10859693 | 3300025903 | Bacteria | 650 |
| 361 | Ga0207680_11048096 | 3300025903 | Bacteria | 584 |
| 362 | Ga0207645_10077821 | 3300025907 | Bacteria | 2125 |
| 363 | Ga0207643_10659266 | 3300025908 | Bacteria | 675 |
| 364 | Ga0207705_10005663 | 3300025909 | Bacteria | 9325 |
| 365 | Ga0207705_10031767 | 3300025909 | Bacteria | 3771 |
| 366 | Ga0207705_10321194 | 3300025909 | Bacteria | 1190 |
| 367 | Ga0207705_10418515 | 3300025909 | Bacteria | 1037 |
| 368 | Ga0207654_10542261 | 3300025911 | Bacteria | 825 |
| 369 | Ga0207654_11300381 | 3300025911 | Bacteria | 530 |
| 370 | Ga0207707_10007406 | 3300025912 | Bacteria | 9560 |
| 371 | Ga0207707_10010835 | 3300025912 | Bacteria | 7922 |
| 372 | Ga0207707_10072729 | 3300025912 | Bacteria | 2997 |
| 373 | Ga0207707_10135825 | 3300025912 | Bacteria | 2150 |
| 374 | Ga0207695_10000837 | 3300025913 | Bacteria | 56634 |
| 375 | Ga0207695_10001415 | 3300025913 | Bacteria | 40402 |
| 376 | Ga0207695_10004225 | 3300025913 | Bacteria | 19746 |
| 377 | Ga0207695_10217410 | 3300025913 | Bacteria | 1819 |
| 378 | Ga0207695_10290079 | 3300025913 | Bacteria | 1528 |
| 379 | Ga0207695_10299028 | 3300025913 | Bacteria | 1501 |
| 380 | Ga0207695_10662474 | 3300025913 | Bacteria | 925 |
| 381 | Ga0207695_11476108 | 3300025913 | Bacteria | 560 |
| 382 | Ga0207693_10004030 | 3300025915 | Bacteria | 12483 |
| 383 | Ga0207693_10347130 | 3300025915 | Bacteria | 1161 |
| 384 | Ga0207660_10005342 | 3300025917 | Bacteria | 8345 |
| 385 | Ga0207660_10082116 | 3300025917 | Bacteria | 2370 |
| 386 | Ga0207660_10175592 | 3300025917 | Bacteria | 1661 |
| 387 | Ga0207660_10177760 | 3300025917 | Bacteria | 1651 |
| 388 | Ga0207660_10532746 | 3300025917 | Bacteria | 954 |
| 389 | Ga0207660_10949207 | 3300025917 | Bacteria | 702 |
| 390 | Ga0207657_10318140 | 3300025919 | Bacteria | 1231 |
| 391 | Ga0207657_10725261 | 3300025919 | Bacteria | 771 |
| 392 | Ga0207657_11440744 | 3300025919 | Bacteria | 516 |
| 393 | Ga0207649_10208624 | 3300025920 | Bacteria | 1384 |
| 394 | Ga0207649_10496707 | 3300025920 | Bacteria | 927 |
| 395 | Ga0207652_10050296 | 3300025921 | Bacteria | 3570 |
| 396 | Ga0207652_10059412 | 3300025921 | Bacteria | 3296 |
| 397 | Ga0207652_10489026 | 3300025921 | Bacteria | 1108 |
| 398 | Ga0207681_10054011 | 3300025923 | Bacteria | 2729 |
| 399 | Ga0207681_10291623 | 3300025923 | Bacteria | 1288 |
| 400 | Ga0207681_11278580 | 3300025923 | Bacteria | 616 |
| 401 | Ga0207694_10103283 | 3300025924 | Bacteria | 2260 |
| 402 | Ga0207694_10214695 | 3300025924 | Bacteria | 1568 |
| 403 | Ga0207694_10256603 | 3300025924 | Bacteria | 1431 |
| 404 | Ga0207694_10290475 | 3300025924 | Bacteria | 1344 |
| 405 | Ga0207694_11185616 | 3300025924 | Bacteria | 646 |
| 406 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 407 | Ga0207650_10373801 | 3300025925 | Bacteria | 1176 |
| 408 | Ga0207659_10000018 | 3300025926 | Bacteria | 156920 |
| 409 | Ga0207659_10259588 | 3300025926 | Bacteria | 1413 |
| 410 | Ga0207687_10000079 | 3300025927 | Bacteria | 70683 |
| 411 | Ga0207687_10825121 | 3300025927 | Bacteria | 791 |
| 412 | Ga0207687_11428646 | 3300025927 | Bacteria | 594 |
| 413 | Ga0207687_11435720 | 3300025927 | Bacteria | 593 |
| 414 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 415 | Ga0207700_10771090 | 3300025928 | Bacteria | 860 |
| 416 | Ga0207644_10006266 | 3300025931 | Bacteria | 7749 |
| 417 | Ga0207644_10638640 | 3300025931 | Bacteria | 885 |
| 418 | Ga0207690_10000898 | 3300025932 | Bacteria | 18981 |
| 419 | Ga0207690_10012606 | 3300025932 | Bacteria | 5061 |
| 420 | Ga0207690_10013676 | 3300025932 | Bacteria | 4883 |
| 421 | Ga0207690_10849117 | 3300025932 | Bacteria | 756 |
| 422 | Ga0207706_10020225 | 3300025933 | Bacteria | 5983 |
| 423 | Ga0207686_10255109 | 3300025934 | Bacteria | 1283 |
| 424 | Ga0207686_10346586 | 3300025934 | Bacteria | 1117 |
| 425 | Ga0207686_11220771 | 3300025934 | Bacteria | 616 |
| 426 | Ga0207709_10384833 | 3300025935 | Bacteria | 1068 |
| 427 | Ga0207670_10002339 | 3300025936 | Bacteria | 9929 |
| 428 | Ga0207670_10083933 | 3300025936 | Bacteria | 2236 |
| 429 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 430 | Ga0207669_10317154 | 3300025937 | Bacteria | 1191 |
| 431 | Ga0207704_10001066 | 3300025938 | Bacteria | 12198 |
| 432 | Ga0207704_10010816 | 3300025938 | Bacteria | 4468 |
| 433 | Ga0207704_10442147 | 3300025938 | Bacteria | 1036 |
| 434 | Ga0207665_10371411 | 3300025939 | Bacteria | 1083 |
| 435 | Ga0207665_10443856 | 3300025939 | Bacteria | 995 |
| 436 | Ga0207665_10766282 | 3300025939 | Bacteria | 761 |
| 437 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 438 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 439 | Ga0207711_10000155 | 3300025941 | Bacteria | 73463 |
| 440 | Ga0207711_10005857 | 3300025941 | Bacteria | 10377 |
| 441 | Ga0207711_10152489 | 3300025941 | Bacteria | 2086 |
| 442 | Ga0207711_10691641 | 3300025941 | Bacteria | 951 |
| 443 | Ga0207711_10724499 | 3300025941 | Bacteria | 927 |
| 444 | Ga0207711_10809128 | 3300025941 | Bacteria | 873 |
| 445 | Ga0207711_10901628 | 3300025941 | Unclassified | 822 |
| 446 | Ga0207711_11079898 | 3300025941 | Bacteria | 743 |
| 447 | Ga0207689_10120163 | 3300025942 | Bacteria | 2162 |
| 448 | Ga0207689_10199604 | 3300025942 | Bacteria | 1651 |
| 449 | Ga0207661_10000693 | 3300025944 | Bacteria | 21892 |
| 450 | Ga0207661_10000774 | 3300025944 | Bacteria | 20762 |
| 451 | Ga0207661_10010255 | 3300025944 | Bacteria | 6739 |
| 452 | Ga0207661_10045890 | 3300025944 | Bacteria | 3462 |
| 453 | Ga0207661_11610162 | 3300025944 | Bacteria | 594 |
| 454 | Ga0207679_10064870 | 3300025945 | Bacteria | 2731 |
| 455 | Ga0207679_10347297 | 3300025945 | Bacteria | 1292 |
| 456 | Ga0207679_10804161 | 3300025945 | Bacteria | 857 |
| 457 | Ga0207667_10011376 | 3300025949 | Bacteria | 10348 |
| 458 | Ga0207667_10044451 | 3300025949 | Bacteria | 4706 |
| 459 | Ga0207667_10263395 | 3300025949 | Bacteria | 1763 |
| 460 | Ga0207667_10319847 | 3300025949 | Bacteria | 1585 |
| 461 | Ga0207667_10456422 | 3300025949 | Bacteria | 1298 |
| 462 | Ga0207651_10251899 | 3300025960 | Bacteria | 1445 |
| 463 | Ga0207651_10394705 | 3300025960 | Bacteria | 1175 |
| 464 | Ga0207651_11129930 | 3300025960 | Bacteria | 702 |
| 465 | Ga0207651_11430805 | 3300025960 | Bacteria | 622 |
| 466 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 467 | Ga0207712_10007748 | 3300025961 | Bacteria | 6789 |
| 468 | Ga0207712_10313588 | 3300025961 | Bacteria | 1291 |
| 469 | Ga0207712_11088134 | 3300025961 | Bacteria | 711 |
| 470 | Ga0207712_11341447 | 3300025961 | Bacteria | 640 |
| 471 | Ga0207668_10000019 | 3300025972 | Bacteria | 152108 |
| 472 | Ga0207668_10000241 | 3300025972 | Bacteria | 36742 |
| 473 | Ga0207668_10006047 | 3300025972 | Bacteria | 7138 |
| 474 | Ga0207668_10007726 | 3300025972 | Bacteria | 6397 |
| 475 | Ga0207668_10070882 | 3300025972 | Bacteria | 2487 |
| 476 | Ga0207668_10427457 | 3300025972 | Bacteria | 1125 |
| 477 | Ga0207668_10646381 | 3300025972 | Bacteria | 925 |
| 478 | Ga0207668_11987327 | 3300025972 | Bacteria | 524 |
| 479 | Ga0207640_10111369 | 3300025981 | Bacteria | 1941 |
| 480 | Ga0207640_10686642 | 3300025981 | Bacteria | 876 |
| 481 | Ga0207640_11403247 | 3300025981 | Bacteria | 626 |
| 482 | Ga0207658_10000295 | 3300025986 | Bacteria | 52135 |
| 483 | Ga0207658_10002476 | 3300025986 | Bacteria | 13480 |
| 484 | Ga0207658_10014433 | 3300025986 | Bacteria | 5408 |
| 485 | Ga0207658_10422709 | 3300025986 | Bacteria | 1175 |
| 486 | Ga0207658_10445065 | 3300025986 | Bacteria | 1146 |
| 487 | Ga0207658_10676398 | 3300025986 | Bacteria | 931 |
| 488 | Ga0207658_10753113 | 3300025986 | Bacteria | 882 |
| 489 | Ga0207677_10000361 | 3300026023 | Bacteria | 31898 |
| 490 | Ga0207677_10430994 | 3300026023 | Bacteria | 1125 |
| 491 | Ga0207703_10000169 | 3300026035 | Bacteria | 76131 |
| 492 | Ga0207703_10000170 | 3300026035 | Bacteria | 75814 |
| 493 | Ga0207703_10002213 | 3300026035 | Bacteria | 17068 |
| 494 | Ga0207703_10004727 | 3300026035 | Bacteria | 11111 |
| 495 | Ga0207703_10570132 | 3300026035 | Bacteria | 1069 |
| 496 | Ga0207639_10010622 | 3300026041 | Bacteria | 6376 |
| 497 | Ga0207639_10016225 | 3300026041 | Bacteria | 5264 |
| 498 | Ga0207639_10133544 | 3300026041 | Bacteria | 2058 |
| 499 | Ga0207639_10410461 | 3300026041 | Bacteria | 1222 |
| 500 | Ga0207639_10705975 | 3300026041 | Bacteria | 936 |
| 501 | Ga0207639_11146478 | 3300026041 | Bacteria | 729 |
| 502 | Ga0207639_11264446 | 3300026041 | Bacteria | 693 |
| 503 | Ga0207639_11840425 | 3300026041 | Bacteria | 566 |
| 504 | Ga0207678_10633354 | 3300026067 | Bacteria | 939 |
| 505 | Ga0207678_10657774 | 3300026067 | Bacteria | 921 |
| 506 | Ga0207708_10022830 | 3300026075 | Bacteria | 4725 |
| 507 | Ga0207708_10312388 | 3300026075 | Bacteria | 1281 |
| 508 | Ga0207708_10818834 | 3300026075 | Bacteria | 802 |
| 509 | Ga0207702_10003690 | 3300026078 | Bacteria | 13856 |
| 510 | Ga0207702_10126043 | 3300026078 | Bacteria | 2299 |
| 511 | Ga0207702_10154757 | 3300026078 | Bacteria | 2089 |
| 512 | Ga0207702_10397749 | 3300026078 | Bacteria | 1328 |
| 513 | Ga0207702_10460042 | 3300026078 | Bacteria | 1236 |
| 514 | Ga0207702_11553126 | 3300026078 | Bacteria | 655 |
| 515 | Ga0207702_11839356 | 3300026078 | Bacteria | 597 |
| 516 | Ga0207702_12449922 | 3300026078 | Bacteria | 509 |
| 517 | Ga0207641_10000077 | 3300026088 | Bacteria | 144978 |
| 518 | Ga0207641_10000612 | 3300026088 | Bacteria | 39133 |
| 519 | Ga0207641_10001331 | 3300026088 | Bacteria | 24454 |
| 520 | Ga0207641_10244530 | 3300026088 | Bacteria | 1673 |
| 521 | Ga0207641_10370456 | 3300026088 | Bacteria | 1369 |
| 522 | Ga0207648_10088874 | 3300026089 | Bacteria | 2698 |
| 523 | Ga0207648_10490922 | 3300026089 | Bacteria | 1123 |
| 524 | Ga0207648_10807326 | 3300026089 | Bacteria | 874 |
| 525 | Ga0207676_10002400 | 3300026095 | Bacteria | 13363 |
| 526 | Ga0207676_10086766 | 3300026095 | Bacteria | 2557 |
| 527 | Ga0207676_10178658 | 3300026095 | Bacteria | 1856 |
| 528 | Ga0207676_10956833 | 3300026095 | Bacteria | 842 |
| 529 | Ga0207676_11495132 | 3300026095 | Bacteria | 672 |
| 530 | Ga0207676_12045022 | 3300026095 | Bacteria | 571 |
| 531 | Ga0207674_10041054 | 3300026116 | Bacteria | 4787 |
| 532 | Ga0207674_10046471 | 3300026116 | Bacteria | 4457 |
| 533 | Ga0207675_100240157 | 3300026118 | Bacteria | 1751 |
| 534 | Ga0207675_100554658 | 3300026118 | Bacteria | 1148 |
| 535 | Ga0207675_100905684 | 3300026118 | Bacteria | 898 |
| 536 | Ga0207675_101438438 | 3300026118 | Bacteria | 710 |
| 537 | Ga0207683_10006424 | 3300026121 | Bacteria | 10067 |
| 538 | Ga0207683_10113141 | 3300026121 | Bacteria | 2431 |
| 539 | Ga0207683_11207475 | 3300026121 | Bacteria | 701 |
| 540 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 541 | Ga0207698_10694156 | 3300026142 | Bacteria | 1012 |
| 542 | Ga0207698_11196583 | 3300026142 | Bacteria | 774 |
| 543 | Ga0207698_11639606 | 3300026142 | Bacteria | 659 |
| 544 | Ga0209981_1029420 | 3300027378 | Bacteria | 803 |
| 545 | Ga0209999_1006261 | 3300027543 | Bacteria | 2137 |
| 546 | Ga0209982_1011433 | 3300027552 | Bacteria | 1326 |
| 547 | Ga0209983_1083430 | 3300027665 | Bacteria | 717 |
| 548 | Ga0209813_10005758 | 3300027866 | Bacteria | 3026 |
| 549 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 550 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 551 | Ga0268266_10000711 | 3300028379 | Bacteria | 44986 |
| 552 | Ga0268266_10001210 | 3300028379 | Bacteria | 31835 |
| 553 | Ga0268266_10003648 | 3300028379 | Bacteria | 15221 |
| 554 | Ga0268266_10020143 | 3300028379 | Bacteria | 5686 |
| 555 | Ga0268266_10063407 | 3300028379 | Bacteria | 3190 |
| 556 | Ga0268266_10077006 | 3300028379 | Bacteria | 2899 |
| 557 | Ga0268266_10107687 | 3300028379 | Bacteria | 2465 |
| 558 | Ga0268265_10001088 | 3300028380 | Bacteria | 24179 |
| 559 | Ga0268265_10001421 | 3300028380 | Bacteria | 20258 |
| 560 | Ga0268265_10027175 | 3300028380 | Bacteria | 4080 |
| 561 | Ga0268265_10128675 | 3300028380 | Bacteria | 2100 |
| 562 | Ga0268265_10329581 | 3300028380 | Bacteria | 1386 |
| 563 | Ga0268265_10639200 | 3300028380 | Bacteria | 1021 |
| 564 | Ga0268264_10000091 | 3300028381 | Bacteria | 233338 |
| 565 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 566 | Ga0268264_10010714 | 3300028381 | Bacteria | 7574 |
| 567 | Ga0268264_11281844 | 3300028381 | Bacteria | 743 |
| 568 | Ga0268264_11430402 | 3300028381 | Bacteria | 702 |
| 569 | Ga0268264_12306966 | 3300028381 | Bacteria | 545 |
| 570 | Ga0265337_1137074 | 3300028556 | Bacteria | 663 |
| 571 | Ga0265326_10000079 | 3300028558 | Bacteria | 51707 |
| 572 | Ga0265322_10000004 | 3300028654 | Bacteria | 275155 |
| 573 | Ga0265336_10202260 | 3300028666 | Bacteria | 590 |
| 574 | Ga0307517_10000835 | 3300028786 | Bacteria | 53001 |
| 575 | Ga0307517_10126586 | 3300028786 | Bacteria | 1861 |
| 576 | Ga0265338_10053005 | 3300028800 | Bacteria | 3634 |
| 577 | Ga0265338_10233227 | 3300028800 | Bacteria | 1367 |
| 578 | Ga0265324_10011479 | 3300029957 | Bacteria | 3373 |
| 579 | Ga0265332_10036105 | 3300031238 | Bacteria | 2146 |
| 580 | Ga0265328_10006864 | 3300031239 | Bacteria | 4782 |
| 581 | Ga0265328_10318040 | 3300031239 | Bacteria | 603 |
| 582 | Ga0265320_10000029 | 3300031240 | Bacteria | 159627 |
| 583 | Ga0265320_10180939 | 3300031240 | Bacteria | 945 |
| 584 | Ga0265325_10063783 | 3300031241 | Bacteria | 1864 |
| 585 | Ga0265340_10290420 | 3300031247 | Bacteria | 726 |
| 586 | Ga0265340_10566998 | 3300031247 | Bacteria | 500 |
| 587 | Ga0265339_10391369 | 3300031249 | Bacteria | 650 |
| 588 | Ga0265327_10000287 | 3300031251 | Bacteria | 99268 |
| 589 | Ga0265327_10000723 | 3300031251 | Bacteria | 51798 |
| 590 | Ga0265327_10000868 | 3300031251 | Bacteria | 44811 |
| 591 | Ga0265327_10114940 | 3300031251 | Bacteria | 1281 |
| 592 | Ga0265316_10034072 | 3300031344 | Bacteria | 4140 |
| 593 | Ga0265316_10109954 | 3300031344 | Bacteria | 2088 |
| 594 | Ga0265316_11037918 | 3300031344 | Bacteria | 570 |
| 595 | Ga0307513_10000873 | 3300031456 | Bacteria | 43622 |
| 596 | Ga0307513_10004902 | 3300031456 | Bacteria | 17766 |
| 597 | Ga0307513_10154808 | 3300031456 | Bacteria | 2194 |
| 598 | Ga0307408_100383663 | 3300031548 | Bacteria | 1202 |
| 599 | Ga0316579_10392193 | 3300031691 | Bacteria | 671 |
| 600 | Ga0265314_10000484 | 3300031711 | Bacteria | 52007 |
| 601 | Ga0265314_10057533 | 3300031711 | Bacteria | 2669 |
| 602 | Ga0316576_10023751 | 3300031727 | Bacteria | 4275 |
| 603 | Ga0307516_10000030 | 3300031730 | Bacteria | 159694 |
| 604 | Ga0307405_11375069 | 3300031731 | Bacteria | 616 |
| 605 | Ga0307406_10535895 | 3300031901 | Bacteria | 955 |
| 606 | Ga0307406_10753607 | 3300031901 | Bacteria | 818 |
| 607 | Ga0307407_10535865 | 3300031903 | Bacteria | 863 |
| 608 | Ga0307409_101099300 | 3300031995 | Bacteria | 816 |
| 609 | Ga0307416_101209772 | 3300032002 | Bacteria | 861 |
| 610 | Ga0307416_101782689 | 3300032002 | Bacteria | 720 |
| 611 | Ga0307416_103053825 | 3300032002 | Bacteria | 560 |
| 612 | Ga0307414_10108804 | 3300032004 | Bacteria | 2104 |
| 613 | Ga0307510_10087941 | 3300033180 | Bacteria | 2970 |
| 614 | Ga0307510_10200659 | 3300033180 | Bacteria | 1530 |
| 615 | Ga0316596_1123774 | 3300033541 | Bacteria | 704 |
| 616 | Ga0373926_0086427 | 3300035083 | Bacteria | 1164 |
| 617 | Ga0373934_0337231 | 3300035086 | Bacteria | 627 |
| 618 | Ga0373940_0033196 | 3300035088 | Bacteria | 1387 |
| 619 | Ga0373944_0013203 | 3300035089 | Bacteria | 2287 |
| 620 | Ga0373923_0558521 | 3300035111 | Bacteria | 561 |
| 621 | Ga0373936_0009511 | 3300035113 | Bacteria | 3664 |
| 622 | Ga0373939_0082754 | 3300035114 | Bacteria | 1069 |
| 623 | Ga0373941_0078984 | 3300035115 | Bacteria | 1108 |
| 624 | Ga0373945_0065928 | 3300035116 | Bacteria | 1361 |
| 625 | Ga0373943_0051520 | 3300035170 | Bacteria | 2027 |
| 626 | Ga0373946_0132043 | 3300035171 | Bacteria | 1149 |
| 627 | Ga0373946_0501511 | 3300035171 | Bacteria | 622 |
| 628 | Ga0373955_0828465 | 3300035172 | Bacteria | 569 |
| 629 | Ga0316574_0235089 | 3300035398 | Bacteria | 1172 |
| 630 | Ga0316574_0565862 | 3300035398 | Bacteria | 704 |
| 631 | Ga0373931_0524431 | 3300035691 | Bacteria | 767 |
| 632 | Ga0373931_0699258 | 3300035691 | Bacteria | 669 |
| 633 | Ga0373931_1029803 | 3300035691 | Bacteria | 558 |
| 634 | Ga0373935_1487928 | 3300035692 | Bacteria | 507 |
| 635 | Ga0373927_0000173 | 3300035695 | Bacteria | 50996 |
| 636 | Ga0373947_0027745 | 3300035725 | Bacteria | 3315 |
| 637 | Ga0373937_0741131 | 3300036401 | Bacteria | 930 |
| 638 | Ga0316582_0832302 | 3300036647 | Bacteria | 632 |
| 639 | Ga0316582_1152383 | 3300036647 | Bacteria | 528 |
| 640 | Ga0316584_0016821 | 3300036712 | Bacteria | 5248 |
| 641 | Ga0373925_0000049 | 3300037068 | Bacteria | 128065 |
| 642 | Ga0373925_0163729 | 3300037068 | Bacteria | 1753 |
| 643 | Ga0373925_0965083 | 3300037068 | Bacteria | 702 |
| 644 | Ga0373925_1014951 | 3300037068 | Bacteria | 683 |
| 645 | Ga0395899_0095773 | 3300037312 | Bacteria | 2147 |
| 646 | Ga0395899_0099667 | 3300037312 | Bacteria | 2098 |
| 647 | Ga0395899_0680639 | 3300037312 | Bacteria | 647 |
| 648 | Ga0395900_0139862 | 3300037418 | Bacteria | 2479 |
| 649 | Ga0395900_0195571 | 3300037418 | Bacteria | 2049 |
| 650 | Ga0395900_0575235 | 3300037418 | Bacteria | 1069 |
| 651 | Ga0395898_0238514 | 3300037466 | Bacteria | 1734 |
| 652 | Ga0395898_0901049 | 3300037466 | Bacteria | 822 |
| 653 | Ga0395898_1478547 | 3300037466 | Bacteria | 606 |
| 654 | Ga0395905_0000022 | 3300037471 | Bacteria | 321527 |
| 655 | Ga0395905_0027924 | 3300037471 | Bacteria | 5320 |
| 656 | Ga0395905_0043114 | 3300037471 | Bacteria | 4233 |
| 657 | Ga0395905_0043133 | 3300037471 | Bacteria | 4232 |
| 658 | Ga0395905_0151539 | 3300037471 | Bacteria | 2181 |
| 659 | Ga0395905_0590077 | 3300037471 | Bacteria | 1013 |
| 660 | Ga0436364_0037096 | 3300037853 | Bacteria | 1036 |
| 661 | Ga0436364_0175783 | 3300037853 | Bacteria | 773 |
| 662 | Ga0436364_0576095 | 3300037853 | Bacteria | 668 |
| 663 | Ga0395901_0134281 | 3300038443 | Bacteria | 2600 |
| 664 | Ga0395901_0230784 | 3300038443 | Bacteria | 1932 |
| 665 | Ga0395901_1098893 | 3300038443 | Bacteria | 766 |
| 666 | Ga0436365_0192477 | 3300039437 | Bacteria | 1621 |
| 667 | Ga0436365_0422229 | 3300039437 | Bacteria | 2215 |
| 668 | Ga0436365_0425122 | 3300039437 | Bacteria | 997 |
| 669 | Ga0436365_1291619 | 3300039437 | Bacteria | 1944 |
| 670 | Ga0436360_0189994 | 3300039438 | Bacteria | 1040 |
| 671 | Ga0436360_0384133 | 3300039438 | Bacteria | 4079 |
| 672 | Ga0436360_0392815 | 3300039438 | Bacteria | 2173 |
| 673 | Ga0436360_0474819 | 3300039438 | Bacteria | 968 |
| 674 | Ga0436360_1355634 | 3300039438 | Bacteria | 1768 |
| 675 | Ga0436361_0304745 | 3300039447 | Bacteria | 3133 |
| 676 | Ga0436361_0319149 | 3300039447 | Bacteria | 733 |
| 677 | Ga0436361_0486019 | 3300039447 | Bacteria | 2465 |
| 678 | Ga0436361_0548490 | 3300039447 | Bacteria | 1281 |
| 679 | Ga0436361_1066444 | 3300039447 | Bacteria | 1015 |
| 680 | Ga0436363_0123189 | 3300039450 | Bacteria | 1173 |
| 681 | Ga0436363_0144206 | 3300039450 | Bacteria | 756 |
| 682 | Ga0436363_0526126 | 3300039450 | Bacteria | 631 |
| 683 | Ga0436363_0763861 | 3300039450 | Bacteria | 616 |
| 684 | Ga0436363_0939738 | 3300039450 | Bacteria | 6202 |
| 685 | Ga0436362_0053172 | 3300039453 | Bacteria | 1832 |
| 686 | Ga0436362_1196929 | 3300039453 | Bacteria | 953 |
| 687 | Ga0451804_0677918 | 3300041463 | Bacteria | 603 |
| 688 | Ga0451807_0534070 | 3300041486 | Bacteria | 558 |
| 689 | Ga0451833_0408238 | 3300041491 | Bacteria | 711 |
| 690 | Ga0451837_1468072 | 3300041494 | Bacteria | 612 |
| 691 | Ga0451843_0090988 | 3300041509 | Bacteria | 501 |
| 692 | Ga0451855_1286586 | 3300041511 | Bacteria | 644 |
| 693 | Ga0451853_0956394 | 3300041512 | Bacteria | 1413 |
| 694 | Ga0451853_1991594 | 3300041512 | Bacteria | 617 |
| 695 | Ga0450901_004112 | 3300042533 | Bacteria | 1507 |
| 696 | Ga0466969_0015922 | 3300044656 | Bacteria | 3940 |
| 697 | Ga0466965_0141460 | 3300044683 | Bacteria | 1253 |
| 698 | Ga0466965_0156640 | 3300044683 | Bacteria | 1193 |
| 699 | Ga0466966_0003014 | 3300044684 | Bacteria | 11108 |
| 700 | Ga0466966_0070352 | 3300044684 | Bacteria | 2194 |
| 701 | Ga0466961_0002790 | 3300044693 | Bacteria | 10861 |
| 702 | Ga0466961_0104630 | 3300044693 | Bacteria | 1782 |
| 703 | Ga0466961_0217535 | 3300044693 | Bacteria | 1178 |
| 704 | Ga0466963_0388530 | 3300044694 | Bacteria | 984 |
| 705 | Ga0466971_0239006 | 3300044719 | Bacteria | 863 |
| 706 | Ga0466968_0016405 | 3300044735 | Bacteria | 2950 |
| 707 | Ga0466968_0591920 | 3300044735 | Bacteria | 559 |
| 708 | Ga0466970_0026932 | 3300044765 | Bacteria | 3014 |
| 709 | Ga0466957_0001331 | 3300044842 | Bacteria | 12898 |
| 710 | Ga0466957_0005133 | 3300044842 | Bacteria | 7318 |
| 711 | Ga0466957_0146347 | 3300044842 | Bacteria | 1525 |
| 712 | Ga0466957_1151491 | 3300044842 | Bacteria | 560 |
| 713 | Ga0466957_1242930 | 3300044842 | Bacteria | 540 |
| 714 | Ga0466959_0000086 | 3300045049 | Bacteria | 59057 |
| 715 | Ga0466959_0102536 | 3300045049 | Bacteria | 2048 |
| 716 | Ga0466959_0386074 | 3300045049 | Bacteria | 953 |
| 717 | Ga0451576_1542699 | 3300045051 | Bacteria | 690 |
| 718 | Ga0466958_0026304 | 3300045836 | Bacteria | 3438 |
| 719 | Ga0466958_0064044 | 3300045836 | Bacteria | 2242 |
| 720 | Ga0466958_0859835 | 3300045836 | Bacteria | 592 |
| 721 | Ga0495592_0008902 | 3300046454 | Bacteria | 7539 |
| 722 | Ga0495603_0001338 | 3300046455 | Bacteria | 14315 |
| 723 | Ga0495629_0791825 | 3300046459 | Bacteria | 626 |
| 724 | Ga0495638_0005743 | 3300046460 | Bacteria | 9134 |
| 725 | Ga0495638_0169895 | 3300046460 | Bacteria | 1252 |
| 726 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 727 | Ga0495641_0460883 | 3300046461 | Bacteria | 579 |
| 728 | Ga0495651_0096467 | 3300046462 | Bacteria | 2209 |
| 729 | Ga0495651_0590045 | 3300046462 | Bacteria | 702 |
| 730 | Ga0495653_0080430 | 3300046463 | Bacteria | 2411 |
| 731 | Ga0495653_0453694 | 3300046463 | Bacteria | 806 |
| 732 | Ga0495650_0146133 | 3300046471 | Bacteria | 852 |
| 733 | Ga0495662_0005830 | 3300046476 | Bacteria | 6164 |
| 734 | Ga0495662_0047569 | 3300046476 | Bacteria | 2070 |
| 735 | Ga0495585_0587470 | 3300046492 | Bacteria | 524 |
| 736 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 737 | Ga0495596_0224590 | 3300046500 | Bacteria | 729 |
| 738 | Ga0495583_0062409 | 3300046506 | Bacteria | 1659 |
| 739 | Ga0495606_0121510 | 3300046507 | Bacteria | 1563 |
| 740 | Ga0495608_0009408 | 3300046511 | Bacteria | 6832 |
| 741 | Ga0495608_0157440 | 3300046511 | Bacteria | 1445 |
| 742 | Ga0495610_0355438 | 3300046512 | Bacteria | 551 |
| 743 | Ga0495628_0000437 | 3300046516 | Bacteria | 37922 |
| 744 | Ga0495628_0014714 | 3300046516 | Bacteria | 6551 |
| 745 | Ga0495628_0071508 | 3300046516 | Bacteria | 2704 |
| 746 | Ga0495628_0557159 | 3300046516 | Bacteria | 822 |
| 747 | Ga0495628_0784862 | 3300046516 | Bacteria | 667 |
| 748 | Ga0495630_0011760 | 3300046517 | Bacteria | 6343 |
| 749 | Ga0495630_0070399 | 3300046517 | Bacteria | 2632 |
| 750 | Ga0495630_0457077 | 3300046517 | Bacteria | 978 |
| 751 | Ga0495644_0001542 | 3300046523 | Bacteria | 9397 |
| 752 | Ga0495644_0114564 | 3300046523 | Bacteria | 1024 |
| 753 | Ga0495663_0042968 | 3300046525 | Bacteria | 1379 |
| 754 | Ga0495642_0010166 | 3300046528 | Bacteria | 3604 |
| 755 | Ga0495642_0289210 | 3300046528 | Bacteria | 717 |
| 756 | Ga0495652_0764050 | 3300046529 | Bacteria | 646 |
| 757 | Ga0495665_0550657 | 3300046531 | Bacteria | 579 |
| 758 | Ga0495586_0001281 | 3300046535 | Bacteria | 14059 |
| 759 | Ga0495598_0197989 | 3300046537 | Bacteria | 724 |
| 760 | Ga0495621_0059748 | 3300046539 | Bacteria | 1382 |
| 761 | Ga0495645_0472690 | 3300046543 | Bacteria | 787 |
| 762 | Ga0495645_0479851 | 3300046543 | Bacteria | 780 |
| 763 | Ga0495622_0000132 | 3300046557 | Bacteria | 63863 |
| 764 | Ga0495668_0025043 | 3300046616 | Bacteria | 3392 |
| 765 | Ga0495668_0351926 | 3300046616 | Bacteria | 808 |
| 766 | Ga0495668_0518658 | 3300046616 | Bacteria | 657 |
| 767 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 768 | Ga0495611_0096417 | 3300046648 | Bacteria | 1369 |
| 769 | Ga0495625_0022110 | 3300046660 | Bacteria | 4881 |
| 770 | Ga0495625_0044306 | 3300046660 | Bacteria | 3222 |
| 771 | Ga0495625_0095839 | 3300046660 | Bacteria | 2044 |
| 772 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 773 | Ga0495635_0742729 | 3300046663 | Bacteria | 634 |
| 774 | Ga0495659_0015957 | 3300046664 | Bacteria | 2474 |
| 775 | Ga0495661_0216748 | 3300046665 | Bacteria | 994 |
| 776 | Ga0495588_0165115 | 3300046674 | Bacteria | 1171 |
| 777 | Ga0495588_0749608 | 3300046674 | Bacteria | 510 |
| 778 | Ga0495657_0016546 | 3300046675 | Bacteria | 5373 |
| 779 | Ga0495599_0005994 | 3300046678 | Bacteria | 7315 |
| 780 | Ga0495623_0282827 | 3300046679 | Bacteria | 922 |
| 781 | Ga0495647_0000009 | 3300046681 | Bacteria | 94874 |
| 782 | Ga0495658_0882508 | 3300046683 | Bacteria | 572 |
| 783 | Ga0495669_0000014 | 3300046684 | Bacteria | 140832 |
| 784 | Ga0495669_0095358 | 3300046684 | Bacteria | 1378 |
| 785 | Ga0495669_0422530 | 3300046684 | Bacteria | 646 |
| 786 | Ga0495613_0000094 | 3300046689 | Bacteria | 86601 |
| 787 | Ga0495613_0001352 | 3300046689 | Bacteria | 18688 |
| 788 | Ga0495624_0001301 | 3300046690 | Bacteria | 19637 |
| 789 | Ga0495624_0095836 | 3300046690 | Bacteria | 1828 |
| 790 | Ga0495670_0010128 | 3300046691 | Bacteria | 4639 |
| 791 | Ga0495670_0142599 | 3300046691 | Bacteria | 1253 |
| 792 | Ga0495670_0464537 | 3300046691 | Bacteria | 686 |
| 793 | Ga0495671_0123829 | 3300046692 | Bacteria | 1261 |
| 794 | Ga0495649_0196378 | 3300046694 | Bacteria | 1049 |
| 795 | Ga0495600_0021782 | 3300046809 | Bacteria | 4109 |
| 796 | Ga0495600_0277195 | 3300046809 | Bacteria | 1062 |
| 797 | Ga0495660_0116836 | 3300046810 | Bacteria | 1354 |
| 798 | Ga0495604_0000089 | 3300047317 | Bacteria | 77741 |
| 799 | Ga0495604_0003648 | 3300047317 | Bacteria | 12274 |
| 800 | Ga0495604_0012257 | 3300047317 | Bacteria | 6815 |
| 801 | Ga0495636_0206442 | 3300047318 | Bacteria | 898 |
| 802 | Ga0495674_0378402 | 3300047319 | Bacteria | 1146 |
| 803 | Ga0495672_0095153 | 3300047320 | Bacteria | 1627 |
| 804 | Ga0495676_0000136 | 3300047321 | Bacteria | 55706 |
| 805 | Ga0495676_0584712 | 3300047321 | Bacteria | 728 |
| 806 | Ga0495680_0000856 | 3300047322 | Bacteria | 33820 |
| 807 | Ga0495680_0010286 | 3300047322 | Bacteria | 8345 |
| 808 | Ga0495683_0120139 | 3300047323 | Bacteria | 1248 |
| 809 | Ga0495687_178773 | 3300047443 | Bacteria | 695 |
| 810 | Ga0495675_0073901 | 3300047444 | Bacteria | 2149 |
| 811 | Ga0495677_0032530 | 3300047445 | Bacteria | 1900 |
| 812 | Ga0495677_0092502 | 3300047445 | Bacteria | 1140 |
| 813 | Ga0495679_033232 | 3300047446 | Bacteria | 1649 |
| 814 | Ga0495681_0105134 | 3300047470 | Bacteria | 1229 |
| 815 | Ga0495684_0257963 | 3300047471 | Bacteria | 1266 |
| 816 | Ga0495684_0725531 | 3300047471 | Bacteria | 656 |
| 817 | Ga0495684_0765397 | 3300047471 | Bacteria | 634 |
| 818 | Ga0495593_0135749 | 3300047673 | Bacteria | 1247 |
| 819 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 820 | Ga0495602_0004094 | 3300048088 | Bacteria | 15176 |
| 821 | Ga0495602_0042761 | 3300048088 | Bacteria | 4125 |
| 822 | Ga0495602_0549889 | 3300048088 | Bacteria | 800 |
| 823 | Ga0495602_0977413 | 3300048088 | Bacteria | 560 |
| 824 | Ga0495614_0543626 | 3300048089 | Bacteria | 555 |
| 825 | Ga0495615_0268657 | 3300048090 | Bacteria | 545 |
| 826 | Ga0496100_0446209 | 3300048903 | Bacteria | 991 |
| 827 | Ga0496101_0610526 | 3300048904 | Bacteria | 862 |
| 828 | Ga0496101_0618564 | 3300048904 | Bacteria | 856 |
| 829 | Ga0496102_0270127 | 3300048905 | Bacteria | 1603 |
| 830 | Ga0496102_0283594 | 3300048905 | Bacteria | 1561 |
| 831 | Ga0496102_0849973 | 3300048905 | Bacteria | 835 |
| 832 | Ga0496103_0309426 | 3300048906 | Bacteria | 1016 |
| 833 | Ga0496103_0682240 | 3300048906 | Bacteria | 652 |
| 834 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 835 | Ga0496104_0059304 | 3300048907 | Bacteria | 3623 |
| 836 | Ga0496104_0395457 | 3300048907 | Bacteria | 1294 |
| 837 | Ga0496104_0657201 | 3300048907 | Bacteria | 957 |
| 838 | Ga0496104_0993673 | 3300048907 | Bacteria | 743 |
| 839 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 840 | Ga0496105_0495177 | 3300048908 | Bacteria | 960 |
| 841 | Ga0496105_0869578 | 3300048908 | Bacteria | 681 |
| 842 | Ga0496105_1361658 | 3300048908 | Bacteria | 516 |
| 843 | Ga0496106_0000475 | 3300048909 | Bacteria | 28606 |
| 844 | Ga0496106_0040840 | 3300048909 | Bacteria | 3476 |
| 845 | Ga0496106_0755617 | 3300048909 | Bacteria | 773 |
| 846 | Ga0496106_0774429 | 3300048909 | Bacteria | 762 |
| 847 | Ga0496107_0046800 | 3300048910 | Bacteria | 3113 |
| 848 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 849 | Ga0496108_0000232 | 3300048911 | Bacteria | 49846 |
| 850 | Ga0496108_0015786 | 3300048911 | Bacteria | 6156 |
| 851 | Ga0496108_0821040 | 3300048911 | Bacteria | 801 |
| 852 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 853 | Ga0496109_0000044 | 3300048912 | Bacteria | 133779 |
| 854 | Ga0496109_0000264 | 3300048912 | Bacteria | 50480 |
| 855 | Ga0496109_0027177 | 3300048912 | Bacteria | 5107 |
| 856 | Ga0496109_0213643 | 3300048912 | Bacteria | 1814 |
| 857 | Ga0496109_0300281 | 3300048912 | Bacteria | 1514 |
| 858 | Ga0496109_1739909 | 3300048912 | Bacteria | 557 |
| 859 | Ga0496110_0076401 | 3300048913 | Bacteria | 2978 |
| 860 | Ga0496110_0168729 | 3300048913 | Bacteria | 1985 |
| 861 | Ga0496110_0702978 | 3300048913 | Bacteria | 912 |
| 862 | Ga0496110_0738921 | 3300048913 | Bacteria | 887 |
| 863 | Ga0496111_0298583 | 3300048914 | Bacteria | 1194 |
| 864 | Ga0496111_0694219 | 3300048914 | Bacteria | 741 |
| 865 | Ga0496112_0083301 | 3300048915 | Bacteria | 3163 |
| 866 | Ga0496112_0275732 | 3300048915 | Bacteria | 1629 |
| 867 | Ga0496113_0037071 | 3300048916 | Bacteria | 3576 |
| 868 | Ga0496114_0002941 | 3300048917 | Bacteria | 13063 |
| 869 | Ga0496115_0000398 | 3300048918 | Bacteria | 35876 |
| 870 | Ga0496115_0004971 | 3300048918 | Bacteria | 9656 |
| 871 | Ga0496115_0220407 | 3300048918 | Bacteria | 1565 |
| 872 | Ga0496115_1226628 | 3300048918 | Bacteria | 562 |
| 873 | Ga0496119_0471420 | 3300048922 | Bacteria | 588 |
| 874 | Ga0496121_0568127 | 3300048924 | Bacteria | 706 |
| 875 | Ga0496125_0212168 | 3300048928 | Bacteria | 1256 |
| 876 | Ga0496126_0519431 | 3300048929 | Bacteria | 949 |
| 877 | Ga0501305_114684 | 3300049161 | Bacteria | 512 |
| 878 | Ga0501311_018393 | 3300049527 | Bacteria | 928 |
| 879 | Ga0501319_002602 | 3300049535 | Bacteria | 1155 |
| 880 | Ga0501031_0411823 | 3300049568 | Bacteria | 874 |
| 881 | Ga0501032_0062543 | 3300049569 | Bacteria | 2494 |
| 882 | Ga0501033_0086870 | 3300049570 | Bacteria | 2289 |
| 883 | Ga0501033_0196043 | 3300049570 | Bacteria | 1444 |
| 884 | Ga0501033_0198140 | 3300049570 | Bacteria | 1435 |
| 885 | Ga0501033_0454733 | 3300049570 | Bacteria | 889 |
| 886 | Ga0501036_0724036 | 3300049572 | Bacteria | 821 |
| 887 | Ga0501037_0261567 | 3300049573 | Bacteria | 1209 |
| 888 | Ga0501042_0049172 | 3300049578 | Bacteria | 3008 |
| 889 | Ga0501042_0394548 | 3300049578 | Bacteria | 1002 |
| 890 | Ga0501043_0238512 | 3300049579 | Bacteria | 1403 |
| 891 | Ga0501043_0409274 | 3300049579 | Bacteria | 1024 |
| 892 | Ga0501046_0255718 | 3300049580 | Bacteria | 1288 |
| 893 | Ga0501047_0002867 | 3300049581 | Bacteria | 16362 |
| 894 | Ga0501047_0033367 | 3300049581 | Bacteria | 4969 |
| 895 | Ga0501048_0225945 | 3300049582 | Bacteria | 1328 |
| 896 | Ga0501068_0480032 | 3300049584 | Bacteria | 806 |
| 897 | Ga0501076_0723856 | 3300049592 | Bacteria | 821 |
| 898 | Ga0501257_074426 | 3300049686 | Bacteria | 871 |
| 899 | Ga0501257_237083 | 3300049686 | Bacteria | 537 |
| 900 | Ga0501080_1244885 | 3300049742 | Bacteria | 639 |
| 901 | Ga0501035_0200644 | 3300049822 | Bacteria | 1711 |
| 902 | Ga0501035_0226406 | 3300049822 | Bacteria | 1595 |
| 903 | Ga0501035_0670678 | 3300049822 | Bacteria | 839 |
| 904 | Ga0501035_0751934 | 3300049822 | Bacteria | 782 |
| 905 | Ga0501035_1300613 | 3300049822 | Bacteria | 561 |
| 906 | Ga0501044_0357130 | 3300049823 | Bacteria | 1380 |
| 907 | Ga0501044_1307797 | 3300049823 | Bacteria | 591 |
| 908 | nmdc:mga03n38_57024_c1 | 3300050490 | Bacteria | 1765 |
| 909 | nmdc:mga00v17_725_c1 | 3300050491 | Bacteria | 18009 |
| 910 | nmdc:mga0yw44_801707_c1 | 3300050492 | Bacteria | 639 |
| 911 | nmdc:mga0k408_11045_c1 | 3300050493 | Bacteria | 4905 |
| 912 | nmdc:mga0k408_142318_c1 | 3300050493 | Bacteria | 1427 |
| 913 | nmdc:mga06z11_2151_c1 | 3300050494 | Bacteria | 7482 |
| 914 | nmdc:mga04h51_6559_c1 | 3300050495 | Bacteria | 3025 |
| 915 | nmdc:mga07m45_106546_c1 | 3300050496 | Bacteria | 1613 |
| 916 | nmdc:mga0rr50_406491_c1 | 3300050513 | Unclassified | 1150 |
| 917 | nmdc:mga0sz30_6524_c2 | 3300050516 | Bacteria | 2113 |
| 918 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 919 | Ga0495601_0000330 | 3300053077 | Bacteria | 25170 |
| 920 | Ga0495595_0002179 | 3300053084 | Bacteria | 7613 |
| 921 | Ga0495619_0001825 | 3300053085 | Bacteria | 14157 |
| 922 | Ga0500643_000458 | 3300053087 | Bacteria | 30192 |
| 923 | Ga0500643_001391 | 3300053087 | Bacteria | 14001 |
| 924 | Ga0500643_006633 | 3300053087 | Bacteria | 4808 |
| 925 | Ga0500643_010973 | 3300053087 | Bacteria | 3337 |
| 926 | Ga0500643_026871 | 3300053087 | Bacteria | 1796 |
| 927 | Ga0500643_042847 | 3300053087 | Bacteria | 1322 |
| 928 | Ga0500646_0209206 | 3300053090 | Bacteria | 672 |
| 929 | Ga0500646_0252087 | 3300053090 | Bacteria | 621 |
| 930 | Ga0500566_0519642 | 3300053094 | Bacteria | 509 |
| 931 | Ga0500641_0002963 | 3300053096 | Bacteria | 6012 |
| 932 | Ga0500641_0013819 | 3300053096 | Bacteria | 2970 |
| 933 | Ga0500555_012638 | 3300053103 | Bacteria | 2431 |
| 934 | Ga0500555_056013 | 3300053103 | Bacteria | 1069 |
| 935 | Ga0500556_0002351 | 3300053104 | Bacteria | 6146 |
| 936 | Ga0500556_0013503 | 3300053104 | Bacteria | 2473 |
| 937 | Ga0500556_0184820 | 3300053104 | Bacteria | 823 |
| 938 | Ga0500562_001679 | 3300053108 | Bacteria | 5505 |
| 939 | Ga0500562_002560 | 3300053108 | Bacteria | 4530 |
| 940 | Ga0500562_007299 | 3300053108 | Bacteria | 2789 |
| 941 | Ga0500562_025091 | 3300053108 | Bacteria | 1559 |
| 942 | Ga0500595_001246 | 3300053119 | Bacteria | 14024 |
| 943 | Ga0500595_026926 | 3300053119 | Bacteria | 1976 |
| 944 | Ga0500608_145794 | 3300053122 | Bacteria | 1044 |
| 945 | Ga0500608_349232 | 3300053122 | Bacteria | 525 |
| 946 | Ga0500614_000632 | 3300053123 | Bacteria | 8960 |
| 947 | Ga0500642_0169271 | 3300053130 | Bacteria | 1023 |
| 948 | Ga0500652_168923 | 3300053131 | Bacteria | 901 |
| 949 | Ga0500559_0112855 | 3300053136 | Bacteria | 1260 |
| 950 | Ga0500604_0142412 | 3300053151 | Bacteria | 811 |
| 951 | Ga0500616_0038008 | 3300053153 | Bacteria | 2602 |
| 952 | Ga0500616_0107210 | 3300053153 | Bacteria | 1355 |
| 953 | Ga0500622_0015751 | 3300053156 | Bacteria | 4046 |
| 954 | Ga0500622_0145153 | 3300053156 | Bacteria | 1127 |
| 955 | Ga0500611_004298 | 3300053727 | Bacteria | 1911 |
| 956 | Ga0500645_003040 | 3300053730 | Bacteria | 7057 |
| 957 | Ga0500645_112285 | 3300053730 | Bacteria | 764 |
| 958 | Ga0500645_171922 | 3300053730 | Bacteria | 591 |
| 959 | Ga0501084_1490831 | 3300054114 | Bacteria | 566 |
| 960 | Ga0587084_076453 | 3300059477 | Bacteria | 641 |
| 961 | Ga0587084_133405 | 3300059477 | Bacteria | 533 |
| 962 | Ga0587084_148318 | 3300059477 | Bacteria | 514 |
| 963 | Ga0587093_026630 | 3300059478 | Bacteria | 809 |
| 964 | Ga0587070_102259 | 3300059491 | Bacteria | 661 |
| 965 | Ga0587070_203856 | 3300059491 | Bacteria | 527 |
| 966 | Ga0587077_070668 | 3300059493 | Bacteria | 779 |
| 967 | Ga0587077_158703 | 3300059493 | Bacteria | 597 |
| 968 | Ga0587083_0150442 | 3300059505 | Bacteria | 628 |
| 969 | Ga0587085_041352 | 3300059506 | Bacteria | 804 |
| 970 | Ga0587088_109047 | 3300059508 | Bacteria | 627 |
| 971 | Ga0587090_030258 | 3300059510 | Bacteria | 901 |
| 972 | Ga0587090_057540 | 3300059510 | Bacteria | 729 |
| 973 | Ga0587090_097035 | 3300059510 | Bacteria | 612 |
| 974 | Ga0587090_097556 | 3300059510 | Bacteria | 611 |
| 975 | Ga0587092_104265 | 3300059512 | Bacteria | 588 |
| 976 | Ga0587092_118862 | 3300059512 | Bacteria | 562 |
| 977 | Ga0587094_085149 | 3300059513 | Bacteria | 590 |
| 978 | Ga0587106_061425 | 3300059605 | Bacteria | 691 |
| 979 | Ga0587125_069606 | 3300059607 | Bacteria | 529 |
| 980 | Ga0587109_183309 | 3300059624 | Bacteria | 536 |
| 981 | Ga0587109_219214 | 3300059624 | Bacteria | 503 |
| 982 | Ga0587128_108397 | 3300059630 | Bacteria | 591 |
| 983 | Ga0587062_082834 | 3300059639 | Bacteria | 599 |
| 984 | Ga0587062_121824 | 3300059639 | Bacteria | 528 |
| 985 | Ga0587068_083977 | 3300059641 | Bacteria | 647 |
| 986 | Ga0587068_090154 | 3300059641 | Bacteria | 631 |
| 987 | Ga0587072_204585 | 3300059643 | Bacteria | 504 |
| 988 | Ga0587076_030973 | 3300059645 | Bacteria | 948 |
| 989 | Ga0587076_110548 | 3300059645 | Bacteria | 625 |
| 990 | Ga0587076_116766 | 3300059645 | Bacteria | 614 |
| 991 | Ga0587076_210658 | 3300059645 | Bacteria | 504 |
| 992 | Ga0587078_055251 | 3300059646 | Bacteria | 590 |
| 993 | Ga0587114_134656 | 3300059655 | Bacteria | 512 |
| 994 | Ga0587119_071169 | 3300059658 | Bacteria | 552 |
| 995 | Ga0587071_155866 | 3300060344 | Bacteria | 571 |
| 996 | Ga0587111_0103299 | 3300060346 | Bacteria | 713 |
| 997 | Ga0587111_0135545 | 3300060346 | Bacteria | 648 |
| 998 | Ga0587111_0267378 | 3300060346 | Bacteria | 512 |
| 999 | Ga0466962_0006714 | 3300061719 | Bacteria | 5517 |
| 1000 | Ga0466962_0174679 | 3300061719 | Bacteria | 1046 |
| 1001 | Ga0466962_0266212 | 3300061719 | Bacteria | 844 |
| 1002 | Ga0530510_1270370 | 3300061734 | Bacteria | 565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100844196 | Ga0070706_1008441962 | 76 |
| 2 | 3300046460 | Ga0495638_0005743 | Ga0495638_0005743_8232_8501 | 76 |
| 3 | 3300046660 | Ga0495625_0044306 | Ga0495625_0044306_764_1033 | 76 |
| 4 | 3300046692 | Ga0495671_0123829 | Ga0495671_0123829_331_600 | 76 |
| 5 | 3300046694 | Ga0495649_0196378 | Ga0495649_0196378_430_699 | 76 |
| 6 | 3300046810 | Ga0495660_0116836 | Ga0495660_0116836_933_1202 | 76 |
| 7 | 3300050493 | nmdc:mga0k408_142318_c1 | nmdc:mga0k408_142318_c1_540_809 | 76 |
| 8 | 3300053727 | Ga0500611_004298 | Ga0500611_004298_1054_1323 | 76 |
| 9 | 3300059493 | Ga0587077_070668 | Ga0587077_070668_452_724 | 76 |
| 10 | 3300059512 | Ga0587092_104265 | Ga0587092_104265_149_421 | 76 |
| 11 | 3300060346 | Ga0587111_0135545 | Ga0587111_0135545_110_382 | 76 |
| 12 | 3300046660 | Ga0495625_0022110 | Ga0495625_0022110_665_934 | 78 |
| 13 | 3300046471 | Ga0495650_0146133 | Ga0495650_0146133_196_468 | 79 |
| 14 | 3300046674 | Ga0495588_0165115 | Ga0495588_0165115_152_424 | 79 |
| 15 | 3300046691 | Ga0495670_0142599 | Ga0495670_0142599_44_316 | 79 |
| 16 | 3300053094 | Ga0500566_0519642 | Ga0500566_0519642_22_294 | 79 |
| 17 | 3300053136 | Ga0500559_0112855 | Ga0500559_0112855_773_1045 | 79 |
| 18 | 3300025915 | Ga0207693_10347130 | Ga0207693_103471302 | 80 |
| 19 | iso_pu_bacteria | 2643221598 | 2643998761 | 80 |
| 20 | iso_pu_bacteria | 2643221614 | 2644087281 | 81 |
| 21 | iso_pu_bacteria | 2643221661 | 2644344675 | 81 |
| 22 | iso_pu_bacteria | 2643221666 | 2644366641 | 81 |
| 23 | 3300001977 | JGI24746J21847_1000324 | JGI24746J21847_10003245 | 82 |
| 24 | 3300005329 | Ga0070683_100016420 | Ga0070683_1000164205 | 82 |
| 25 | 3300005329 | Ga0070683_100063549 | Ga0070683_1000635493 | 82 |
| 26 | 3300005329 | Ga0070683_100166154 | Ga0070683_1001661543 | 82 |
| 27 | 3300005329 | Ga0070683_100932775 | Ga0070683_1009327752 | 82 |
| 28 | 3300005334 | Ga0068869_100416965 | Ga0068869_1004169652 | 82 |
| 29 | 3300005335 | Ga0070666_10011180 | Ga0070666_100111807 | 82 |
| 30 | 3300005338 | Ga0068868_100002347 | Ga0068868_1000023478 | 82 |
| 31 | 3300005340 | Ga0070689_100433727 | Ga0070689_1004337272 | 82 |
| 32 | 3300005354 | Ga0070675_100000028 | Ga0070675_10000002818 | 82 |
| 33 | 3300005356 | Ga0070674_100000002 | Ga0070674_100000002118 | 82 |
| 34 | 3300005364 | Ga0070673_101401080 | Ga0070673_1014010801 | 82 |
| 35 | 3300005364 | Ga0070673_101684586 | Ga0070673_1016845861 | 82 |
| 36 | 3300005365 | Ga0070688_100454848 | Ga0070688_1004548482 | 82 |
| 37 | 3300005366 | Ga0070659_100009501 | Ga0070659_1000095016 | 82 |
| 38 | 3300005436 | Ga0070713_100000058 | Ga0070713_10000005849 | 82 |
| 39 | 3300005441 | Ga0070700_100071247 | Ga0070700_1000712471 | 82 |
| 40 | 3300005455 | Ga0070663_101919697 | Ga0070663_1019196972 | 82 |
| 41 | 3300005456 | Ga0070678_100008208 | Ga0070678_1000082083 | 82 |
| 42 | 3300005466 | Ga0070685_10215289 | Ga0070685_102152893 | 82 |
| 43 | 3300005535 | Ga0070684_100009565 | Ga0070684_1000095653 | 82 |
| 44 | 3300005535 | Ga0070684_100017638 | Ga0070684_1000176383 | 82 |
| 45 | 3300005544 | Ga0070686_100681904 | Ga0070686_1006819042 | 82 |
| 46 | 3300005548 | Ga0070665_100004723 | Ga0070665_1000047234 | 82 |
| 47 | 3300005564 | Ga0070664_100359490 | Ga0070664_1003594903 | 82 |
| 48 | 3300005577 | Ga0068857_100030398 | Ga0068857_1000303983 | 82 |
| 49 | 3300005578 | Ga0068854_100131599 | Ga0068854_1001315992 | 82 |
| 50 | 3300005614 | Ga0068856_100187737 | Ga0068856_1001877372 | 82 |
| 51 | 3300005616 | Ga0068852_100000539 | Ga0068852_10000053911 | 82 |
| 52 | 3300005718 | Ga0068866_10000036 | Ga0068866_1000003627 | 82 |
| 53 | 3300005719 | Ga0068861_101610348 | Ga0068861_1016103482 | 82 |
| 54 | 3300005840 | Ga0068870_10790524 | Ga0068870_107905242 | 82 |
| 55 | 3300005841 | Ga0068863_100000107 | Ga0068863_1000001073 | 82 |
| 56 | 3300005842 | Ga0068858_100000069 | Ga0068858_1000000692 | 82 |
| 57 | 3300006173 | Ga0070716_100014183 | Ga0070716_1000141835 | 82 |
| 58 | 3300006173 | Ga0070716_100352737 | Ga0070716_1003527372 | 82 |
| 59 | 3300006175 | Ga0070712_100002000 | Ga0070712_1000020005 | 82 |
| 60 | 3300006237 | Ga0097621_101532608 | Ga0097621_1015326082 | 82 |
| 61 | 3300006881 | Ga0068865_101464000 | Ga0068865_1014640002 | 82 |
| 62 | 3300009098 | Ga0105245_10766221 | Ga0105245_107662213 | 82 |
| 63 | 3300009101 | Ga0105247_11218550 | Ga0105247_112185501 | 82 |
| 64 | 3300009148 | Ga0105243_10069020 | Ga0105243_100690202 | 82 |
| 65 | 3300009176 | Ga0105242_12105949 | Ga0105242_121059492 | 82 |
| 66 | 3300009177 | Ga0105248_10000175 | Ga0105248_1000017568 | 82 |
| 67 | 3300010375 | Ga0105239_12463115 | Ga0105239_124631151 | 82 |
| 68 | 3300013104 | Ga0157370_10003852 | Ga0157370_100038529 | 82 |
| 69 | 3300013297 | Ga0157378_10005783 | Ga0157378_1000578313 | 82 |
| 70 | 3300013308 | Ga0157375_10000137 | Ga0157375_1000013725 | 82 |
| 71 | 3300013308 | Ga0157375_10234488 | Ga0157375_102344883 | 82 |
| 72 | 3300013308 | Ga0157375_10329398 | Ga0157375_103293983 | 82 |
| 73 | 3300014325 | Ga0163163_10468208 | Ga0163163_104682083 | 82 |
| 74 | 3300014325 | Ga0163163_10897577 | Ga0163163_108975772 | 82 |
| 75 | 3300014326 | Ga0157380_10007574 | Ga0157380_100075742 | 82 |
| 76 | 3300014968 | Ga0157379_10086911 | Ga0157379_100869111 | 82 |
| 77 | 3300014969 | Ga0157376_10264369 | Ga0157376_102643692 | 82 |
| 78 | 3300017792 | Ga0163161_10000027 | Ga0163161_10000027157 | 82 |
| 79 | 3300022467 | Ga0224712_10018482 | Ga0224712_100184822 | 82 |
| 80 | 3300025899 | Ga0207642_10000060 | Ga0207642_1000006023 | 82 |
| 81 | 3300025903 | Ga0207680_10004412 | Ga0207680_100044126 | 82 |
| 82 | 3300025908 | Ga0207643_10659266 | Ga0207643_106592661 | 82 |
| 83 | 3300025915 | Ga0207693_10004030 | Ga0207693_100040305 | 82 |
| 84 | 3300025920 | Ga0207649_10496707 | Ga0207649_104967071 | 82 |
| 85 | 3300025926 | Ga0207659_10000018 | Ga0207659_10000018155 | 82 |
| 86 | 3300025927 | Ga0207687_11435720 | Ga0207687_114357201 | 82 |
| 87 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003442 | 82 |
| 88 | 3300025932 | Ga0207690_10012606 | Ga0207690_100126065 | 82 |
| 89 | 3300025934 | Ga0207686_11220771 | Ga0207686_112207712 | 82 |
| 90 | 3300025935 | Ga0207709_10384833 | Ga0207709_103848332 | 82 |
| 91 | 3300025936 | Ga0207670_10083933 | Ga0207670_100839333 | 82 |
| 92 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003176 | 82 |
| 93 | 3300025939 | Ga0207665_10371411 | Ga0207665_103714112 | 82 |
| 94 | 3300025939 | Ga0207665_10443856 | Ga0207665_104438562 | 82 |
| 95 | 3300025941 | Ga0207711_10000006 | Ga0207711_1000000615 | 82 |
| 96 | 3300025942 | Ga0207689_10120163 | Ga0207689_101201633 | 82 |
| 97 | 3300025944 | Ga0207661_10000774 | Ga0207661_100007745 | 82 |
| 98 | 3300025944 | Ga0207661_10010255 | Ga0207661_100102555 | 82 |
| 99 | 3300025944 | Ga0207661_10045890 | Ga0207661_100458903 | 82 |
| 100 | 3300025944 | Ga0207661_11610162 | Ga0207661_116101621 | 82 |
| 101 | 3300025945 | Ga0207679_10064870 | Ga0207679_100648703 | 82 |
| 102 | 3300025960 | Ga0207651_11129930 | Ga0207651_111299302 | 82 |
| 103 | 3300025960 | Ga0207651_11430805 | Ga0207651_114308052 | 82 |
| 104 | 3300025961 | Ga0207712_10000019 | Ga0207712_10000019206 | 82 |
| 105 | 3300025972 | Ga0207668_10646381 | Ga0207668_106463812 | 82 |
| 106 | 3300025981 | Ga0207640_10111369 | Ga0207640_101113692 | 82 |
| 107 | 3300026023 | Ga0207677_10000361 | Ga0207677_1000036128 | 82 |
| 108 | 3300026035 | Ga0207703_10000169 | Ga0207703_1000016946 | 82 |
| 109 | 3300026067 | Ga0207678_10633354 | Ga0207678_106333543 | 82 |
| 110 | 3300026075 | Ga0207708_10312388 | Ga0207708_103123882 | 82 |
| 111 | 3300026075 | Ga0207708_10818834 | Ga0207708_108188342 | 82 |
| 112 | 3300026078 | Ga0207702_10126043 | Ga0207702_101260432 | 82 |
| 113 | 3300026088 | Ga0207641_10000077 | Ga0207641_1000007732 | 82 |
| 114 | 3300026116 | Ga0207674_10041054 | Ga0207674_100410544 | 82 |
| 115 | 3300026118 | Ga0207675_101438438 | Ga0207675_1014384382 | 82 |
| 116 | 3300026121 | Ga0207683_10006424 | Ga0207683_100064246 | 82 |
| 117 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004294 | 82 |
| 118 | 3300028379 | Ga0268266_10001210 | Ga0268266_1000121034 | 82 |
| 119 | 3300028379 | Ga0268266_10020143 | Ga0268266_100201436 | 82 |
| 120 | 3300031731 | Ga0307405_11375069 | Ga0307405_113750692 | 82 |
| 121 | 3300032002 | Ga0307416_101782689 | Ga0307416_1017826892 | 82 |
| 122 | 3300041463 | Ga0451804_0677918 | Ga0451804_0677918_261_512 | 82 |
| 123 | 3300046454 | Ga0495592_0008902 | Ga0495592_0008902_5728_5979 | 82 |
| 124 | 3300046455 | Ga0495603_0001338 | Ga0495603_0001338_96_347 | 82 |
| 125 | 3300046459 | Ga0495629_0791825 | Ga0495629_0791825_255_506 | 82 |
| 126 | 3300046462 | Ga0495651_0096467 | Ga0495651_0096467_43_294 | 82 |
| 127 | 3300046463 | Ga0495653_0080430 | Ga0495653_0080430_2092_2343 | 82 |
| 128 | 3300046476 | Ga0495662_0047569 | Ga0495662_0047569_704_955 | 82 |
| 129 | 3300046511 | Ga0495608_0009408 | Ga0495608_0009408_113_364 | 82 |
| 130 | 3300046516 | Ga0495628_0071508 | Ga0495628_0071508_460_711 | 82 |
| 131 | 3300046516 | Ga0495628_0557159 | Ga0495628_0557159_23_274 | 82 |
| 132 | 3300046516 | Ga0495628_0784862 | Ga0495628_0784862_337_588 | 82 |
| 133 | 3300046531 | Ga0495665_0550657 | Ga0495665_0550657_98_349 | 82 |
| 134 | 3300046543 | Ga0495645_0479851 | Ga0495645_0479851_482_733 | 82 |
| 135 | 3300046616 | Ga0495668_0518658 | Ga0495668_0518658_313_564 | 82 |
| 136 | 3300046663 | Ga0495635_0742729 | Ga0495635_0742729_105_356 | 82 |
| 137 | 3300046675 | Ga0495657_0016546 | Ga0495657_0016546_3454_3705 | 82 |
| 138 | 3300046679 | Ga0495623_0282827 | Ga0495623_0282827_316_567 | 82 |
| 139 | 3300046689 | Ga0495613_0000094 | Ga0495613_0000094_64900_65151 | 82 |
| 140 | 3300046689 | Ga0495613_0001352 | Ga0495613_0001352_5890_6141 | 82 |
| 141 | 3300046809 | Ga0495600_0277195 | Ga0495600_0277195_354_605 | 82 |
| 142 | 3300047317 | Ga0495604_0000089 | Ga0495604_0000089_69354_69605 | 82 |
| 143 | 3300047317 | Ga0495604_0003648 | Ga0495604_0003648_10579_10830 | 82 |
| 144 | 3300047322 | Ga0495680_0000856 | Ga0495680_0000856_5756_6007 | 82 |
| 145 | 3300047471 | Ga0495684_0765397 | Ga0495684_0765397_21_272 | 82 |
| 146 | 3300047673 | Ga0495593_0135749 | Ga0495593_0135749_356_607 | 82 |
| 147 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_20377_20628 | 82 |
| 148 | 3300048088 | Ga0495602_0549889 | Ga0495602_0549889_19_270 | 82 |
| 149 | 3300048089 | Ga0495614_0543626 | Ga0495614_0543626_197_448 | 82 |
| 150 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_107301_107552 | 82 |
| 151 | 3300048907 | Ga0496104_0059304 | Ga0496104_0059304_2314_2565 | 82 |
| 152 | 3300048907 | Ga0496104_0395457 | Ga0496104_0395457_982_1233 | 82 |
| 153 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_122362_122613 | 82 |
| 154 | 3300048909 | Ga0496106_0000475 | Ga0496106_0000475_1799_2050 | 82 |
| 155 | 3300048910 | Ga0496107_0046800 | Ga0496107_0046800_1342_1593 | 82 |
| 156 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_120500_120751 | 82 |
| 157 | 3300048911 | Ga0496108_0000232 | Ga0496108_0000232_2077_2328 | 82 |
| 158 | 3300048911 | Ga0496108_0015786 | Ga0496108_0015786_5789_6040 | 82 |
| 159 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_293243_293494 | 82 |
| 160 | 3300048912 | Ga0496109_0000044 | Ga0496109_0000044_85985_86236 | 82 |
| 161 | 3300048912 | Ga0496109_0000264 | Ga0496109_0000264_26622_26873 | 82 |
| 162 | 3300048912 | Ga0496109_0213643 | Ga0496109_0213643_373_624 | 82 |
| 163 | 3300048912 | Ga0496109_0300281 | Ga0496109_0300281_1146_1397 | 82 |
| 164 | 3300048922 | Ga0496119_0471420 | Ga0496119_0471420_324_575 | 82 |
| 165 | 3300048928 | Ga0496125_0212168 | Ga0496125_0212168_209_460 | 82 |
| 166 | 3300049578 | Ga0501042_0049172 | Ga0501042_0049172_229_480 | 82 |
| 167 | 3300049584 | Ga0501068_0480032 | Ga0501068_0480032_58_309 | 82 |
| 168 | 3300050492 | nmdc:mga0yw44_801707_c1 | nmdc:mga0yw44_801707_c1_18_269 | 82 |
| 169 | 3300050513 | nmdc:mga0rr50_406491_c1 | nmdc:mga0rr50_406491_c1_691_942 | 82 |
| 170 | 3300053084 | Ga0495595_0002179 | Ga0495595_0002179_5154_5405 | 82 |
| 171 | 3300053085 | Ga0495619_0001825 | Ga0495619_0001825_9967_10218 | 82 |
| 172 | iso_pu_bacteria | 2582581293 | 2585198814 | 82 |
| 173 | iso_pu_bacteria | 2818991435 | 2819537619 | 82 |
| 174 | iso_pu_bacteria | 2818991454 | 2819647395 | 82 |
| 175 | 3300005329 | Ga0070683_100714760 | Ga0070683_1007147602 | 83 |
| 176 | 3300005341 | Ga0070691_10005831 | Ga0070691_100058313 | 83 |
| 177 | 3300005367 | Ga0070667_100030728 | Ga0070667_1000307283 | 83 |
| 178 | 3300005458 | Ga0070681_10115729 | Ga0070681_101157292 | 83 |
| 179 | 3300005530 | Ga0070679_100000461 | Ga0070679_10000046135 | 83 |
| 180 | 3300005539 | Ga0068853_100048939 | Ga0068853_1000489393 | 83 |
| 181 | 3300005548 | Ga0070665_100000040 | Ga0070665_100000040103 | 83 |
| 182 | 3300005548 | Ga0070665_100011815 | Ga0070665_1000118158 | 83 |
| 183 | 3300005563 | Ga0068855_100897910 | Ga0068855_1008979101 | 83 |
| 184 | 3300005614 | Ga0068856_100006911 | Ga0068856_1000069114 | 83 |
| 185 | 3300005719 | Ga0068861_101135889 | Ga0068861_1011358892 | 83 |
| 186 | 3300005842 | Ga0068858_100000526 | Ga0068858_10000052615 | 83 |
| 187 | 3300005843 | Ga0068860_100292278 | Ga0068860_1002922783 | 83 |
| 188 | 3300005844 | Ga0068862_100934228 | Ga0068862_1009342281 | 83 |
| 189 | 3300005937 | Ga0081455_10016739 | Ga0081455_100167392 | 83 |
| 190 | 3300005937 | Ga0081455_10634994 | Ga0081455_106349942 | 83 |
| 191 | 3300005985 | Ga0081539_10071037 | Ga0081539_100710372 | 83 |
| 192 | 3300005985 | Ga0081539_10208170 | Ga0081539_102081702 | 83 |
| 193 | 3300006881 | Ga0068865_100356363 | Ga0068865_1003563632 | 83 |
| 194 | 3300009098 | Ga0105245_10000310 | Ga0105245_100003102 | 83 |
| 195 | 3300009148 | Ga0105243_11788017 | Ga0105243_117880172 | 83 |
| 196 | 3300009176 | Ga0105242_10256474 | Ga0105242_102564742 | 83 |
| 197 | 3300009177 | Ga0105248_11078655 | Ga0105248_110786551 | 83 |
| 198 | 3300009553 | Ga0105249_10009609 | Ga0105249_100096094 | 83 |
| 199 | 3300009553 | Ga0105249_10397947 | Ga0105249_103979472 | 83 |
| 200 | 3300013104 | Ga0157370_10301379 | Ga0157370_103013792 | 83 |
| 201 | 3300013296 | Ga0157374_10004652 | Ga0157374_1000465213 | 83 |
| 202 | 3300013306 | Ga0163162_11358862 | Ga0163162_113588622 | 83 |
| 203 | 3300014325 | Ga0163163_10641795 | Ga0163163_106417953 | 83 |
| 204 | 3300014968 | Ga0157379_10019721 | Ga0157379_100197213 | 83 |
| 205 | 3300014969 | Ga0157376_12943750 | Ga0157376_129437501 | 83 |
| 206 | 3300020070 | Ga0206356_11355552 | Ga0206356_113555523 | 83 |
| 207 | 3300020078 | Ga0206352_10973552 | Ga0206352_109735522 | 83 |
| 208 | 3300025315 | Ga0207697_10275067 | Ga0207697_102750672 | 83 |
| 209 | 3300025912 | Ga0207707_10007406 | Ga0207707_100074069 | 83 |
| 210 | 3300025917 | Ga0207660_10175592 | Ga0207660_101755921 | 83 |
| 211 | 3300025917 | Ga0207660_10532746 | Ga0207660_105327462 | 83 |
| 212 | 3300025919 | Ga0207657_10725261 | Ga0207657_107252612 | 83 |
| 213 | 3300025921 | Ga0207652_10059412 | Ga0207652_100594122 | 83 |
| 214 | 3300025927 | Ga0207687_10000079 | Ga0207687_100000792 | 83 |
| 215 | 3300025934 | Ga0207686_10346586 | Ga0207686_103465862 | 83 |
| 216 | 3300025938 | Ga0207704_10442147 | Ga0207704_104421472 | 83 |
| 217 | 3300025941 | Ga0207711_10901628 | Ga0207711_109016282 | 83 |
| 218 | 3300025944 | Ga0207661_10000693 | Ga0207661_1000069314 | 83 |
| 219 | 3300025949 | Ga0207667_10319847 | Ga0207667_103198471 | 83 |
| 220 | 3300025961 | Ga0207712_11088134 | Ga0207712_110881341 | 83 |
| 221 | 3300025961 | Ga0207712_11341447 | Ga0207712_113414472 | 83 |
| 222 | 3300025972 | Ga0207668_10427457 | Ga0207668_104274572 | 83 |
| 223 | 3300025986 | Ga0207658_10014433 | Ga0207658_100144333 | 83 |
| 224 | 3300026035 | Ga0207703_10000170 | Ga0207703_1000017052 | 83 |
| 225 | 3300026041 | Ga0207639_10010622 | Ga0207639_100106224 | 83 |
| 226 | 3300026078 | Ga0207702_10003690 | Ga0207702_100036909 | 83 |
| 227 | 3300026118 | Ga0207675_100554658 | Ga0207675_1005546582 | 83 |
| 228 | 3300028379 | Ga0268266_10000045 | Ga0268266_10000045106 | 83 |
| 229 | 3300028379 | Ga0268266_10063407 | Ga0268266_100634074 | 83 |
| 230 | 3300028380 | Ga0268265_10027175 | Ga0268265_100271754 | 83 |
| 231 | 3300028381 | Ga0268264_11430402 | Ga0268264_114304021 | 83 |
| 232 | 3300028556 | Ga0265337_1137074 | Ga0265337_11370741 | 83 |
| 233 | 3300028558 | Ga0265326_10000079 | Ga0265326_100000794 | 83 |
| 234 | 3300028654 | Ga0265322_10000004 | Ga0265322_10000004114 | 83 |
| 235 | 3300028666 | Ga0265336_10202260 | Ga0265336_102022601 | 83 |
| 236 | 3300029957 | Ga0265324_10011479 | Ga0265324_100114794 | 83 |
| 237 | 3300031238 | Ga0265332_10036105 | Ga0265332_100361051 | 83 |
| 238 | 3300031239 | Ga0265328_10006864 | Ga0265328_100068641 | 83 |
| 239 | 3300031240 | Ga0265320_10000029 | Ga0265320_10000029112 | 83 |
| 240 | 3300031249 | Ga0265339_10391369 | Ga0265339_103913692 | 83 |
| 241 | 3300031251 | Ga0265327_10000723 | Ga0265327_100007234 | 83 |
| 242 | 3300031344 | Ga0265316_10034072 | Ga0265316_100340723 | 83 |
| 243 | 3300031691 | Ga0316579_10392193 | Ga0316579_103921931 | 83 |
| 244 | 3300031711 | Ga0265314_10000484 | Ga0265314_100004844 | 83 |
| 245 | 3300031727 | Ga0316576_10023751 | Ga0316576_100237514 | 83 |
| 246 | 3300035398 | Ga0316574_0565862 | Ga0316574_0565862_289_543 | 83 |
| 247 | 3300036647 | Ga0316582_0832302 | Ga0316582_0832302_75_329 | 83 |
| 248 | 3300036647 | Ga0316582_1152383 | Ga0316582_1152383_230_484 | 83 |
| 249 | 3300036712 | Ga0316584_0016821 | Ga0316584_0016821_2427_2681 | 83 |
| 250 | 3300041512 | Ga0451853_0956394 | Ga0451853_0956394_64_318 | 83 |
| 251 | 3300044842 | Ga0466957_0005133 | Ga0466957_0005133_2157_2411 | 83 |
| 252 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_76895_77149 | 83 |
| 253 | 3300046461 | Ga0495641_0460883 | Ga0495641_0460883_49_303 | 83 |
| 254 | 3300046462 | Ga0495651_0590045 | Ga0495651_0590045_414_668 | 83 |
| 255 | 3300046463 | Ga0495653_0453694 | Ga0495653_0453694_534_788 | 83 |
| 256 | 3300046476 | Ga0495662_0005830 | Ga0495662_0005830_5720_5974 | 83 |
| 257 | 3300046499 | Ga0495594_0000006 | Ga0495594_0000006_40241_40495 | 83 |
| 258 | 3300046500 | Ga0495596_0224590 | Ga0495596_0224590_268_522 | 83 |
| 259 | 3300046511 | Ga0495608_0157440 | Ga0495608_0157440_76_330 | 83 |
| 260 | 3300046516 | Ga0495628_0000437 | Ga0495628_0000437_37590_37844 | 83 |
| 261 | 3300046516 | Ga0495628_0014714 | Ga0495628_0014714_4754_5008 | 83 |
| 262 | 3300046517 | Ga0495630_0011760 | Ga0495630_0011760_1553_1807 | 83 |
| 263 | 3300046517 | Ga0495630_0070399 | Ga0495630_0070399_380_634 | 83 |
| 264 | 3300046523 | Ga0495644_0001542 | Ga0495644_0001542_7603_7857 | 83 |
| 265 | 3300046535 | Ga0495586_0001281 | Ga0495586_0001281_12349_12603 | 83 |
| 266 | 3300046557 | Ga0495622_0000132 | Ga0495622_0000132_13624_13878 | 83 |
| 267 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_224211_224465 | 83 |
| 268 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_203559_203813 | 83 |
| 269 | 3300046678 | Ga0495599_0005994 | Ga0495599_0005994_2241_2495 | 83 |
| 270 | 3300046681 | Ga0495647_0000009 | Ga0495647_0000009_66332_66586 | 83 |
| 271 | 3300046690 | Ga0495624_0001301 | Ga0495624_0001301_19329_19583 | 83 |
| 272 | 3300046690 | Ga0495624_0095836 | Ga0495624_0095836_1119_1373 | 83 |
| 273 | 3300046691 | Ga0495670_0010128 | Ga0495670_0010128_3790_4044 | 83 |
| 274 | 3300046809 | Ga0495600_0021782 | Ga0495600_0021782_3695_3949 | 83 |
| 275 | 3300047317 | Ga0495604_0012257 | Ga0495604_0012257_2145_2399 | 83 |
| 276 | 3300047321 | Ga0495676_0000136 | Ga0495676_0000136_36826_37080 | 83 |
| 277 | 3300047321 | Ga0495676_0584712 | Ga0495676_0584712_429_683 | 83 |
| 278 | 3300047322 | Ga0495680_0010286 | Ga0495680_0010286_48_302 | 83 |
| 279 | 3300047446 | Ga0495679_033232 | Ga0495679_033232_31_285 | 83 |
| 280 | 3300047471 | Ga0495684_0257963 | Ga0495684_0257963_563_817 | 83 |
| 281 | 3300047471 | Ga0495684_0725531 | Ga0495684_0725531_34_288 | 83 |
| 282 | 3300048088 | Ga0495602_0004094 | Ga0495602_0004094_224_478 | 83 |
| 283 | 3300048088 | Ga0495602_0042761 | Ga0495602_0042761_309_563 | 83 |
| 284 | 3300048906 | Ga0496103_0682240 | Ga0496103_0682240_137_391 | 83 |
| 285 | 3300048908 | Ga0496105_0869578 | Ga0496105_0869578_268_522 | 83 |
| 286 | 3300048909 | Ga0496106_0774429 | Ga0496106_0774429_217_471 | 83 |
| 287 | 3300048912 | Ga0496109_1739909 | Ga0496109_1739909_110_364 | 83 |
| 288 | 3300048913 | Ga0496110_0076401 | Ga0496110_0076401_20_274 | 83 |
| 289 | 3300048913 | Ga0496110_0702978 | Ga0496110_0702978_531_785 | 83 |
| 290 | 3300048914 | Ga0496111_0694219 | Ga0496111_0694219_197_451 | 83 |
| 291 | 3300048917 | Ga0496114_0002941 | Ga0496114_0002941_12317_12571 | 83 |
| 292 | 3300048918 | Ga0496115_0004971 | Ga0496115_0004971_6500_6754 | 83 |
| 293 | 3300049578 | Ga0501042_0394548 | Ga0501042_0394548_467_721 | 83 |
| 294 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_189272_189526 | 83 |
| 295 | 3300053077 | Ga0495601_0000330 | Ga0495601_0000330_10889_11143 | 83 |
| 296 | 3300053123 | Ga0500614_000632 | Ga0500614_000632_8660_8914 | 83 |
| 297 | 3300005367 | Ga0070667_100325131 | Ga0070667_1003251312 | 84 |
| 298 | 3300005455 | Ga0070663_100625906 | Ga0070663_1006259062 | 84 |
| 299 | 3300005563 | Ga0068855_102601919 | Ga0068855_1026019191 | 84 |
| 300 | 3300006846 | Ga0075430_101679919 | Ga0075430_1016799191 | 84 |
| 301 | 3300009093 | Ga0105240_10000679 | Ga0105240_100006793 | 84 |
| 302 | 3300009174 | Ga0105241_10423518 | Ga0105241_104235182 | 84 |
| 303 | 3300009177 | Ga0105248_10689378 | Ga0105248_106893782 | 84 |
| 304 | 3300009551 | Ga0105238_10327059 | Ga0105238_103270592 | 84 |
| 305 | 3300010375 | Ga0105239_10770120 | Ga0105239_107701202 | 84 |
| 306 | 3300025913 | Ga0207695_10004225 | Ga0207695_100042254 | 84 |
| 307 | 3300025913 | Ga0207695_11476108 | Ga0207695_114761081 | 84 |
| 308 | 3300025924 | Ga0207694_10214695 | Ga0207694_102146952 | 84 |
| 309 | 3300025940 | Ga0207691_10000002 | Ga0207691_10000002118 | 84 |
| 310 | 3300025941 | Ga0207711_10724499 | Ga0207711_107244992 | 84 |
| 311 | 3300025986 | Ga0207658_10753113 | Ga0207658_107531132 | 84 |
| 312 | 3300031251 | Ga0265327_10000287 | Ga0265327_1000028773 | 84 |
| 313 | 3300033541 | Ga0316596_1123774 | Ga0316596_11237741 | 84 |
| 314 | 3300035398 | Ga0316574_0235089 | Ga0316574_0235089_655_912 | 84 |
| 315 | 3300047444 | Ga0495675_0073901 | Ga0495675_0073901_342_599 | 84 |
| 316 | 3300049570 | Ga0501033_0086870 | Ga0501033_0086870_670_933 | 84 |
| 317 | 3300053119 | Ga0500595_001246 | Ga0500595_001246_6769_7032 | 84 |
| 318 | 3300059510 | Ga0587090_097035 | Ga0587090_097035_176_442 | 84 |
| 319 | 3300059512 | Ga0587092_118862 | Ga0587092_118862_145_411 | 84 |
| 320 | 3300059607 | Ga0587125_069606 | Ga0587125_069606_49_315 | 84 |
| 321 | 3300059655 | Ga0587114_134656 | Ga0587114_134656_189_455 | 84 |
| 322 | 3300060346 | Ga0587111_0267378 | Ga0587111_0267378_56_322 | 84 |
| 323 | 3300061734 | Ga0530510_1270370 | Ga0530510_1270370_62_319 | 84 |
| 324 | 3300009545 | Ga0105237_10555144 | Ga0105237_105551441 | 85 |
| 325 | 3300012481 | Ga0157320_1016578 | Ga0157320_10165782 | 85 |
| 326 | 3300031239 | Ga0265328_10318040 | Ga0265328_103180402 | 85 |
| 327 | 3300031241 | Ga0265325_10063783 | Ga0265325_100637833 | 85 |
| 328 | 3300031247 | Ga0265340_10290420 | Ga0265340_102904202 | 85 |
| 329 | 3300031344 | Ga0265316_10109954 | Ga0265316_101099541 | 85 |
| 330 | 3300031711 | Ga0265314_10057533 | Ga0265314_100575332 | 85 |
| 331 | 3300031901 | Ga0307406_10535895 | Ga0307406_105358952 | 85 |
| 332 | 3300035088 | Ga0373940_0033196 | Ga0373940_0033196_614_871 | 85 |
| 333 | 3300035114 | Ga0373939_0082754 | Ga0373939_0082754_585_842 | 85 |
| 334 | 3300039438 | Ga0436360_0189994 | Ga0436360_0189994_603_866 | 85 |
| 335 | 3300045051 | Ga0451576_1542699 | Ga0451576_1542699_132_389 | 85 |
| 336 | 3300046684 | Ga0495669_0000014 | Ga0495669_0000014_27908_28174 | 85 |
| 337 | 3300046684 | Ga0495669_0095358 | Ga0495669_0095358_693_950 | 85 |
| 338 | 3300047445 | Ga0495677_0032530 | Ga0495677_0032530_224_490 | 85 |
| 339 | 3300003323 | rootH1_10216558 | rootH1_102165582 | 86 |
| 340 | 3300005334 | Ga0068869_100184472 | Ga0068869_1001844722 | 86 |
| 341 | 3300005344 | Ga0070661_100721965 | Ga0070661_1007219652 | 86 |
| 342 | 3300005344 | Ga0070661_101234163 | Ga0070661_1012341631 | 86 |
| 343 | 3300005347 | Ga0070668_101902611 | Ga0070668_1019026111 | 86 |
| 344 | 3300005354 | Ga0070675_100340652 | Ga0070675_1003406523 | 86 |
| 345 | 3300005364 | Ga0070673_100088435 | Ga0070673_1000884353 | 86 |
| 346 | 3300005366 | Ga0070659_100594061 | Ga0070659_1005940612 | 86 |
| 347 | 3300005441 | Ga0070700_100076081 | Ga0070700_1000760813 | 86 |
| 348 | 3300005456 | Ga0070678_101403683 | Ga0070678_1014036832 | 86 |
| 349 | 3300005456 | Ga0070678_101783160 | Ga0070678_1017831601 | 86 |
| 350 | 3300005459 | Ga0068867_100929217 | Ga0068867_1009292172 | 86 |
| 351 | 3300005466 | Ga0070685_10158172 | Ga0070685_101581723 | 86 |
| 352 | 3300005539 | Ga0068853_100037066 | Ga0068853_1000370664 | 86 |
| 353 | 3300005544 | Ga0070686_100219355 | Ga0070686_1002193552 | 86 |
| 354 | 3300005577 | Ga0068857_100540747 | Ga0068857_1005407472 | 86 |
| 355 | 3300005578 | Ga0068854_100241760 | Ga0068854_1002417603 | 86 |
| 356 | 3300005614 | Ga0068856_100192860 | Ga0068856_1001928604 | 86 |
| 357 | 3300005616 | Ga0068852_101834273 | Ga0068852_1018342732 | 86 |
| 358 | 3300005840 | Ga0068870_10119561 | Ga0068870_101195613 | 86 |
| 359 | 3300005842 | Ga0068858_101112043 | Ga0068858_1011120432 | 86 |
| 360 | 3300006881 | Ga0068865_100295944 | Ga0068865_1002959442 | 86 |
| 361 | 3300009093 | Ga0105240_12322411 | Ga0105240_123224111 | 86 |
| 362 | 3300009098 | Ga0105245_11223792 | Ga0105245_112237922 | 86 |
| 363 | 3300009176 | Ga0105242_10839100 | Ga0105242_108391002 | 86 |
| 364 | 3300009551 | Ga0105238_10345064 | Ga0105238_103450642 | 86 |
| 365 | 3300013104 | Ga0157370_10440303 | Ga0157370_104403032 | 86 |
| 366 | 3300014325 | Ga0163163_10932181 | Ga0163163_109321812 | 86 |
| 367 | 3300014326 | Ga0157380_11825896 | Ga0157380_118258962 | 86 |
| 368 | 3300025901 | Ga0207688_10452551 | Ga0207688_104525511 | 86 |
| 369 | 3300025907 | Ga0207645_10077821 | Ga0207645_100778212 | 86 |
| 370 | 3300025911 | Ga0207654_10542261 | Ga0207654_105422612 | 86 |
| 371 | 3300025923 | Ga0207681_11278580 | Ga0207681_112785802 | 86 |
| 372 | 3300025924 | Ga0207694_10256603 | Ga0207694_102566033 | 86 |
| 373 | 3300025926 | Ga0207659_10259588 | Ga0207659_102595883 | 86 |
| 374 | 3300025927 | Ga0207687_11428646 | Ga0207687_114286462 | 86 |
| 375 | 3300025934 | Ga0207686_10255109 | Ga0207686_102551093 | 86 |
| 376 | 3300025936 | Ga0207670_10002339 | Ga0207670_100023392 | 86 |
| 377 | 3300025937 | Ga0207669_10317154 | Ga0207669_103171542 | 86 |
| 378 | 3300025938 | Ga0207704_10010816 | Ga0207704_100108164 | 86 |
| 379 | 3300025941 | Ga0207711_10809128 | Ga0207711_108091282 | 86 |
| 380 | 3300025942 | Ga0207689_10199604 | Ga0207689_101996043 | 86 |
| 381 | 3300025945 | Ga0207679_10347297 | Ga0207679_103472972 | 86 |
| 382 | 3300025960 | Ga0207651_10394705 | Ga0207651_103947052 | 86 |
| 383 | 3300025972 | Ga0207668_11987327 | Ga0207668_119873271 | 86 |
| 384 | 3300025981 | Ga0207640_10686642 | Ga0207640_106866422 | 86 |
| 385 | 3300025986 | Ga0207658_10422709 | Ga0207658_104227091 | 86 |
| 386 | 3300026041 | Ga0207639_10016225 | Ga0207639_100162255 | 86 |
| 387 | 3300026075 | Ga0207708_10022830 | Ga0207708_100228303 | 86 |
| 388 | 3300026078 | Ga0207702_10154757 | Ga0207702_101547574 | 86 |
| 389 | 3300026089 | Ga0207648_10088874 | Ga0207648_100888743 | 86 |
| 390 | 3300026095 | Ga0207676_11495132 | Ga0207676_114951321 | 86 |
| 391 | 3300031456 | Ga0307513_10000873 | Ga0307513_100008733 | 86 |
| 392 | 3300033180 | Ga0307510_10200659 | Ga0307510_102006592 | 86 |
| 393 | 3300035691 | Ga0373931_0524431 | Ga0373931_0524431_80_349 | 86 |
| 394 | 3300035692 | Ga0373935_1487928 | Ga0373935_1487928_93_371 | 86 |
| 395 | 3300037312 | Ga0395899_0680639 | Ga0395899_0680639_269_538 | 86 |
| 396 | 3300037471 | Ga0395905_0000022 | Ga0395905_0000022_108954_109223 | 86 |
| 397 | 3300039450 | Ga0436363_0763861 | Ga0436363_0763861_228_503 | 86 |
| 398 | 3300041486 | Ga0451807_0534070 | Ga0451807_0534070_86_355 | 86 |
| 399 | 3300041509 | Ga0451843_0090988 | Ga0451843_0090988_118_387 | 86 |
| 400 | 3300041511 | Ga0451855_1286586 | Ga0451855_1286586_253_522 | 86 |
| 401 | 3300041512 | Ga0451853_1991594 | Ga0451853_1991594_120_389 | 86 |
| 402 | 3300044656 | Ga0466969_0015922 | Ga0466969_0015922_825_1094 | 86 |
| 403 | 3300044684 | Ga0466966_0003014 | Ga0466966_0003014_10142_10411 | 86 |
| 404 | 3300044684 | Ga0466966_0070352 | Ga0466966_0070352_1418_1681 | 86 |
| 405 | 3300044693 | Ga0466961_0002790 | Ga0466961_0002790_5873_6142 | 86 |
| 406 | 3300044693 | Ga0466961_0217535 | Ga0466961_0217535_560_823 | 86 |
| 407 | 3300044694 | Ga0466963_0388530 | Ga0466963_0388530_355_618 | 86 |
| 408 | 3300044719 | Ga0466971_0239006 | Ga0466971_0239006_25_294 | 86 |
| 409 | 3300044765 | Ga0466970_0026932 | Ga0466970_0026932_940_1209 | 86 |
| 410 | 3300044842 | Ga0466957_0001331 | Ga0466957_0001331_989_1258 | 86 |
| 411 | 3300044842 | Ga0466957_0146347 | Ga0466957_0146347_494_757 | 86 |
| 412 | 3300045049 | Ga0466959_0000086 | Ga0466959_0000086_2497_2766 | 86 |
| 413 | 3300045836 | Ga0466958_0026304 | Ga0466958_0026304_1637_1906 | 86 |
| 414 | 3300045836 | Ga0466958_0064044 | Ga0466958_0064044_1790_2053 | 86 |
| 415 | 3300046537 | Ga0495598_0197989 | Ga0495598_0197989_380_649 | 86 |
| 416 | 3300046539 | Ga0495621_0059748 | Ga0495621_0059748_855_1124 | 86 |
| 417 | 3300046616 | Ga0495668_0351926 | Ga0495668_0351926_178_447 | 86 |
| 418 | 3300048929 | Ga0496126_0519431 | Ga0496126_0519431_327_596 | 86 |
| 419 | 3300049527 | Ga0501311_018393 | Ga0501311_018393_32_301 | 86 |
| 420 | 3300049570 | Ga0501033_0454733 | Ga0501033_0454733_443_712 | 86 |
| 421 | 3300049572 | Ga0501036_0724036 | Ga0501036_0724036_39_308 | 86 |
| 422 | 3300049579 | Ga0501043_0238512 | Ga0501043_0238512_1093_1362 | 86 |
| 423 | 3300049580 | Ga0501046_0255718 | Ga0501046_0255718_919_1188 | 86 |
| 424 | 3300049822 | Ga0501035_0200644 | Ga0501035_0200644_1362_1631 | 86 |
| 425 | 3300053087 | Ga0500643_000458 | Ga0500643_000458_13247_13516 | 86 |
| 426 | 3300053087 | Ga0500643_010973 | Ga0500643_010973_421_690 | 86 |
| 427 | 3300053096 | Ga0500641_0013819 | Ga0500641_0013819_503_772 | 86 |
| 428 | 3300053104 | Ga0500556_0002351 | Ga0500556_0002351_4537_4806 | 86 |
| 429 | 3300053104 | Ga0500556_0184820 | Ga0500556_0184820_485_754 | 86 |
| 430 | 3300053108 | Ga0500562_007299 | Ga0500562_007299_1402_1671 | 86 |
| 431 | 3300053108 | Ga0500562_025091 | Ga0500562_025091_892_1161 | 86 |
| 432 | 3300053122 | Ga0500608_145794 | Ga0500608_145794_657_926 | 86 |
| 433 | 3300053131 | Ga0500652_168923 | Ga0500652_168923_486_755 | 86 |
| 434 | 3300053151 | Ga0500604_0142412 | Ga0500604_0142412_527_796 | 86 |
| 435 | 3300053153 | Ga0500616_0038008 | Ga0500616_0038008_109_378 | 86 |
| 436 | 3300053153 | Ga0500616_0107210 | Ga0500616_0107210_578_847 | 86 |
| 437 | 3300053156 | Ga0500622_0145153 | Ga0500622_0145153_821_1090 | 86 |
| 438 | 3300053730 | Ga0500645_003040 | Ga0500645_003040_3435_3704 | 86 |
| 439 | 3300053730 | Ga0500645_171922 | Ga0500645_171922_201_470 | 86 |
| 440 | 3300059477 | Ga0587084_076453 | Ga0587084_076453_302_571 | 86 |
| 441 | 3300059478 | Ga0587093_026630 | Ga0587093_026630_265_534 | 86 |
| 442 | 3300059491 | Ga0587070_102259 | Ga0587070_102259_252_521 | 86 |
| 443 | 3300059493 | Ga0587077_158703 | Ga0587077_158703_49_318 | 86 |
| 444 | 3300059505 | Ga0587083_0150442 | Ga0587083_0150442_325_594 | 86 |
| 445 | 3300059510 | Ga0587090_057540 | Ga0587090_057540_187_456 | 86 |
| 446 | 3300059624 | Ga0587109_219214 | Ga0587109_219214_199_468 | 86 |
| 447 | 3300059639 | Ga0587062_082834 | Ga0587062_082834_224_493 | 86 |
| 448 | 3300059641 | Ga0587068_090154 | Ga0587068_090154_85_354 | 86 |
| 449 | 3300059643 | Ga0587072_204585 | Ga0587072_204585_59_328 | 86 |
| 450 | 3300059645 | Ga0587076_030973 | Ga0587076_030973_285_554 | 86 |
| 451 | 3300061719 | Ga0466962_0006714 | Ga0466962_0006714_2793_3062 | 86 |
| 452 | 3300061719 | Ga0466962_0266212 | Ga0466962_0266212_307_570 | 86 |
| 453 | 3300005327 | Ga0070658_10038677 | Ga0070658_100386773 | 87 |
| 454 | 3300005327 | Ga0070658_10875618 | Ga0070658_108756181 | 87 |
| 455 | 3300005329 | Ga0070683_100710425 | Ga0070683_1007104251 | 87 |
| 456 | 3300005336 | Ga0070680_100012704 | Ga0070680_1000127048 | 87 |
| 457 | 3300005339 | Ga0070660_101159559 | Ga0070660_1011595592 | 87 |
| 458 | 3300005458 | Ga0070681_10013326 | Ga0070681_100133269 | 87 |
| 459 | 3300005535 | Ga0070684_101263314 | Ga0070684_1012633142 | 87 |
| 460 | 3300005539 | Ga0068853_100171967 | Ga0068853_1001719671 | 87 |
| 461 | 3300005545 | Ga0070695_100862319 | Ga0070695_1008623192 | 87 |
| 462 | 3300005548 | Ga0070665_100018730 | Ga0070665_1000187304 | 87 |
| 463 | 3300005563 | Ga0068855_100023693 | Ga0068855_1000236936 | 87 |
| 464 | 3300005563 | Ga0068855_100508201 | Ga0068855_1005082012 | 87 |
| 465 | 3300005577 | Ga0068857_101955562 | Ga0068857_1019555622 | 87 |
| 466 | 3300005578 | Ga0068854_100333838 | Ga0068854_1003338382 | 87 |
| 467 | 3300005614 | Ga0068856_102278804 | Ga0068856_1022788041 | 87 |
| 468 | 3300005614 | Ga0068856_102409057 | Ga0068856_1024090571 | 87 |
| 469 | 3300005616 | Ga0068852_101654697 | Ga0068852_1016546972 | 87 |
| 470 | 3300005616 | Ga0068852_101935920 | Ga0068852_1019359202 | 87 |
| 471 | 3300005618 | Ga0068864_102134671 | Ga0068864_1021346711 | 87 |
| 472 | 3300005844 | Ga0068862_100042579 | Ga0068862_1000425791 | 87 |
| 473 | 3300009093 | Ga0105240_10061517 | Ga0105240_100615173 | 87 |
| 474 | 3300009093 | Ga0105240_10228697 | Ga0105240_102286972 | 87 |
| 475 | 3300009098 | Ga0105245_11876879 | Ga0105245_118768791 | 87 |
| 476 | 3300009148 | Ga0105243_12111823 | Ga0105243_121118231 | 87 |
| 477 | 3300009176 | Ga0105242_11228048 | Ga0105242_112280482 | 87 |
| 478 | 3300009177 | Ga0105248_11654977 | Ga0105248_116549771 | 87 |
| 479 | 3300009545 | Ga0105237_11270995 | Ga0105237_112709952 | 87 |
| 480 | 3300009551 | Ga0105238_10144704 | Ga0105238_101447041 | 87 |
| 481 | 3300009551 | Ga0105238_10333177 | Ga0105238_103331772 | 87 |
| 482 | 3300009551 | Ga0105238_11130117 | Ga0105238_111301172 | 87 |
| 483 | 3300009553 | Ga0105249_13278100 | Ga0105249_132781001 | 87 |
| 484 | 3300013100 | Ga0157373_10002536 | Ga0157373_1000253617 | 87 |
| 485 | 3300013104 | Ga0157370_10109059 | Ga0157370_101090592 | 87 |
| 486 | 3300013104 | Ga0157370_10479742 | Ga0157370_104797422 | 87 |
| 487 | 3300013104 | Ga0157370_11102487 | Ga0157370_111024872 | 87 |
| 488 | 3300013104 | Ga0157370_11990422 | Ga0157370_119904221 | 87 |
| 489 | 3300013296 | Ga0157374_12378826 | Ga0157374_123788261 | 87 |
| 490 | 3300013307 | Ga0157372_10093929 | Ga0157372_100939292 | 87 |
| 491 | 3300013307 | Ga0157372_13047628 | Ga0157372_130476282 | 87 |
| 492 | 3300014326 | Ga0157380_11932763 | Ga0157380_119327632 | 87 |
| 493 | 3300014497 | Ga0182008_10955409 | Ga0182008_109554092 | 87 |
| 494 | 3300021377 | Ga0213874_10129590 | Ga0213874_101295901 | 87 |
| 495 | 3300021377 | Ga0213874_10349288 | Ga0213874_103492881 | 87 |
| 496 | 3300021384 | Ga0213876_10000568 | Ga0213876_1000056817 | 87 |
| 497 | 3300021384 | Ga0213876_10641129 | Ga0213876_106411291 | 87 |
| 498 | 3300021388 | Ga0213875_10367830 | Ga0213875_103678302 | 87 |
| 499 | 3300025254 | Ga0209148_1006910 | Ga0209148_10069102 | 87 |
| 500 | 3300025254 | Ga0209148_1018139 | Ga0209148_10181392 | 87 |
| 501 | 3300025272 | Ga0209455_1054995 | Ga0209455_10549951 | 87 |
| 502 | 3300025909 | Ga0207705_10031767 | Ga0207705_100317673 | 87 |
| 503 | 3300025909 | Ga0207705_10321194 | Ga0207705_103211942 | 87 |
| 504 | 3300025912 | Ga0207707_10072729 | Ga0207707_100727294 | 87 |
| 505 | 3300025913 | Ga0207695_10217410 | Ga0207695_102174102 | 87 |
| 506 | 3300025913 | Ga0207695_10662474 | Ga0207695_106624742 | 87 |
| 507 | 3300025917 | Ga0207660_10082116 | Ga0207660_100821162 | 87 |
| 508 | 3300025917 | Ga0207660_10949207 | Ga0207660_109492072 | 87 |
| 509 | 3300025919 | Ga0207657_11440744 | Ga0207657_114407441 | 87 |
| 510 | 3300025924 | Ga0207694_11185616 | Ga0207694_111856162 | 87 |
| 511 | 3300025949 | Ga0207667_10044451 | Ga0207667_100444515 | 87 |
| 512 | 3300025949 | Ga0207667_10263395 | Ga0207667_102633951 | 87 |
| 513 | 3300025972 | Ga0207668_10006047 | Ga0207668_100060471 | 87 |
| 514 | 3300026041 | Ga0207639_10133544 | Ga0207639_101335443 | 87 |
| 515 | 3300026041 | Ga0207639_11264446 | Ga0207639_112644462 | 87 |
| 516 | 3300026078 | Ga0207702_10397749 | Ga0207702_103977492 | 87 |
| 517 | 3300026078 | Ga0207702_11553126 | Ga0207702_115531262 | 87 |
| 518 | 3300026095 | Ga0207676_12045022 | Ga0207676_120450221 | 87 |
| 519 | 3300026142 | Ga0207698_10694156 | Ga0207698_106941561 | 87 |
| 520 | 3300026142 | Ga0207698_11639606 | Ga0207698_116396062 | 87 |
| 521 | 3300028380 | Ga0268265_10639200 | Ga0268265_106392001 | 87 |
| 522 | 3300028800 | Ga0265338_10053005 | Ga0265338_100530052 | 87 |
| 523 | 3300031240 | Ga0265320_10180939 | Ga0265320_101809392 | 87 |
| 524 | 3300031251 | Ga0265327_10000868 | Ga0265327_1000086827 | 87 |
| 525 | 3300031344 | Ga0265316_11037918 | Ga0265316_110379181 | 87 |
| 526 | 3300031730 | Ga0307516_10000030 | Ga0307516_10000030116 | 87 |
| 527 | 3300031901 | Ga0307406_10753607 | Ga0307406_107536071 | 87 |
| 528 | 3300032002 | Ga0307416_101209772 | Ga0307416_1012097721 | 87 |
| 529 | 3300032002 | Ga0307416_103053825 | Ga0307416_1030538251 | 87 |
| 530 | 3300033180 | Ga0307510_10087941 | Ga0307510_100879412 | 87 |
| 531 | 3300035171 | Ga0373946_0501511 | Ga0373946_0501511_55_327 | 87 |
| 532 | 3300035691 | Ga0373931_1029803 | Ga0373931_1029803_182_457 | 87 |
| 533 | 3300035725 | Ga0373947_0027745 | Ga0373947_0027745_1746_2018 | 87 |
| 534 | 3300037068 | Ga0373925_0163729 | Ga0373925_0163729_634_906 | 87 |
| 535 | 3300037312 | Ga0395899_0095773 | Ga0395899_0095773_1169_1441 | 87 |
| 536 | 3300037312 | Ga0395899_0099667 | Ga0395899_0099667_1408_1680 | 87 |
| 537 | 3300037418 | Ga0395900_0139862 | Ga0395900_0139862_2095_2367 | 87 |
| 538 | 3300037418 | Ga0395900_0195571 | Ga0395900_0195571_30_302 | 87 |
| 539 | 3300037418 | Ga0395900_0575235 | Ga0395900_0575235_462_734 | 87 |
| 540 | 3300037466 | Ga0395898_0238514 | Ga0395898_0238514_485_757 | 87 |
| 541 | 3300037466 | Ga0395898_0901049 | Ga0395898_0901049_112_384 | 87 |
| 542 | 3300037471 | Ga0395905_0043114 | Ga0395905_0043114_3710_3982 | 87 |
| 543 | 3300037471 | Ga0395905_0043133 | Ga0395905_0043133_3510_3782 | 87 |
| 544 | 3300037471 | Ga0395905_0151539 | Ga0395905_0151539_1544_1816 | 87 |
| 545 | 3300037853 | Ga0436364_0175783 | Ga0436364_0175783_303_572 | 87 |
| 546 | 3300037853 | Ga0436364_0576095 | Ga0436364_0576095_249_518 | 87 |
| 547 | 3300038443 | Ga0395901_0134281 | Ga0395901_0134281_1890_2162 | 87 |
| 548 | 3300038443 | Ga0395901_0230784 | Ga0395901_0230784_645_917 | 87 |
| 549 | 3300038443 | Ga0395901_1098893 | Ga0395901_1098893_256_528 | 87 |
| 550 | 3300039437 | Ga0436365_0422229 | Ga0436365_0422229_1338_1610 | 87 |
| 551 | 3300039437 | Ga0436365_0425122 | Ga0436365_0425122_499_771 | 87 |
| 552 | 3300039438 | Ga0436360_1355634 | Ga0436360_1355634_1335_1610 | 87 |
| 553 | 3300039447 | Ga0436361_0319149 | Ga0436361_0319149_148_420 | 87 |
| 554 | 3300039447 | Ga0436361_0486019 | Ga0436361_0486019_1767_2048 | 87 |
| 555 | 3300039447 | Ga0436361_1066444 | Ga0436361_1066444_27_311 | 87 |
| 556 | 3300039450 | Ga0436363_0526126 | Ga0436363_0526126_101_370 | 87 |
| 557 | 3300039450 | Ga0436363_0939738 | Ga0436363_0939738_2584_2853 | 87 |
| 558 | 3300041491 | Ga0451833_0408238 | Ga0451833_0408238_257_529 | 87 |
| 559 | 3300041494 | Ga0451837_1468072 | Ga0451837_1468072_127_399 | 87 |
| 560 | 3300044683 | Ga0466965_0141460 | Ga0466965_0141460_325_597 | 87 |
| 561 | 3300044693 | Ga0466961_0104630 | Ga0466961_0104630_868_1140 | 87 |
| 562 | 3300044735 | Ga0466968_0016405 | Ga0466968_0016405_1244_1516 | 87 |
| 563 | 3300044842 | Ga0466957_1151491 | Ga0466957_1151491_218_490 | 87 |
| 564 | 3300044842 | Ga0466957_1242930 | Ga0466957_1242930_244_516 | 87 |
| 565 | 3300045836 | Ga0466958_0859835 | Ga0466958_0859835_197_469 | 87 |
| 566 | 3300048918 | Ga0496115_0000398 | Ga0496115_0000398_7200_7472 | 87 |
| 567 | 3300048918 | Ga0496115_1226628 | Ga0496115_1226628_183_455 | 87 |
| 568 | 3300048924 | Ga0496121_0568127 | Ga0496121_0568127_224_496 | 87 |
| 569 | 3300049568 | Ga0501031_0411823 | Ga0501031_0411823_71_349 | 87 |
| 570 | 3300049569 | Ga0501032_0062543 | Ga0501032_0062543_1775_2053 | 87 |
| 571 | 3300049570 | Ga0501033_0198140 | Ga0501033_0198140_420_698 | 87 |
| 572 | 3300049581 | Ga0501047_0033367 | Ga0501047_0033367_831_1103 | 87 |
| 573 | 3300049582 | Ga0501048_0225945 | Ga0501048_0225945_222_494 | 87 |
| 574 | 3300049592 | Ga0501076_0723856 | Ga0501076_0723856_143_412 | 87 |
| 575 | 3300049686 | Ga0501257_074426 | Ga0501257_074426_377_646 | 87 |
| 576 | 3300049822 | Ga0501035_0226406 | Ga0501035_0226406_566_844 | 87 |
| 577 | 3300049822 | Ga0501035_0670678 | Ga0501035_0670678_266_538 | 87 |
| 578 | 3300049823 | Ga0501044_0357130 | Ga0501044_0357130_199_471 | 87 |
| 579 | 3300053087 | Ga0500643_001391 | Ga0500643_001391_8489_8767 | 87 |
| 580 | 3300053090 | Ga0500646_0209206 | Ga0500646_0209206_385_657 | 87 |
| 581 | 3300053090 | Ga0500646_0252087 | Ga0500646_0252087_255_527 | 87 |
| 582 | 3300053103 | Ga0500555_012638 | Ga0500555_012638_341_613 | 87 |
| 583 | 3300053103 | Ga0500555_056013 | Ga0500555_056013_400_678 | 87 |
| 584 | 3300053104 | Ga0500556_0013503 | Ga0500556_0013503_1608_1880 | 87 |
| 585 | 3300053108 | Ga0500562_002560 | Ga0500562_002560_875_1150 | 87 |
| 586 | 3300053122 | Ga0500608_349232 | Ga0500608_349232_193_465 | 87 |
| 587 | 3300053156 | Ga0500622_0015751 | Ga0500622_0015751_702_974 | 87 |
| 588 | 3300059477 | Ga0587084_133405 | Ga0587084_133405_94_363 | 87 |
| 589 | 3300059477 | Ga0587084_148318 | Ga0587084_148318_80_352 | 87 |
| 590 | 3300059508 | Ga0587088_109047 | Ga0587088_109047_19_288 | 87 |
| 591 | 3300059510 | Ga0587090_030258 | Ga0587090_030258_114_386 | 87 |
| 592 | 3300059510 | Ga0587090_097556 | Ga0587090_097556_167_436 | 87 |
| 593 | 3300059605 | Ga0587106_061425 | Ga0587106_061425_277_546 | 87 |
| 594 | 3300059624 | Ga0587109_183309 | Ga0587109_183309_168_437 | 87 |
| 595 | 3300059639 | Ga0587062_121824 | Ga0587062_121824_220_489 | 87 |
| 596 | 3300059641 | Ga0587068_083977 | Ga0587068_083977_150_419 | 87 |
| 597 | 3300059645 | Ga0587076_110548 | Ga0587076_110548_187_456 | 87 |
| 598 | 3300059645 | Ga0587076_116766 | Ga0587076_116766_190_462 | 87 |
| 599 | 3300059646 | Ga0587078_055251 | Ga0587078_055251_206_478 | 87 |
| 600 | 3300059658 | Ga0587119_071169 | Ga0587119_071169_224_493 | 87 |
| 601 | 3300005327 | Ga0070658_11153827 | Ga0070658_111538272 | 88 |
| 602 | 3300005331 | Ga0070670_100047898 | Ga0070670_1000478984 | 88 |
| 603 | 3300005331 | Ga0070670_100331041 | Ga0070670_1003310411 | 88 |
| 604 | 3300005335 | Ga0070666_10293043 | Ga0070666_102930432 | 88 |
| 605 | 3300005347 | Ga0070668_100000042 | Ga0070668_10000004214 | 88 |
| 606 | 3300005347 | Ga0070668_100003919 | Ga0070668_1000039193 | 88 |
| 607 | 3300005347 | Ga0070668_100011777 | Ga0070668_1000117774 | 88 |
| 608 | 3300005347 | Ga0070668_100022321 | Ga0070668_1000223217 | 88 |
| 609 | 3300005353 | Ga0070669_100057999 | Ga0070669_1000579992 | 88 |
| 610 | 3300005353 | Ga0070669_100275924 | Ga0070669_1002759242 | 88 |
| 611 | 3300005355 | Ga0070671_100002736 | Ga0070671_10000273616 | 88 |
| 612 | 3300005367 | Ga0070667_100000508 | Ga0070667_10000050817 | 88 |
| 613 | 3300005367 | Ga0070667_100008242 | Ga0070667_1000082423 | 88 |
| 614 | 3300005367 | Ga0070667_100016906 | Ga0070667_1000169065 | 88 |
| 615 | 3300005539 | Ga0068853_101872118 | Ga0068853_1018721181 | 88 |
| 616 | 3300005548 | Ga0070665_100000691 | Ga0070665_10000069141 | 88 |
| 617 | 3300005548 | Ga0070665_100001884 | Ga0070665_10000188413 | 88 |
| 618 | 3300005548 | Ga0070665_100017881 | Ga0070665_1000178819 | 88 |
| 619 | 3300005563 | Ga0068855_101163494 | Ga0068855_1011634941 | 88 |
| 620 | 3300005614 | Ga0068856_101090815 | Ga0068856_1010908152 | 88 |
| 621 | 3300005617 | Ga0068859_100001582 | Ga0068859_10000158211 | 88 |
| 622 | 3300005617 | Ga0068859_100159602 | Ga0068859_1001596023 | 88 |
| 623 | 3300005617 | Ga0068859_100279829 | Ga0068859_1002798292 | 88 |
| 624 | 3300005617 | Ga0068859_100500762 | Ga0068859_1005007621 | 88 |
| 625 | 3300005618 | Ga0068864_100000757 | Ga0068864_10000075719 | 88 |
| 626 | 3300005841 | Ga0068863_100000119 | Ga0068863_10000011928 | 88 |
| 627 | 3300005841 | Ga0068863_100004097 | Ga0068863_10000409712 | 88 |
| 628 | 3300005842 | Ga0068858_100006690 | Ga0068858_1000066902 | 88 |
| 629 | 3300005842 | Ga0068858_100133716 | Ga0068858_1001337162 | 88 |
| 630 | 3300005843 | Ga0068860_100000133 | Ga0068860_100000133106 | 88 |
| 631 | 3300005843 | Ga0068860_100000212 | Ga0068860_10000021266 | 88 |
| 632 | 3300005843 | Ga0068860_100124911 | Ga0068860_1001249114 | 88 |
| 633 | 3300005844 | Ga0068862_100000619 | Ga0068862_10000061912 | 88 |
| 634 | 3300005844 | Ga0068862_100012644 | Ga0068862_1000126443 | 88 |
| 635 | 3300005844 | Ga0068862_100314277 | Ga0068862_1003142771 | 88 |
| 636 | 3300005844 | Ga0068862_100435154 | Ga0068862_1004351542 | 88 |
| 637 | 3300005844 | Ga0068862_100569443 | Ga0068862_1005694432 | 88 |
| 638 | 3300006028 | Ga0070717_11024276 | Ga0070717_110242762 | 88 |
| 639 | 3300006042 | Ga0075368_10002212 | Ga0075368_100022125 | 88 |
| 640 | 3300006048 | Ga0075363_100108203 | Ga0075363_1001082032 | 88 |
| 641 | 3300006051 | Ga0075364_10008150 | Ga0075364_100081504 | 88 |
| 642 | 3300006178 | Ga0075367_10008101 | Ga0075367_100081015 | 88 |
| 643 | 3300006195 | Ga0075366_10133687 | Ga0075366_101336872 | 88 |
| 644 | 3300006353 | Ga0075370_10108116 | Ga0075370_101081162 | 88 |
| 645 | 3300006931 | Ga0097620_100001582 | Ga0097620_10000158219 | 88 |
| 646 | 3300006931 | Ga0097620_100159599 | Ga0097620_1001595992 | 88 |
| 647 | 3300006931 | Ga0097620_100279830 | Ga0097620_1002798302 | 88 |
| 648 | 3300006931 | Ga0097620_100500837 | Ga0097620_1005008371 | 88 |
| 649 | 3300009011 | Ga0105251_10092099 | Ga0105251_100920991 | 88 |
| 650 | 3300009093 | Ga0105240_11258726 | Ga0105240_112587262 | 88 |
| 651 | 3300009098 | Ga0105245_12491889 | Ga0105245_124918891 | 88 |
| 652 | 3300009101 | Ga0105247_10032337 | Ga0105247_100323374 | 88 |
| 653 | 3300009101 | Ga0105247_10212029 | Ga0105247_102120293 | 88 |
| 654 | 3300009101 | Ga0105247_10404660 | Ga0105247_104046602 | 88 |
| 655 | 3300009177 | Ga0105248_10004488 | Ga0105248_1000448817 | 88 |
| 656 | 3300009177 | Ga0105248_10063658 | Ga0105248_100636583 | 88 |
| 657 | 3300009553 | Ga0105249_10017801 | Ga0105249_100178012 | 88 |
| 658 | 3300009553 | Ga0105249_10414920 | Ga0105249_104149202 | 88 |
| 659 | 3300010375 | Ga0105239_11806958 | Ga0105239_118069582 | 88 |
| 660 | 3300013296 | Ga0157374_10098882 | Ga0157374_100988823 | 88 |
| 661 | 3300013306 | Ga0163162_10043181 | Ga0163162_100431813 | 88 |
| 662 | 3300013306 | Ga0163162_10059611 | Ga0163162_100596115 | 88 |
| 663 | 3300014325 | Ga0163163_10000780 | Ga0163163_100007809 | 88 |
| 664 | 3300014968 | Ga0157379_10000947 | Ga0157379_1000094714 | 88 |
| 665 | 3300014968 | Ga0157379_10003056 | Ga0157379_100030565 | 88 |
| 666 | 3300017792 | Ga0163161_10126978 | Ga0163161_101269783 | 88 |
| 667 | 3300017792 | Ga0163161_10918988 | Ga0163161_109189882 | 88 |
| 668 | 3300021358 | Ga0213873_10125109 | Ga0213873_101251091 | 88 |
| 669 | 3300021377 | Ga0213874_10180478 | Ga0213874_101804782 | 88 |
| 670 | 3300021384 | Ga0213876_10032943 | Ga0213876_100329433 | 88 |
| 671 | 3300021384 | Ga0213876_10291320 | Ga0213876_102913202 | 88 |
| 672 | 3300021441 | Ga0213871_10005996 | Ga0213871_100059963 | 88 |
| 673 | 3300021441 | Ga0213871_10012129 | Ga0213871_100121292 | 88 |
| 674 | 3300022467 | Ga0224712_10188353 | Ga0224712_101883532 | 88 |
| 675 | 3300025900 | Ga0207710_10402607 | Ga0207710_104026072 | 88 |
| 676 | 3300025903 | Ga0207680_10859693 | Ga0207680_108596932 | 88 |
| 677 | 3300025923 | Ga0207681_10054011 | Ga0207681_100540113 | 88 |
| 678 | 3300025923 | Ga0207681_10291623 | Ga0207681_102916231 | 88 |
| 679 | 3300025925 | Ga0207650_10000016 | Ga0207650_10000016147 | 88 |
| 680 | 3300025925 | Ga0207650_10373801 | Ga0207650_103738012 | 88 |
| 681 | 3300025931 | Ga0207644_10006266 | Ga0207644_100062665 | 88 |
| 682 | 3300025941 | Ga0207711_10005857 | Ga0207711_100058573 | 88 |
| 683 | 3300025941 | Ga0207711_10691641 | Ga0207711_106916412 | 88 |
| 684 | 3300025961 | Ga0207712_10007748 | Ga0207712_100077489 | 88 |
| 685 | 3300025961 | Ga0207712_10313588 | Ga0207712_103135882 | 88 |
| 686 | 3300025972 | Ga0207668_10000019 | Ga0207668_10000019115 | 88 |
| 687 | 3300025972 | Ga0207668_10000241 | Ga0207668_1000024110 | 88 |
| 688 | 3300025972 | Ga0207668_10007726 | Ga0207668_100077267 | 88 |
| 689 | 3300025972 | Ga0207668_10070882 | Ga0207668_100708822 | 88 |
| 690 | 3300025986 | Ga0207658_10000295 | Ga0207658_1000029531 | 88 |
| 691 | 3300025986 | Ga0207658_10002476 | Ga0207658_100024762 | 88 |
| 692 | 3300025986 | Ga0207658_10676398 | Ga0207658_106763982 | 88 |
| 693 | 3300026035 | Ga0207703_10002213 | Ga0207703_1000221311 | 88 |
| 694 | 3300026035 | Ga0207703_10004727 | Ga0207703_100047273 | 88 |
| 695 | 3300026041 | Ga0207639_11146478 | Ga0207639_111464781 | 88 |
| 696 | 3300026078 | Ga0207702_11839356 | Ga0207702_118393561 | 88 |
| 697 | 3300026088 | Ga0207641_10000612 | Ga0207641_1000061228 | 88 |
| 698 | 3300026088 | Ga0207641_10001331 | Ga0207641_1000133110 | 88 |
| 699 | 3300026089 | Ga0207648_10807326 | Ga0207648_108073262 | 88 |
| 700 | 3300026095 | Ga0207676_10002400 | Ga0207676_1000240013 | 88 |
| 701 | 3300026118 | Ga0207675_100240157 | Ga0207675_1002401572 | 88 |
| 702 | 3300026118 | Ga0207675_100905684 | Ga0207675_1009056842 | 88 |
| 703 | 3300027866 | Ga0209813_10005758 | Ga0209813_100057583 | 88 |
| 704 | 3300028379 | Ga0268266_10000711 | Ga0268266_1000071139 | 88 |
| 705 | 3300028379 | Ga0268266_10003648 | Ga0268266_1000364817 | 88 |
| 706 | 3300028379 | Ga0268266_10107687 | Ga0268266_101076873 | 88 |
| 707 | 3300028380 | Ga0268265_10001088 | Ga0268265_1000108820 | 88 |
| 708 | 3300028380 | Ga0268265_10001421 | Ga0268265_100014217 | 88 |
| 709 | 3300028380 | Ga0268265_10128675 | Ga0268265_101286752 | 88 |
| 710 | 3300028380 | Ga0268265_10329581 | Ga0268265_103295813 | 88 |
| 711 | 3300028381 | Ga0268264_10000091 | Ga0268264_10000091160 | 88 |
| 712 | 3300028381 | Ga0268264_10000207 | Ga0268264_1000020766 | 88 |
| 713 | 3300028381 | Ga0268264_10010714 | Ga0268264_100107147 | 88 |
| 714 | 3300028381 | Ga0268264_12306966 | Ga0268264_123069661 | 88 |
| 715 | 3300031247 | Ga0265340_10566998 | Ga0265340_105669981 | 88 |
| 716 | 3300031548 | Ga0307408_100383663 | Ga0307408_1003836631 | 88 |
| 717 | 3300031903 | Ga0307407_10535865 | Ga0307407_105358652 | 88 |
| 718 | 3300031995 | Ga0307409_101099300 | Ga0307409_1010993002 | 88 |
| 719 | 3300032004 | Ga0307414_10108804 | Ga0307414_101088043 | 88 |
| 720 | 3300035115 | Ga0373941_0078984 | Ga0373941_0078984_40_312 | 88 |
| 721 | 3300035691 | Ga0373931_0699258 | Ga0373931_0699258_35_307 | 88 |
| 722 | 3300037068 | Ga0373925_0965083 | Ga0373925_0965083_52_324 | 88 |
| 723 | 3300037068 | Ga0373925_1014951 | Ga0373925_1014951_181_453 | 88 |
| 724 | 3300037471 | Ga0395905_0027924 | Ga0395905_0027924_4513_4797 | 88 |
| 725 | 3300037471 | Ga0395905_0590077 | Ga0395905_0590077_13_300 | 88 |
| 726 | 3300037853 | Ga0436364_0037096 | Ga0436364_0037096_498_770 | 88 |
| 727 | 3300039437 | Ga0436365_0192477 | Ga0436365_0192477_539_811 | 88 |
| 728 | 3300039437 | Ga0436365_1291619 | Ga0436365_1291619_227_499 | 88 |
| 729 | 3300039438 | Ga0436360_0384133 | Ga0436360_0384133_2631_2915 | 88 |
| 730 | 3300039438 | Ga0436360_0392815 | Ga0436360_0392815_1282_1557 | 88 |
| 731 | 3300039438 | Ga0436360_0474819 | Ga0436360_0474819_70_345 | 88 |
| 732 | 3300039447 | Ga0436361_0304745 | Ga0436361_0304745_1955_2239 | 88 |
| 733 | 3300039447 | Ga0436361_0548490 | Ga0436361_0548490_921_1205 | 88 |
| 734 | 3300039450 | Ga0436363_0123189 | Ga0436363_0123189_619_900 | 88 |
| 735 | 3300039453 | Ga0436362_0053172 | Ga0436362_0053172_558_842 | 88 |
| 736 | 3300039453 | Ga0436362_1196929 | Ga0436362_1196929_58_342 | 88 |
| 737 | 3300042533 | Ga0450901_004112 | Ga0450901_004112_1186_1470 | 88 |
| 738 | 3300044683 | Ga0466965_0156640 | Ga0466965_0156640_223_498 | 88 |
| 739 | 3300044735 | Ga0466968_0591920 | Ga0466968_0591920_252_527 | 88 |
| 740 | 3300045049 | Ga0466959_0102536 | Ga0466959_0102536_923_1207 | 88 |
| 741 | 3300045049 | Ga0466959_0386074 | Ga0466959_0386074_136_408 | 88 |
| 742 | 3300046674 | Ga0495588_0749608 | Ga0495588_0749608_26_298 | 88 |
| 743 | 3300046691 | Ga0495670_0464537 | Ga0495670_0464537_24_296 | 88 |
| 744 | 3300048904 | Ga0496101_0610526 | Ga0496101_0610526_556_828 | 88 |
| 745 | 3300048905 | Ga0496102_0283594 | Ga0496102_0283594_1144_1416 | 88 |
| 746 | 3300048905 | Ga0496102_0849973 | Ga0496102_0849973_356_628 | 88 |
| 747 | 3300048907 | Ga0496104_0657201 | Ga0496104_0657201_550_822 | 88 |
| 748 | 3300048908 | Ga0496105_0495177 | Ga0496105_0495177_650_922 | 88 |
| 749 | 3300048909 | Ga0496106_0755617 | Ga0496106_0755617_76_348 | 88 |
| 750 | 3300048913 | Ga0496110_0738921 | Ga0496110_0738921_329_601 | 88 |
| 751 | 3300049161 | Ga0501305_114684 | Ga0501305_114684_221_496 | 88 |
| 752 | 3300049535 | Ga0501319_002602 | Ga0501319_002602_615_899 | 88 |
| 753 | 3300049570 | Ga0501033_0196043 | Ga0501033_0196043_746_1018 | 88 |
| 754 | 3300049573 | Ga0501037_0261567 | Ga0501037_0261567_816_1088 | 88 |
| 755 | 3300049579 | Ga0501043_0409274 | Ga0501043_0409274_341_613 | 88 |
| 756 | 3300049581 | Ga0501047_0002867 | Ga0501047_0002867_15577_15849 | 88 |
| 757 | 3300049686 | Ga0501257_237083 | Ga0501257_237083_166_438 | 88 |
| 758 | 3300049742 | Ga0501080_1244885 | Ga0501080_1244885_342_614 | 88 |
| 759 | 3300049822 | Ga0501035_0751934 | Ga0501035_0751934_33_305 | 88 |
| 760 | 3300049822 | Ga0501035_1300613 | Ga0501035_1300613_159_431 | 88 |
| 761 | 3300049823 | Ga0501044_1307797 | Ga0501044_1307797_197_466 | 88 |
| 762 | 3300050490 | nmdc:mga03n38_57024_c1 | nmdc:mga03n38_57024_c1_496_768 | 88 |
| 763 | 3300050491 | nmdc:mga00v17_725_c1 | nmdc:mga00v17_725_c1_11905_12177 | 88 |
| 764 | 3300050493 | nmdc:mga0k408_11045_c1 | nmdc:mga0k408_11045_c1_843_1115 | 88 |
| 765 | 3300050494 | nmdc:mga06z11_2151_c1 | nmdc:mga06z11_2151_c1_5831_6103 | 88 |
| 766 | 3300050495 | nmdc:mga04h51_6559_c1 | nmdc:mga04h51_6559_c1_1241_1513 | 88 |
| 767 | 3300050496 | nmdc:mga07m45_106546_c1 | nmdc:mga07m45_106546_c1_478_750 | 88 |
| 768 | 3300050516 | nmdc:mga0sz30_6524_c2 | nmdc:mga0sz30_6524_c2_80_352 | 88 |
| 769 | 3300053087 | Ga0500643_006633 | Ga0500643_006633_2672_2953 | 88 |
| 770 | 3300053087 | Ga0500643_026871 | Ga0500643_026871_865_1137 | 88 |
| 771 | 3300053087 | Ga0500643_042847 | Ga0500643_042847_1015_1287 | 88 |
| 772 | 3300053096 | Ga0500641_0002963 | Ga0500641_0002963_1062_1334 | 88 |
| 773 | 3300053108 | Ga0500562_001679 | Ga0500562_001679_2610_2879 | 88 |
| 774 | 3300053130 | Ga0500642_0169271 | Ga0500642_0169271_666_938 | 88 |
| 775 | 3300053730 | Ga0500645_112285 | Ga0500645_112285_412_684 | 88 |
| 776 | 3300059491 | Ga0587070_203856 | Ga0587070_203856_111_383 | 88 |
| 777 | 3300059506 | Ga0587085_041352 | Ga0587085_041352_340_612 | 88 |
| 778 | 3300059513 | Ga0587094_085149 | Ga0587094_085149_150_422 | 88 |
| 779 | 3300059630 | Ga0587128_108397 | Ga0587128_108397_218_487 | 88 |
| 780 | 3300059645 | Ga0587076_210658 | Ga0587076_210658_182_454 | 88 |
| 781 | 3300060344 | Ga0587071_155866 | Ga0587071_155866_29_301 | 88 |
| 782 | 3300060346 | Ga0587111_0103299 | Ga0587111_0103299_162_434 | 88 |
| 783 | 3300061719 | Ga0466962_0174679 | Ga0466962_0174679_320_604 | 88 |
| 784 | 3300005341 | Ga0070691_10597617 | Ga0070691_105976171 | 89 |
| 785 | 3300005344 | Ga0070661_100284810 | Ga0070661_1002848102 | 89 |
| 786 | 3300005366 | Ga0070659_100976467 | Ga0070659_1009764672 | 89 |
| 787 | 3300005458 | Ga0070681_10297309 | Ga0070681_102973093 | 89 |
| 788 | 3300005530 | Ga0070679_101377108 | Ga0070679_1013771081 | 89 |
| 789 | 3300005563 | Ga0068855_100115879 | Ga0068855_1001158793 | 89 |
| 790 | 3300005563 | Ga0068855_101717364 | Ga0068855_1017173641 | 89 |
| 791 | 3300005614 | Ga0068856_102184620 | Ga0068856_1021846202 | 89 |
| 792 | 3300005844 | Ga0068862_101546090 | Ga0068862_1015460902 | 89 |
| 793 | 3300009093 | Ga0105240_10286498 | Ga0105240_102864982 | 89 |
| 794 | 3300009093 | Ga0105240_10529912 | Ga0105240_105299123 | 89 |
| 795 | 3300009551 | Ga0105238_10105565 | Ga0105238_101055654 | 89 |
| 796 | 3300013105 | Ga0157369_10887202 | Ga0157369_108872022 | 89 |
| 797 | 3300013306 | Ga0163162_10189403 | Ga0163162_101894034 | 89 |
| 798 | 3300025909 | Ga0207705_10418515 | Ga0207705_104185152 | 89 |
| 799 | 3300025912 | Ga0207707_10135825 | Ga0207707_101358253 | 89 |
| 800 | 3300025913 | Ga0207695_10000837 | Ga0207695_1000083747 | 89 |
| 801 | 3300025913 | Ga0207695_10290079 | Ga0207695_102900792 | 89 |
| 802 | 3300025913 | Ga0207695_10299028 | Ga0207695_102990282 | 89 |
| 803 | 3300025917 | Ga0207660_10177760 | Ga0207660_101777602 | 89 |
| 804 | 3300025921 | Ga0207652_10050296 | Ga0207652_100502962 | 89 |
| 805 | 3300025924 | Ga0207694_10290475 | Ga0207694_102904752 | 89 |
| 806 | 3300025932 | Ga0207690_10849117 | Ga0207690_108491172 | 89 |
| 807 | 3300025939 | Ga0207665_10766282 | Ga0207665_107662822 | 89 |
| 808 | 3300025949 | Ga0207667_10456422 | Ga0207667_104564222 | 89 |
| 809 | 3300026041 | Ga0207639_11840425 | Ga0207639_118404251 | 89 |
| 810 | 3300026078 | Ga0207702_12449922 | Ga0207702_124499221 | 89 |
| 811 | 3300027378 | Ga0209981_1029420 | Ga0209981_10294202 | 89 |
| 812 | 3300027543 | Ga0209999_1006261 | Ga0209999_10062613 | 89 |
| 813 | 3300027552 | Ga0209982_1011433 | Ga0209982_10114332 | 89 |
| 814 | 3300027665 | Ga0209983_1083430 | Ga0209983_10834302 | 89 |
| 815 | 3300028800 | Ga0265338_10233227 | Ga0265338_102332272 | 89 |
| 816 | 3300031251 | Ga0265327_10114940 | Ga0265327_101149402 | 89 |
| 817 | 3300035113 | Ga0373936_0009511 | Ga0373936_0009511_3032_3304 | 89 |
| 818 | 3300037466 | Ga0395898_1478547 | Ga0395898_1478547_150_422 | 89 |
| 819 | 3300039450 | Ga0436363_0144206 | Ga0436363_0144206_444_725 | 89 |
| 820 | 3300046529 | Ga0495652_0764050 | Ga0495652_0764050_338_610 | 89 |
| 821 | 3300048088 | Ga0495602_0977413 | Ga0495602_0977413_107_379 | 89 |
| 822 | 3300054114 | Ga0501084_1490831 | Ga0501084_1490831_10_282 | 89 |
| 823 | 3300000531 | CNBas_1012637 | CNBas_10126371 | 90 |
| 824 | 3300005293 | Ga0065715_10354226 | Ga0065715_103542262 | 90 |
| 825 | 3300005327 | Ga0070658_10037444 | Ga0070658_100374445 | 90 |
| 826 | 3300005327 | Ga0070658_10648962 | Ga0070658_106489622 | 90 |
| 827 | 3300005329 | Ga0070683_100616227 | Ga0070683_1006162272 | 90 |
| 828 | 3300005331 | Ga0070670_100730249 | Ga0070670_1007302492 | 90 |
| 829 | 3300005335 | Ga0070666_10299046 | Ga0070666_102990462 | 90 |
| 830 | 3300005336 | Ga0070680_100029823 | Ga0070680_1000298235 | 90 |
| 831 | 3300005337 | Ga0070682_101453512 | Ga0070682_1014535121 | 90 |
| 832 | 3300005337 | Ga0070682_101523012 | Ga0070682_1015230122 | 90 |
| 833 | 3300005338 | Ga0068868_100542997 | Ga0068868_1005429972 | 90 |
| 834 | 3300005339 | Ga0070660_100329886 | Ga0070660_1003298861 | 90 |
| 835 | 3300005339 | Ga0070660_100349902 | Ga0070660_1003499022 | 90 |
| 836 | 3300005340 | Ga0070689_101892303 | Ga0070689_1018923032 | 90 |
| 837 | 3300005344 | Ga0070661_100713913 | Ga0070661_1007139132 | 90 |
| 838 | 3300005355 | Ga0070671_100613538 | Ga0070671_1006135381 | 90 |
| 839 | 3300005355 | Ga0070671_100912813 | Ga0070671_1009128131 | 90 |
| 840 | 3300005364 | Ga0070673_100227069 | Ga0070673_1002270693 | 90 |
| 841 | 3300005364 | Ga0070673_100787119 | Ga0070673_1007871191 | 90 |
| 842 | 3300005367 | Ga0070667_100728170 | Ga0070667_1007281702 | 90 |
| 843 | 3300005440 | Ga0070705_101290225 | Ga0070705_1012902252 | 90 |
| 844 | 3300005455 | Ga0070663_100886956 | Ga0070663_1008869562 | 90 |
| 845 | 3300005456 | Ga0070678_100951193 | Ga0070678_1009511932 | 90 |
| 846 | 3300005457 | Ga0070662_100023925 | Ga0070662_1000239258 | 90 |
| 847 | 3300005458 | Ga0070681_10002805 | Ga0070681_100028058 | 90 |
| 848 | 3300005459 | Ga0068867_100697246 | Ga0068867_1006972462 | 90 |
| 849 | 3300005467 | Ga0070706_100245176 | Ga0070706_1002451762 | 90 |
| 850 | 3300005530 | Ga0070679_100031245 | Ga0070679_1000312452 | 90 |
| 851 | 3300005535 | Ga0070684_100890659 | Ga0070684_1008906592 | 90 |
| 852 | 3300005539 | Ga0068853_101301087 | Ga0068853_1013010872 | 90 |
| 853 | 3300005543 | Ga0070672_101136985 | Ga0070672_1011369852 | 90 |
| 854 | 3300005548 | Ga0070665_100000418 | Ga0070665_10000041832 | 90 |
| 855 | 3300005548 | Ga0070665_100038239 | Ga0070665_1000382398 | 90 |
| 856 | 3300005563 | Ga0068855_100005017 | Ga0068855_1000050178 | 90 |
| 857 | 3300005564 | Ga0070664_100263642 | Ga0070664_1002636421 | 90 |
| 858 | 3300005577 | Ga0068857_100052533 | Ga0068857_1000525332 | 90 |
| 859 | 3300005614 | Ga0068856_100423337 | Ga0068856_1004233372 | 90 |
| 860 | 3300005614 | Ga0068856_102327512 | Ga0068856_1023275122 | 90 |
| 861 | 3300005616 | Ga0068852_100282530 | Ga0068852_1002825302 | 90 |
| 862 | 3300005617 | Ga0068859_101368042 | Ga0068859_1013680422 | 90 |
| 863 | 3300005618 | Ga0068864_100135302 | Ga0068864_1001353022 | 90 |
| 864 | 3300005618 | Ga0068864_100311255 | Ga0068864_1003112552 | 90 |
| 865 | 3300005618 | Ga0068864_100323202 | Ga0068864_1003232022 | 90 |
| 866 | 3300005719 | Ga0068861_101607137 | Ga0068861_1016071372 | 90 |
| 867 | 3300005841 | Ga0068863_100213206 | Ga0068863_1002132062 | 90 |
| 868 | 3300005841 | Ga0068863_100309374 | Ga0068863_1003093742 | 90 |
| 869 | 3300005841 | Ga0068863_101305412 | Ga0068863_1013054122 | 90 |
| 870 | 3300005843 | Ga0068860_100775126 | Ga0068860_1007751262 | 90 |
| 871 | 3300006358 | Ga0068871_100486484 | Ga0068871_1004864842 | 90 |
| 872 | 3300006881 | Ga0068865_100001766 | Ga0068865_1000017665 | 90 |
| 873 | 3300006931 | Ga0097620_101368029 | Ga0097620_1013680292 | 90 |
| 874 | 3300009093 | Ga0105240_10003732 | Ga0105240_1000373225 | 90 |
| 875 | 3300009148 | Ga0105243_11653481 | Ga0105243_116534811 | 90 |
| 876 | 3300009174 | Ga0105241_10796834 | Ga0105241_107968342 | 90 |
| 877 | 3300009176 | Ga0105242_12039340 | Ga0105242_120393401 | 90 |
| 878 | 3300009177 | Ga0105248_10005017 | Ga0105248_100050173 | 90 |
| 879 | 3300009177 | Ga0105248_10523874 | Ga0105248_105238741 | 90 |
| 880 | 3300009177 | Ga0105248_12515633 | Ga0105248_125156332 | 90 |
| 881 | 3300009545 | Ga0105237_10561436 | Ga0105237_105614362 | 90 |
| 882 | 3300009545 | Ga0105237_11503065 | Ga0105237_115030652 | 90 |
| 883 | 3300009551 | Ga0105238_10089409 | Ga0105238_100894094 | 90 |
| 884 | 3300009551 | Ga0105238_10187590 | Ga0105238_101875903 | 90 |
| 885 | 3300009551 | Ga0105238_10316772 | Ga0105238_103167722 | 90 |
| 886 | 3300009553 | Ga0105249_10876021 | Ga0105249_108760212 | 90 |
| 887 | 3300009553 | Ga0105249_11764683 | Ga0105249_117646831 | 90 |
| 888 | 3300010375 | Ga0105239_10221492 | Ga0105239_102214922 | 90 |
| 889 | 3300010375 | Ga0105239_10820725 | Ga0105239_108207251 | 90 |
| 890 | 3300013100 | Ga0157373_10827430 | Ga0157373_108274302 | 90 |
| 891 | 3300013104 | Ga0157370_10334409 | Ga0157370_103344093 | 90 |
| 892 | 3300013104 | Ga0157370_11546511 | Ga0157370_115465112 | 90 |
| 893 | 3300013297 | Ga0157378_11220927 | Ga0157378_112209272 | 90 |
| 894 | 3300013306 | Ga0163162_12398190 | Ga0163162_123981902 | 90 |
| 895 | 3300013306 | Ga0163162_12415827 | Ga0163162_124158271 | 90 |
| 896 | 3300013308 | Ga0157375_10618834 | Ga0157375_106188343 | 90 |
| 897 | 3300013308 | Ga0157375_11013469 | Ga0157375_110134691 | 90 |
| 898 | 3300013308 | Ga0157375_11762204 | Ga0157375_117622041 | 90 |
| 899 | 3300014325 | Ga0163163_10372208 | Ga0163163_103722082 | 90 |
| 900 | 3300014325 | Ga0163163_10448826 | Ga0163163_104488262 | 90 |
| 901 | 3300014745 | Ga0157377_10349866 | Ga0157377_103498662 | 90 |
| 902 | 3300014968 | Ga0157379_10486049 | Ga0157379_104860491 | 90 |
| 903 | 3300014968 | Ga0157379_11076522 | Ga0157379_110765222 | 90 |
| 904 | 3300014969 | Ga0157376_10147350 | Ga0157376_101473502 | 90 |
| 905 | 3300017792 | Ga0163161_10285686 | Ga0163161_102856862 | 90 |
| 906 | 3300025321 | Ga0207656_10447104 | Ga0207656_104471042 | 90 |
| 907 | 3300025900 | Ga0207710_10506290 | Ga0207710_105062901 | 90 |
| 908 | 3300025903 | Ga0207680_10266568 | Ga0207680_102665682 | 90 |
| 909 | 3300025903 | Ga0207680_11048096 | Ga0207680_110480961 | 90 |
| 910 | 3300025909 | Ga0207705_10005663 | Ga0207705_100056638 | 90 |
| 911 | 3300025911 | Ga0207654_11300381 | Ga0207654_113003811 | 90 |
| 912 | 3300025912 | Ga0207707_10010835 | Ga0207707_100108358 | 90 |
| 913 | 3300025913 | Ga0207695_10001415 | Ga0207695_1000141534 | 90 |
| 914 | 3300025917 | Ga0207660_10005342 | Ga0207660_100053426 | 90 |
| 915 | 3300025919 | Ga0207657_10318140 | Ga0207657_103181403 | 90 |
| 916 | 3300025920 | Ga0207649_10208624 | Ga0207649_102086242 | 90 |
| 917 | 3300025921 | Ga0207652_10489026 | Ga0207652_104890262 | 90 |
| 918 | 3300025924 | Ga0207694_10103283 | Ga0207694_101032833 | 90 |
| 919 | 3300025927 | Ga0207687_10825121 | Ga0207687_108251212 | 90 |
| 920 | 3300025928 | Ga0207700_10771090 | Ga0207700_107710902 | 90 |
| 921 | 3300025931 | Ga0207644_10638640 | Ga0207644_106386402 | 90 |
| 922 | 3300025932 | Ga0207690_10000898 | Ga0207690_1000089811 | 90 |
| 923 | 3300025932 | Ga0207690_10013676 | Ga0207690_100136764 | 90 |
| 924 | 3300025933 | Ga0207706_10020225 | Ga0207706_100202257 | 90 |
| 925 | 3300025938 | Ga0207704_10001066 | Ga0207704_100010665 | 90 |
| 926 | 3300025941 | Ga0207711_10000155 | Ga0207711_1000015571 | 90 |
| 927 | 3300025941 | Ga0207711_10152489 | Ga0207711_101524893 | 90 |
| 928 | 3300025941 | Ga0207711_11079898 | Ga0207711_110798982 | 90 |
| 929 | 3300025945 | Ga0207679_10804161 | Ga0207679_108041612 | 90 |
| 930 | 3300025949 | Ga0207667_10011376 | Ga0207667_100113763 | 90 |
| 931 | 3300025960 | Ga0207651_10251899 | Ga0207651_102518991 | 90 |
| 932 | 3300025981 | Ga0207640_11403247 | Ga0207640_114032471 | 90 |
| 933 | 3300025986 | Ga0207658_10445065 | Ga0207658_104450652 | 90 |
| 934 | 3300026023 | Ga0207677_10430994 | Ga0207677_104309942 | 90 |
| 935 | 3300026035 | Ga0207703_10570132 | Ga0207703_105701322 | 90 |
| 936 | 3300026041 | Ga0207639_10410461 | Ga0207639_104104612 | 90 |
| 937 | 3300026041 | Ga0207639_10705975 | Ga0207639_107059751 | 90 |
| 938 | 3300026067 | Ga0207678_10657774 | Ga0207678_106577742 | 90 |
| 939 | 3300026078 | Ga0207702_10460042 | Ga0207702_104600422 | 90 |
| 940 | 3300026088 | Ga0207641_10244530 | Ga0207641_102445302 | 90 |
| 941 | 3300026088 | Ga0207641_10370456 | Ga0207641_103704562 | 90 |
| 942 | 3300026089 | Ga0207648_10490922 | Ga0207648_104909222 | 90 |
| 943 | 3300026095 | Ga0207676_10086766 | Ga0207676_100867662 | 90 |
| 944 | 3300026095 | Ga0207676_10178658 | Ga0207676_101786582 | 90 |
| 945 | 3300026095 | Ga0207676_10956833 | Ga0207676_109568332 | 90 |
| 946 | 3300026116 | Ga0207674_10046471 | Ga0207674_100464714 | 90 |
| 947 | 3300026121 | Ga0207683_10113141 | Ga0207683_101131412 | 90 |
| 948 | 3300026121 | Ga0207683_11207475 | Ga0207683_112074752 | 90 |
| 949 | 3300026142 | Ga0207698_11196583 | Ga0207698_111965832 | 90 |
| 950 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031153 | 90 |
| 951 | 3300028379 | Ga0268266_10077006 | Ga0268266_100770063 | 90 |
| 952 | 3300028381 | Ga0268264_11281844 | Ga0268264_112818442 | 90 |
| 953 | 3300028786 | Ga0307517_10000835 | Ga0307517_1000083548 | 90 |
| 954 | 3300028786 | Ga0307517_10126586 | Ga0307517_101265862 | 90 |
| 955 | 3300031456 | Ga0307513_10004902 | Ga0307513_1000490216 | 90 |
| 956 | 3300031456 | Ga0307513_10154808 | Ga0307513_101548082 | 90 |
| 957 | 3300035083 | Ga0373926_0086427 | Ga0373926_0086427_184_459 | 90 |
| 958 | 3300035086 | Ga0373934_0337231 | Ga0373934_0337231_38_313 | 90 |
| 959 | 3300035089 | Ga0373944_0013203 | Ga0373944_0013203_528_803 | 90 |
| 960 | 3300035111 | Ga0373923_0558521 | Ga0373923_0558521_232_507 | 90 |
| 961 | 3300035116 | Ga0373945_0065928 | Ga0373945_0065928_108_383 | 90 |
| 962 | 3300035170 | Ga0373943_0051520 | Ga0373943_0051520_1714_1989 | 90 |
| 963 | 3300035171 | Ga0373946_0132043 | Ga0373946_0132043_203_478 | 90 |
| 964 | 3300035172 | Ga0373955_0828465 | Ga0373955_0828465_221_496 | 90 |
| 965 | 3300035695 | Ga0373927_0000173 | Ga0373927_0000173_4155_4430 | 90 |
| 966 | 3300036401 | Ga0373937_0741131 | Ga0373937_0741131_159_434 | 90 |
| 967 | 3300037068 | Ga0373925_0000049 | Ga0373925_0000049_64579_64854 | 90 |
| 968 | 3300046460 | Ga0495638_0169895 | Ga0495638_0169895_827_1099 | 90 |
| 969 | 3300046492 | Ga0495585_0587470 | Ga0495585_0587470_148_420 | 90 |
| 970 | 3300046506 | Ga0495583_0062409 | Ga0495583_0062409_499_771 | 90 |
| 971 | 3300046507 | Ga0495606_0121510 | Ga0495606_0121510_217_489 | 90 |
| 972 | 3300046512 | Ga0495610_0355438 | Ga0495610_0355438_105_377 | 90 |
| 973 | 3300046517 | Ga0495630_0457077 | Ga0495630_0457077_557_832 | 90 |
| 974 | 3300046523 | Ga0495644_0114564 | Ga0495644_0114564_565_837 | 90 |
| 975 | 3300046525 | Ga0495663_0042968 | Ga0495663_0042968_777_1049 | 90 |
| 976 | 3300046528 | Ga0495642_0010166 | Ga0495642_0010166_382_654 | 90 |
| 977 | 3300046528 | Ga0495642_0289210 | Ga0495642_0289210_257_529 | 90 |
| 978 | 3300046543 | Ga0495645_0472690 | Ga0495645_0472690_383_658 | 90 |
| 979 | 3300046616 | Ga0495668_0025043 | Ga0495668_0025043_987_1259 | 90 |
| 980 | 3300046648 | Ga0495611_0096417 | Ga0495611_0096417_151_423 | 90 |
| 981 | 3300046660 | Ga0495625_0095839 | Ga0495625_0095839_1643_1915 | 90 |
| 982 | 3300046664 | Ga0495659_0015957 | Ga0495659_0015957_1132_1404 | 90 |
| 983 | 3300046665 | Ga0495661_0216748 | Ga0495661_0216748_521_793 | 90 |
| 984 | 3300046683 | Ga0495658_0882508 | Ga0495658_0882508_58_330 | 90 |
| 985 | 3300046684 | Ga0495669_0422530 | Ga0495669_0422530_244_516 | 90 |
| 986 | 3300047318 | Ga0495636_0206442 | Ga0495636_0206442_417_689 | 90 |
| 987 | 3300047319 | Ga0495674_0378402 | Ga0495674_0378402_741_1016 | 90 |
| 988 | 3300047320 | Ga0495672_0095153 | Ga0495672_0095153_435_707 | 90 |
| 989 | 3300047323 | Ga0495683_0120139 | Ga0495683_0120139_552_824 | 90 |
| 990 | 3300047443 | Ga0495687_178773 | Ga0495687_178773_230_502 | 90 |
| 991 | 3300047445 | Ga0495677_0092502 | Ga0495677_0092502_206_478 | 90 |
| 992 | 3300047470 | Ga0495681_0105134 | Ga0495681_0105134_832_1104 | 90 |
| 993 | 3300048090 | Ga0495615_0268657 | Ga0495615_0268657_118_390 | 90 |
| 994 | 3300048903 | Ga0496100_0446209 | Ga0496100_0446209_684_956 | 90 |
| 995 | 3300048904 | Ga0496101_0618564 | Ga0496101_0618564_71_343 | 90 |
| 996 | 3300048905 | Ga0496102_0270127 | Ga0496102_0270127_1262_1534 | 90 |
| 997 | 3300048906 | Ga0496103_0309426 | Ga0496103_0309426_676_948 | 90 |
| 998 | 3300048907 | Ga0496104_0993673 | Ga0496104_0993673_160_432 | 90 |
| 999 | 3300048908 | Ga0496105_1361658 | Ga0496105_1361658_88_363 | 90 |
| 1000 | 3300048909 | Ga0496106_0040840 | Ga0496106_0040840_1426_1698 | 90 |
| 1001 | 3300048911 | Ga0496108_0821040 | Ga0496108_0821040_458_730 | 90 |
| 1002 | 3300048912 | Ga0496109_0027177 | Ga0496109_0027177_1755_2027 | 90 |
| 1003 | 3300048913 | Ga0496110_0168729 | Ga0496110_0168729_207_479 | 90 |
| 1004 | 3300048914 | Ga0496111_0298583 | Ga0496111_0298583_501_773 | 90 |
| 1005 | 3300048915 | Ga0496112_0083301 | Ga0496112_0083301_2334_2609 | 90 |
| 1006 | 3300048915 | Ga0496112_0275732 | Ga0496112_0275732_129_401 | 90 |
| 1007 | 3300048916 | Ga0496113_0037071 | Ga0496113_0037071_663_935 | 90 |
| 1008 | 3300048918 | Ga0496115_0220407 | Ga0496115_0220407_401_691 | 90 |
| 1009 | 3300053119 | Ga0500595_026926 | Ga0500595_026926_698_979 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9361 | 20 | 83 |
| 5okz-assembly4.cif.gz_b | crystal strucrure of the mpp6 exosome complex | 0.9151 | 28 | 84 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.904 | 18 | 83 |
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.902 | 19 | 87 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.8956 | 20 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9361 | 20 | 83 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9101 | 29 | 82 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8956 | 20 | 83 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8825 | 22 | 90 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8785 | 29 | 82 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7P7E9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9723 | 27 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A432T7Q1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9713 | 25 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7V3W3R6-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9652 | 25 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A351YBM2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9645 | 21 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-X1EXW6-F1-model_v4 | Ribosomal protein L27 | 0.958 | 19 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar