F488085

General Info

Members Datasets Scaffolds Average Seq Length
1009 424 1002 88

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10037444|Ga0070658_100374445
Length 96
Sequence MAHKKSGGSSRNGRDSAGQRLGVKKFGGEAVLAGNILVRQRGTKFWPGDNVGLGRDHTLFATATGAVKFITKRDDRTYVNVVPATAAADQMNAKTK

Samples

Sample ID Description Type Environment
1 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 2818991435 Caulobacter henricii 536 Isolate Unclassified
7 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
8 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
184 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
249 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
323 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
365 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
375 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
385 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
386 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
387 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
388 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
389 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
390 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
391 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
392 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
398 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
399 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
400 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.65
Metatranscriptomes 4.66
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.55
Nodule 0
Rhizoplane 4.86
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 4.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1012637 3300000531 Bacteria 529
2 JGI24746J21847_1000324 3300001977 Bacteria 6853
3 rootH1_10216558 3300003323 Bacteria 1111
4 Ga0065715_10354226 3300005293 Bacteria 946
5 Ga0070658_10037444 3300005327 Bacteria 3911
6 Ga0070658_10038677 3300005327 Bacteria 3847
7 Ga0070658_10648962 3300005327 Bacteria 916
8 Ga0070658_10875618 3300005327 Bacteria 781
9 Ga0070658_11153827 3300005327 Bacteria 674
10 Ga0070683_100016420 3300005329 Bacteria 6531
11 Ga0070683_100063549 3300005329 Bacteria 3434
12 Ga0070683_100166154 3300005329 Bacteria 2094
13 Ga0070683_100616227 3300005329 Bacteria 1039
14 Ga0070683_100710425 3300005329 Bacteria 963
15 Ga0070683_100714760 3300005329 Bacteria 960
16 Ga0070683_100932775 3300005329 Bacteria 833
17 Ga0070670_100047898 3300005331 Bacteria 3679
18 Ga0070670_100331041 3300005331 Bacteria 1336
19 Ga0070670_100730249 3300005331 Bacteria 892
20 Ga0068869_100184472 3300005334 Bacteria 1637
21 Ga0068869_100416965 3300005334 Bacteria 1107
22 Ga0070666_10011180 3300005335 Bacteria 5626
23 Ga0070666_10293043 3300005335 Bacteria 1158
24 Ga0070666_10299046 3300005335 Bacteria 1146
25 Ga0070680_100012704 3300005336 Bacteria 6545
26 Ga0070680_100029823 3300005336 Bacteria 4379
27 Ga0070682_101453512 3300005337 Bacteria 588
28 Ga0070682_101523012 3300005337 Bacteria 576
29 Ga0068868_100002347 3300005338 Bacteria 13098
30 Ga0068868_100542997 3300005338 Bacteria 1023
31 Ga0070660_100329886 3300005339 Bacteria 1254
32 Ga0070660_100349902 3300005339 Bacteria 1217
33 Ga0070660_101159559 3300005339 Bacteria 655
34 Ga0070689_100433727 3300005340 Bacteria 1116
35 Ga0070689_101892303 3300005340 Bacteria 545
36 Ga0070691_10005831 3300005341 Bacteria 5621
37 Ga0070691_10597617 3300005341 Bacteria 651
38 Ga0070661_100284810 3300005344 Bacteria 1283
39 Ga0070661_100713913 3300005344 Bacteria 818
40 Ga0070661_100721965 3300005344 Bacteria 813
41 Ga0070661_101234163 3300005344 Bacteria 626
42 Ga0070668_100000042 3300005347 Bacteria 78694
43 Ga0070668_100003919 3300005347 Bacteria 10993
44 Ga0070668_100011777 3300005347 Bacteria 6513
45 Ga0070668_100022321 3300005347 Bacteria 4783
46 Ga0070668_101902611 3300005347 Bacteria 548
47 Ga0070669_100057999 3300005353 Bacteria 2841
48 Ga0070669_100275924 3300005353 Bacteria 1346
49 Ga0070675_100000028 3300005354 Bacteria 103914
50 Ga0070675_100340652 3300005354 Bacteria 1328
51 Ga0070671_100002736 3300005355 Bacteria 13694
52 Ga0070671_100613538 3300005355 Bacteria 940
53 Ga0070671_100912813 3300005355 Bacteria 767
54 Ga0070674_100000002 3300005356 Bacteria 271088
55 Ga0070673_100088435 3300005364 Bacteria 2527
56 Ga0070673_100227069 3300005364 Bacteria 1618
57 Ga0070673_100787119 3300005364 Bacteria 877
58 Ga0070673_101401080 3300005364 Bacteria 658
59 Ga0070673_101684586 3300005364 Bacteria 600
60 Ga0070688_100454848 3300005365 Bacteria 958
61 Ga0070659_100009501 3300005366 Bacteria 7145
62 Ga0070659_100594061 3300005366 Bacteria 951
63 Ga0070659_100976467 3300005366 Bacteria 743
64 Ga0070667_100000508 3300005367 Bacteria 39312
65 Ga0070667_100008242 3300005367 Bacteria 8637
66 Ga0070667_100016906 3300005367 Bacteria 6037
67 Ga0070667_100030728 3300005367 Bacteria 4479
68 Ga0070667_100325131 3300005367 Bacteria 1388
69 Ga0070667_100728170 3300005367 Bacteria 919
70 Ga0070713_100000058 3300005436 Bacteria 70009
71 Ga0070705_101290225 3300005440 Bacteria 605
72 Ga0070700_100071247 3300005441 Bacteria 2219
73 Ga0070700_100076081 3300005441 Bacteria 2155
74 Ga0070663_100625906 3300005455 Bacteria 908
75 Ga0070663_100886956 3300005455 Bacteria 770
76 Ga0070663_101919697 3300005455 Bacteria 532
77 Ga0070678_100008208 3300005456 Bacteria 6243
78 Ga0070678_100951193 3300005456 Bacteria 787
79 Ga0070678_101403683 3300005456 Bacteria 652
80 Ga0070678_101783160 3300005456 Bacteria 580
81 Ga0070662_100023925 3300005457 Bacteria 4203
82 Ga0070681_10002805 3300005458 Bacteria 16089
83 Ga0070681_10013326 3300005458 Bacteria 8171
84 Ga0070681_10115729 3300005458 Bacteria 2619
85 Ga0070681_10297309 3300005458 Bacteria 1524
86 Ga0068867_100697246 3300005459 Bacteria 896
87 Ga0068867_100929217 3300005459 Bacteria 784
88 Ga0070685_10158172 3300005466 Bacteria 1442
89 Ga0070685_10215289 3300005466 Bacteria 1256
90 Ga0070706_100245176 3300005467 Bacteria 1673
91 Ga0070706_100844196 3300005467 Bacteria 847
92 Ga0070679_100000461 3300005530 Bacteria 34593
93 Ga0070679_100031245 3300005530 Bacteria 5260
94 Ga0070679_101377108 3300005530 Bacteria 651
95 Ga0070684_100009565 3300005535 Bacteria 7637
96 Ga0070684_100017638 3300005535 Bacteria 5865
97 Ga0070684_100890659 3300005535 Bacteria 834
98 Ga0070684_101263314 3300005535 Bacteria 695
99 Ga0068853_100037066 3300005539 Bacteria 4147
100 Ga0068853_100048939 3300005539 Bacteria 3631
101 Ga0068853_100171967 3300005539 Bacteria 1960
102 Ga0068853_101301087 3300005539 Bacteria 703
103 Ga0068853_101872118 3300005539 Bacteria 582
104 Ga0070672_101136985 3300005543 Bacteria 695
105 Ga0070686_100219355 3300005544 Bacteria 1373
106 Ga0070686_100681904 3300005544 Bacteria 818
107 Ga0070695_100862319 3300005545 Bacteria 729
108 Ga0070665_100000040 3300005548 Bacteria 305480
109 Ga0070665_100000418 3300005548 Bacteria 62048
110 Ga0070665_100000691 3300005548 Bacteria 44984
111 Ga0070665_100001884 3300005548 Bacteria 23770
112 Ga0070665_100004723 3300005548 Bacteria 14190
113 Ga0070665_100011815 3300005548 Bacteria 8819
114 Ga0070665_100017881 3300005548 Bacteria 7118
115 Ga0070665_100018730 3300005548 Bacteria 6941
116 Ga0070665_100038239 3300005548 Bacteria 4824
117 Ga0068855_100005017 3300005563 Bacteria 16158
118 Ga0068855_100023693 3300005563 Bacteria 7350
119 Ga0068855_100115879 3300005563 Bacteria 3071
120 Ga0068855_100508201 3300005563 Bacteria 1309
121 Ga0068855_100897910 3300005563 Bacteria 936
122 Ga0068855_101163494 3300005563 Bacteria 804
123 Ga0068855_101717364 3300005563 Bacteria 640
124 Ga0068855_102601919 3300005563 Bacteria 502
125 Ga0070664_100263642 3300005564 Bacteria 1551
126 Ga0070664_100359490 3300005564 Bacteria 1326
127 Ga0068857_100030398 3300005577 Bacteria 4770
128 Ga0068857_100052533 3300005577 Bacteria 3616
129 Ga0068857_100540747 3300005577 Bacteria 1097
130 Ga0068857_101955562 3300005577 Bacteria 575
131 Ga0068854_100131599 3300005578 Bacteria 1911
132 Ga0068854_100241760 3300005578 Bacteria 1438
133 Ga0068854_100333838 3300005578 Bacteria 1236
134 Ga0068856_100006911 3300005614 Bacteria 11099
135 Ga0068856_100187737 3300005614 Bacteria 2081
136 Ga0068856_100192860 3300005614 Bacteria 2051
137 Ga0068856_100423337 3300005614 Bacteria 1351
138 Ga0068856_101090815 3300005614 Bacteria 816
139 Ga0068856_102184620 3300005614 Bacteria 563
140 Ga0068856_102278804 3300005614 Bacteria 550
141 Ga0068856_102327512 3300005614 Bacteria 544
142 Ga0068856_102409057 3300005614 Bacteria 534
143 Ga0068852_100000539 3300005616 Bacteria 24879
144 Ga0068852_100282530 3300005616 Bacteria 1600
145 Ga0068852_101654697 3300005616 Bacteria 662
146 Ga0068852_101834273 3300005616 Bacteria 629
147 Ga0068852_101935920 3300005616 Bacteria 612
148 Ga0068859_100001582 3300005617 Bacteria 23209
149 Ga0068859_100159602 3300005617 Bacteria 2334
150 Ga0068859_100279829 3300005617 Bacteria 1761
151 Ga0068859_100500762 3300005617 Bacteria 1310
152 Ga0068859_101368042 3300005617 Bacteria 781
153 Ga0068864_100000757 3300005618 Bacteria 27175
154 Ga0068864_100135302 3300005618 Bacteria 2218
155 Ga0068864_100311255 3300005618 Bacteria 1476
156 Ga0068864_100323202 3300005618 Bacteria 1449
157 Ga0068864_102134671 3300005618 Bacteria 567
158 Ga0068866_10000036 3300005718 Bacteria 51111
159 Ga0068861_101135889 3300005719 Bacteria 752
160 Ga0068861_101607137 3300005719 Bacteria 640
161 Ga0068861_101610348 3300005719 Bacteria 640
162 Ga0068870_10119561 3300005840 Bacteria 1516
163 Ga0068870_10790524 3300005840 Bacteria 662
164 Ga0068863_100000107 3300005841 Bacteria 88879
165 Ga0068863_100000119 3300005841 Bacteria 82539
166 Ga0068863_100004097 3300005841 Bacteria 14400
167 Ga0068863_100213206 3300005841 Bacteria 1859
168 Ga0068863_100309374 3300005841 Bacteria 1533
169 Ga0068863_101305412 3300005841 Bacteria 732
170 Ga0068858_100000069 3300005842 Bacteria 105617
171 Ga0068858_100000526 3300005842 Bacteria 40242
172 Ga0068858_100006690 3300005842 Bacteria 11215
173 Ga0068858_100133716 3300005842 Bacteria 2326
174 Ga0068858_101112043 3300005842 Bacteria 776
175 Ga0068860_100000133 3300005843 Bacteria 120382
176 Ga0068860_100000212 3300005843 Bacteria 91248
177 Ga0068860_100124911 3300005843 Bacteria 2466
178 Ga0068860_100292278 3300005843 Bacteria 1595
179 Ga0068860_100775126 3300005843 Bacteria 972
180 Ga0068862_100000619 3300005844 Bacteria 36984
181 Ga0068862_100012644 3300005844 Bacteria 6986
182 Ga0068862_100042579 3300005844 Bacteria 3868
183 Ga0068862_100314277 3300005844 Bacteria 1444
184 Ga0068862_100435154 3300005844 Bacteria 1234
185 Ga0068862_100569443 3300005844 Bacteria 1084
186 Ga0068862_100934228 3300005844 Bacteria 854
187 Ga0068862_101546090 3300005844 Bacteria 670
188 Ga0081455_10016739 3300005937 Bacteria 7061
189 Ga0081455_10634994 3300005937 Bacteria 690
190 Ga0081539_10071037 3300005985 Bacteria 1866
191 Ga0081539_10208170 3300005985 Bacteria 898
192 Ga0070717_11024276 3300006028 Bacteria 752
193 Ga0075368_10002212 3300006042 Bacteria 6312
194 Ga0075363_100108203 3300006048 Bacteria 1543
195 Ga0075364_10008150 3300006051 Bacteria 6252
196 Ga0070716_100014183 3300006173 Bacteria 4078
197 Ga0070716_100352737 3300006173 Bacteria 1042
198 Ga0070712_100002000 3300006175 Bacteria 12482
199 Ga0075367_10008101 3300006178 Bacteria 5425
200 Ga0075366_10133687 3300006195 Bacteria 1497
201 Ga0097621_101532608 3300006237 Unclassified 633
202 Ga0075370_10108116 3300006353 Bacteria 1613
203 Ga0068871_100486484 3300006358 Bacteria 1111
204 Ga0075430_101679919 3300006846 Bacteria 521
205 Ga0068865_100001766 3300006881 Bacteria 12693
206 Ga0068865_100295944 3300006881 Bacteria 1293
207 Ga0068865_100356363 3300006881 Bacteria 1187
208 Ga0068865_101464000 3300006881 Bacteria 611
209 Ga0097620_100001582 3300006931 Bacteria 23209
210 Ga0097620_100159599 3300006931 Bacteria 2334
211 Ga0097620_100279830 3300006931 Bacteria 1761
212 Ga0097620_100500837 3300006931 Bacteria 1310
213 Ga0097620_101368029 3300006931 Bacteria 781
214 Ga0105251_10092099 3300009011 Bacteria 1392
215 Ga0105240_10000679 3300009093 Bacteria 62613
216 Ga0105240_10003732 3300009093 Bacteria 23537
217 Ga0105240_10061517 3300009093 Bacteria 4679
218 Ga0105240_10228697 3300009093 Bacteria 2163
219 Ga0105240_10286498 3300009093 Bacteria 1890
220 Ga0105240_10529912 3300009093 Bacteria 1306
221 Ga0105240_11258726 3300009093 Bacteria 782
222 Ga0105240_12322411 3300009093 Bacteria 555
223 Ga0105245_10000310 3300009098 Bacteria 46567
224 Ga0105245_10766221 3300009098 Bacteria 1001
225 Ga0105245_11223792 3300009098 Bacteria 799
226 Ga0105245_11876879 3300009098 Bacteria 652
227 Ga0105245_12491889 3300009098 Bacteria 571
228 Ga0105247_10032337 3300009101 Bacteria 3179
229 Ga0105247_10212029 3300009101 Bacteria 1307
230 Ga0105247_10404660 3300009101 Bacteria 973
231 Ga0105247_11218550 3300009101 Bacteria 600
232 Ga0105243_10069020 3300009148 Bacteria 2850
233 Ga0105243_11653481 3300009148 Bacteria 668
234 Ga0105243_11788017 3300009148 Bacteria 645
235 Ga0105243_12111823 3300009148 Bacteria 599
236 Ga0105241_10423518 3300009174 Bacteria 1172
237 Ga0105241_10796834 3300009174 Bacteria 870
238 Ga0105242_10256474 3300009176 Bacteria 1578
239 Ga0105242_10839100 3300009176 Bacteria 913
240 Ga0105242_11228048 3300009176 Bacteria 770
241 Ga0105242_12039340 3300009176 Bacteria 617
242 Ga0105242_12105949 3300009176 Bacteria 608
243 Ga0105248_10000175 3300009177 Bacteria 74795
244 Ga0105248_10004488 3300009177 Bacteria 15447
245 Ga0105248_10005017 3300009177 Bacteria 14619
246 Ga0105248_10063658 3300009177 Bacteria 4140
247 Ga0105248_10523874 3300009177 Bacteria 1337
248 Ga0105248_10689378 3300009177 Bacteria 1152
249 Ga0105248_11078655 3300009177 Unclassified 908
250 Ga0105248_11654977 3300009177 Bacteria 725
251 Ga0105248_12515633 3300009177 Bacteria 587
252 Ga0105237_10555144 3300009545 Bacteria 1155
253 Ga0105237_10561436 3300009545 Bacteria 1148
254 Ga0105237_11270995 3300009545 Bacteria 742
255 Ga0105237_11503065 3300009545 Bacteria 680
256 Ga0105238_10089409 3300009551 Bacteria 3066
257 Ga0105238_10105565 3300009551 Bacteria 2799
258 Ga0105238_10144704 3300009551 Bacteria 2353
259 Ga0105238_10187590 3300009551 Bacteria 2044
260 Ga0105238_10316772 3300009551 Bacteria 1545
261 Ga0105238_10327059 3300009551 Bacteria 1519
262 Ga0105238_10333177 3300009551 Bacteria 1505
263 Ga0105238_10345064 3300009551 Bacteria 1477
264 Ga0105238_11130117 3300009551 Bacteria 807
265 Ga0105249_10009609 3300009553 Bacteria 8475
266 Ga0105249_10017801 3300009553 Bacteria 6313
267 Ga0105249_10397947 3300009553 Bacteria 1407
268 Ga0105249_10414920 3300009553 Bacteria 1379
269 Ga0105249_10876021 3300009553 Bacteria 964
270 Ga0105249_11764683 3300009553 Bacteria 691
271 Ga0105249_13278100 3300009553 Bacteria 521
272 Ga0105239_10221492 3300010375 Bacteria 2122
273 Ga0105239_10770120 3300010375 Bacteria 1102
274 Ga0105239_10820725 3300010375 Bacteria 1066
275 Ga0105239_11806958 3300010375 Bacteria 708
276 Ga0105239_12463115 3300010375 Bacteria 606
277 Ga0157320_1016578 3300012481 Bacteria 634
278 Ga0157373_10002536 3300013100 Bacteria 13905
279 Ga0157373_10827430 3300013100 Bacteria 684
280 Ga0157370_10003852 3300013104 Bacteria 17496
281 Ga0157370_10109059 3300013104 Bacteria 2588
282 Ga0157370_10301379 3300013104 Bacteria 1479
283 Ga0157370_10334409 3300013104 Bacteria 1396
284 Ga0157370_10440303 3300013104 Bacteria 1198
285 Ga0157370_10479742 3300013104 Bacteria 1143
286 Ga0157370_11102487 3300013104 Bacteria 717
287 Ga0157370_11546511 3300013104 Bacteria 596
288 Ga0157370_11990422 3300013104 Bacteria 521
289 Ga0157369_10887202 3300013105 Bacteria 915
290 Ga0157374_10004652 3300013296 Bacteria 11508
291 Ga0157374_10098882 3300013296 Bacteria 2794
292 Ga0157374_12378826 3300013296 Bacteria 557
293 Ga0157378_10005783 3300013297 Bacteria 10838
294 Ga0157378_11220927 3300013297 Bacteria 792
295 Ga0163162_10043181 3300013306 Bacteria 4514
296 Ga0163162_10059611 3300013306 Bacteria 3849
297 Ga0163162_10189403 3300013306 Bacteria 2184
298 Ga0163162_11358862 3300013306 Bacteria 808
299 Ga0163162_12398190 3300013306 Bacteria 606
300 Ga0163162_12415827 3300013306 Bacteria 604
301 Ga0157372_10093929 3300013307 Bacteria 3414
302 Ga0157372_13047628 3300013307 Bacteria 535
303 Ga0157375_10000137 3300013308 Bacteria 72720
304 Ga0157375_10234488 3300013308 Bacteria 1994
305 Ga0157375_10329398 3300013308 Bacteria 1692
306 Ga0157375_10618834 3300013308 Bacteria 1241
307 Ga0157375_11013469 3300013308 Bacteria 970
308 Ga0157375_11762204 3300013308 Bacteria 734
309 Ga0163163_10000780 3300014325 Bacteria 27061
310 Ga0163163_10372208 3300014325 Bacteria 1486
311 Ga0163163_10448826 3300014325 Bacteria 1350
312 Ga0163163_10468208 3300014325 Bacteria 1321
313 Ga0163163_10641795 3300014325 Bacteria 1125
314 Ga0163163_10897577 3300014325 Bacteria 950
315 Ga0163163_10932181 3300014325 Bacteria 932
316 Ga0157380_10007574 3300014326 Bacteria 7714
317 Ga0157380_11825896 3300014326 Bacteria 667
318 Ga0157380_11932763 3300014326 Bacteria 651
319 Ga0182008_10955409 3300014497 Bacteria 508
320 Ga0157377_10349866 3300014745 Bacteria 991
321 Ga0157379_10000947 3300014968 Bacteria 23530
322 Ga0157379_10003056 3300014968 Bacteria 14141
323 Ga0157379_10019721 3300014968 Bacteria 5958
324 Ga0157379_10086911 3300014968 Bacteria 2803
325 Ga0157379_10486049 3300014968 Bacteria 1143
326 Ga0157379_11076522 3300014968 Bacteria 769
327 Ga0157376_10147350 3300014969 Bacteria 2119
328 Ga0157376_10264369 3300014969 Bacteria 1613
329 Ga0157376_12943750 3300014969 Bacteria 515
330 Ga0163161_10000027 3300017792 Bacteria 197774
331 Ga0163161_10126978 3300017792 Bacteria 1921
332 Ga0163161_10285686 3300017792 Bacteria 1295
333 Ga0163161_10918988 3300017792 Bacteria 742
334 Ga0206356_11355552 3300020070 Bacteria 2762
335 Ga0206352_10973552 3300020078 Bacteria 734
336 Ga0213873_10125109 3300021358 Bacteria 758
337 Ga0213874_10129590 3300021377 Bacteria 865
338 Ga0213874_10180478 3300021377 Bacteria 751
339 Ga0213874_10349288 3300021377 Bacteria 566
340 Ga0213876_10000568 3300021384 Bacteria 27555
341 Ga0213876_10032943 3300021384 Bacteria 2732
342 Ga0213876_10291320 3300021384 Bacteria 867
343 Ga0213876_10641129 3300021384 Bacteria 565
344 Ga0213875_10367830 3300021388 Bacteria 684
345 Ga0213871_10005996 3300021441 Bacteria 2546
346 Ga0213871_10012129 3300021441 Bacteria 1994
347 Ga0224712_10018482 3300022467 Bacteria 2331
348 Ga0224712_10188353 3300022467 Bacteria 933
349 Ga0209148_1006910 3300025254 Bacteria 2409
350 Ga0209148_1018139 3300025254 Bacteria 1186
351 Ga0209455_1054995 3300025272 Bacteria 541
352 Ga0207697_10275067 3300025315 Bacteria 746
353 Ga0207656_10447104 3300025321 Bacteria 653
354 Ga0207642_10000060 3300025899 Bacteria 32182
355 Ga0207710_10402607 3300025900 Bacteria 702
356 Ga0207710_10506290 3300025900 Bacteria 627
357 Ga0207688_10452551 3300025901 Bacteria 800
358 Ga0207680_10004412 3300025903 Bacteria 6670
359 Ga0207680_10266568 3300025903 Bacteria 1187
360 Ga0207680_10859693 3300025903 Bacteria 650
361 Ga0207680_11048096 3300025903 Bacteria 584
362 Ga0207645_10077821 3300025907 Bacteria 2125
363 Ga0207643_10659266 3300025908 Bacteria 675
364 Ga0207705_10005663 3300025909 Bacteria 9325
365 Ga0207705_10031767 3300025909 Bacteria 3771
366 Ga0207705_10321194 3300025909 Bacteria 1190
367 Ga0207705_10418515 3300025909 Bacteria 1037
368 Ga0207654_10542261 3300025911 Bacteria 825
369 Ga0207654_11300381 3300025911 Bacteria 530
370 Ga0207707_10007406 3300025912 Bacteria 9560
371 Ga0207707_10010835 3300025912 Bacteria 7922
372 Ga0207707_10072729 3300025912 Bacteria 2997
373 Ga0207707_10135825 3300025912 Bacteria 2150
374 Ga0207695_10000837 3300025913 Bacteria 56634
375 Ga0207695_10001415 3300025913 Bacteria 40402
376 Ga0207695_10004225 3300025913 Bacteria 19746
377 Ga0207695_10217410 3300025913 Bacteria 1819
378 Ga0207695_10290079 3300025913 Bacteria 1528
379 Ga0207695_10299028 3300025913 Bacteria 1501
380 Ga0207695_10662474 3300025913 Bacteria 925
381 Ga0207695_11476108 3300025913 Bacteria 560
382 Ga0207693_10004030 3300025915 Bacteria 12483
383 Ga0207693_10347130 3300025915 Bacteria 1161
384 Ga0207660_10005342 3300025917 Bacteria 8345
385 Ga0207660_10082116 3300025917 Bacteria 2370
386 Ga0207660_10175592 3300025917 Bacteria 1661
387 Ga0207660_10177760 3300025917 Bacteria 1651
388 Ga0207660_10532746 3300025917 Bacteria 954
389 Ga0207660_10949207 3300025917 Bacteria 702
390 Ga0207657_10318140 3300025919 Bacteria 1231
391 Ga0207657_10725261 3300025919 Bacteria 771
392 Ga0207657_11440744 3300025919 Bacteria 516
393 Ga0207649_10208624 3300025920 Bacteria 1384
394 Ga0207649_10496707 3300025920 Bacteria 927
395 Ga0207652_10050296 3300025921 Bacteria 3570
396 Ga0207652_10059412 3300025921 Bacteria 3296
397 Ga0207652_10489026 3300025921 Bacteria 1108
398 Ga0207681_10054011 3300025923 Bacteria 2729
399 Ga0207681_10291623 3300025923 Bacteria 1288
400 Ga0207681_11278580 3300025923 Bacteria 616
401 Ga0207694_10103283 3300025924 Bacteria 2260
402 Ga0207694_10214695 3300025924 Bacteria 1568
403 Ga0207694_10256603 3300025924 Bacteria 1431
404 Ga0207694_10290475 3300025924 Bacteria 1344
405 Ga0207694_11185616 3300025924 Bacteria 646
406 Ga0207650_10000016 3300025925 Bacteria 361958
407 Ga0207650_10373801 3300025925 Bacteria 1176
408 Ga0207659_10000018 3300025926 Bacteria 156920
409 Ga0207659_10259588 3300025926 Bacteria 1413
410 Ga0207687_10000079 3300025927 Bacteria 70683
411 Ga0207687_10825121 3300025927 Bacteria 791
412 Ga0207687_11428646 3300025927 Bacteria 594
413 Ga0207687_11435720 3300025927 Bacteria 593
414 Ga0207700_10000003 3300025928 Bacteria 500797
415 Ga0207700_10771090 3300025928 Bacteria 860
416 Ga0207644_10006266 3300025931 Bacteria 7749
417 Ga0207644_10638640 3300025931 Bacteria 885
418 Ga0207690_10000898 3300025932 Bacteria 18981
419 Ga0207690_10012606 3300025932 Bacteria 5061
420 Ga0207690_10013676 3300025932 Bacteria 4883
421 Ga0207690_10849117 3300025932 Bacteria 756
422 Ga0207706_10020225 3300025933 Bacteria 5983
423 Ga0207686_10255109 3300025934 Bacteria 1283
424 Ga0207686_10346586 3300025934 Bacteria 1117
425 Ga0207686_11220771 3300025934 Bacteria 616
426 Ga0207709_10384833 3300025935 Bacteria 1068
427 Ga0207670_10002339 3300025936 Bacteria 9929
428 Ga0207670_10083933 3300025936 Bacteria 2236
429 Ga0207669_10000003 3300025937 Bacteria 252239
430 Ga0207669_10317154 3300025937 Bacteria 1191
431 Ga0207704_10001066 3300025938 Bacteria 12198
432 Ga0207704_10010816 3300025938 Bacteria 4468
433 Ga0207704_10442147 3300025938 Bacteria 1036
434 Ga0207665_10371411 3300025939 Bacteria 1083
435 Ga0207665_10443856 3300025939 Bacteria 995
436 Ga0207665_10766282 3300025939 Bacteria 761
437 Ga0207691_10000002 3300025940 Bacteria 189785
438 Ga0207711_10000006 3300025941 Bacteria 792692
439 Ga0207711_10000155 3300025941 Bacteria 73463
440 Ga0207711_10005857 3300025941 Bacteria 10377
441 Ga0207711_10152489 3300025941 Bacteria 2086
442 Ga0207711_10691641 3300025941 Bacteria 951
443 Ga0207711_10724499 3300025941 Bacteria 927
444 Ga0207711_10809128 3300025941 Bacteria 873
445 Ga0207711_10901628 3300025941 Unclassified 822
446 Ga0207711_11079898 3300025941 Bacteria 743
447 Ga0207689_10120163 3300025942 Bacteria 2162
448 Ga0207689_10199604 3300025942 Bacteria 1651
449 Ga0207661_10000693 3300025944 Bacteria 21892
450 Ga0207661_10000774 3300025944 Bacteria 20762
451 Ga0207661_10010255 3300025944 Bacteria 6739
452 Ga0207661_10045890 3300025944 Bacteria 3462
453 Ga0207661_11610162 3300025944 Bacteria 594
454 Ga0207679_10064870 3300025945 Bacteria 2731
455 Ga0207679_10347297 3300025945 Bacteria 1292
456 Ga0207679_10804161 3300025945 Bacteria 857
457 Ga0207667_10011376 3300025949 Bacteria 10348
458 Ga0207667_10044451 3300025949 Bacteria 4706
459 Ga0207667_10263395 3300025949 Bacteria 1763
460 Ga0207667_10319847 3300025949 Bacteria 1585
461 Ga0207667_10456422 3300025949 Bacteria 1298
462 Ga0207651_10251899 3300025960 Bacteria 1445
463 Ga0207651_10394705 3300025960 Bacteria 1175
464 Ga0207651_11129930 3300025960 Bacteria 702
465 Ga0207651_11430805 3300025960 Bacteria 622
466 Ga0207712_10000019 3300025961 Bacteria 317060
467 Ga0207712_10007748 3300025961 Bacteria 6789
468 Ga0207712_10313588 3300025961 Bacteria 1291
469 Ga0207712_11088134 3300025961 Bacteria 711
470 Ga0207712_11341447 3300025961 Bacteria 640
471 Ga0207668_10000019 3300025972 Bacteria 152108
472 Ga0207668_10000241 3300025972 Bacteria 36742
473 Ga0207668_10006047 3300025972 Bacteria 7138
474 Ga0207668_10007726 3300025972 Bacteria 6397
475 Ga0207668_10070882 3300025972 Bacteria 2487
476 Ga0207668_10427457 3300025972 Bacteria 1125
477 Ga0207668_10646381 3300025972 Bacteria 925
478 Ga0207668_11987327 3300025972 Bacteria 524
479 Ga0207640_10111369 3300025981 Bacteria 1941
480 Ga0207640_10686642 3300025981 Bacteria 876
481 Ga0207640_11403247 3300025981 Bacteria 626
482 Ga0207658_10000295 3300025986 Bacteria 52135
483 Ga0207658_10002476 3300025986 Bacteria 13480
484 Ga0207658_10014433 3300025986 Bacteria 5408
485 Ga0207658_10422709 3300025986 Bacteria 1175
486 Ga0207658_10445065 3300025986 Bacteria 1146
487 Ga0207658_10676398 3300025986 Bacteria 931
488 Ga0207658_10753113 3300025986 Bacteria 882
489 Ga0207677_10000361 3300026023 Bacteria 31898
490 Ga0207677_10430994 3300026023 Bacteria 1125
491 Ga0207703_10000169 3300026035 Bacteria 76131
492 Ga0207703_10000170 3300026035 Bacteria 75814
493 Ga0207703_10002213 3300026035 Bacteria 17068
494 Ga0207703_10004727 3300026035 Bacteria 11111
495 Ga0207703_10570132 3300026035 Bacteria 1069
496 Ga0207639_10010622 3300026041 Bacteria 6376
497 Ga0207639_10016225 3300026041 Bacteria 5264
498 Ga0207639_10133544 3300026041 Bacteria 2058
499 Ga0207639_10410461 3300026041 Bacteria 1222
500 Ga0207639_10705975 3300026041 Bacteria 936
501 Ga0207639_11146478 3300026041 Bacteria 729
502 Ga0207639_11264446 3300026041 Bacteria 693
503 Ga0207639_11840425 3300026041 Bacteria 566
504 Ga0207678_10633354 3300026067 Bacteria 939
505 Ga0207678_10657774 3300026067 Bacteria 921
506 Ga0207708_10022830 3300026075 Bacteria 4725
507 Ga0207708_10312388 3300026075 Bacteria 1281
508 Ga0207708_10818834 3300026075 Bacteria 802
509 Ga0207702_10003690 3300026078 Bacteria 13856
510 Ga0207702_10126043 3300026078 Bacteria 2299
511 Ga0207702_10154757 3300026078 Bacteria 2089
512 Ga0207702_10397749 3300026078 Bacteria 1328
513 Ga0207702_10460042 3300026078 Bacteria 1236
514 Ga0207702_11553126 3300026078 Bacteria 655
515 Ga0207702_11839356 3300026078 Bacteria 597
516 Ga0207702_12449922 3300026078 Bacteria 509
517 Ga0207641_10000077 3300026088 Bacteria 144978
518 Ga0207641_10000612 3300026088 Bacteria 39133
519 Ga0207641_10001331 3300026088 Bacteria 24454
520 Ga0207641_10244530 3300026088 Bacteria 1673
521 Ga0207641_10370456 3300026088 Bacteria 1369
522 Ga0207648_10088874 3300026089 Bacteria 2698
523 Ga0207648_10490922 3300026089 Bacteria 1123
524 Ga0207648_10807326 3300026089 Bacteria 874
525 Ga0207676_10002400 3300026095 Bacteria 13363
526 Ga0207676_10086766 3300026095 Bacteria 2557
527 Ga0207676_10178658 3300026095 Bacteria 1856
528 Ga0207676_10956833 3300026095 Bacteria 842
529 Ga0207676_11495132 3300026095 Bacteria 672
530 Ga0207676_12045022 3300026095 Bacteria 571
531 Ga0207674_10041054 3300026116 Bacteria 4787
532 Ga0207674_10046471 3300026116 Bacteria 4457
533 Ga0207675_100240157 3300026118 Bacteria 1751
534 Ga0207675_100554658 3300026118 Bacteria 1148
535 Ga0207675_100905684 3300026118 Bacteria 898
536 Ga0207675_101438438 3300026118 Bacteria 710
537 Ga0207683_10006424 3300026121 Bacteria 10067
538 Ga0207683_10113141 3300026121 Bacteria 2431
539 Ga0207683_11207475 3300026121 Bacteria 701
540 Ga0207698_10000004 3300026142 Bacteria 313614
541 Ga0207698_10694156 3300026142 Bacteria 1012
542 Ga0207698_11196583 3300026142 Bacteria 774
543 Ga0207698_11639606 3300026142 Bacteria 659
544 Ga0209981_1029420 3300027378 Bacteria 803
545 Ga0209999_1006261 3300027543 Bacteria 2137
546 Ga0209982_1011433 3300027552 Bacteria 1326
547 Ga0209983_1083430 3300027665 Bacteria 717
548 Ga0209813_10005758 3300027866 Bacteria 3026
549 Ga0268266_10000003 3300028379 Bacteria 1701703
550 Ga0268266_10000045 3300028379 Bacteria 312955
551 Ga0268266_10000711 3300028379 Bacteria 44986
552 Ga0268266_10001210 3300028379 Bacteria 31835
553 Ga0268266_10003648 3300028379 Bacteria 15221
554 Ga0268266_10020143 3300028379 Bacteria 5686
555 Ga0268266_10063407 3300028379 Bacteria 3190
556 Ga0268266_10077006 3300028379 Bacteria 2899
557 Ga0268266_10107687 3300028379 Bacteria 2465
558 Ga0268265_10001088 3300028380 Bacteria 24179
559 Ga0268265_10001421 3300028380 Bacteria 20258
560 Ga0268265_10027175 3300028380 Bacteria 4080
561 Ga0268265_10128675 3300028380 Bacteria 2100
562 Ga0268265_10329581 3300028380 Bacteria 1386
563 Ga0268265_10639200 3300028380 Bacteria 1021
564 Ga0268264_10000091 3300028381 Bacteria 233338
565 Ga0268264_10000207 3300028381 Bacteria 120086
566 Ga0268264_10010714 3300028381 Bacteria 7574
567 Ga0268264_11281844 3300028381 Bacteria 743
568 Ga0268264_11430402 3300028381 Bacteria 702
569 Ga0268264_12306966 3300028381 Bacteria 545
570 Ga0265337_1137074 3300028556 Bacteria 663
571 Ga0265326_10000079 3300028558 Bacteria 51707
572 Ga0265322_10000004 3300028654 Bacteria 275155
573 Ga0265336_10202260 3300028666 Bacteria 590
574 Ga0307517_10000835 3300028786 Bacteria 53001
575 Ga0307517_10126586 3300028786 Bacteria 1861
576 Ga0265338_10053005 3300028800 Bacteria 3634
577 Ga0265338_10233227 3300028800 Bacteria 1367
578 Ga0265324_10011479 3300029957 Bacteria 3373
579 Ga0265332_10036105 3300031238 Bacteria 2146
580 Ga0265328_10006864 3300031239 Bacteria 4782
581 Ga0265328_10318040 3300031239 Bacteria 603
582 Ga0265320_10000029 3300031240 Bacteria 159627
583 Ga0265320_10180939 3300031240 Bacteria 945
584 Ga0265325_10063783 3300031241 Bacteria 1864
585 Ga0265340_10290420 3300031247 Bacteria 726
586 Ga0265340_10566998 3300031247 Bacteria 500
587 Ga0265339_10391369 3300031249 Bacteria 650
588 Ga0265327_10000287 3300031251 Bacteria 99268
589 Ga0265327_10000723 3300031251 Bacteria 51798
590 Ga0265327_10000868 3300031251 Bacteria 44811
591 Ga0265327_10114940 3300031251 Bacteria 1281
592 Ga0265316_10034072 3300031344 Bacteria 4140
593 Ga0265316_10109954 3300031344 Bacteria 2088
594 Ga0265316_11037918 3300031344 Bacteria 570
595 Ga0307513_10000873 3300031456 Bacteria 43622
596 Ga0307513_10004902 3300031456 Bacteria 17766
597 Ga0307513_10154808 3300031456 Bacteria 2194
598 Ga0307408_100383663 3300031548 Bacteria 1202
599 Ga0316579_10392193 3300031691 Bacteria 671
600 Ga0265314_10000484 3300031711 Bacteria 52007
601 Ga0265314_10057533 3300031711 Bacteria 2669
602 Ga0316576_10023751 3300031727 Bacteria 4275
603 Ga0307516_10000030 3300031730 Bacteria 159694
604 Ga0307405_11375069 3300031731 Bacteria 616
605 Ga0307406_10535895 3300031901 Bacteria 955
606 Ga0307406_10753607 3300031901 Bacteria 818
607 Ga0307407_10535865 3300031903 Bacteria 863
608 Ga0307409_101099300 3300031995 Bacteria 816
609 Ga0307416_101209772 3300032002 Bacteria 861
610 Ga0307416_101782689 3300032002 Bacteria 720
611 Ga0307416_103053825 3300032002 Bacteria 560
612 Ga0307414_10108804 3300032004 Bacteria 2104
613 Ga0307510_10087941 3300033180 Bacteria 2970
614 Ga0307510_10200659 3300033180 Bacteria 1530
615 Ga0316596_1123774 3300033541 Bacteria 704
616 Ga0373926_0086427 3300035083 Bacteria 1164
617 Ga0373934_0337231 3300035086 Bacteria 627
618 Ga0373940_0033196 3300035088 Bacteria 1387
619 Ga0373944_0013203 3300035089 Bacteria 2287
620 Ga0373923_0558521 3300035111 Bacteria 561
621 Ga0373936_0009511 3300035113 Bacteria 3664
622 Ga0373939_0082754 3300035114 Bacteria 1069
623 Ga0373941_0078984 3300035115 Bacteria 1108
624 Ga0373945_0065928 3300035116 Bacteria 1361
625 Ga0373943_0051520 3300035170 Bacteria 2027
626 Ga0373946_0132043 3300035171 Bacteria 1149
627 Ga0373946_0501511 3300035171 Bacteria 622
628 Ga0373955_0828465 3300035172 Bacteria 569
629 Ga0316574_0235089 3300035398 Bacteria 1172
630 Ga0316574_0565862 3300035398 Bacteria 704
631 Ga0373931_0524431 3300035691 Bacteria 767
632 Ga0373931_0699258 3300035691 Bacteria 669
633 Ga0373931_1029803 3300035691 Bacteria 558
634 Ga0373935_1487928 3300035692 Bacteria 507
635 Ga0373927_0000173 3300035695 Bacteria 50996
636 Ga0373947_0027745 3300035725 Bacteria 3315
637 Ga0373937_0741131 3300036401 Bacteria 930
638 Ga0316582_0832302 3300036647 Bacteria 632
639 Ga0316582_1152383 3300036647 Bacteria 528
640 Ga0316584_0016821 3300036712 Bacteria 5248
641 Ga0373925_0000049 3300037068 Bacteria 128065
642 Ga0373925_0163729 3300037068 Bacteria 1753
643 Ga0373925_0965083 3300037068 Bacteria 702
644 Ga0373925_1014951 3300037068 Bacteria 683
645 Ga0395899_0095773 3300037312 Bacteria 2147
646 Ga0395899_0099667 3300037312 Bacteria 2098
647 Ga0395899_0680639 3300037312 Bacteria 647
648 Ga0395900_0139862 3300037418 Bacteria 2479
649 Ga0395900_0195571 3300037418 Bacteria 2049
650 Ga0395900_0575235 3300037418 Bacteria 1069
651 Ga0395898_0238514 3300037466 Bacteria 1734
652 Ga0395898_0901049 3300037466 Bacteria 822
653 Ga0395898_1478547 3300037466 Bacteria 606
654 Ga0395905_0000022 3300037471 Bacteria 321527
655 Ga0395905_0027924 3300037471 Bacteria 5320
656 Ga0395905_0043114 3300037471 Bacteria 4233
657 Ga0395905_0043133 3300037471 Bacteria 4232
658 Ga0395905_0151539 3300037471 Bacteria 2181
659 Ga0395905_0590077 3300037471 Bacteria 1013
660 Ga0436364_0037096 3300037853 Bacteria 1036
661 Ga0436364_0175783 3300037853 Bacteria 773
662 Ga0436364_0576095 3300037853 Bacteria 668
663 Ga0395901_0134281 3300038443 Bacteria 2600
664 Ga0395901_0230784 3300038443 Bacteria 1932
665 Ga0395901_1098893 3300038443 Bacteria 766
666 Ga0436365_0192477 3300039437 Bacteria 1621
667 Ga0436365_0422229 3300039437 Bacteria 2215
668 Ga0436365_0425122 3300039437 Bacteria 997
669 Ga0436365_1291619 3300039437 Bacteria 1944
670 Ga0436360_0189994 3300039438 Bacteria 1040
671 Ga0436360_0384133 3300039438 Bacteria 4079
672 Ga0436360_0392815 3300039438 Bacteria 2173
673 Ga0436360_0474819 3300039438 Bacteria 968
674 Ga0436360_1355634 3300039438 Bacteria 1768
675 Ga0436361_0304745 3300039447 Bacteria 3133
676 Ga0436361_0319149 3300039447 Bacteria 733
677 Ga0436361_0486019 3300039447 Bacteria 2465
678 Ga0436361_0548490 3300039447 Bacteria 1281
679 Ga0436361_1066444 3300039447 Bacteria 1015
680 Ga0436363_0123189 3300039450 Bacteria 1173
681 Ga0436363_0144206 3300039450 Bacteria 756
682 Ga0436363_0526126 3300039450 Bacteria 631
683 Ga0436363_0763861 3300039450 Bacteria 616
684 Ga0436363_0939738 3300039450 Bacteria 6202
685 Ga0436362_0053172 3300039453 Bacteria 1832
686 Ga0436362_1196929 3300039453 Bacteria 953
687 Ga0451804_0677918 3300041463 Bacteria 603
688 Ga0451807_0534070 3300041486 Bacteria 558
689 Ga0451833_0408238 3300041491 Bacteria 711
690 Ga0451837_1468072 3300041494 Bacteria 612
691 Ga0451843_0090988 3300041509 Bacteria 501
692 Ga0451855_1286586 3300041511 Bacteria 644
693 Ga0451853_0956394 3300041512 Bacteria 1413
694 Ga0451853_1991594 3300041512 Bacteria 617
695 Ga0450901_004112 3300042533 Bacteria 1507
696 Ga0466969_0015922 3300044656 Bacteria 3940
697 Ga0466965_0141460 3300044683 Bacteria 1253
698 Ga0466965_0156640 3300044683 Bacteria 1193
699 Ga0466966_0003014 3300044684 Bacteria 11108
700 Ga0466966_0070352 3300044684 Bacteria 2194
701 Ga0466961_0002790 3300044693 Bacteria 10861
702 Ga0466961_0104630 3300044693 Bacteria 1782
703 Ga0466961_0217535 3300044693 Bacteria 1178
704 Ga0466963_0388530 3300044694 Bacteria 984
705 Ga0466971_0239006 3300044719 Bacteria 863
706 Ga0466968_0016405 3300044735 Bacteria 2950
707 Ga0466968_0591920 3300044735 Bacteria 559
708 Ga0466970_0026932 3300044765 Bacteria 3014
709 Ga0466957_0001331 3300044842 Bacteria 12898
710 Ga0466957_0005133 3300044842 Bacteria 7318
711 Ga0466957_0146347 3300044842 Bacteria 1525
712 Ga0466957_1151491 3300044842 Bacteria 560
713 Ga0466957_1242930 3300044842 Bacteria 540
714 Ga0466959_0000086 3300045049 Bacteria 59057
715 Ga0466959_0102536 3300045049 Bacteria 2048
716 Ga0466959_0386074 3300045049 Bacteria 953
717 Ga0451576_1542699 3300045051 Bacteria 690
718 Ga0466958_0026304 3300045836 Bacteria 3438
719 Ga0466958_0064044 3300045836 Bacteria 2242
720 Ga0466958_0859835 3300045836 Bacteria 592
721 Ga0495592_0008902 3300046454 Bacteria 7539
722 Ga0495603_0001338 3300046455 Bacteria 14315
723 Ga0495629_0791825 3300046459 Bacteria 626
724 Ga0495638_0005743 3300046460 Bacteria 9134
725 Ga0495638_0169895 3300046460 Bacteria 1252
726 Ga0495641_0000014 3300046461 Bacteria 140908
727 Ga0495641_0460883 3300046461 Bacteria 579
728 Ga0495651_0096467 3300046462 Bacteria 2209
729 Ga0495651_0590045 3300046462 Bacteria 702
730 Ga0495653_0080430 3300046463 Bacteria 2411
731 Ga0495653_0453694 3300046463 Bacteria 806
732 Ga0495650_0146133 3300046471 Bacteria 852
733 Ga0495662_0005830 3300046476 Bacteria 6164
734 Ga0495662_0047569 3300046476 Bacteria 2070
735 Ga0495585_0587470 3300046492 Bacteria 524
736 Ga0495594_0000006 3300046499 Bacteria 167901
737 Ga0495596_0224590 3300046500 Bacteria 729
738 Ga0495583_0062409 3300046506 Bacteria 1659
739 Ga0495606_0121510 3300046507 Bacteria 1563
740 Ga0495608_0009408 3300046511 Bacteria 6832
741 Ga0495608_0157440 3300046511 Bacteria 1445
742 Ga0495610_0355438 3300046512 Bacteria 551
743 Ga0495628_0000437 3300046516 Bacteria 37922
744 Ga0495628_0014714 3300046516 Bacteria 6551
745 Ga0495628_0071508 3300046516 Bacteria 2704
746 Ga0495628_0557159 3300046516 Bacteria 822
747 Ga0495628_0784862 3300046516 Bacteria 667
748 Ga0495630_0011760 3300046517 Bacteria 6343
749 Ga0495630_0070399 3300046517 Bacteria 2632
750 Ga0495630_0457077 3300046517 Bacteria 978
751 Ga0495644_0001542 3300046523 Bacteria 9397
752 Ga0495644_0114564 3300046523 Bacteria 1024
753 Ga0495663_0042968 3300046525 Bacteria 1379
754 Ga0495642_0010166 3300046528 Bacteria 3604
755 Ga0495642_0289210 3300046528 Bacteria 717
756 Ga0495652_0764050 3300046529 Bacteria 646
757 Ga0495665_0550657 3300046531 Bacteria 579
758 Ga0495586_0001281 3300046535 Bacteria 14059
759 Ga0495598_0197989 3300046537 Bacteria 724
760 Ga0495621_0059748 3300046539 Bacteria 1382
761 Ga0495645_0472690 3300046543 Bacteria 787
762 Ga0495645_0479851 3300046543 Bacteria 780
763 Ga0495622_0000132 3300046557 Bacteria 63863
764 Ga0495668_0025043 3300046616 Bacteria 3392
765 Ga0495668_0351926 3300046616 Bacteria 808
766 Ga0495668_0518658 3300046616 Bacteria 657
767 Ga0495634_0000002 3300046642 Bacteria 247842
768 Ga0495611_0096417 3300046648 Bacteria 1369
769 Ga0495625_0022110 3300046660 Bacteria 4881
770 Ga0495625_0044306 3300046660 Bacteria 3222
771 Ga0495625_0095839 3300046660 Bacteria 2044
772 Ga0495635_0000005 3300046663 Bacteria 302178
773 Ga0495635_0742729 3300046663 Bacteria 634
774 Ga0495659_0015957 3300046664 Bacteria 2474
775 Ga0495661_0216748 3300046665 Bacteria 994
776 Ga0495588_0165115 3300046674 Bacteria 1171
777 Ga0495588_0749608 3300046674 Bacteria 510
778 Ga0495657_0016546 3300046675 Bacteria 5373
779 Ga0495599_0005994 3300046678 Bacteria 7315
780 Ga0495623_0282827 3300046679 Bacteria 922
781 Ga0495647_0000009 3300046681 Bacteria 94874
782 Ga0495658_0882508 3300046683 Bacteria 572
783 Ga0495669_0000014 3300046684 Bacteria 140832
784 Ga0495669_0095358 3300046684 Bacteria 1378
785 Ga0495669_0422530 3300046684 Bacteria 646
786 Ga0495613_0000094 3300046689 Bacteria 86601
787 Ga0495613_0001352 3300046689 Bacteria 18688
788 Ga0495624_0001301 3300046690 Bacteria 19637
789 Ga0495624_0095836 3300046690 Bacteria 1828
790 Ga0495670_0010128 3300046691 Bacteria 4639
791 Ga0495670_0142599 3300046691 Bacteria 1253
792 Ga0495670_0464537 3300046691 Bacteria 686
793 Ga0495671_0123829 3300046692 Bacteria 1261
794 Ga0495649_0196378 3300046694 Bacteria 1049
795 Ga0495600_0021782 3300046809 Bacteria 4109
796 Ga0495600_0277195 3300046809 Bacteria 1062
797 Ga0495660_0116836 3300046810 Bacteria 1354
798 Ga0495604_0000089 3300047317 Bacteria 77741
799 Ga0495604_0003648 3300047317 Bacteria 12274
800 Ga0495604_0012257 3300047317 Bacteria 6815
801 Ga0495636_0206442 3300047318 Bacteria 898
802 Ga0495674_0378402 3300047319 Bacteria 1146
803 Ga0495672_0095153 3300047320 Bacteria 1627
804 Ga0495676_0000136 3300047321 Bacteria 55706
805 Ga0495676_0584712 3300047321 Bacteria 728
806 Ga0495680_0000856 3300047322 Bacteria 33820
807 Ga0495680_0010286 3300047322 Bacteria 8345
808 Ga0495683_0120139 3300047323 Bacteria 1248
809 Ga0495687_178773 3300047443 Bacteria 695
810 Ga0495675_0073901 3300047444 Bacteria 2149
811 Ga0495677_0032530 3300047445 Bacteria 1900
812 Ga0495677_0092502 3300047445 Bacteria 1140
813 Ga0495679_033232 3300047446 Bacteria 1649
814 Ga0495681_0105134 3300047470 Bacteria 1229
815 Ga0495684_0257963 3300047471 Bacteria 1266
816 Ga0495684_0725531 3300047471 Bacteria 656
817 Ga0495684_0765397 3300047471 Bacteria 634
818 Ga0495593_0135749 3300047673 Bacteria 1247
819 Ga0495602_0000041 3300048088 Bacteria 126954
820 Ga0495602_0004094 3300048088 Bacteria 15176
821 Ga0495602_0042761 3300048088 Bacteria 4125
822 Ga0495602_0549889 3300048088 Bacteria 800
823 Ga0495602_0977413 3300048088 Bacteria 560
824 Ga0495614_0543626 3300048089 Bacteria 555
825 Ga0495615_0268657 3300048090 Bacteria 545
826 Ga0496100_0446209 3300048903 Bacteria 991
827 Ga0496101_0610526 3300048904 Bacteria 862
828 Ga0496101_0618564 3300048904 Bacteria 856
829 Ga0496102_0270127 3300048905 Bacteria 1603
830 Ga0496102_0283594 3300048905 Bacteria 1561
831 Ga0496102_0849973 3300048905 Bacteria 835
832 Ga0496103_0309426 3300048906 Bacteria 1016
833 Ga0496103_0682240 3300048906 Bacteria 652
834 Ga0496104_0000024 3300048907 Bacteria 229913
835 Ga0496104_0059304 3300048907 Bacteria 3623
836 Ga0496104_0395457 3300048907 Bacteria 1294
837 Ga0496104_0657201 3300048907 Bacteria 957
838 Ga0496104_0993673 3300048907 Bacteria 743
839 Ga0496105_0000013 3300048908 Bacteria 229894
840 Ga0496105_0495177 3300048908 Bacteria 960
841 Ga0496105_0869578 3300048908 Bacteria 681
842 Ga0496105_1361658 3300048908 Bacteria 516
843 Ga0496106_0000475 3300048909 Bacteria 28606
844 Ga0496106_0040840 3300048909 Bacteria 3476
845 Ga0496106_0755617 3300048909 Bacteria 773
846 Ga0496106_0774429 3300048909 Bacteria 762
847 Ga0496107_0046800 3300048910 Bacteria 3113
848 Ga0496108_0000006 3300048911 Bacteria 469473
849 Ga0496108_0000232 3300048911 Bacteria 49846
850 Ga0496108_0015786 3300048911 Bacteria 6156
851 Ga0496108_0821040 3300048911 Bacteria 801
852 Ga0496109_0000004 3300048912 Bacteria 404818
853 Ga0496109_0000044 3300048912 Bacteria 133779
854 Ga0496109_0000264 3300048912 Bacteria 50480
855 Ga0496109_0027177 3300048912 Bacteria 5107
856 Ga0496109_0213643 3300048912 Bacteria 1814
857 Ga0496109_0300281 3300048912 Bacteria 1514
858 Ga0496109_1739909 3300048912 Bacteria 557
859 Ga0496110_0076401 3300048913 Bacteria 2978
860 Ga0496110_0168729 3300048913 Bacteria 1985
861 Ga0496110_0702978 3300048913 Bacteria 912
862 Ga0496110_0738921 3300048913 Bacteria 887
863 Ga0496111_0298583 3300048914 Bacteria 1194
864 Ga0496111_0694219 3300048914 Bacteria 741
865 Ga0496112_0083301 3300048915 Bacteria 3163
866 Ga0496112_0275732 3300048915 Bacteria 1629
867 Ga0496113_0037071 3300048916 Bacteria 3576
868 Ga0496114_0002941 3300048917 Bacteria 13063
869 Ga0496115_0000398 3300048918 Bacteria 35876
870 Ga0496115_0004971 3300048918 Bacteria 9656
871 Ga0496115_0220407 3300048918 Bacteria 1565
872 Ga0496115_1226628 3300048918 Bacteria 562
873 Ga0496119_0471420 3300048922 Bacteria 588
874 Ga0496121_0568127 3300048924 Bacteria 706
875 Ga0496125_0212168 3300048928 Bacteria 1256
876 Ga0496126_0519431 3300048929 Bacteria 949
877 Ga0501305_114684 3300049161 Bacteria 512
878 Ga0501311_018393 3300049527 Bacteria 928
879 Ga0501319_002602 3300049535 Bacteria 1155
880 Ga0501031_0411823 3300049568 Bacteria 874
881 Ga0501032_0062543 3300049569 Bacteria 2494
882 Ga0501033_0086870 3300049570 Bacteria 2289
883 Ga0501033_0196043 3300049570 Bacteria 1444
884 Ga0501033_0198140 3300049570 Bacteria 1435
885 Ga0501033_0454733 3300049570 Bacteria 889
886 Ga0501036_0724036 3300049572 Bacteria 821
887 Ga0501037_0261567 3300049573 Bacteria 1209
888 Ga0501042_0049172 3300049578 Bacteria 3008
889 Ga0501042_0394548 3300049578 Bacteria 1002
890 Ga0501043_0238512 3300049579 Bacteria 1403
891 Ga0501043_0409274 3300049579 Bacteria 1024
892 Ga0501046_0255718 3300049580 Bacteria 1288
893 Ga0501047_0002867 3300049581 Bacteria 16362
894 Ga0501047_0033367 3300049581 Bacteria 4969
895 Ga0501048_0225945 3300049582 Bacteria 1328
896 Ga0501068_0480032 3300049584 Bacteria 806
897 Ga0501076_0723856 3300049592 Bacteria 821
898 Ga0501257_074426 3300049686 Bacteria 871
899 Ga0501257_237083 3300049686 Bacteria 537
900 Ga0501080_1244885 3300049742 Bacteria 639
901 Ga0501035_0200644 3300049822 Bacteria 1711
902 Ga0501035_0226406 3300049822 Bacteria 1595
903 Ga0501035_0670678 3300049822 Bacteria 839
904 Ga0501035_0751934 3300049822 Bacteria 782
905 Ga0501035_1300613 3300049822 Bacteria 561
906 Ga0501044_0357130 3300049823 Bacteria 1380
907 Ga0501044_1307797 3300049823 Bacteria 591
908 nmdc:mga03n38_57024_c1 3300050490 Bacteria 1765
909 nmdc:mga00v17_725_c1 3300050491 Bacteria 18009
910 nmdc:mga0yw44_801707_c1 3300050492 Bacteria 639
911 nmdc:mga0k408_11045_c1 3300050493 Bacteria 4905
912 nmdc:mga0k408_142318_c1 3300050493 Bacteria 1427
913 nmdc:mga06z11_2151_c1 3300050494 Bacteria 7482
914 nmdc:mga04h51_6559_c1 3300050495 Bacteria 3025
915 nmdc:mga07m45_106546_c1 3300050496 Bacteria 1613
916 nmdc:mga0rr50_406491_c1 3300050513 Unclassified 1150
917 nmdc:mga0sz30_6524_c2 3300050516 Bacteria 2113
918 Ga0495601_0000017 3300053077 Bacteria 204209
919 Ga0495601_0000330 3300053077 Bacteria 25170
920 Ga0495595_0002179 3300053084 Bacteria 7613
921 Ga0495619_0001825 3300053085 Bacteria 14157
922 Ga0500643_000458 3300053087 Bacteria 30192
923 Ga0500643_001391 3300053087 Bacteria 14001
924 Ga0500643_006633 3300053087 Bacteria 4808
925 Ga0500643_010973 3300053087 Bacteria 3337
926 Ga0500643_026871 3300053087 Bacteria 1796
927 Ga0500643_042847 3300053087 Bacteria 1322
928 Ga0500646_0209206 3300053090 Bacteria 672
929 Ga0500646_0252087 3300053090 Bacteria 621
930 Ga0500566_0519642 3300053094 Bacteria 509
931 Ga0500641_0002963 3300053096 Bacteria 6012
932 Ga0500641_0013819 3300053096 Bacteria 2970
933 Ga0500555_012638 3300053103 Bacteria 2431
934 Ga0500555_056013 3300053103 Bacteria 1069
935 Ga0500556_0002351 3300053104 Bacteria 6146
936 Ga0500556_0013503 3300053104 Bacteria 2473
937 Ga0500556_0184820 3300053104 Bacteria 823
938 Ga0500562_001679 3300053108 Bacteria 5505
939 Ga0500562_002560 3300053108 Bacteria 4530
940 Ga0500562_007299 3300053108 Bacteria 2789
941 Ga0500562_025091 3300053108 Bacteria 1559
942 Ga0500595_001246 3300053119 Bacteria 14024
943 Ga0500595_026926 3300053119 Bacteria 1976
944 Ga0500608_145794 3300053122 Bacteria 1044
945 Ga0500608_349232 3300053122 Bacteria 525
946 Ga0500614_000632 3300053123 Bacteria 8960
947 Ga0500642_0169271 3300053130 Bacteria 1023
948 Ga0500652_168923 3300053131 Bacteria 901
949 Ga0500559_0112855 3300053136 Bacteria 1260
950 Ga0500604_0142412 3300053151 Bacteria 811
951 Ga0500616_0038008 3300053153 Bacteria 2602
952 Ga0500616_0107210 3300053153 Bacteria 1355
953 Ga0500622_0015751 3300053156 Bacteria 4046
954 Ga0500622_0145153 3300053156 Bacteria 1127
955 Ga0500611_004298 3300053727 Bacteria 1911
956 Ga0500645_003040 3300053730 Bacteria 7057
957 Ga0500645_112285 3300053730 Bacteria 764
958 Ga0500645_171922 3300053730 Bacteria 591
959 Ga0501084_1490831 3300054114 Bacteria 566
960 Ga0587084_076453 3300059477 Bacteria 641
961 Ga0587084_133405 3300059477 Bacteria 533
962 Ga0587084_148318 3300059477 Bacteria 514
963 Ga0587093_026630 3300059478 Bacteria 809
964 Ga0587070_102259 3300059491 Bacteria 661
965 Ga0587070_203856 3300059491 Bacteria 527
966 Ga0587077_070668 3300059493 Bacteria 779
967 Ga0587077_158703 3300059493 Bacteria 597
968 Ga0587083_0150442 3300059505 Bacteria 628
969 Ga0587085_041352 3300059506 Bacteria 804
970 Ga0587088_109047 3300059508 Bacteria 627
971 Ga0587090_030258 3300059510 Bacteria 901
972 Ga0587090_057540 3300059510 Bacteria 729
973 Ga0587090_097035 3300059510 Bacteria 612
974 Ga0587090_097556 3300059510 Bacteria 611
975 Ga0587092_104265 3300059512 Bacteria 588
976 Ga0587092_118862 3300059512 Bacteria 562
977 Ga0587094_085149 3300059513 Bacteria 590
978 Ga0587106_061425 3300059605 Bacteria 691
979 Ga0587125_069606 3300059607 Bacteria 529
980 Ga0587109_183309 3300059624 Bacteria 536
981 Ga0587109_219214 3300059624 Bacteria 503
982 Ga0587128_108397 3300059630 Bacteria 591
983 Ga0587062_082834 3300059639 Bacteria 599
984 Ga0587062_121824 3300059639 Bacteria 528
985 Ga0587068_083977 3300059641 Bacteria 647
986 Ga0587068_090154 3300059641 Bacteria 631
987 Ga0587072_204585 3300059643 Bacteria 504
988 Ga0587076_030973 3300059645 Bacteria 948
989 Ga0587076_110548 3300059645 Bacteria 625
990 Ga0587076_116766 3300059645 Bacteria 614
991 Ga0587076_210658 3300059645 Bacteria 504
992 Ga0587078_055251 3300059646 Bacteria 590
993 Ga0587114_134656 3300059655 Bacteria 512
994 Ga0587119_071169 3300059658 Bacteria 552
995 Ga0587071_155866 3300060344 Bacteria 571
996 Ga0587111_0103299 3300060346 Bacteria 713
997 Ga0587111_0135545 3300060346 Bacteria 648
998 Ga0587111_0267378 3300060346 Bacteria 512
999 Ga0466962_0006714 3300061719 Bacteria 5517
1000 Ga0466962_0174679 3300061719 Bacteria 1046
1001 Ga0466962_0266212 3300061719 Bacteria 844
1002 Ga0530510_1270370 3300061734 Bacteria 565

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100844196 Ga0070706_1008441962 76
2 3300046460 Ga0495638_0005743 Ga0495638_0005743_8232_8501 76
3 3300046660 Ga0495625_0044306 Ga0495625_0044306_764_1033 76
4 3300046692 Ga0495671_0123829 Ga0495671_0123829_331_600 76
5 3300046694 Ga0495649_0196378 Ga0495649_0196378_430_699 76
6 3300046810 Ga0495660_0116836 Ga0495660_0116836_933_1202 76
7 3300050493 nmdc:mga0k408_142318_c1 nmdc:mga0k408_142318_c1_540_809 76
8 3300053727 Ga0500611_004298 Ga0500611_004298_1054_1323 76
9 3300059493 Ga0587077_070668 Ga0587077_070668_452_724 76
10 3300059512 Ga0587092_104265 Ga0587092_104265_149_421 76
11 3300060346 Ga0587111_0135545 Ga0587111_0135545_110_382 76
12 3300046660 Ga0495625_0022110 Ga0495625_0022110_665_934 78
13 3300046471 Ga0495650_0146133 Ga0495650_0146133_196_468 79
14 3300046674 Ga0495588_0165115 Ga0495588_0165115_152_424 79
15 3300046691 Ga0495670_0142599 Ga0495670_0142599_44_316 79
16 3300053094 Ga0500566_0519642 Ga0500566_0519642_22_294 79
17 3300053136 Ga0500559_0112855 Ga0500559_0112855_773_1045 79
18 3300025915 Ga0207693_10347130 Ga0207693_103471302 80
19 iso_pu_bacteria 2643221598 2643998761 80
20 iso_pu_bacteria 2643221614 2644087281 81
21 iso_pu_bacteria 2643221661 2644344675 81
22 iso_pu_bacteria 2643221666 2644366641 81
23 3300001977 JGI24746J21847_1000324 JGI24746J21847_10003245 82
24 3300005329 Ga0070683_100016420 Ga0070683_1000164205 82
25 3300005329 Ga0070683_100063549 Ga0070683_1000635493 82
26 3300005329 Ga0070683_100166154 Ga0070683_1001661543 82
27 3300005329 Ga0070683_100932775 Ga0070683_1009327752 82
28 3300005334 Ga0068869_100416965 Ga0068869_1004169652 82
29 3300005335 Ga0070666_10011180 Ga0070666_100111807 82
30 3300005338 Ga0068868_100002347 Ga0068868_1000023478 82
31 3300005340 Ga0070689_100433727 Ga0070689_1004337272 82
32 3300005354 Ga0070675_100000028 Ga0070675_10000002818 82
33 3300005356 Ga0070674_100000002 Ga0070674_100000002118 82
34 3300005364 Ga0070673_101401080 Ga0070673_1014010801 82
35 3300005364 Ga0070673_101684586 Ga0070673_1016845861 82
36 3300005365 Ga0070688_100454848 Ga0070688_1004548482 82
37 3300005366 Ga0070659_100009501 Ga0070659_1000095016 82
38 3300005436 Ga0070713_100000058 Ga0070713_10000005849 82
39 3300005441 Ga0070700_100071247 Ga0070700_1000712471 82
40 3300005455 Ga0070663_101919697 Ga0070663_1019196972 82
41 3300005456 Ga0070678_100008208 Ga0070678_1000082083 82
42 3300005466 Ga0070685_10215289 Ga0070685_102152893 82
43 3300005535 Ga0070684_100009565 Ga0070684_1000095653 82
44 3300005535 Ga0070684_100017638 Ga0070684_1000176383 82
45 3300005544 Ga0070686_100681904 Ga0070686_1006819042 82
46 3300005548 Ga0070665_100004723 Ga0070665_1000047234 82
47 3300005564 Ga0070664_100359490 Ga0070664_1003594903 82
48 3300005577 Ga0068857_100030398 Ga0068857_1000303983 82
49 3300005578 Ga0068854_100131599 Ga0068854_1001315992 82
50 3300005614 Ga0068856_100187737 Ga0068856_1001877372 82
51 3300005616 Ga0068852_100000539 Ga0068852_10000053911 82
52 3300005718 Ga0068866_10000036 Ga0068866_1000003627 82
53 3300005719 Ga0068861_101610348 Ga0068861_1016103482 82
54 3300005840 Ga0068870_10790524 Ga0068870_107905242 82
55 3300005841 Ga0068863_100000107 Ga0068863_1000001073 82
56 3300005842 Ga0068858_100000069 Ga0068858_1000000692 82
57 3300006173 Ga0070716_100014183 Ga0070716_1000141835 82
58 3300006173 Ga0070716_100352737 Ga0070716_1003527372 82
59 3300006175 Ga0070712_100002000 Ga0070712_1000020005 82
60 3300006237 Ga0097621_101532608 Ga0097621_1015326082 82
61 3300006881 Ga0068865_101464000 Ga0068865_1014640002 82
62 3300009098 Ga0105245_10766221 Ga0105245_107662213 82
63 3300009101 Ga0105247_11218550 Ga0105247_112185501 82
64 3300009148 Ga0105243_10069020 Ga0105243_100690202 82
65 3300009176 Ga0105242_12105949 Ga0105242_121059492 82
66 3300009177 Ga0105248_10000175 Ga0105248_1000017568 82
67 3300010375 Ga0105239_12463115 Ga0105239_124631151 82
68 3300013104 Ga0157370_10003852 Ga0157370_100038529 82
69 3300013297 Ga0157378_10005783 Ga0157378_1000578313 82
70 3300013308 Ga0157375_10000137 Ga0157375_1000013725 82
71 3300013308 Ga0157375_10234488 Ga0157375_102344883 82
72 3300013308 Ga0157375_10329398 Ga0157375_103293983 82
73 3300014325 Ga0163163_10468208 Ga0163163_104682083 82
74 3300014325 Ga0163163_10897577 Ga0163163_108975772 82
75 3300014326 Ga0157380_10007574 Ga0157380_100075742 82
76 3300014968 Ga0157379_10086911 Ga0157379_100869111 82
77 3300014969 Ga0157376_10264369 Ga0157376_102643692 82
78 3300017792 Ga0163161_10000027 Ga0163161_10000027157 82
79 3300022467 Ga0224712_10018482 Ga0224712_100184822 82
80 3300025899 Ga0207642_10000060 Ga0207642_1000006023 82
81 3300025903 Ga0207680_10004412 Ga0207680_100044126 82
82 3300025908 Ga0207643_10659266 Ga0207643_106592661 82
83 3300025915 Ga0207693_10004030 Ga0207693_100040305 82
84 3300025920 Ga0207649_10496707 Ga0207649_104967071 82
85 3300025926 Ga0207659_10000018 Ga0207659_10000018155 82
86 3300025927 Ga0207687_11435720 Ga0207687_114357201 82
87 3300025928 Ga0207700_10000003 Ga0207700_10000003442 82
88 3300025932 Ga0207690_10012606 Ga0207690_100126065 82
89 3300025934 Ga0207686_11220771 Ga0207686_112207712 82
90 3300025935 Ga0207709_10384833 Ga0207709_103848332 82
91 3300025936 Ga0207670_10083933 Ga0207670_100839333 82
92 3300025937 Ga0207669_10000003 Ga0207669_10000003176 82
93 3300025939 Ga0207665_10371411 Ga0207665_103714112 82
94 3300025939 Ga0207665_10443856 Ga0207665_104438562 82
95 3300025941 Ga0207711_10000006 Ga0207711_1000000615 82
96 3300025942 Ga0207689_10120163 Ga0207689_101201633 82
97 3300025944 Ga0207661_10000774 Ga0207661_100007745 82
98 3300025944 Ga0207661_10010255 Ga0207661_100102555 82
99 3300025944 Ga0207661_10045890 Ga0207661_100458903 82
100 3300025944 Ga0207661_11610162 Ga0207661_116101621 82
101 3300025945 Ga0207679_10064870 Ga0207679_100648703 82
102 3300025960 Ga0207651_11129930 Ga0207651_111299302 82
103 3300025960 Ga0207651_11430805 Ga0207651_114308052 82
104 3300025961 Ga0207712_10000019 Ga0207712_10000019206 82
105 3300025972 Ga0207668_10646381 Ga0207668_106463812 82
106 3300025981 Ga0207640_10111369 Ga0207640_101113692 82
107 3300026023 Ga0207677_10000361 Ga0207677_1000036128 82
108 3300026035 Ga0207703_10000169 Ga0207703_1000016946 82
109 3300026067 Ga0207678_10633354 Ga0207678_106333543 82
110 3300026075 Ga0207708_10312388 Ga0207708_103123882 82
111 3300026075 Ga0207708_10818834 Ga0207708_108188342 82
112 3300026078 Ga0207702_10126043 Ga0207702_101260432 82
113 3300026088 Ga0207641_10000077 Ga0207641_1000007732 82
114 3300026116 Ga0207674_10041054 Ga0207674_100410544 82
115 3300026118 Ga0207675_101438438 Ga0207675_1014384382 82
116 3300026121 Ga0207683_10006424 Ga0207683_100064246 82
117 3300026142 Ga0207698_10000004 Ga0207698_10000004294 82
118 3300028379 Ga0268266_10001210 Ga0268266_1000121034 82
119 3300028379 Ga0268266_10020143 Ga0268266_100201436 82
120 3300031731 Ga0307405_11375069 Ga0307405_113750692 82
121 3300032002 Ga0307416_101782689 Ga0307416_1017826892 82
122 3300041463 Ga0451804_0677918 Ga0451804_0677918_261_512 82
123 3300046454 Ga0495592_0008902 Ga0495592_0008902_5728_5979 82
124 3300046455 Ga0495603_0001338 Ga0495603_0001338_96_347 82
125 3300046459 Ga0495629_0791825 Ga0495629_0791825_255_506 82
126 3300046462 Ga0495651_0096467 Ga0495651_0096467_43_294 82
127 3300046463 Ga0495653_0080430 Ga0495653_0080430_2092_2343 82
128 3300046476 Ga0495662_0047569 Ga0495662_0047569_704_955 82
129 3300046511 Ga0495608_0009408 Ga0495608_0009408_113_364 82
130 3300046516 Ga0495628_0071508 Ga0495628_0071508_460_711 82
131 3300046516 Ga0495628_0557159 Ga0495628_0557159_23_274 82
132 3300046516 Ga0495628_0784862 Ga0495628_0784862_337_588 82
133 3300046531 Ga0495665_0550657 Ga0495665_0550657_98_349 82
134 3300046543 Ga0495645_0479851 Ga0495645_0479851_482_733 82
135 3300046616 Ga0495668_0518658 Ga0495668_0518658_313_564 82
136 3300046663 Ga0495635_0742729 Ga0495635_0742729_105_356 82
137 3300046675 Ga0495657_0016546 Ga0495657_0016546_3454_3705 82
138 3300046679 Ga0495623_0282827 Ga0495623_0282827_316_567 82
139 3300046689 Ga0495613_0000094 Ga0495613_0000094_64900_65151 82
140 3300046689 Ga0495613_0001352 Ga0495613_0001352_5890_6141 82
141 3300046809 Ga0495600_0277195 Ga0495600_0277195_354_605 82
142 3300047317 Ga0495604_0000089 Ga0495604_0000089_69354_69605 82
143 3300047317 Ga0495604_0003648 Ga0495604_0003648_10579_10830 82
144 3300047322 Ga0495680_0000856 Ga0495680_0000856_5756_6007 82
145 3300047471 Ga0495684_0765397 Ga0495684_0765397_21_272 82
146 3300047673 Ga0495593_0135749 Ga0495593_0135749_356_607 82
147 3300048088 Ga0495602_0000041 Ga0495602_0000041_20377_20628 82
148 3300048088 Ga0495602_0549889 Ga0495602_0549889_19_270 82
149 3300048089 Ga0495614_0543626 Ga0495614_0543626_197_448 82
150 3300048907 Ga0496104_0000024 Ga0496104_0000024_107301_107552 82
151 3300048907 Ga0496104_0059304 Ga0496104_0059304_2314_2565 82
152 3300048907 Ga0496104_0395457 Ga0496104_0395457_982_1233 82
153 3300048908 Ga0496105_0000013 Ga0496105_0000013_122362_122613 82
154 3300048909 Ga0496106_0000475 Ga0496106_0000475_1799_2050 82
155 3300048910 Ga0496107_0046800 Ga0496107_0046800_1342_1593 82
156 3300048911 Ga0496108_0000006 Ga0496108_0000006_120500_120751 82
157 3300048911 Ga0496108_0000232 Ga0496108_0000232_2077_2328 82
158 3300048911 Ga0496108_0015786 Ga0496108_0015786_5789_6040 82
159 3300048912 Ga0496109_0000004 Ga0496109_0000004_293243_293494 82
160 3300048912 Ga0496109_0000044 Ga0496109_0000044_85985_86236 82
161 3300048912 Ga0496109_0000264 Ga0496109_0000264_26622_26873 82
162 3300048912 Ga0496109_0213643 Ga0496109_0213643_373_624 82
163 3300048912 Ga0496109_0300281 Ga0496109_0300281_1146_1397 82
164 3300048922 Ga0496119_0471420 Ga0496119_0471420_324_575 82
165 3300048928 Ga0496125_0212168 Ga0496125_0212168_209_460 82
166 3300049578 Ga0501042_0049172 Ga0501042_0049172_229_480 82
167 3300049584 Ga0501068_0480032 Ga0501068_0480032_58_309 82
168 3300050492 nmdc:mga0yw44_801707_c1 nmdc:mga0yw44_801707_c1_18_269 82
169 3300050513 nmdc:mga0rr50_406491_c1 nmdc:mga0rr50_406491_c1_691_942 82
170 3300053084 Ga0495595_0002179 Ga0495595_0002179_5154_5405 82
171 3300053085 Ga0495619_0001825 Ga0495619_0001825_9967_10218 82
172 iso_pu_bacteria 2582581293 2585198814 82
173 iso_pu_bacteria 2818991435 2819537619 82
174 iso_pu_bacteria 2818991454 2819647395 82
175 3300005329 Ga0070683_100714760 Ga0070683_1007147602 83
176 3300005341 Ga0070691_10005831 Ga0070691_100058313 83
177 3300005367 Ga0070667_100030728 Ga0070667_1000307283 83
178 3300005458 Ga0070681_10115729 Ga0070681_101157292 83
179 3300005530 Ga0070679_100000461 Ga0070679_10000046135 83
180 3300005539 Ga0068853_100048939 Ga0068853_1000489393 83
181 3300005548 Ga0070665_100000040 Ga0070665_100000040103 83
182 3300005548 Ga0070665_100011815 Ga0070665_1000118158 83
183 3300005563 Ga0068855_100897910 Ga0068855_1008979101 83
184 3300005614 Ga0068856_100006911 Ga0068856_1000069114 83
185 3300005719 Ga0068861_101135889 Ga0068861_1011358892 83
186 3300005842 Ga0068858_100000526 Ga0068858_10000052615 83
187 3300005843 Ga0068860_100292278 Ga0068860_1002922783 83
188 3300005844 Ga0068862_100934228 Ga0068862_1009342281 83
189 3300005937 Ga0081455_10016739 Ga0081455_100167392 83
190 3300005937 Ga0081455_10634994 Ga0081455_106349942 83
191 3300005985 Ga0081539_10071037 Ga0081539_100710372 83
192 3300005985 Ga0081539_10208170 Ga0081539_102081702 83
193 3300006881 Ga0068865_100356363 Ga0068865_1003563632 83
194 3300009098 Ga0105245_10000310 Ga0105245_100003102 83
195 3300009148 Ga0105243_11788017 Ga0105243_117880172 83
196 3300009176 Ga0105242_10256474 Ga0105242_102564742 83
197 3300009177 Ga0105248_11078655 Ga0105248_110786551 83
198 3300009553 Ga0105249_10009609 Ga0105249_100096094 83
199 3300009553 Ga0105249_10397947 Ga0105249_103979472 83
200 3300013104 Ga0157370_10301379 Ga0157370_103013792 83
201 3300013296 Ga0157374_10004652 Ga0157374_1000465213 83
202 3300013306 Ga0163162_11358862 Ga0163162_113588622 83
203 3300014325 Ga0163163_10641795 Ga0163163_106417953 83
204 3300014968 Ga0157379_10019721 Ga0157379_100197213 83
205 3300014969 Ga0157376_12943750 Ga0157376_129437501 83
206 3300020070 Ga0206356_11355552 Ga0206356_113555523 83
207 3300020078 Ga0206352_10973552 Ga0206352_109735522 83
208 3300025315 Ga0207697_10275067 Ga0207697_102750672 83
209 3300025912 Ga0207707_10007406 Ga0207707_100074069 83
210 3300025917 Ga0207660_10175592 Ga0207660_101755921 83
211 3300025917 Ga0207660_10532746 Ga0207660_105327462 83
212 3300025919 Ga0207657_10725261 Ga0207657_107252612 83
213 3300025921 Ga0207652_10059412 Ga0207652_100594122 83
214 3300025927 Ga0207687_10000079 Ga0207687_100000792 83
215 3300025934 Ga0207686_10346586 Ga0207686_103465862 83
216 3300025938 Ga0207704_10442147 Ga0207704_104421472 83
217 3300025941 Ga0207711_10901628 Ga0207711_109016282 83
218 3300025944 Ga0207661_10000693 Ga0207661_1000069314 83
219 3300025949 Ga0207667_10319847 Ga0207667_103198471 83
220 3300025961 Ga0207712_11088134 Ga0207712_110881341 83
221 3300025961 Ga0207712_11341447 Ga0207712_113414472 83
222 3300025972 Ga0207668_10427457 Ga0207668_104274572 83
223 3300025986 Ga0207658_10014433 Ga0207658_100144333 83
224 3300026035 Ga0207703_10000170 Ga0207703_1000017052 83
225 3300026041 Ga0207639_10010622 Ga0207639_100106224 83
226 3300026078 Ga0207702_10003690 Ga0207702_100036909 83
227 3300026118 Ga0207675_100554658 Ga0207675_1005546582 83
228 3300028379 Ga0268266_10000045 Ga0268266_10000045106 83
229 3300028379 Ga0268266_10063407 Ga0268266_100634074 83
230 3300028380 Ga0268265_10027175 Ga0268265_100271754 83
231 3300028381 Ga0268264_11430402 Ga0268264_114304021 83
232 3300028556 Ga0265337_1137074 Ga0265337_11370741 83
233 3300028558 Ga0265326_10000079 Ga0265326_100000794 83
234 3300028654 Ga0265322_10000004 Ga0265322_10000004114 83
235 3300028666 Ga0265336_10202260 Ga0265336_102022601 83
236 3300029957 Ga0265324_10011479 Ga0265324_100114794 83
237 3300031238 Ga0265332_10036105 Ga0265332_100361051 83
238 3300031239 Ga0265328_10006864 Ga0265328_100068641 83
239 3300031240 Ga0265320_10000029 Ga0265320_10000029112 83
240 3300031249 Ga0265339_10391369 Ga0265339_103913692 83
241 3300031251 Ga0265327_10000723 Ga0265327_100007234 83
242 3300031344 Ga0265316_10034072 Ga0265316_100340723 83
243 3300031691 Ga0316579_10392193 Ga0316579_103921931 83
244 3300031711 Ga0265314_10000484 Ga0265314_100004844 83
245 3300031727 Ga0316576_10023751 Ga0316576_100237514 83
246 3300035398 Ga0316574_0565862 Ga0316574_0565862_289_543 83
247 3300036647 Ga0316582_0832302 Ga0316582_0832302_75_329 83
248 3300036647 Ga0316582_1152383 Ga0316582_1152383_230_484 83
249 3300036712 Ga0316584_0016821 Ga0316584_0016821_2427_2681 83
250 3300041512 Ga0451853_0956394 Ga0451853_0956394_64_318 83
251 3300044842 Ga0466957_0005133 Ga0466957_0005133_2157_2411 83
252 3300046461 Ga0495641_0000014 Ga0495641_0000014_76895_77149 83
253 3300046461 Ga0495641_0460883 Ga0495641_0460883_49_303 83
254 3300046462 Ga0495651_0590045 Ga0495651_0590045_414_668 83
255 3300046463 Ga0495653_0453694 Ga0495653_0453694_534_788 83
256 3300046476 Ga0495662_0005830 Ga0495662_0005830_5720_5974 83
257 3300046499 Ga0495594_0000006 Ga0495594_0000006_40241_40495 83
258 3300046500 Ga0495596_0224590 Ga0495596_0224590_268_522 83
259 3300046511 Ga0495608_0157440 Ga0495608_0157440_76_330 83
260 3300046516 Ga0495628_0000437 Ga0495628_0000437_37590_37844 83
261 3300046516 Ga0495628_0014714 Ga0495628_0014714_4754_5008 83
262 3300046517 Ga0495630_0011760 Ga0495630_0011760_1553_1807 83
263 3300046517 Ga0495630_0070399 Ga0495630_0070399_380_634 83
264 3300046523 Ga0495644_0001542 Ga0495644_0001542_7603_7857 83
265 3300046535 Ga0495586_0001281 Ga0495586_0001281_12349_12603 83
266 3300046557 Ga0495622_0000132 Ga0495622_0000132_13624_13878 83
267 3300046642 Ga0495634_0000002 Ga0495634_0000002_224211_224465 83
268 3300046663 Ga0495635_0000005 Ga0495635_0000005_203559_203813 83
269 3300046678 Ga0495599_0005994 Ga0495599_0005994_2241_2495 83
270 3300046681 Ga0495647_0000009 Ga0495647_0000009_66332_66586 83
271 3300046690 Ga0495624_0001301 Ga0495624_0001301_19329_19583 83
272 3300046690 Ga0495624_0095836 Ga0495624_0095836_1119_1373 83
273 3300046691 Ga0495670_0010128 Ga0495670_0010128_3790_4044 83
274 3300046809 Ga0495600_0021782 Ga0495600_0021782_3695_3949 83
275 3300047317 Ga0495604_0012257 Ga0495604_0012257_2145_2399 83
276 3300047321 Ga0495676_0000136 Ga0495676_0000136_36826_37080 83
277 3300047321 Ga0495676_0584712 Ga0495676_0584712_429_683 83
278 3300047322 Ga0495680_0010286 Ga0495680_0010286_48_302 83
279 3300047446 Ga0495679_033232 Ga0495679_033232_31_285 83
280 3300047471 Ga0495684_0257963 Ga0495684_0257963_563_817 83
281 3300047471 Ga0495684_0725531 Ga0495684_0725531_34_288 83
282 3300048088 Ga0495602_0004094 Ga0495602_0004094_224_478 83
283 3300048088 Ga0495602_0042761 Ga0495602_0042761_309_563 83
284 3300048906 Ga0496103_0682240 Ga0496103_0682240_137_391 83
285 3300048908 Ga0496105_0869578 Ga0496105_0869578_268_522 83
286 3300048909 Ga0496106_0774429 Ga0496106_0774429_217_471 83
287 3300048912 Ga0496109_1739909 Ga0496109_1739909_110_364 83
288 3300048913 Ga0496110_0076401 Ga0496110_0076401_20_274 83
289 3300048913 Ga0496110_0702978 Ga0496110_0702978_531_785 83
290 3300048914 Ga0496111_0694219 Ga0496111_0694219_197_451 83
291 3300048917 Ga0496114_0002941 Ga0496114_0002941_12317_12571 83
292 3300048918 Ga0496115_0004971 Ga0496115_0004971_6500_6754 83
293 3300049578 Ga0501042_0394548 Ga0501042_0394548_467_721 83
294 3300053077 Ga0495601_0000017 Ga0495601_0000017_189272_189526 83
295 3300053077 Ga0495601_0000330 Ga0495601_0000330_10889_11143 83
296 3300053123 Ga0500614_000632 Ga0500614_000632_8660_8914 83
297 3300005367 Ga0070667_100325131 Ga0070667_1003251312 84
298 3300005455 Ga0070663_100625906 Ga0070663_1006259062 84
299 3300005563 Ga0068855_102601919 Ga0068855_1026019191 84
300 3300006846 Ga0075430_101679919 Ga0075430_1016799191 84
301 3300009093 Ga0105240_10000679 Ga0105240_100006793 84
302 3300009174 Ga0105241_10423518 Ga0105241_104235182 84
303 3300009177 Ga0105248_10689378 Ga0105248_106893782 84
304 3300009551 Ga0105238_10327059 Ga0105238_103270592 84
305 3300010375 Ga0105239_10770120 Ga0105239_107701202 84
306 3300025913 Ga0207695_10004225 Ga0207695_100042254 84
307 3300025913 Ga0207695_11476108 Ga0207695_114761081 84
308 3300025924 Ga0207694_10214695 Ga0207694_102146952 84
309 3300025940 Ga0207691_10000002 Ga0207691_10000002118 84
310 3300025941 Ga0207711_10724499 Ga0207711_107244992 84
311 3300025986 Ga0207658_10753113 Ga0207658_107531132 84
312 3300031251 Ga0265327_10000287 Ga0265327_1000028773 84
313 3300033541 Ga0316596_1123774 Ga0316596_11237741 84
314 3300035398 Ga0316574_0235089 Ga0316574_0235089_655_912 84
315 3300047444 Ga0495675_0073901 Ga0495675_0073901_342_599 84
316 3300049570 Ga0501033_0086870 Ga0501033_0086870_670_933 84
317 3300053119 Ga0500595_001246 Ga0500595_001246_6769_7032 84
318 3300059510 Ga0587090_097035 Ga0587090_097035_176_442 84
319 3300059512 Ga0587092_118862 Ga0587092_118862_145_411 84
320 3300059607 Ga0587125_069606 Ga0587125_069606_49_315 84
321 3300059655 Ga0587114_134656 Ga0587114_134656_189_455 84
322 3300060346 Ga0587111_0267378 Ga0587111_0267378_56_322 84
323 3300061734 Ga0530510_1270370 Ga0530510_1270370_62_319 84
324 3300009545 Ga0105237_10555144 Ga0105237_105551441 85
325 3300012481 Ga0157320_1016578 Ga0157320_10165782 85
326 3300031239 Ga0265328_10318040 Ga0265328_103180402 85
327 3300031241 Ga0265325_10063783 Ga0265325_100637833 85
328 3300031247 Ga0265340_10290420 Ga0265340_102904202 85
329 3300031344 Ga0265316_10109954 Ga0265316_101099541 85
330 3300031711 Ga0265314_10057533 Ga0265314_100575332 85
331 3300031901 Ga0307406_10535895 Ga0307406_105358952 85
332 3300035088 Ga0373940_0033196 Ga0373940_0033196_614_871 85
333 3300035114 Ga0373939_0082754 Ga0373939_0082754_585_842 85
334 3300039438 Ga0436360_0189994 Ga0436360_0189994_603_866 85
335 3300045051 Ga0451576_1542699 Ga0451576_1542699_132_389 85
336 3300046684 Ga0495669_0000014 Ga0495669_0000014_27908_28174 85
337 3300046684 Ga0495669_0095358 Ga0495669_0095358_693_950 85
338 3300047445 Ga0495677_0032530 Ga0495677_0032530_224_490 85
339 3300003323 rootH1_10216558 rootH1_102165582 86
340 3300005334 Ga0068869_100184472 Ga0068869_1001844722 86
341 3300005344 Ga0070661_100721965 Ga0070661_1007219652 86
342 3300005344 Ga0070661_101234163 Ga0070661_1012341631 86
343 3300005347 Ga0070668_101902611 Ga0070668_1019026111 86
344 3300005354 Ga0070675_100340652 Ga0070675_1003406523 86
345 3300005364 Ga0070673_100088435 Ga0070673_1000884353 86
346 3300005366 Ga0070659_100594061 Ga0070659_1005940612 86
347 3300005441 Ga0070700_100076081 Ga0070700_1000760813 86
348 3300005456 Ga0070678_101403683 Ga0070678_1014036832 86
349 3300005456 Ga0070678_101783160 Ga0070678_1017831601 86
350 3300005459 Ga0068867_100929217 Ga0068867_1009292172 86
351 3300005466 Ga0070685_10158172 Ga0070685_101581723 86
352 3300005539 Ga0068853_100037066 Ga0068853_1000370664 86
353 3300005544 Ga0070686_100219355 Ga0070686_1002193552 86
354 3300005577 Ga0068857_100540747 Ga0068857_1005407472 86
355 3300005578 Ga0068854_100241760 Ga0068854_1002417603 86
356 3300005614 Ga0068856_100192860 Ga0068856_1001928604 86
357 3300005616 Ga0068852_101834273 Ga0068852_1018342732 86
358 3300005840 Ga0068870_10119561 Ga0068870_101195613 86
359 3300005842 Ga0068858_101112043 Ga0068858_1011120432 86
360 3300006881 Ga0068865_100295944 Ga0068865_1002959442 86
361 3300009093 Ga0105240_12322411 Ga0105240_123224111 86
362 3300009098 Ga0105245_11223792 Ga0105245_112237922 86
363 3300009176 Ga0105242_10839100 Ga0105242_108391002 86
364 3300009551 Ga0105238_10345064 Ga0105238_103450642 86
365 3300013104 Ga0157370_10440303 Ga0157370_104403032 86
366 3300014325 Ga0163163_10932181 Ga0163163_109321812 86
367 3300014326 Ga0157380_11825896 Ga0157380_118258962 86
368 3300025901 Ga0207688_10452551 Ga0207688_104525511 86
369 3300025907 Ga0207645_10077821 Ga0207645_100778212 86
370 3300025911 Ga0207654_10542261 Ga0207654_105422612 86
371 3300025923 Ga0207681_11278580 Ga0207681_112785802 86
372 3300025924 Ga0207694_10256603 Ga0207694_102566033 86
373 3300025926 Ga0207659_10259588 Ga0207659_102595883 86
374 3300025927 Ga0207687_11428646 Ga0207687_114286462 86
375 3300025934 Ga0207686_10255109 Ga0207686_102551093 86
376 3300025936 Ga0207670_10002339 Ga0207670_100023392 86
377 3300025937 Ga0207669_10317154 Ga0207669_103171542 86
378 3300025938 Ga0207704_10010816 Ga0207704_100108164 86
379 3300025941 Ga0207711_10809128 Ga0207711_108091282 86
380 3300025942 Ga0207689_10199604 Ga0207689_101996043 86
381 3300025945 Ga0207679_10347297 Ga0207679_103472972 86
382 3300025960 Ga0207651_10394705 Ga0207651_103947052 86
383 3300025972 Ga0207668_11987327 Ga0207668_119873271 86
384 3300025981 Ga0207640_10686642 Ga0207640_106866422 86
385 3300025986 Ga0207658_10422709 Ga0207658_104227091 86
386 3300026041 Ga0207639_10016225 Ga0207639_100162255 86
387 3300026075 Ga0207708_10022830 Ga0207708_100228303 86
388 3300026078 Ga0207702_10154757 Ga0207702_101547574 86
389 3300026089 Ga0207648_10088874 Ga0207648_100888743 86
390 3300026095 Ga0207676_11495132 Ga0207676_114951321 86
391 3300031456 Ga0307513_10000873 Ga0307513_100008733 86
392 3300033180 Ga0307510_10200659 Ga0307510_102006592 86
393 3300035691 Ga0373931_0524431 Ga0373931_0524431_80_349 86
394 3300035692 Ga0373935_1487928 Ga0373935_1487928_93_371 86
395 3300037312 Ga0395899_0680639 Ga0395899_0680639_269_538 86
396 3300037471 Ga0395905_0000022 Ga0395905_0000022_108954_109223 86
397 3300039450 Ga0436363_0763861 Ga0436363_0763861_228_503 86
398 3300041486 Ga0451807_0534070 Ga0451807_0534070_86_355 86
399 3300041509 Ga0451843_0090988 Ga0451843_0090988_118_387 86
400 3300041511 Ga0451855_1286586 Ga0451855_1286586_253_522 86
401 3300041512 Ga0451853_1991594 Ga0451853_1991594_120_389 86
402 3300044656 Ga0466969_0015922 Ga0466969_0015922_825_1094 86
403 3300044684 Ga0466966_0003014 Ga0466966_0003014_10142_10411 86
404 3300044684 Ga0466966_0070352 Ga0466966_0070352_1418_1681 86
405 3300044693 Ga0466961_0002790 Ga0466961_0002790_5873_6142 86
406 3300044693 Ga0466961_0217535 Ga0466961_0217535_560_823 86
407 3300044694 Ga0466963_0388530 Ga0466963_0388530_355_618 86
408 3300044719 Ga0466971_0239006 Ga0466971_0239006_25_294 86
409 3300044765 Ga0466970_0026932 Ga0466970_0026932_940_1209 86
410 3300044842 Ga0466957_0001331 Ga0466957_0001331_989_1258 86
411 3300044842 Ga0466957_0146347 Ga0466957_0146347_494_757 86
412 3300045049 Ga0466959_0000086 Ga0466959_0000086_2497_2766 86
413 3300045836 Ga0466958_0026304 Ga0466958_0026304_1637_1906 86
414 3300045836 Ga0466958_0064044 Ga0466958_0064044_1790_2053 86
415 3300046537 Ga0495598_0197989 Ga0495598_0197989_380_649 86
416 3300046539 Ga0495621_0059748 Ga0495621_0059748_855_1124 86
417 3300046616 Ga0495668_0351926 Ga0495668_0351926_178_447 86
418 3300048929 Ga0496126_0519431 Ga0496126_0519431_327_596 86
419 3300049527 Ga0501311_018393 Ga0501311_018393_32_301 86
420 3300049570 Ga0501033_0454733 Ga0501033_0454733_443_712 86
421 3300049572 Ga0501036_0724036 Ga0501036_0724036_39_308 86
422 3300049579 Ga0501043_0238512 Ga0501043_0238512_1093_1362 86
423 3300049580 Ga0501046_0255718 Ga0501046_0255718_919_1188 86
424 3300049822 Ga0501035_0200644 Ga0501035_0200644_1362_1631 86
425 3300053087 Ga0500643_000458 Ga0500643_000458_13247_13516 86
426 3300053087 Ga0500643_010973 Ga0500643_010973_421_690 86
427 3300053096 Ga0500641_0013819 Ga0500641_0013819_503_772 86
428 3300053104 Ga0500556_0002351 Ga0500556_0002351_4537_4806 86
429 3300053104 Ga0500556_0184820 Ga0500556_0184820_485_754 86
430 3300053108 Ga0500562_007299 Ga0500562_007299_1402_1671 86
431 3300053108 Ga0500562_025091 Ga0500562_025091_892_1161 86
432 3300053122 Ga0500608_145794 Ga0500608_145794_657_926 86
433 3300053131 Ga0500652_168923 Ga0500652_168923_486_755 86
434 3300053151 Ga0500604_0142412 Ga0500604_0142412_527_796 86
435 3300053153 Ga0500616_0038008 Ga0500616_0038008_109_378 86
436 3300053153 Ga0500616_0107210 Ga0500616_0107210_578_847 86
437 3300053156 Ga0500622_0145153 Ga0500622_0145153_821_1090 86
438 3300053730 Ga0500645_003040 Ga0500645_003040_3435_3704 86
439 3300053730 Ga0500645_171922 Ga0500645_171922_201_470 86
440 3300059477 Ga0587084_076453 Ga0587084_076453_302_571 86
441 3300059478 Ga0587093_026630 Ga0587093_026630_265_534 86
442 3300059491 Ga0587070_102259 Ga0587070_102259_252_521 86
443 3300059493 Ga0587077_158703 Ga0587077_158703_49_318 86
444 3300059505 Ga0587083_0150442 Ga0587083_0150442_325_594 86
445 3300059510 Ga0587090_057540 Ga0587090_057540_187_456 86
446 3300059624 Ga0587109_219214 Ga0587109_219214_199_468 86
447 3300059639 Ga0587062_082834 Ga0587062_082834_224_493 86
448 3300059641 Ga0587068_090154 Ga0587068_090154_85_354 86
449 3300059643 Ga0587072_204585 Ga0587072_204585_59_328 86
450 3300059645 Ga0587076_030973 Ga0587076_030973_285_554 86
451 3300061719 Ga0466962_0006714 Ga0466962_0006714_2793_3062 86
452 3300061719 Ga0466962_0266212 Ga0466962_0266212_307_570 86
453 3300005327 Ga0070658_10038677 Ga0070658_100386773 87
454 3300005327 Ga0070658_10875618 Ga0070658_108756181 87
455 3300005329 Ga0070683_100710425 Ga0070683_1007104251 87
456 3300005336 Ga0070680_100012704 Ga0070680_1000127048 87
457 3300005339 Ga0070660_101159559 Ga0070660_1011595592 87
458 3300005458 Ga0070681_10013326 Ga0070681_100133269 87
459 3300005535 Ga0070684_101263314 Ga0070684_1012633142 87
460 3300005539 Ga0068853_100171967 Ga0068853_1001719671 87
461 3300005545 Ga0070695_100862319 Ga0070695_1008623192 87
462 3300005548 Ga0070665_100018730 Ga0070665_1000187304 87
463 3300005563 Ga0068855_100023693 Ga0068855_1000236936 87
464 3300005563 Ga0068855_100508201 Ga0068855_1005082012 87
465 3300005577 Ga0068857_101955562 Ga0068857_1019555622 87
466 3300005578 Ga0068854_100333838 Ga0068854_1003338382 87
467 3300005614 Ga0068856_102278804 Ga0068856_1022788041 87
468 3300005614 Ga0068856_102409057 Ga0068856_1024090571 87
469 3300005616 Ga0068852_101654697 Ga0068852_1016546972 87
470 3300005616 Ga0068852_101935920 Ga0068852_1019359202 87
471 3300005618 Ga0068864_102134671 Ga0068864_1021346711 87
472 3300005844 Ga0068862_100042579 Ga0068862_1000425791 87
473 3300009093 Ga0105240_10061517 Ga0105240_100615173 87
474 3300009093 Ga0105240_10228697 Ga0105240_102286972 87
475 3300009098 Ga0105245_11876879 Ga0105245_118768791 87
476 3300009148 Ga0105243_12111823 Ga0105243_121118231 87
477 3300009176 Ga0105242_11228048 Ga0105242_112280482 87
478 3300009177 Ga0105248_11654977 Ga0105248_116549771 87
479 3300009545 Ga0105237_11270995 Ga0105237_112709952 87
480 3300009551 Ga0105238_10144704 Ga0105238_101447041 87
481 3300009551 Ga0105238_10333177 Ga0105238_103331772 87
482 3300009551 Ga0105238_11130117 Ga0105238_111301172 87
483 3300009553 Ga0105249_13278100 Ga0105249_132781001 87
484 3300013100 Ga0157373_10002536 Ga0157373_1000253617 87
485 3300013104 Ga0157370_10109059 Ga0157370_101090592 87
486 3300013104 Ga0157370_10479742 Ga0157370_104797422 87
487 3300013104 Ga0157370_11102487 Ga0157370_111024872 87
488 3300013104 Ga0157370_11990422 Ga0157370_119904221 87
489 3300013296 Ga0157374_12378826 Ga0157374_123788261 87
490 3300013307 Ga0157372_10093929 Ga0157372_100939292 87
491 3300013307 Ga0157372_13047628 Ga0157372_130476282 87
492 3300014326 Ga0157380_11932763 Ga0157380_119327632 87
493 3300014497 Ga0182008_10955409 Ga0182008_109554092 87
494 3300021377 Ga0213874_10129590 Ga0213874_101295901 87
495 3300021377 Ga0213874_10349288 Ga0213874_103492881 87
496 3300021384 Ga0213876_10000568 Ga0213876_1000056817 87
497 3300021384 Ga0213876_10641129 Ga0213876_106411291 87
498 3300021388 Ga0213875_10367830 Ga0213875_103678302 87
499 3300025254 Ga0209148_1006910 Ga0209148_10069102 87
500 3300025254 Ga0209148_1018139 Ga0209148_10181392 87
501 3300025272 Ga0209455_1054995 Ga0209455_10549951 87
502 3300025909 Ga0207705_10031767 Ga0207705_100317673 87
503 3300025909 Ga0207705_10321194 Ga0207705_103211942 87
504 3300025912 Ga0207707_10072729 Ga0207707_100727294 87
505 3300025913 Ga0207695_10217410 Ga0207695_102174102 87
506 3300025913 Ga0207695_10662474 Ga0207695_106624742 87
507 3300025917 Ga0207660_10082116 Ga0207660_100821162 87
508 3300025917 Ga0207660_10949207 Ga0207660_109492072 87
509 3300025919 Ga0207657_11440744 Ga0207657_114407441 87
510 3300025924 Ga0207694_11185616 Ga0207694_111856162 87
511 3300025949 Ga0207667_10044451 Ga0207667_100444515 87
512 3300025949 Ga0207667_10263395 Ga0207667_102633951 87
513 3300025972 Ga0207668_10006047 Ga0207668_100060471 87
514 3300026041 Ga0207639_10133544 Ga0207639_101335443 87
515 3300026041 Ga0207639_11264446 Ga0207639_112644462 87
516 3300026078 Ga0207702_10397749 Ga0207702_103977492 87
517 3300026078 Ga0207702_11553126 Ga0207702_115531262 87
518 3300026095 Ga0207676_12045022 Ga0207676_120450221 87
519 3300026142 Ga0207698_10694156 Ga0207698_106941561 87
520 3300026142 Ga0207698_11639606 Ga0207698_116396062 87
521 3300028380 Ga0268265_10639200 Ga0268265_106392001 87
522 3300028800 Ga0265338_10053005 Ga0265338_100530052 87
523 3300031240 Ga0265320_10180939 Ga0265320_101809392 87
524 3300031251 Ga0265327_10000868 Ga0265327_1000086827 87
525 3300031344 Ga0265316_11037918 Ga0265316_110379181 87
526 3300031730 Ga0307516_10000030 Ga0307516_10000030116 87
527 3300031901 Ga0307406_10753607 Ga0307406_107536071 87
528 3300032002 Ga0307416_101209772 Ga0307416_1012097721 87
529 3300032002 Ga0307416_103053825 Ga0307416_1030538251 87
530 3300033180 Ga0307510_10087941 Ga0307510_100879412 87
531 3300035171 Ga0373946_0501511 Ga0373946_0501511_55_327 87
532 3300035691 Ga0373931_1029803 Ga0373931_1029803_182_457 87
533 3300035725 Ga0373947_0027745 Ga0373947_0027745_1746_2018 87
534 3300037068 Ga0373925_0163729 Ga0373925_0163729_634_906 87
535 3300037312 Ga0395899_0095773 Ga0395899_0095773_1169_1441 87
536 3300037312 Ga0395899_0099667 Ga0395899_0099667_1408_1680 87
537 3300037418 Ga0395900_0139862 Ga0395900_0139862_2095_2367 87
538 3300037418 Ga0395900_0195571 Ga0395900_0195571_30_302 87
539 3300037418 Ga0395900_0575235 Ga0395900_0575235_462_734 87
540 3300037466 Ga0395898_0238514 Ga0395898_0238514_485_757 87
541 3300037466 Ga0395898_0901049 Ga0395898_0901049_112_384 87
542 3300037471 Ga0395905_0043114 Ga0395905_0043114_3710_3982 87
543 3300037471 Ga0395905_0043133 Ga0395905_0043133_3510_3782 87
544 3300037471 Ga0395905_0151539 Ga0395905_0151539_1544_1816 87
545 3300037853 Ga0436364_0175783 Ga0436364_0175783_303_572 87
546 3300037853 Ga0436364_0576095 Ga0436364_0576095_249_518 87
547 3300038443 Ga0395901_0134281 Ga0395901_0134281_1890_2162 87
548 3300038443 Ga0395901_0230784 Ga0395901_0230784_645_917 87
549 3300038443 Ga0395901_1098893 Ga0395901_1098893_256_528 87
550 3300039437 Ga0436365_0422229 Ga0436365_0422229_1338_1610 87
551 3300039437 Ga0436365_0425122 Ga0436365_0425122_499_771 87
552 3300039438 Ga0436360_1355634 Ga0436360_1355634_1335_1610 87
553 3300039447 Ga0436361_0319149 Ga0436361_0319149_148_420 87
554 3300039447 Ga0436361_0486019 Ga0436361_0486019_1767_2048 87
555 3300039447 Ga0436361_1066444 Ga0436361_1066444_27_311 87
556 3300039450 Ga0436363_0526126 Ga0436363_0526126_101_370 87
557 3300039450 Ga0436363_0939738 Ga0436363_0939738_2584_2853 87
558 3300041491 Ga0451833_0408238 Ga0451833_0408238_257_529 87
559 3300041494 Ga0451837_1468072 Ga0451837_1468072_127_399 87
560 3300044683 Ga0466965_0141460 Ga0466965_0141460_325_597 87
561 3300044693 Ga0466961_0104630 Ga0466961_0104630_868_1140 87
562 3300044735 Ga0466968_0016405 Ga0466968_0016405_1244_1516 87
563 3300044842 Ga0466957_1151491 Ga0466957_1151491_218_490 87
564 3300044842 Ga0466957_1242930 Ga0466957_1242930_244_516 87
565 3300045836 Ga0466958_0859835 Ga0466958_0859835_197_469 87
566 3300048918 Ga0496115_0000398 Ga0496115_0000398_7200_7472 87
567 3300048918 Ga0496115_1226628 Ga0496115_1226628_183_455 87
568 3300048924 Ga0496121_0568127 Ga0496121_0568127_224_496 87
569 3300049568 Ga0501031_0411823 Ga0501031_0411823_71_349 87
570 3300049569 Ga0501032_0062543 Ga0501032_0062543_1775_2053 87
571 3300049570 Ga0501033_0198140 Ga0501033_0198140_420_698 87
572 3300049581 Ga0501047_0033367 Ga0501047_0033367_831_1103 87
573 3300049582 Ga0501048_0225945 Ga0501048_0225945_222_494 87
574 3300049592 Ga0501076_0723856 Ga0501076_0723856_143_412 87
575 3300049686 Ga0501257_074426 Ga0501257_074426_377_646 87
576 3300049822 Ga0501035_0226406 Ga0501035_0226406_566_844 87
577 3300049822 Ga0501035_0670678 Ga0501035_0670678_266_538 87
578 3300049823 Ga0501044_0357130 Ga0501044_0357130_199_471 87
579 3300053087 Ga0500643_001391 Ga0500643_001391_8489_8767 87
580 3300053090 Ga0500646_0209206 Ga0500646_0209206_385_657 87
581 3300053090 Ga0500646_0252087 Ga0500646_0252087_255_527 87
582 3300053103 Ga0500555_012638 Ga0500555_012638_341_613 87
583 3300053103 Ga0500555_056013 Ga0500555_056013_400_678 87
584 3300053104 Ga0500556_0013503 Ga0500556_0013503_1608_1880 87
585 3300053108 Ga0500562_002560 Ga0500562_002560_875_1150 87
586 3300053122 Ga0500608_349232 Ga0500608_349232_193_465 87
587 3300053156 Ga0500622_0015751 Ga0500622_0015751_702_974 87
588 3300059477 Ga0587084_133405 Ga0587084_133405_94_363 87
589 3300059477 Ga0587084_148318 Ga0587084_148318_80_352 87
590 3300059508 Ga0587088_109047 Ga0587088_109047_19_288 87
591 3300059510 Ga0587090_030258 Ga0587090_030258_114_386 87
592 3300059510 Ga0587090_097556 Ga0587090_097556_167_436 87
593 3300059605 Ga0587106_061425 Ga0587106_061425_277_546 87
594 3300059624 Ga0587109_183309 Ga0587109_183309_168_437 87
595 3300059639 Ga0587062_121824 Ga0587062_121824_220_489 87
596 3300059641 Ga0587068_083977 Ga0587068_083977_150_419 87
597 3300059645 Ga0587076_110548 Ga0587076_110548_187_456 87
598 3300059645 Ga0587076_116766 Ga0587076_116766_190_462 87
599 3300059646 Ga0587078_055251 Ga0587078_055251_206_478 87
600 3300059658 Ga0587119_071169 Ga0587119_071169_224_493 87
601 3300005327 Ga0070658_11153827 Ga0070658_111538272 88
602 3300005331 Ga0070670_100047898 Ga0070670_1000478984 88
603 3300005331 Ga0070670_100331041 Ga0070670_1003310411 88
604 3300005335 Ga0070666_10293043 Ga0070666_102930432 88
605 3300005347 Ga0070668_100000042 Ga0070668_10000004214 88
606 3300005347 Ga0070668_100003919 Ga0070668_1000039193 88
607 3300005347 Ga0070668_100011777 Ga0070668_1000117774 88
608 3300005347 Ga0070668_100022321 Ga0070668_1000223217 88
609 3300005353 Ga0070669_100057999 Ga0070669_1000579992 88
610 3300005353 Ga0070669_100275924 Ga0070669_1002759242 88
611 3300005355 Ga0070671_100002736 Ga0070671_10000273616 88
612 3300005367 Ga0070667_100000508 Ga0070667_10000050817 88
613 3300005367 Ga0070667_100008242 Ga0070667_1000082423 88
614 3300005367 Ga0070667_100016906 Ga0070667_1000169065 88
615 3300005539 Ga0068853_101872118 Ga0068853_1018721181 88
616 3300005548 Ga0070665_100000691 Ga0070665_10000069141 88
617 3300005548 Ga0070665_100001884 Ga0070665_10000188413 88
618 3300005548 Ga0070665_100017881 Ga0070665_1000178819 88
619 3300005563 Ga0068855_101163494 Ga0068855_1011634941 88
620 3300005614 Ga0068856_101090815 Ga0068856_1010908152 88
621 3300005617 Ga0068859_100001582 Ga0068859_10000158211 88
622 3300005617 Ga0068859_100159602 Ga0068859_1001596023 88
623 3300005617 Ga0068859_100279829 Ga0068859_1002798292 88
624 3300005617 Ga0068859_100500762 Ga0068859_1005007621 88
625 3300005618 Ga0068864_100000757 Ga0068864_10000075719 88
626 3300005841 Ga0068863_100000119 Ga0068863_10000011928 88
627 3300005841 Ga0068863_100004097 Ga0068863_10000409712 88
628 3300005842 Ga0068858_100006690 Ga0068858_1000066902 88
629 3300005842 Ga0068858_100133716 Ga0068858_1001337162 88
630 3300005843 Ga0068860_100000133 Ga0068860_100000133106 88
631 3300005843 Ga0068860_100000212 Ga0068860_10000021266 88
632 3300005843 Ga0068860_100124911 Ga0068860_1001249114 88
633 3300005844 Ga0068862_100000619 Ga0068862_10000061912 88
634 3300005844 Ga0068862_100012644 Ga0068862_1000126443 88
635 3300005844 Ga0068862_100314277 Ga0068862_1003142771 88
636 3300005844 Ga0068862_100435154 Ga0068862_1004351542 88
637 3300005844 Ga0068862_100569443 Ga0068862_1005694432 88
638 3300006028 Ga0070717_11024276 Ga0070717_110242762 88
639 3300006042 Ga0075368_10002212 Ga0075368_100022125 88
640 3300006048 Ga0075363_100108203 Ga0075363_1001082032 88
641 3300006051 Ga0075364_10008150 Ga0075364_100081504 88
642 3300006178 Ga0075367_10008101 Ga0075367_100081015 88
643 3300006195 Ga0075366_10133687 Ga0075366_101336872 88
644 3300006353 Ga0075370_10108116 Ga0075370_101081162 88
645 3300006931 Ga0097620_100001582 Ga0097620_10000158219 88
646 3300006931 Ga0097620_100159599 Ga0097620_1001595992 88
647 3300006931 Ga0097620_100279830 Ga0097620_1002798302 88
648 3300006931 Ga0097620_100500837 Ga0097620_1005008371 88
649 3300009011 Ga0105251_10092099 Ga0105251_100920991 88
650 3300009093 Ga0105240_11258726 Ga0105240_112587262 88
651 3300009098 Ga0105245_12491889 Ga0105245_124918891 88
652 3300009101 Ga0105247_10032337 Ga0105247_100323374 88
653 3300009101 Ga0105247_10212029 Ga0105247_102120293 88
654 3300009101 Ga0105247_10404660 Ga0105247_104046602 88
655 3300009177 Ga0105248_10004488 Ga0105248_1000448817 88
656 3300009177 Ga0105248_10063658 Ga0105248_100636583 88
657 3300009553 Ga0105249_10017801 Ga0105249_100178012 88
658 3300009553 Ga0105249_10414920 Ga0105249_104149202 88
659 3300010375 Ga0105239_11806958 Ga0105239_118069582 88
660 3300013296 Ga0157374_10098882 Ga0157374_100988823 88
661 3300013306 Ga0163162_10043181 Ga0163162_100431813 88
662 3300013306 Ga0163162_10059611 Ga0163162_100596115 88
663 3300014325 Ga0163163_10000780 Ga0163163_100007809 88
664 3300014968 Ga0157379_10000947 Ga0157379_1000094714 88
665 3300014968 Ga0157379_10003056 Ga0157379_100030565 88
666 3300017792 Ga0163161_10126978 Ga0163161_101269783 88
667 3300017792 Ga0163161_10918988 Ga0163161_109189882 88
668 3300021358 Ga0213873_10125109 Ga0213873_101251091 88
669 3300021377 Ga0213874_10180478 Ga0213874_101804782 88
670 3300021384 Ga0213876_10032943 Ga0213876_100329433 88
671 3300021384 Ga0213876_10291320 Ga0213876_102913202 88
672 3300021441 Ga0213871_10005996 Ga0213871_100059963 88
673 3300021441 Ga0213871_10012129 Ga0213871_100121292 88
674 3300022467 Ga0224712_10188353 Ga0224712_101883532 88
675 3300025900 Ga0207710_10402607 Ga0207710_104026072 88
676 3300025903 Ga0207680_10859693 Ga0207680_108596932 88
677 3300025923 Ga0207681_10054011 Ga0207681_100540113 88
678 3300025923 Ga0207681_10291623 Ga0207681_102916231 88
679 3300025925 Ga0207650_10000016 Ga0207650_10000016147 88
680 3300025925 Ga0207650_10373801 Ga0207650_103738012 88
681 3300025931 Ga0207644_10006266 Ga0207644_100062665 88
682 3300025941 Ga0207711_10005857 Ga0207711_100058573 88
683 3300025941 Ga0207711_10691641 Ga0207711_106916412 88
684 3300025961 Ga0207712_10007748 Ga0207712_100077489 88
685 3300025961 Ga0207712_10313588 Ga0207712_103135882 88
686 3300025972 Ga0207668_10000019 Ga0207668_10000019115 88
687 3300025972 Ga0207668_10000241 Ga0207668_1000024110 88
688 3300025972 Ga0207668_10007726 Ga0207668_100077267 88
689 3300025972 Ga0207668_10070882 Ga0207668_100708822 88
690 3300025986 Ga0207658_10000295 Ga0207658_1000029531 88
691 3300025986 Ga0207658_10002476 Ga0207658_100024762 88
692 3300025986 Ga0207658_10676398 Ga0207658_106763982 88
693 3300026035 Ga0207703_10002213 Ga0207703_1000221311 88
694 3300026035 Ga0207703_10004727 Ga0207703_100047273 88
695 3300026041 Ga0207639_11146478 Ga0207639_111464781 88
696 3300026078 Ga0207702_11839356 Ga0207702_118393561 88
697 3300026088 Ga0207641_10000612 Ga0207641_1000061228 88
698 3300026088 Ga0207641_10001331 Ga0207641_1000133110 88
699 3300026089 Ga0207648_10807326 Ga0207648_108073262 88
700 3300026095 Ga0207676_10002400 Ga0207676_1000240013 88
701 3300026118 Ga0207675_100240157 Ga0207675_1002401572 88
702 3300026118 Ga0207675_100905684 Ga0207675_1009056842 88
703 3300027866 Ga0209813_10005758 Ga0209813_100057583 88
704 3300028379 Ga0268266_10000711 Ga0268266_1000071139 88
705 3300028379 Ga0268266_10003648 Ga0268266_1000364817 88
706 3300028379 Ga0268266_10107687 Ga0268266_101076873 88
707 3300028380 Ga0268265_10001088 Ga0268265_1000108820 88
708 3300028380 Ga0268265_10001421 Ga0268265_100014217 88
709 3300028380 Ga0268265_10128675 Ga0268265_101286752 88
710 3300028380 Ga0268265_10329581 Ga0268265_103295813 88
711 3300028381 Ga0268264_10000091 Ga0268264_10000091160 88
712 3300028381 Ga0268264_10000207 Ga0268264_1000020766 88
713 3300028381 Ga0268264_10010714 Ga0268264_100107147 88
714 3300028381 Ga0268264_12306966 Ga0268264_123069661 88
715 3300031247 Ga0265340_10566998 Ga0265340_105669981 88
716 3300031548 Ga0307408_100383663 Ga0307408_1003836631 88
717 3300031903 Ga0307407_10535865 Ga0307407_105358652 88
718 3300031995 Ga0307409_101099300 Ga0307409_1010993002 88
719 3300032004 Ga0307414_10108804 Ga0307414_101088043 88
720 3300035115 Ga0373941_0078984 Ga0373941_0078984_40_312 88
721 3300035691 Ga0373931_0699258 Ga0373931_0699258_35_307 88
722 3300037068 Ga0373925_0965083 Ga0373925_0965083_52_324 88
723 3300037068 Ga0373925_1014951 Ga0373925_1014951_181_453 88
724 3300037471 Ga0395905_0027924 Ga0395905_0027924_4513_4797 88
725 3300037471 Ga0395905_0590077 Ga0395905_0590077_13_300 88
726 3300037853 Ga0436364_0037096 Ga0436364_0037096_498_770 88
727 3300039437 Ga0436365_0192477 Ga0436365_0192477_539_811 88
728 3300039437 Ga0436365_1291619 Ga0436365_1291619_227_499 88
729 3300039438 Ga0436360_0384133 Ga0436360_0384133_2631_2915 88
730 3300039438 Ga0436360_0392815 Ga0436360_0392815_1282_1557 88
731 3300039438 Ga0436360_0474819 Ga0436360_0474819_70_345 88
732 3300039447 Ga0436361_0304745 Ga0436361_0304745_1955_2239 88
733 3300039447 Ga0436361_0548490 Ga0436361_0548490_921_1205 88
734 3300039450 Ga0436363_0123189 Ga0436363_0123189_619_900 88
735 3300039453 Ga0436362_0053172 Ga0436362_0053172_558_842 88
736 3300039453 Ga0436362_1196929 Ga0436362_1196929_58_342 88
737 3300042533 Ga0450901_004112 Ga0450901_004112_1186_1470 88
738 3300044683 Ga0466965_0156640 Ga0466965_0156640_223_498 88
739 3300044735 Ga0466968_0591920 Ga0466968_0591920_252_527 88
740 3300045049 Ga0466959_0102536 Ga0466959_0102536_923_1207 88
741 3300045049 Ga0466959_0386074 Ga0466959_0386074_136_408 88
742 3300046674 Ga0495588_0749608 Ga0495588_0749608_26_298 88
743 3300046691 Ga0495670_0464537 Ga0495670_0464537_24_296 88
744 3300048904 Ga0496101_0610526 Ga0496101_0610526_556_828 88
745 3300048905 Ga0496102_0283594 Ga0496102_0283594_1144_1416 88
746 3300048905 Ga0496102_0849973 Ga0496102_0849973_356_628 88
747 3300048907 Ga0496104_0657201 Ga0496104_0657201_550_822 88
748 3300048908 Ga0496105_0495177 Ga0496105_0495177_650_922 88
749 3300048909 Ga0496106_0755617 Ga0496106_0755617_76_348 88
750 3300048913 Ga0496110_0738921 Ga0496110_0738921_329_601 88
751 3300049161 Ga0501305_114684 Ga0501305_114684_221_496 88
752 3300049535 Ga0501319_002602 Ga0501319_002602_615_899 88
753 3300049570 Ga0501033_0196043 Ga0501033_0196043_746_1018 88
754 3300049573 Ga0501037_0261567 Ga0501037_0261567_816_1088 88
755 3300049579 Ga0501043_0409274 Ga0501043_0409274_341_613 88
756 3300049581 Ga0501047_0002867 Ga0501047_0002867_15577_15849 88
757 3300049686 Ga0501257_237083 Ga0501257_237083_166_438 88
758 3300049742 Ga0501080_1244885 Ga0501080_1244885_342_614 88
759 3300049822 Ga0501035_0751934 Ga0501035_0751934_33_305 88
760 3300049822 Ga0501035_1300613 Ga0501035_1300613_159_431 88
761 3300049823 Ga0501044_1307797 Ga0501044_1307797_197_466 88
762 3300050490 nmdc:mga03n38_57024_c1 nmdc:mga03n38_57024_c1_496_768 88
763 3300050491 nmdc:mga00v17_725_c1 nmdc:mga00v17_725_c1_11905_12177 88
764 3300050493 nmdc:mga0k408_11045_c1 nmdc:mga0k408_11045_c1_843_1115 88
765 3300050494 nmdc:mga06z11_2151_c1 nmdc:mga06z11_2151_c1_5831_6103 88
766 3300050495 nmdc:mga04h51_6559_c1 nmdc:mga04h51_6559_c1_1241_1513 88
767 3300050496 nmdc:mga07m45_106546_c1 nmdc:mga07m45_106546_c1_478_750 88
768 3300050516 nmdc:mga0sz30_6524_c2 nmdc:mga0sz30_6524_c2_80_352 88
769 3300053087 Ga0500643_006633 Ga0500643_006633_2672_2953 88
770 3300053087 Ga0500643_026871 Ga0500643_026871_865_1137 88
771 3300053087 Ga0500643_042847 Ga0500643_042847_1015_1287 88
772 3300053096 Ga0500641_0002963 Ga0500641_0002963_1062_1334 88
773 3300053108 Ga0500562_001679 Ga0500562_001679_2610_2879 88
774 3300053130 Ga0500642_0169271 Ga0500642_0169271_666_938 88
775 3300053730 Ga0500645_112285 Ga0500645_112285_412_684 88
776 3300059491 Ga0587070_203856 Ga0587070_203856_111_383 88
777 3300059506 Ga0587085_041352 Ga0587085_041352_340_612 88
778 3300059513 Ga0587094_085149 Ga0587094_085149_150_422 88
779 3300059630 Ga0587128_108397 Ga0587128_108397_218_487 88
780 3300059645 Ga0587076_210658 Ga0587076_210658_182_454 88
781 3300060344 Ga0587071_155866 Ga0587071_155866_29_301 88
782 3300060346 Ga0587111_0103299 Ga0587111_0103299_162_434 88
783 3300061719 Ga0466962_0174679 Ga0466962_0174679_320_604 88
784 3300005341 Ga0070691_10597617 Ga0070691_105976171 89
785 3300005344 Ga0070661_100284810 Ga0070661_1002848102 89
786 3300005366 Ga0070659_100976467 Ga0070659_1009764672 89
787 3300005458 Ga0070681_10297309 Ga0070681_102973093 89
788 3300005530 Ga0070679_101377108 Ga0070679_1013771081 89
789 3300005563 Ga0068855_100115879 Ga0068855_1001158793 89
790 3300005563 Ga0068855_101717364 Ga0068855_1017173641 89
791 3300005614 Ga0068856_102184620 Ga0068856_1021846202 89
792 3300005844 Ga0068862_101546090 Ga0068862_1015460902 89
793 3300009093 Ga0105240_10286498 Ga0105240_102864982 89
794 3300009093 Ga0105240_10529912 Ga0105240_105299123 89
795 3300009551 Ga0105238_10105565 Ga0105238_101055654 89
796 3300013105 Ga0157369_10887202 Ga0157369_108872022 89
797 3300013306 Ga0163162_10189403 Ga0163162_101894034 89
798 3300025909 Ga0207705_10418515 Ga0207705_104185152 89
799 3300025912 Ga0207707_10135825 Ga0207707_101358253 89
800 3300025913 Ga0207695_10000837 Ga0207695_1000083747 89
801 3300025913 Ga0207695_10290079 Ga0207695_102900792 89
802 3300025913 Ga0207695_10299028 Ga0207695_102990282 89
803 3300025917 Ga0207660_10177760 Ga0207660_101777602 89
804 3300025921 Ga0207652_10050296 Ga0207652_100502962 89
805 3300025924 Ga0207694_10290475 Ga0207694_102904752 89
806 3300025932 Ga0207690_10849117 Ga0207690_108491172 89
807 3300025939 Ga0207665_10766282 Ga0207665_107662822 89
808 3300025949 Ga0207667_10456422 Ga0207667_104564222 89
809 3300026041 Ga0207639_11840425 Ga0207639_118404251 89
810 3300026078 Ga0207702_12449922 Ga0207702_124499221 89
811 3300027378 Ga0209981_1029420 Ga0209981_10294202 89
812 3300027543 Ga0209999_1006261 Ga0209999_10062613 89
813 3300027552 Ga0209982_1011433 Ga0209982_10114332 89
814 3300027665 Ga0209983_1083430 Ga0209983_10834302 89
815 3300028800 Ga0265338_10233227 Ga0265338_102332272 89
816 3300031251 Ga0265327_10114940 Ga0265327_101149402 89
817 3300035113 Ga0373936_0009511 Ga0373936_0009511_3032_3304 89
818 3300037466 Ga0395898_1478547 Ga0395898_1478547_150_422 89
819 3300039450 Ga0436363_0144206 Ga0436363_0144206_444_725 89
820 3300046529 Ga0495652_0764050 Ga0495652_0764050_338_610 89
821 3300048088 Ga0495602_0977413 Ga0495602_0977413_107_379 89
822 3300054114 Ga0501084_1490831 Ga0501084_1490831_10_282 89
823 3300000531 CNBas_1012637 CNBas_10126371 90
824 3300005293 Ga0065715_10354226 Ga0065715_103542262 90
825 3300005327 Ga0070658_10037444 Ga0070658_100374445 90
826 3300005327 Ga0070658_10648962 Ga0070658_106489622 90
827 3300005329 Ga0070683_100616227 Ga0070683_1006162272 90
828 3300005331 Ga0070670_100730249 Ga0070670_1007302492 90
829 3300005335 Ga0070666_10299046 Ga0070666_102990462 90
830 3300005336 Ga0070680_100029823 Ga0070680_1000298235 90
831 3300005337 Ga0070682_101453512 Ga0070682_1014535121 90
832 3300005337 Ga0070682_101523012 Ga0070682_1015230122 90
833 3300005338 Ga0068868_100542997 Ga0068868_1005429972 90
834 3300005339 Ga0070660_100329886 Ga0070660_1003298861 90
835 3300005339 Ga0070660_100349902 Ga0070660_1003499022 90
836 3300005340 Ga0070689_101892303 Ga0070689_1018923032 90
837 3300005344 Ga0070661_100713913 Ga0070661_1007139132 90
838 3300005355 Ga0070671_100613538 Ga0070671_1006135381 90
839 3300005355 Ga0070671_100912813 Ga0070671_1009128131 90
840 3300005364 Ga0070673_100227069 Ga0070673_1002270693 90
841 3300005364 Ga0070673_100787119 Ga0070673_1007871191 90
842 3300005367 Ga0070667_100728170 Ga0070667_1007281702 90
843 3300005440 Ga0070705_101290225 Ga0070705_1012902252 90
844 3300005455 Ga0070663_100886956 Ga0070663_1008869562 90
845 3300005456 Ga0070678_100951193 Ga0070678_1009511932 90
846 3300005457 Ga0070662_100023925 Ga0070662_1000239258 90
847 3300005458 Ga0070681_10002805 Ga0070681_100028058 90
848 3300005459 Ga0068867_100697246 Ga0068867_1006972462 90
849 3300005467 Ga0070706_100245176 Ga0070706_1002451762 90
850 3300005530 Ga0070679_100031245 Ga0070679_1000312452 90
851 3300005535 Ga0070684_100890659 Ga0070684_1008906592 90
852 3300005539 Ga0068853_101301087 Ga0068853_1013010872 90
853 3300005543 Ga0070672_101136985 Ga0070672_1011369852 90
854 3300005548 Ga0070665_100000418 Ga0070665_10000041832 90
855 3300005548 Ga0070665_100038239 Ga0070665_1000382398 90
856 3300005563 Ga0068855_100005017 Ga0068855_1000050178 90
857 3300005564 Ga0070664_100263642 Ga0070664_1002636421 90
858 3300005577 Ga0068857_100052533 Ga0068857_1000525332 90
859 3300005614 Ga0068856_100423337 Ga0068856_1004233372 90
860 3300005614 Ga0068856_102327512 Ga0068856_1023275122 90
861 3300005616 Ga0068852_100282530 Ga0068852_1002825302 90
862 3300005617 Ga0068859_101368042 Ga0068859_1013680422 90
863 3300005618 Ga0068864_100135302 Ga0068864_1001353022 90
864 3300005618 Ga0068864_100311255 Ga0068864_1003112552 90
865 3300005618 Ga0068864_100323202 Ga0068864_1003232022 90
866 3300005719 Ga0068861_101607137 Ga0068861_1016071372 90
867 3300005841 Ga0068863_100213206 Ga0068863_1002132062 90
868 3300005841 Ga0068863_100309374 Ga0068863_1003093742 90
869 3300005841 Ga0068863_101305412 Ga0068863_1013054122 90
870 3300005843 Ga0068860_100775126 Ga0068860_1007751262 90
871 3300006358 Ga0068871_100486484 Ga0068871_1004864842 90
872 3300006881 Ga0068865_100001766 Ga0068865_1000017665 90
873 3300006931 Ga0097620_101368029 Ga0097620_1013680292 90
874 3300009093 Ga0105240_10003732 Ga0105240_1000373225 90
875 3300009148 Ga0105243_11653481 Ga0105243_116534811 90
876 3300009174 Ga0105241_10796834 Ga0105241_107968342 90
877 3300009176 Ga0105242_12039340 Ga0105242_120393401 90
878 3300009177 Ga0105248_10005017 Ga0105248_100050173 90
879 3300009177 Ga0105248_10523874 Ga0105248_105238741 90
880 3300009177 Ga0105248_12515633 Ga0105248_125156332 90
881 3300009545 Ga0105237_10561436 Ga0105237_105614362 90
882 3300009545 Ga0105237_11503065 Ga0105237_115030652 90
883 3300009551 Ga0105238_10089409 Ga0105238_100894094 90
884 3300009551 Ga0105238_10187590 Ga0105238_101875903 90
885 3300009551 Ga0105238_10316772 Ga0105238_103167722 90
886 3300009553 Ga0105249_10876021 Ga0105249_108760212 90
887 3300009553 Ga0105249_11764683 Ga0105249_117646831 90
888 3300010375 Ga0105239_10221492 Ga0105239_102214922 90
889 3300010375 Ga0105239_10820725 Ga0105239_108207251 90
890 3300013100 Ga0157373_10827430 Ga0157373_108274302 90
891 3300013104 Ga0157370_10334409 Ga0157370_103344093 90
892 3300013104 Ga0157370_11546511 Ga0157370_115465112 90
893 3300013297 Ga0157378_11220927 Ga0157378_112209272 90
894 3300013306 Ga0163162_12398190 Ga0163162_123981902 90
895 3300013306 Ga0163162_12415827 Ga0163162_124158271 90
896 3300013308 Ga0157375_10618834 Ga0157375_106188343 90
897 3300013308 Ga0157375_11013469 Ga0157375_110134691 90
898 3300013308 Ga0157375_11762204 Ga0157375_117622041 90
899 3300014325 Ga0163163_10372208 Ga0163163_103722082 90
900 3300014325 Ga0163163_10448826 Ga0163163_104488262 90
901 3300014745 Ga0157377_10349866 Ga0157377_103498662 90
902 3300014968 Ga0157379_10486049 Ga0157379_104860491 90
903 3300014968 Ga0157379_11076522 Ga0157379_110765222 90
904 3300014969 Ga0157376_10147350 Ga0157376_101473502 90
905 3300017792 Ga0163161_10285686 Ga0163161_102856862 90
906 3300025321 Ga0207656_10447104 Ga0207656_104471042 90
907 3300025900 Ga0207710_10506290 Ga0207710_105062901 90
908 3300025903 Ga0207680_10266568 Ga0207680_102665682 90
909 3300025903 Ga0207680_11048096 Ga0207680_110480961 90
910 3300025909 Ga0207705_10005663 Ga0207705_100056638 90
911 3300025911 Ga0207654_11300381 Ga0207654_113003811 90
912 3300025912 Ga0207707_10010835 Ga0207707_100108358 90
913 3300025913 Ga0207695_10001415 Ga0207695_1000141534 90
914 3300025917 Ga0207660_10005342 Ga0207660_100053426 90
915 3300025919 Ga0207657_10318140 Ga0207657_103181403 90
916 3300025920 Ga0207649_10208624 Ga0207649_102086242 90
917 3300025921 Ga0207652_10489026 Ga0207652_104890262 90
918 3300025924 Ga0207694_10103283 Ga0207694_101032833 90
919 3300025927 Ga0207687_10825121 Ga0207687_108251212 90
920 3300025928 Ga0207700_10771090 Ga0207700_107710902 90
921 3300025931 Ga0207644_10638640 Ga0207644_106386402 90
922 3300025932 Ga0207690_10000898 Ga0207690_1000089811 90
923 3300025932 Ga0207690_10013676 Ga0207690_100136764 90
924 3300025933 Ga0207706_10020225 Ga0207706_100202257 90
925 3300025938 Ga0207704_10001066 Ga0207704_100010665 90
926 3300025941 Ga0207711_10000155 Ga0207711_1000015571 90
927 3300025941 Ga0207711_10152489 Ga0207711_101524893 90
928 3300025941 Ga0207711_11079898 Ga0207711_110798982 90
929 3300025945 Ga0207679_10804161 Ga0207679_108041612 90
930 3300025949 Ga0207667_10011376 Ga0207667_100113763 90
931 3300025960 Ga0207651_10251899 Ga0207651_102518991 90
932 3300025981 Ga0207640_11403247 Ga0207640_114032471 90
933 3300025986 Ga0207658_10445065 Ga0207658_104450652 90
934 3300026023 Ga0207677_10430994 Ga0207677_104309942 90
935 3300026035 Ga0207703_10570132 Ga0207703_105701322 90
936 3300026041 Ga0207639_10410461 Ga0207639_104104612 90
937 3300026041 Ga0207639_10705975 Ga0207639_107059751 90
938 3300026067 Ga0207678_10657774 Ga0207678_106577742 90
939 3300026078 Ga0207702_10460042 Ga0207702_104600422 90
940 3300026088 Ga0207641_10244530 Ga0207641_102445302 90
941 3300026088 Ga0207641_10370456 Ga0207641_103704562 90
942 3300026089 Ga0207648_10490922 Ga0207648_104909222 90
943 3300026095 Ga0207676_10086766 Ga0207676_100867662 90
944 3300026095 Ga0207676_10178658 Ga0207676_101786582 90
945 3300026095 Ga0207676_10956833 Ga0207676_109568332 90
946 3300026116 Ga0207674_10046471 Ga0207674_100464714 90
947 3300026121 Ga0207683_10113141 Ga0207683_101131412 90
948 3300026121 Ga0207683_11207475 Ga0207683_112074752 90
949 3300026142 Ga0207698_11196583 Ga0207698_111965832 90
950 3300028379 Ga0268266_10000003 Ga0268266_100000031153 90
951 3300028379 Ga0268266_10077006 Ga0268266_100770063 90
952 3300028381 Ga0268264_11281844 Ga0268264_112818442 90
953 3300028786 Ga0307517_10000835 Ga0307517_1000083548 90
954 3300028786 Ga0307517_10126586 Ga0307517_101265862 90
955 3300031456 Ga0307513_10004902 Ga0307513_1000490216 90
956 3300031456 Ga0307513_10154808 Ga0307513_101548082 90
957 3300035083 Ga0373926_0086427 Ga0373926_0086427_184_459 90
958 3300035086 Ga0373934_0337231 Ga0373934_0337231_38_313 90
959 3300035089 Ga0373944_0013203 Ga0373944_0013203_528_803 90
960 3300035111 Ga0373923_0558521 Ga0373923_0558521_232_507 90
961 3300035116 Ga0373945_0065928 Ga0373945_0065928_108_383 90
962 3300035170 Ga0373943_0051520 Ga0373943_0051520_1714_1989 90
963 3300035171 Ga0373946_0132043 Ga0373946_0132043_203_478 90
964 3300035172 Ga0373955_0828465 Ga0373955_0828465_221_496 90
965 3300035695 Ga0373927_0000173 Ga0373927_0000173_4155_4430 90
966 3300036401 Ga0373937_0741131 Ga0373937_0741131_159_434 90
967 3300037068 Ga0373925_0000049 Ga0373925_0000049_64579_64854 90
968 3300046460 Ga0495638_0169895 Ga0495638_0169895_827_1099 90
969 3300046492 Ga0495585_0587470 Ga0495585_0587470_148_420 90
970 3300046506 Ga0495583_0062409 Ga0495583_0062409_499_771 90
971 3300046507 Ga0495606_0121510 Ga0495606_0121510_217_489 90
972 3300046512 Ga0495610_0355438 Ga0495610_0355438_105_377 90
973 3300046517 Ga0495630_0457077 Ga0495630_0457077_557_832 90
974 3300046523 Ga0495644_0114564 Ga0495644_0114564_565_837 90
975 3300046525 Ga0495663_0042968 Ga0495663_0042968_777_1049 90
976 3300046528 Ga0495642_0010166 Ga0495642_0010166_382_654 90
977 3300046528 Ga0495642_0289210 Ga0495642_0289210_257_529 90
978 3300046543 Ga0495645_0472690 Ga0495645_0472690_383_658 90
979 3300046616 Ga0495668_0025043 Ga0495668_0025043_987_1259 90
980 3300046648 Ga0495611_0096417 Ga0495611_0096417_151_423 90
981 3300046660 Ga0495625_0095839 Ga0495625_0095839_1643_1915 90
982 3300046664 Ga0495659_0015957 Ga0495659_0015957_1132_1404 90
983 3300046665 Ga0495661_0216748 Ga0495661_0216748_521_793 90
984 3300046683 Ga0495658_0882508 Ga0495658_0882508_58_330 90
985 3300046684 Ga0495669_0422530 Ga0495669_0422530_244_516 90
986 3300047318 Ga0495636_0206442 Ga0495636_0206442_417_689 90
987 3300047319 Ga0495674_0378402 Ga0495674_0378402_741_1016 90
988 3300047320 Ga0495672_0095153 Ga0495672_0095153_435_707 90
989 3300047323 Ga0495683_0120139 Ga0495683_0120139_552_824 90
990 3300047443 Ga0495687_178773 Ga0495687_178773_230_502 90
991 3300047445 Ga0495677_0092502 Ga0495677_0092502_206_478 90
992 3300047470 Ga0495681_0105134 Ga0495681_0105134_832_1104 90
993 3300048090 Ga0495615_0268657 Ga0495615_0268657_118_390 90
994 3300048903 Ga0496100_0446209 Ga0496100_0446209_684_956 90
995 3300048904 Ga0496101_0618564 Ga0496101_0618564_71_343 90
996 3300048905 Ga0496102_0270127 Ga0496102_0270127_1262_1534 90
997 3300048906 Ga0496103_0309426 Ga0496103_0309426_676_948 90
998 3300048907 Ga0496104_0993673 Ga0496104_0993673_160_432 90
999 3300048908 Ga0496105_1361658 Ga0496105_1361658_88_363 90
1000 3300048909 Ga0496106_0040840 Ga0496106_0040840_1426_1698 90
1001 3300048911 Ga0496108_0821040 Ga0496108_0821040_458_730 90
1002 3300048912 Ga0496109_0027177 Ga0496109_0027177_1755_2027 90
1003 3300048913 Ga0496110_0168729 Ga0496110_0168729_207_479 90
1004 3300048914 Ga0496111_0298583 Ga0496111_0298583_501_773 90
1005 3300048915 Ga0496112_0083301 Ga0496112_0083301_2334_2609 90
1006 3300048915 Ga0496112_0275732 Ga0496112_0275732_129_401 90
1007 3300048916 Ga0496113_0037071 Ga0496113_0037071_663_935 90
1008 3300048918 Ga0496115_0220407 Ga0496115_0220407_401_691 90
1009 3300053119 Ga0500595_026926 Ga0500595_026926_698_979 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9361 20 83
5okz-assembly4.cif.gz_b crystal strucrure of the mpp6 exosome complex 0.9151 28 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.904 18 83
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.902 19 87
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8956 20 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9361 20 83 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9101 29 82 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8956 20 83 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8825 22 90 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8785 29 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7X7P7E9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9723 27 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A432T7Q1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9713 25 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V3W3R6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9652 25 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A351YBM2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9645 21 84 GO:0003735
GO:0006412
GO:0022625
AF-X1EXW6-F1-model_v4 Ribosomal protein L27 0.958 19 86 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
77.4 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map