F488022

General Info

Members Datasets Scaffolds Average Seq Length
1007 440 922 274

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000042|JGI25155J39150_100004218
Length 316
Sequence MRFPPRGPLRLRPGEAGSAAPTCMWEISGRSLLCLPITSLEYAMTAVLNAPVFADVPVREFQPGPAGTHITIRGLTKYFAGWPLYEDFNLDIPKHKIVSVFGPNGCGKSTLINMIAGLIPIDAGEILFDGKSLKDTKIGYVFQNYREAMFPWMRTIDNIAYPLKLEGKSKAEVDRRMAELVASFDVKFDLNRYPYELSGGQQQTASIMRALAPNPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAVYLADQVLLLTKRPTRVAEILPYGDARPRTVETLSEASFIRTKKLSLEIFQREVRR

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
10 2643221569 Achromobacter sp. Root565 Isolate Unclassified
11 2643221585 Pelomonas sp. Root662 Isolate Unclassified
12 2643221594 Achromobacter sp. Root170 Isolate Unclassified
13 2643221609 Acidovorax sp. Root217 Isolate Unclassified
14 2643221611 Acidovorax sp. Root219 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
18 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2643221672 Variovorax sp. Root434 Isolate Unclassified
21 2738541277 Variovorax sp. GV051 Isolate Unclassified
22 2738541307 Variovorax sp. GV008 Isolate Unclassified
23 2738543012 Acidovorax sp. CF301 Isolate Unclassified
24 2738543013 Variovorax sp. BT01 Isolate Unclassified
25 2738543019 Variovorax sp. GV040 Isolate Unclassified
26 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
27 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
28 2816332133 Acidovorax radicis 2721A Isolate Unclassified
29 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
30 2818991446 Variovorax sp. 1180 Isolate Unclassified
31 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
32 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
35 2842677519 Variovorax sp. R-72495 Isolate Unclassified
36 2842733646 Variovorax sp. R-72446 Isolate Unclassified
37 2842747753 Variovorax sp. R-72060 Isolate Unclassified
38 2855730933 Achromobacter sp. HZ28 Isolate Nodule
39 2855767633 Achromobacter sp. HZ34 Isolate Nodule
40 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
41 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
42 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
43 2858950400 Achromobacter sp. K91 Isolate Unclassified
44 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
45 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
46 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
47 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
48 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
49 2885198086 Variovorax sp. 679 Isolate Unclassified
50 2885211737 Variovorax sp. 553 Isolate Unclassified
51 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
52 2899924645 Variovorax sp. 369 Isolate Unclassified
53 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
54 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
55 2904456579 Variovorax sp. 2002 Isolate Unclassified
56 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
57 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
58 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
59 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
60 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
61 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
62 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
63 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
64 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
65 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
66 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
67 2928037797 Variovorax sp. 1126 Isolate Unclassified
68 2928044640 Variovorax sp. 1128 Isolate Unclassified
69 2928051484 Variovorax sp. 1133 Isolate Unclassified
70 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
71 2928070936 Variovorax gossypii 1167 Isolate Unclassified
72 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
73 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
74 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
75 2929520902 Variovorax beijingensis 502 Isolate Unclassified
76 2941479691
77 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
78 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
79 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
80 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
81 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
82 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
83 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
84 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
85 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
86 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
87 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
88 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
89 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
90 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
93 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
94 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
95 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
96 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
97 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
98 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
99 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
100 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
101 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
102 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
103 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
104 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
105 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
110 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
111 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
112 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
113 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
114 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
115 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
116 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
117 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
118 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
119 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
120 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
121 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
122 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
123 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
124 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
125 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
128 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
129 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
130 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
131 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
132 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
133 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
134 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
135 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
136 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
141 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
142 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
143 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
144 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
145 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
146 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
150 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
156 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
157 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
158 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
159 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
160 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
161 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
162 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
163 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
164 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
165 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
166 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
167 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
168 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
169 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
170 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
171 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
172 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
173 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
174 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
175 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
176 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
177 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
178 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
179 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
180 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
183 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
190 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
191 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
192 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
193 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
194 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
195 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
196 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
197 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
200 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
201 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
204 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
205 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
206 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
207 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
211 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
212 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
213 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
214 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
215 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
216 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
217 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
218 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
219 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
220 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
221 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
222 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
229 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
231 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
232 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
233 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
236 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
237 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
240 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
245 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
248 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
298 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
300 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
305 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
306 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
307 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
308 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
309 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
310 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
311 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
312 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
313 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
314 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
315 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
316 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
317 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
318 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
319 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
320 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
321 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
322 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
323 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
324 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
325 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
326 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
327 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
328 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
329 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
330 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
331 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
332 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
333 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
334 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
335 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
336 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
337 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
341 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
342 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
343 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
344 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
345 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
346 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
347 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
348 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
349 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
350 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
351 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
352 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
353 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
354 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
355 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
356 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
357 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
358 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
359 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
360 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
361 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
362 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
363 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
368 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
371 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
372 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
373 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
374 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
375 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
376 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
386 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
387 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
415 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
416 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
417 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
418 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
419 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
420 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
421 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
422 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
423 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
424 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
425 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
426 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
427 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
430 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
440 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 0
Isolates 8.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.47
Nodule 0.99
Rhizoplane 1.49
Rhizosphere 63.16
Stem 0
Stem Tuber 0
Unclassified 15.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010263 3300001979 Bacteria 3618
2 JGI24739J22299_10015867 3300001989 Bacteria 2733
3 JGI25155J39150_1000042 3300002704 Bacteria 88585
4 JGI25155J39150_1000651 3300002704 Bacteria 6849
5 JGI25155J39150_1001094 3300002704 Bacteria 2726
6 JGI25156J39149_1000053 3300002705 Bacteria 88796
7 JGI25156J39149_1000170 3300002705 Bacteria 47634
8 JGI25156J39149_1001869 3300002705 Bacteria 8231
9 JGI25156J39149_1007194 3300002705 Bacteria 2953
10 JGI25162J39368_1003814 3300002737 Bacteria 3981
11 JGI25154J39366_1000082 3300002738 Bacteria 88767
12 JGI25154J39366_1000306 3300002738 Bacteria 28725
13 JGI25154J39366_1000455 3300002738 Bacteria 21495
14 JGI25157J39369_1000072 3300002741 Bacteria 88796
15 JGI25157J39369_1000170 3300002741 Bacteria 54809
16 JGI25159J45721_1002106 3300002987 Bacteria 7812
17 JGI25159J45721_1010517 3300002987 Bacteria 2348
18 JGI25151J46595_10000301 3300003187 Bacteria 54192
19 JGI25151J46595_10011183 3300003187 Bacteria 4134
20 JGI25153J46596_10012010 3300003215 Bacteria 3781
21 rootL2_10017868 3300003322 Bacteria 14919
22 rootH1_10005172 3300003323 Bacteria 2973
23 JGI25160J50197_1000227 3300003354 Bacteria 44493
24 JGI25161J50226_1000007 3300003374 Bacteria 256181
25 Ga0055538_1000013 3300003751 Bacteria 348596
26 Ga0055539_1000018 3300003752 Bacteria 348596
27 Ga0055533_1000022 3300003756 Bacteria 348596
28 Ga0055532_1000017 3300003758 Bacteria 306880
29 Ga0055525_1000024 3300003759 Bacteria 348596
30 Ga0055535_1000260 3300003761 Bacteria 55578
31 Ga0055535_1005719 3300003761 Bacteria 2661
32 Ga0055542_1000013 3300003762 Bacteria 387560
33 Ga0055526_1021281 3300003771 Bacteria 2263
34 Ga0055537_1002740 3300003773 Bacteria 5717
35 Ga0055524_1000052 3300003775 Bacteria 144959
36 Ga0055524_1001441 3300003775 Bacteria 13654
37 Ga0055536_1004462 3300003781 Bacteria 7148
38 Ga0055534_1001477 3300003784 Bacteria 9327
39 Ga0055534_1002933 3300003784 Bacteria 5651
40 Ga0055534_1006234 3300003784 Bacteria 3040
41 Ga0055530_10003439 3300003791 Bacteria 8999
42 Ga0055530_10004911 3300003791 Bacteria 6630
43 Ga0055530_10018827 3300003791 Bacteria 2114
44 Ga0055540_1000123 3300003792 Bacteria 80351
45 Ga0055540_1002288 3300003792 Bacteria 10318
46 Ga0055540_1013297 3300003792 Bacteria 2524
47 Ga0055531_10000740 3300003794 Bacteria 27497
48 Ga0055531_10001116 3300003794 Bacteria 20815
49 Ga0055531_10016084 3300003794 Bacteria 3251
50 Ga0055541_1000013 3300003841 Bacteria 348596
51 Ga0055543_1000386 3300004625 Bacteria 28622
52 Ga0065165_1013879 3300005262 Bacteria 3166
53 Ga0065704_10000444 3300005289 Bacteria 86255
54 Ga0065715_10020215 3300005293 Bacteria 2452
55 Ga0065715_10035108 3300005293 Bacteria 1466
56 Ga0065715_10125321 3300005293 Bacteria 2133
57 Ga0070658_10224146 3300005327 Bacteria 1591
58 Ga0070676_10002668 3300005328 Bacteria 9187
59 Ga0070676_10277204 3300005328 Bacteria 1128
60 Ga0070683_100129404 3300005329 Bacteria 2388
61 Ga0070683_100647230 3300005329 Bacteria 1012
62 Ga0070690_100031929 3300005330 Bacteria 3284
63 Ga0070670_100001971 3300005331 Bacteria 16798
64 Ga0070670_100014554 3300005331 Bacteria 6754
65 Ga0070670_100029888 3300005331 Bacteria 4693
66 Ga0070670_100037645 3300005331 Bacteria 4161
67 Ga0070670_100043346 3300005331 Bacteria 3868
68 Ga0070670_100089726 3300005331 Bacteria 2642
69 Ga0070670_100119461 3300005331 Bacteria 2273
70 Ga0070670_100188056 3300005331 Bacteria 1793
71 Ga0070670_100328284 3300005331 Bacteria 1341
72 Ga0070677_10006417 3300005333 Bacteria 3907
73 Ga0070677_10009189 3300005333 Bacteria 3350
74 Ga0070677_10010076 3300005333 Bacteria 3221
75 Ga0068869_100041131 3300005334 Bacteria 3309
76 Ga0068869_100402150 3300005334 Bacteria 1127
77 Ga0070666_10000758 3300005335 Bacteria 19568
78 Ga0070666_10002174 3300005335 Bacteria 11914
79 Ga0070666_10079624 3300005335 Bacteria 2238
80 Ga0070666_10363788 3300005335 Bacteria 1037
81 Ga0068868_100001290 3300005338 Bacteria 17256
82 Ga0068868_100011821 3300005338 Bacteria 6365
83 Ga0068868_100045446 3300005338 Bacteria 3435
84 Ga0068868_100100646 3300005338 Bacteria 2338
85 Ga0068868_100123985 3300005338 Bacteria 2109
86 Ga0070689_100008704 3300005340 Bacteria 7162
87 Ga0070689_100186212 3300005340 Bacteria 1688
88 Ga0070689_100335959 3300005340 Bacteria 1265
89 Ga0070687_100192273 3300005343 Bacteria 1230
90 Ga0070661_100298968 3300005344 Bacteria 1252
91 Ga0070661_100345298 3300005344 Bacteria 1167
92 Ga0070668_100003834 3300005347 Bacteria 11107
93 Ga0070668_100036636 3300005347 Bacteria 3744
94 Ga0070668_100133019 3300005347 Bacteria 1998
95 Ga0070668_100412093 3300005347 Bacteria 1155
96 Ga0070668_100510634 3300005347 Bacteria 1042
97 Ga0070669_100094824 3300005353 Bacteria 2243
98 Ga0070669_100108307 3300005353 Bacteria 2106
99 Ga0070675_100001026 3300005354 Bacteria 20075
100 Ga0070675_100011870 3300005354 Bacteria 6826
101 Ga0070675_100014529 3300005354 Bacteria 6210
102 Ga0070675_100022217 3300005354 Bacteria 5067
103 Ga0070675_100060263 3300005354 Bacteria 3133
104 Ga0070675_100617966 3300005354 Bacteria 983
105 Ga0070671_100010647 3300005355 Bacteria 7381
106 Ga0070671_100043160 3300005355 Bacteria 3748
107 Ga0070671_100067899 3300005355 Bacteria 2973
108 Ga0070671_100075846 3300005355 Bacteria 2809
109 Ga0070671_100079613 3300005355 Bacteria 2739
110 Ga0070671_100129197 3300005355 Bacteria 2127
111 Ga0070671_100186048 3300005355 Bacteria 1760
112 Ga0070671_100220387 3300005355 Bacteria 1609
113 Ga0070674_100000094 3300005356 Bacteria 41372
114 Ga0070674_100017248 3300005356 Bacteria 4538
115 Ga0070674_100036756 3300005356 Bacteria 3290
116 Ga0070674_100064418 3300005356 Bacteria 2568
117 Ga0070673_100000679 3300005364 Bacteria 18764
118 Ga0070673_100000753 3300005364 Bacteria 17978
119 Ga0070673_100056321 3300005364 Bacteria 3101
120 Ga0070673_100061005 3300005364 Bacteria 2990
121 Ga0070673_100070739 3300005364 Bacteria 2801
122 Ga0070673_100086055 3300005364 Bacteria 2560
123 Ga0070688_100027851 3300005365 Bacteria 3367
124 Ga0070659_100310018 3300005366 Bacteria 1318
125 Ga0070667_100001746 3300005367 Bacteria 19433
126 Ga0070667_100009087 3300005367 Bacteria 8223
127 Ga0070667_100059026 3300005367 Bacteria 3245
128 Ga0070667_100063129 3300005367 Bacteria 3138
129 Ga0070667_100089857 3300005367 Bacteria 2639
130 Ga0070667_100153304 3300005367 Bacteria 2026
131 Ga0070667_100201356 3300005367 Bacteria 1767
132 Ga0070667_100474046 3300005367 Bacteria 1145
133 Ga0070667_100580873 3300005367 Bacteria 1031
134 Ga0070705_100361539 3300005440 Bacteria 1062
135 Ga0070708_100458382 3300005445 Bacteria 1203
136 Ga0070663_100010261 3300005455 Bacteria 5835
137 Ga0070663_100032973 3300005455 Bacteria 3575
138 Ga0070663_100060857 3300005455 Bacteria 2717
139 Ga0070678_100000409 3300005456 Bacteria 20280
140 Ga0070678_100015011 3300005456 Bacteria 4906
141 Ga0070678_100022737 3300005456 Bacteria 4161
142 Ga0070678_100030734 3300005456 Bacteria 3695
143 Ga0070678_100136716 3300005456 Bacteria 1955
144 Ga0070678_100153175 3300005456 Bacteria 1859
145 Ga0070678_100179796 3300005456 Bacteria 1730
146 Ga0070678_100213423 3300005456 Bacteria 1601
147 Ga0070678_100325069 3300005456 Bacteria 1314
148 Ga0070662_100004880 3300005457 Bacteria 8510
149 Ga0070662_100036562 3300005457 Bacteria 3474
150 Ga0070662_100104882 3300005457 Bacteria 2145
151 Ga0070662_100440947 3300005457 Bacteria 1079
152 Ga0068867_100001043 3300005459 Bacteria 18890
153 Ga0068867_100008620 3300005459 Bacteria 7200
154 Ga0068867_100012008 3300005459 Bacteria 6118
155 Ga0068867_100017264 3300005459 Bacteria 5125
156 Ga0068867_100021275 3300005459 Bacteria 4629
157 Ga0068867_100049323 3300005459 Bacteria 3099
158 Ga0068867_100069565 3300005459 Bacteria 2629
159 Ga0068867_100153326 3300005459 Bacteria 1811
160 Ga0070706_100002539 3300005467 Bacteria 18347
161 Ga0070707_100036814 3300005468 Bacteria 4670
162 Ga0070684_100049524 3300005535 Bacteria 3646
163 Ga0068853_100072987 3300005539 Bacteria 2991
164 Ga0068853_100454005 3300005539 Bacteria 1206
165 Ga0070672_100000552 3300005543 Bacteria 22019
166 Ga0070672_100010312 3300005543 Bacteria 6477
167 Ga0070672_100047920 3300005543 Bacteria 3318
168 Ga0070672_100056675 3300005543 Bacteria 3074
169 Ga0070672_100067655 3300005543 Bacteria 2831
170 Ga0070672_100137156 3300005543 Bacteria 2015
171 Ga0070672_100200596 3300005543 Bacteria 1668
172 Ga0070672_100242749 3300005543 Bacteria 1515
173 Ga0070696_100061266 3300005546 Bacteria 2632
174 Ga0070665_100002419 3300005548 Bacteria 20581
175 Ga0070665_100004291 3300005548 Bacteria 14986
176 Ga0070665_100243262 3300005548 Bacteria 1800
177 Ga0070665_100414457 3300005548 Bacteria 1356
178 Ga0068855_100011166 3300005563 Bacteria 10845
179 Ga0068855_100068193 3300005563 Bacteria 4141
180 Ga0070664_100026043 3300005564 Bacteria 4849
181 Ga0070664_100072613 3300005564 Bacteria 2951
182 Ga0070664_100074036 3300005564 Bacteria 2922
183 Ga0070664_100175452 3300005564 Bacteria 1902
184 Ga0070664_100196192 3300005564 Bacteria 1800
185 Ga0068857_100017408 3300005577 Bacteria 6297
186 Ga0068857_100157826 3300005577 Bacteria 2057
187 Ga0068857_100159525 3300005577 Bacteria 2046
188 Ga0068857_100330635 3300005577 Bacteria 1408
189 Ga0068854_100052677 3300005578 Bacteria 2919
190 Ga0068854_100072045 3300005578 Bacteria 2529
191 Ga0068854_100110195 3300005578 Bacteria 2075
192 Ga0068854_100352732 3300005578 Bacteria 1205
193 Ga0068856_100151917 3300005614 Bacteria 2325
194 Ga0070702_100059433 3300005615 Bacteria 2218
195 Ga0070702_100199324 3300005615 Bacteria 1324
196 Ga0070702_100309120 3300005615 Bacteria 1097
197 Ga0068852_100027996 3300005616 Bacteria 4604
198 Ga0068852_100042319 3300005616 Bacteria 3856
199 Ga0068852_100063421 3300005616 Bacteria 3217
200 Ga0068852_100084077 3300005616 Bacteria 2831
201 Ga0068852_100161780 3300005616 Bacteria 2091
202 Ga0068852_100209190 3300005616 Bacteria 1850
203 Ga0068859_100023045 3300005617 Bacteria 6243
204 Ga0068859_100098576 3300005617 Bacteria 2977
205 Ga0068859_100121412 3300005617 Bacteria 2679
206 Ga0068859_100473170 3300005617 Bacteria 1348
207 Ga0068864_100000845 3300005618 Bacteria 25824
208 Ga0068864_100021018 3300005618 Bacteria 5465
209 Ga0068864_100024185 3300005618 Bacteria 5107
210 Ga0068864_100044697 3300005618 Bacteria 3798
211 Ga0068864_100071385 3300005618 Bacteria 3023
212 Ga0068864_100078936 3300005618 Bacteria 2881
213 Ga0068864_100096415 3300005618 Bacteria 2617
214 Ga0068864_100184809 3300005618 Bacteria 1907
215 Ga0068861_100105393 3300005719 Bacteria 2251
216 Ga0068861_100393112 3300005719 Bacteria 1228
217 Ga0068861_100460110 3300005719 Bacteria 1142
218 Ga0068851_10000843 3300005834 Bacteria 13213
219 Ga0068870_10065494 3300005840 Bacteria 1966
220 Ga0068863_100002048 3300005841 Bacteria 19982
221 Ga0068863_100034799 3300005841 Bacteria 4797
222 Ga0068863_100071222 3300005841 Bacteria 3289
223 Ga0068863_100107675 3300005841 Bacteria 2652
224 Ga0068863_100119529 3300005841 Bacteria 2512
225 Ga0068863_100152090 3300005841 Bacteria 2214
226 Ga0068863_100152743 3300005841 Bacteria 2210
227 Ga0068863_100154405 3300005841 Bacteria 2197
228 Ga0068858_100002570 3300005842 Bacteria 18284
229 Ga0068858_100252112 3300005842 Bacteria 1677
230 Ga0068858_100266980 3300005842 Bacteria 1628
231 Ga0068858_100325491 3300005842 Bacteria 1469
232 Ga0068858_100539810 3300005842 Bacteria 1129
233 Ga0068860_100008382 3300005843 Bacteria 10293
234 Ga0068860_100012965 3300005843 Bacteria 8187
235 Ga0068860_100057346 3300005843 Bacteria 3702
236 Ga0068860_100075322 3300005843 Bacteria 3210
237 Ga0068862_100113099 3300005844 Bacteria 2385
238 Ga0068862_100145352 3300005844 Bacteria 2107
239 Ga0068862_100154254 3300005844 Bacteria 2046
240 Ga0068862_100173498 3300005844 Bacteria 1931
241 Ga0068862_100634976 3300005844 Bacteria 1028
242 Ga0070717_10179449 3300006028 Bacteria 1845
243 Ga0075365_10162457 3300006038 Bacteria 1557
244 Ga0075365_10299676 3300006038 Bacteria 1131
245 Ga0075368_10114950 3300006042 Bacteria 1111
246 Ga0075363_100036983 3300006048 Bacteria 2562
247 Ga0075364_10109509 3300006051 Bacteria 1842
248 Ga0075364_10161447 3300006051 Bacteria 1513
249 Ga0075364_10302949 3300006051 Bacteria 1088
250 Ga0075364_10350918 3300006051 Bacteria 1006
251 Ga0075362_10062690 3300006177 Bacteria 1685
252 Ga0075367_10010982 3300006178 Bacteria 4774
253 Ga0075367_10018189 3300006178 Bacteria 3873
254 Ga0075367_10166400 3300006178 Bacteria 1372
255 Ga0075369_10009596 3300006186 Bacteria 3764
256 Ga0075369_10059355 3300006186 Bacteria 1666
257 Ga0075369_10086249 3300006186 Bacteria 1397
258 Ga0075369_10205939 3300006186 Bacteria 908
259 Ga0075366_10002787 3300006195 Bacteria 9038
260 Ga0075366_10015678 3300006195 Bacteria 4349
261 Ga0075366_10064729 3300006195 Bacteria 2174
262 Ga0075366_10143252 3300006195 Bacteria 1445
263 Ga0075366_10210536 3300006195 Bacteria 1183
264 Ga0097621_100007338 3300006237 Bacteria 7881
265 Ga0097621_100037524 3300006237 Bacteria 3884
266 Ga0097621_100140720 3300006237 Bacteria 2061
267 Ga0097621_100241368 3300006237 Bacteria 1579
268 Ga0097621_100404665 3300006237 Bacteria 1222
269 Ga0097621_100450408 3300006237 Bacteria 1160
270 Ga0097621_100558114 3300006237 Bacteria 1043
271 Ga0075370_10006766 3300006353 Bacteria 5792
272 Ga0075370_10024220 3300006353 Bacteria 3351
273 Ga0075370_10027723 3300006353 Bacteria 3145
274 Ga0075370_10063075 3300006353 Bacteria 2112
275 Ga0075370_10070550 3300006353 Bacteria 1998
276 Ga0075370_10127002 3300006353 Bacteria 1487
277 Ga0068871_100064731 3300006358 Bacteria 2993
278 Ga0068871_100230418 3300006358 Bacteria 1608
279 Ga0068871_100473496 3300006358 Bacteria 1126
280 Ga0075428_100101687 3300006844 Bacteria 3133
281 Ga0075430_100034456 3300006846 Bacteria 4297
282 Ga0075430_100109091 3300006846 Bacteria 2309
283 Ga0075431_100034361 3300006847 Bacteria 5223
284 Ga0075431_100052328 3300006847 Bacteria 4211
285 Ga0075429_100029093 3300006880 Bacteria 4799
286 Ga0075429_100193894 3300006880 Bacteria 1780
287 Ga0068865_100006221 3300006881 Bacteria 7277
288 Ga0068865_100022991 3300006881 Bacteria 4075
289 Ga0068865_100041947 3300006881 Bacteria 3117
290 Ga0068865_100114232 3300006881 Bacteria 1997
291 Ga0068865_100426501 3300006881 Bacteria 1091
292 Ga0097620_100023045 3300006931 Bacteria 6243
293 Ga0097620_100098578 3300006931 Bacteria 2977
294 Ga0097620_100121412 3300006931 Bacteria 2679
295 Ga0097620_100473176 3300006931 Bacteria 1348
296 Ga0079104_1000206 3300006946 Bacteria 82424
297 Ga0099826_10000021 3300006948 Bacteria 173580
298 Ga0105251_10159709 3300009011 Bacteria 1016
299 Ga0105244_10000031 3300009036 Bacteria 177606
300 Ga0105244_10003602 3300009036 Bacteria 11001
301 Ga0105240_10008920 3300009093 Bacteria 14257
302 Ga0105240_10041470 3300009093 Bacteria 5875
303 Ga0105240_10059308 3300009093 Bacteria 4776
304 Ga0105240_10112031 3300009093 Bacteria 3299
305 Ga0105240_10290611 3300009093 Bacteria 1874
306 Ga0111539_10058487 3300009094 Bacteria 4573
307 Ga0105245_10105475 3300009098 Bacteria 2614
308 Ga0105247_10353938 3300009101 Bacteria 1033
309 Ga0105243_10000765 3300009148 Bacteria 30835
310 Ga0105243_10024959 3300009148 Bacteria 4564
311 Ga0105243_10041298 3300009148 Bacteria 3607
312 Ga0105243_10251968 3300009148 Bacteria 1577
313 Ga0105243_10438575 3300009148 Bacteria 1222
314 Ga0105241_10165743 3300009174 Bacteria 1821
315 Ga0105242_10090130 3300009176 Bacteria 2579
316 Ga0105242_10448469 3300009176 Bacteria 1216
317 Ga0105248_10086277 3300009177 Bacteria 3532
318 Ga0105248_10116526 3300009177 Bacteria 3013
319 Ga0105248_10119263 3300009177 Bacteria 2976
320 Ga0105248_10268583 3300009177 Bacteria 1921
321 Ga0105248_10285586 3300009177 Bacteria 1858
322 Ga0105237_10051964 3300009545 Bacteria 4116
323 Ga0105237_10103567 3300009545 Bacteria 2838
324 Ga0105237_10175171 3300009545 Bacteria 2145
325 Ga0105237_10279165 3300009545 Bacteria 1673
326 Ga0105238_10000065 3300009551 Bacteria 121196
327 Ga0105238_10063764 3300009551 Bacteria 3686
328 Ga0105238_10196657 3300009551 Bacteria 1992
329 Ga0105249_10086300 3300009553 Bacteria 2927
330 Ga0105249_10091395 3300009553 Bacteria 2848
331 Ga0105239_10054735 3300010375 Bacteria 4377
332 Ga0105239_10063942 3300010375 Bacteria 4040
333 Ga0105239_10159772 3300010375 Bacteria 2517
334 Ga0105239_10709275 3300010375 Bacteria 1150
335 Ga0105246_10165345 3300011119 Bacteria 1689
336 Ga0105246_10402965 3300011119 Bacteria 1136
337 Ga0157319_1000695 3300012497 Bacteria 1560
338 Ga0157339_1001068 3300012505 Bacteria 1581
339 Ga0157371_10045298 3300013102 Bacteria 3130
340 Ga0157370_10002003 3300013104 Bacteria 25038
341 Ga0157370_10310879 3300013104 Bacteria 1454
342 Ga0157369_10035810 3300013105 Bacteria 5441
343 Ga0157374_10050728 3300013296 Bacteria 3858
344 Ga0157374_10110971 3300013296 Bacteria 2638
345 Ga0157374_10146904 3300013296 Bacteria 2290
346 Ga0157374_10446048 3300013296 Bacteria 1295
347 Ga0157374_10482189 3300013296 Bacteria 1243
348 Ga0157374_10606869 3300013296 Bacteria 1104
349 Ga0157378_10040681 3300013297 Bacteria 4123
350 Ga0157378_10070198 3300013297 Bacteria 3144
351 Ga0157378_10240961 3300013297 Bacteria 1727
352 Ga0157378_10378962 3300013297 Bacteria 1389
353 Ga0157378_10508236 3300013297 Bacteria 1205
354 Ga0157378_10516439 3300013297 Bacteria 1195
355 Ga0163162_10047977 3300013306 Bacteria 4279
356 Ga0163162_10077315 3300013306 Bacteria 3391
357 Ga0163162_10115597 3300013306 Bacteria 2783
358 Ga0163162_10122403 3300013306 Bacteria 2706
359 Ga0163162_10221744 3300013306 Bacteria 2021
360 Ga0163162_10599824 3300013306 Bacteria 1227
361 Ga0157372_10060900 3300013307 Bacteria 4224
362 Ga0157375_10011762 3300013308 Bacteria 7738
363 Ga0157375_10035622 3300013308 Bacteria 4752
364 Ga0157375_10049483 3300013308 Bacteria 4118
365 Ga0157375_10059297 3300013308 Bacteria 3791
366 Ga0157375_10064588 3300013308 Bacteria 3645
367 Ga0157375_10219009 3300013308 Bacteria 2062
368 Ga0157375_10233301 3300013308 Bacteria 1999
369 Ga0157375_10451319 3300013308 Bacteria 1451
370 Ga0163163_10217309 3300014325 Bacteria 1960
371 Ga0163163_10218492 3300014325 Bacteria 1954
372 Ga0157380_10009058 3300014326 Bacteria 7112
373 Ga0182008_10024475 3300014497 Bacteria 3075
374 Ga0182008_10037502 3300014497 Bacteria 2425
375 Ga0182008_10053291 3300014497 Bacteria 2003
376 Ga0182008_10079655 3300014497 Bacteria 1612
377 Ga0157377_10000016 3300014745 Bacteria 190613
378 Ga0157379_10008726 3300014968 Bacteria 8833
379 Ga0157379_10048728 3300014968 Bacteria 3782
380 Ga0157379_10049079 3300014968 Bacteria 3768
381 Ga0157379_10281376 3300014968 Bacteria 1514
382 Ga0157376_10106693 3300014969 Bacteria 2458
383 Ga0157376_10215134 3300014969 Bacteria 1776
384 Ga0157376_10328135 3300014969 Bacteria 1457
385 Ga0182006_1002966 3300015261 Bacteria 8953
386 Ga0182006_1014559 3300015261 Bacteria 3387
387 Ga0182007_10002108 3300015262 Bacteria 10177
388 Ga0182007_10016980 3300015262 Bacteria 2670
389 Ga0183362_10004 3300015683 Bacteria 569303
390 Ga0163161_10032312 3300017792 Bacteria 3736
391 Ga0163161_10040898 3300017792 Bacteria 3330
392 Ga0163161_10141036 3300017792 Bacteria 1825
393 Ga0163161_10155206 3300017792 Bacteria 1742
394 Ga0163161_10233374 3300017792 Bacteria 1428
395 Ga0163161_10272017 3300017792 Bacteria 1326
396 Ga0213872_10016125 3300021361 Bacteria 3469
397 Ga0209435_100015 3300025206 Bacteria 321177
398 Ga0209435_100019 3300025206 Bacteria 260989
399 Ga0209435_100290 3300025206 Bacteria 12177
400 Ga0209436_104004 3300025208 Bacteria 3726
401 Ga0209436_105266 3300025208 Bacteria 3005
402 Ga0209784_100005 3300025224 Bacteria 1040422
403 Ga0209566_100005 3300025225 Bacteria 1040422
404 Ga0209674_100009 3300025226 Bacteria 1040422
405 Ga0209672_102201 3300025228 Bacteria 5090
406 Ga0209147_100004 3300025229 Bacteria 1371850
407 Ga0209147_100843 3300025229 Bacteria 14406
408 Ga0209563_100012 3300025230 Bacteria 1040422
409 Ga0209437_100758 3300025233 Bacteria 15571
410 Ga0209258_100020 3300025242 Bacteria 565241
411 Ga0209258_100226 3300025242 Bacteria 106588
412 Ga0207425_1000814 3300025245 Bacteria 15617
413 Ga0209646_1000020 3300025246 Bacteria 462204
414 Ga0209646_1000038 3300025246 Bacteria 353982
415 Ga0209646_1000040 3300025246 Bacteria 347867
416 Ga0209026_1000034 3300025250 Bacteria 306953
417 Ga0209026_1000048 3300025250 Bacteria 257264
418 Ga0209026_1003765 3300025250 Bacteria 4808
419 Ga0209677_100006 3300025253 Bacteria 1040422
420 Ga0209148_1000031 3300025254 Bacteria 564601
421 Ga0209759_1000038 3300025256 Bacteria 257264
422 Ga0209759_1000049 3300025256 Bacteria 221692
423 Ga0209759_1000357 3300025256 Bacteria 59208
424 Ga0209129_1000055 3300025258 Bacteria 261708
425 Ga0209129_1006666 3300025258 Bacteria 3660
426 Ga0209565_1000078 3300025263 Bacteria 160838
427 Ga0209565_1000310 3300025263 Bacteria 45322
428 Ga0209565_1000615 3300025263 Bacteria 23470
429 Ga0209565_1001707 3300025263 Bacteria 9041
430 Ga0209565_1016361 3300025263 Bacteria 1651
431 Ga0209673_1000170 3300025273 Bacteria 133933
432 Ga0209673_1001531 3300025273 Bacteria 21069
433 Ga0209673_1002628 3300025273 Bacteria 12057
434 Ga0209673_1011259 3300025273 Bacteria 3700
435 Ga0209673_1026678 3300025273 Bacteria 1892
436 Ga0209673_1027129 3300025273 Bacteria 1868
437 Ga0209130_1000289 3300025284 Bacteria 61485
438 Ga0209130_1000807 3300025284 Bacteria 26513
439 Ga0209130_1001274 3300025284 Bacteria 17481
440 Ga0209130_1011749 3300025284 Bacteria 2329
441 Ga0209130_1012738 3300025284 Bacteria 2184
442 Ga0209675_1000055 3300025291 Bacteria 193129
443 Ga0209675_1001778 3300025291 Bacteria 11775
444 Ga0209675_1002139 3300025291 Bacteria 10421
445 Ga0209675_1010406 3300025291 Bacteria 3179
446 Ga0209675_1016325 3300025291 Bacteria 2168
447 Ga0209675_1018963 3300025291 Bacteria 1908
448 Ga0209676_1000040 3300025292 Bacteria 438184
449 Ga0209676_1003179 3300025292 Bacteria 10438
450 Ga0209676_1011949 3300025292 Bacteria 3455
451 Ga0209676_1013043 3300025292 Bacteria 3219
452 Ga0209676_1017739 3300025292 Bacteria 2507
453 Ga0209025_1000003 3300025294 Bacteria 1366495
454 Ga0209025_1000409 3300025294 Bacteria 86577
455 Ga0209025_1001751 3300025294 Bacteria 26059
456 Ga0209025_1009368 3300025294 Bacteria 6843
457 Ga0209025_1010755 3300025294 Bacteria 6151
458 Ga0209025_1018466 3300025294 Bacteria 3947
459 Ga0209025_1051447 3300025294 Bacteria 1636
460 Ga0209564_1000157 3300025295 Bacteria 164758
461 Ga0209564_1000806 3300025295 Bacteria 42875
462 Ga0209564_1001767 3300025295 Bacteria 20130
463 Ga0209564_1002258 3300025295 Bacteria 15792
464 Ga0209758_1000042 3300025297 Bacteria 407145
465 Ga0209758_1005953 3300025297 Bacteria 9040
466 Ga0209758_1040043 3300025297 Bacteria 1773
467 Ga0209050_1000021 3300025298 Bacteria 574406
468 Ga0209050_1000760 3300025298 Bacteria 46346
469 Ga0209050_1003967 3300025298 Bacteria 10438
470 Ga0209050_1004794 3300025298 Bacteria 8911
471 Ga0209050_1015628 3300025298 Bacteria 3170
472 Ga0209050_1041968 3300025298 Bacteria 1255
473 Ga0209256_1000036 3300025299 Bacteria 386664
474 Ga0209256_1000056 3300025299 Bacteria 283044
475 Ga0209256_1000124 3300025299 Bacteria 165390
476 Ga0209256_1000127 3300025299 Bacteria 164393
477 Ga0209256_1000906 3300025299 Bacteria 36323
478 Ga0207426_1000055 3300025302 Bacteria 374450
479 Ga0207426_1000079 3300025302 Bacteria 314709
480 Ga0207426_1000091 3300025302 Bacteria 280561
481 Ga0209051_1000025 3300025303 Bacteria 415397
482 Ga0209051_1000068 3300025303 Bacteria 220063
483 Ga0209051_1000351 3300025303 Bacteria 68445
484 Ga0209051_1000423 3300025303 Bacteria 58174
485 Ga0209051_1000446 3300025303 Bacteria 55218
486 Ga0209051_1000530 3300025303 Bacteria 47308
487 Ga0209051_1008921 3300025303 Bacteria 5237
488 Ga0209051_1013428 3300025303 Bacteria 3898
489 Ga0209051_1015139 3300025303 Bacteria 3562
490 Ga0209257_1000015 3300025304 Bacteria 908141
491 Ga0209257_1000039 3300025304 Bacteria 591694
492 Ga0209257_1000043 3300025304 Bacteria 512127
493 Ga0209257_1001377 3300025304 Bacteria 29185
494 Ga0209257_1003725 3300025304 Bacteria 12653
495 Ga0209257_1013914 3300025304 Bacteria 3516
496 Ga0209257_1024395 3300025304 Bacteria 2094
497 Ga0207697_10020918 3300025315 Bacteria 2679
498 Ga0207656_10087638 3300025321 Bacteria 1408
499 Ga0207656_10170628 3300025321 Bacteria 1040
500 Ga0207655_1000029 3300025728 Bacteria 432187
501 Ga0207655_1005080 3300025728 Bacteria 9094
502 Ga0207682_10001047 3300025893 Bacteria 12739
503 Ga0207682_10006237 3300025893 Bacteria 4818
504 Ga0207682_10095522 3300025893 Bacteria 1294
505 Ga0207642_10044161 3300025899 Bacteria 1971
506 Ga0207642_10136047 3300025899 Bacteria 1289
507 Ga0207688_10043780 3300025901 Bacteria 2494
508 Ga0207680_10001068 3300025903 Bacteria 12931
509 Ga0207680_10039848 3300025903 Bacteria 2729
510 Ga0207680_10056911 3300025903 Bacteria 2364
511 Ga0207680_10424525 3300025903 Bacteria 942
512 Ga0207645_10004706 3300025907 Bacteria 10041
513 Ga0207645_10014655 3300025907 Bacteria 5235
514 Ga0207645_10071087 3300025907 Bacteria 2227
515 Ga0207645_10094840 3300025907 Bacteria 1921
516 Ga0207645_10095900 3300025907 Bacteria 1910
517 Ga0207643_10017706 3300025908 Bacteria 3899
518 Ga0207643_10042663 3300025908 Bacteria 2558
519 Ga0207643_10080252 3300025908 Bacteria 1890
520 Ga0207684_10023176 3300025910 Bacteria 5302
521 Ga0207695_10002732 3300025913 Bacteria 25730
522 Ga0207695_10007216 3300025913 Bacteria 14208
523 Ga0207695_10082478 3300025913 Bacteria 3250
524 Ga0207695_10123453 3300025913 Bacteria 2555
525 Ga0207695_10178105 3300025913 Bacteria 2048
526 Ga0207695_10628475 3300025913 Bacteria 955
527 Ga0207671_10002693 3300025914 Bacteria 18627
528 Ga0207671_10061344 3300025914 Bacteria 2790
529 Ga0207671_10126738 3300025914 Bacteria 1956
530 Ga0207671_10214023 3300025914 Bacteria 1508
531 Ga0207662_10027183 3300025918 Bacteria 3303
532 Ga0207662_10199852 3300025918 Bacteria 1293
533 Ga0207657_10255358 3300025919 Bacteria 1396
534 Ga0207649_10324495 3300025920 Bacteria 1132
535 Ga0207681_10006325 3300025923 Bacteria 7268
536 Ga0207681_10079980 3300025923 Bacteria 2304
537 Ga0207681_10098926 3300025923 Bacteria 2099
538 Ga0207694_10000977 3300025924 Bacteria 25038
539 Ga0207694_10281387 3300025924 Bacteria 1366
540 Ga0207694_10349242 3300025924 Bacteria 1224
541 Ga0207650_10000710 3300025925 Bacteria 25994
542 Ga0207650_10009975 3300025925 Bacteria 6501
543 Ga0207650_10028205 3300025925 Bacteria 4023
544 Ga0207650_10046048 3300025925 Bacteria 3211
545 Ga0207650_10066503 3300025925 Bacteria 2703
546 Ga0207650_10067275 3300025925 Bacteria 2688
547 Ga0207650_10101393 3300025925 Bacteria 2216
548 Ga0207650_10164554 3300025925 Bacteria 1759
549 Ga0207659_10000322 3300025926 Bacteria 28877
550 Ga0207659_10008216 3300025926 Bacteria 6469
551 Ga0207659_10008726 3300025926 Bacteria 6309
552 Ga0207659_10015561 3300025926 Bacteria 4932
553 Ga0207659_10065728 3300025926 Bacteria 2629
554 Ga0207659_10165010 3300025926 Bacteria 1742
555 Ga0207659_10240214 3300025926 Bacteria 1465
556 Ga0207644_10001344 3300025931 Bacteria 15805
557 Ga0207644_10001677 3300025931 Bacteria 14280
558 Ga0207644_10032216 3300025931 Bacteria 3655
559 Ga0207644_10087523 3300025931 Bacteria 2315
560 Ga0207644_10104089 3300025931 Bacteria 2136
561 Ga0207644_10129888 3300025931 Bacteria 1927
562 Ga0207690_10313305 3300025932 Bacteria 1231
563 Ga0207706_10003941 3300025933 Bacteria 14064
564 Ga0207706_10102503 3300025933 Bacteria 2518
565 Ga0207706_10115153 3300025933 Bacteria 2364
566 Ga0207706_10348057 3300025933 Bacteria 1289
567 Ga0207709_10000602 3300025935 Bacteria 29841
568 Ga0207709_10022513 3300025935 Bacteria 3574
569 Ga0207709_10040350 3300025935 Bacteria 2795
570 Ga0207670_10011674 3300025936 Bacteria 5110
571 Ga0207670_10048461 3300025936 Bacteria 2835
572 Ga0207669_10003485 3300025937 Bacteria 6803
573 Ga0207669_10003984 3300025937 Bacteria 6454
574 Ga0207669_10343979 3300025937 Bacteria 1149
575 Ga0207691_10000018 3300025940 Bacteria 134343
576 Ga0207691_10012940 3300025940 Bacteria 7991
577 Ga0207691_10028725 3300025940 Bacteria 5204
578 Ga0207691_10182602 3300025940 Bacteria 1833
579 Ga0207691_10186128 3300025940 Bacteria 1813
580 Ga0207691_10214481 3300025940 Bacteria 1671
581 Ga0207691_10234077 3300025940 Bacteria 1590
582 Ga0207691_10270263 3300025940 Bacteria 1464
583 Ga0207691_10419650 3300025940 Bacteria 1140
584 Ga0207691_10446115 3300025940 Bacteria 1101
585 Ga0207711_10005256 3300025941 Bacteria 10975
586 Ga0207711_10042630 3300025941 Bacteria 3867
587 Ga0207711_10089412 3300025941 Bacteria 2706
588 Ga0207711_10211901 3300025941 Bacteria 1770
589 Ga0207711_10435873 3300025941 Bacteria 1219
590 Ga0207689_10006735 3300025942 Bacteria 10132
591 Ga0207689_10007284 3300025942 Bacteria 9712
592 Ga0207689_10061475 3300025942 Bacteria 3089
593 Ga0207689_10167766 3300025942 Bacteria 1809
594 Ga0207689_10367962 3300025942 Bacteria 1196
595 Ga0207689_10472244 3300025942 Bacteria 1050
596 Ga0207661_10192549 3300025944 Bacteria 1788
597 Ga0207679_10042747 3300025945 Bacteria 3259
598 Ga0207679_10065938 3300025945 Bacteria 2711
599 Ga0207679_10091344 3300025945 Bacteria 2356
600 Ga0207679_10132589 3300025945 Bacteria 2001
601 Ga0207667_10011582 3300025949 Bacteria 10240
602 Ga0207667_10016772 3300025949 Bacteria 8264
603 Ga0207667_10433859 3300025949 Bacteria 1336
604 Ga0207667_10644054 3300025949 Bacteria 1066
605 Ga0207651_10003638 3300025960 Bacteria 7603
606 Ga0207651_10037982 3300025960 Bacteria 3159
607 Ga0207651_10150357 3300025960 Bacteria 1811
608 Ga0207651_10192900 3300025960 Bacteria 1626
609 Ga0207712_10076268 3300025961 Bacteria 2426
610 Ga0207668_10020765 3300025972 Bacteria 4180
611 Ga0207668_10211799 3300025972 Bacteria 1550
612 Ga0207668_10287717 3300025972 Bacteria 1351
613 Ga0207640_10211336 3300025981 Bacteria 1478
614 Ga0207640_10234350 3300025981 Bacteria 1414
615 Ga0207640_10291698 3300025981 Bacteria 1286
616 Ga0207658_10006133 3300025986 Bacteria 8204
617 Ga0207658_10023598 3300025986 Bacteria 4295
618 Ga0207658_10032603 3300025986 Bacteria 3709
619 Ga0207658_10050765 3300025986 Bacteria 3054
620 Ga0207658_10118246 3300025986 Bacteria 2108
621 Ga0207658_10267976 3300025986 Bacteria 1458
622 Ga0207677_10004386 3300026023 Bacteria 7561
623 Ga0207677_10006410 3300026023 Bacteria 6452
624 Ga0207677_10006484 3300026023 Bacteria 6427
625 Ga0207677_10012052 3300026023 Bacteria 4952
626 Ga0207677_10195210 3300026023 Bacteria 1604
627 Ga0207677_10433020 3300026023 Bacteria 1123
628 Ga0207703_10000817 3300026035 Bacteria 30675
629 Ga0207703_10047463 3300026035 Bacteria 3463
630 Ga0207703_10085234 3300026035 Bacteria 2643
631 Ga0207639_10009051 3300026041 Bacteria 6860
632 Ga0207678_10048631 3300026067 Bacteria 3665
633 Ga0207641_10005073 3300026088 Bacteria 11290
634 Ga0207641_10049395 3300026088 Bacteria 3555
635 Ga0207641_10074666 3300026088 Bacteria 2925
636 Ga0207641_10083149 3300026088 Bacteria 2783
637 Ga0207641_10182140 3300026088 Bacteria 1925
638 Ga0207648_10000515 3300026089 Bacteria 43207
639 Ga0207648_10026670 3300026089 Bacteria 5132
640 Ga0207648_10032136 3300026089 Bacteria 4637
641 Ga0207648_10052000 3300026089 Bacteria 3581
642 Ga0207648_10077196 3300026089 Bacteria 2903
643 Ga0207648_10086284 3300026089 Bacteria 2738
644 Ga0207648_10124194 3300026089 Bacteria 2270
645 Ga0207648_10135345 3300026089 Bacteria 2170
646 Ga0207648_10148502 3300026089 Bacteria 2068
647 Ga0207648_10244922 3300026089 Bacteria 1597
648 Ga0207676_10001475 3300026095 Bacteria 17445
649 Ga0207676_10010532 3300026095 Bacteria 6588
650 Ga0207676_10011558 3300026095 Bacteria 6314
651 Ga0207676_10017436 3300026095 Bacteria 5203
652 Ga0207676_10019636 3300026095 Bacteria 4933
653 Ga0207676_10078691 3300026095 Bacteria 2671
654 Ga0207676_10112667 3300026095 Bacteria 2279
655 Ga0207676_10250526 3300026095 Bacteria 1594
656 Ga0207674_10012362 3300026116 Bacteria 9542
657 Ga0207674_10016088 3300026116 Bacteria 8193
658 Ga0207674_10050876 3300026116 Bacteria 4230
659 Ga0207674_10076115 3300026116 Bacteria 3365
660 Ga0207674_10202405 3300026116 Bacteria 1935
661 Ga0207674_10217177 3300026116 Bacteria 1860
662 Ga0207675_100004701 3300026118 Bacteria 13140
663 Ga0207675_100024107 3300026118 Bacteria 5657
664 Ga0207675_100030188 3300026118 Bacteria 5049
665 Ga0207675_100049796 3300026118 Bacteria 3909
666 Ga0207675_100057248 3300026118 Bacteria 3637
667 Ga0207675_100225865 3300026118 Bacteria 1805
668 Ga0207683_10000020 3300026121 Bacteria 118805
669 Ga0207683_10024111 3300026121 Bacteria 5236
670 Ga0207683_10044935 3300026121 Bacteria 3862
671 Ga0207683_10089845 3300026121 Bacteria 2734
672 Ga0207683_10104296 3300026121 Bacteria 2534
673 Ga0207683_10113807 3300026121 Bacteria 2424
674 Ga0207683_10219993 3300026121 Bacteria 1730
675 Ga0207683_10396596 3300026121 Bacteria 1269
676 Ga0207698_10007168 3300026142 Bacteria 6981
677 Ga0207698_10038539 3300026142 Bacteria 3532
678 Ga0207698_10146995 3300026142 Bacteria 2040
679 Ga0207698_10253160 3300026142 Bacteria 1613
680 Ga0209281_1000259 3300027111 Bacteria 101905
681 Ga0209970_1000196 3300027614 Bacteria 9671
682 Ga0209282_1000019 3300027666 Bacteria 184034
683 Ga0209282_1000139 3300027666 Bacteria 42847
684 Ga0209813_10024788 3300027866 Bacteria 1719
685 Ga0268266_10018522 3300028379 Bacteria 5933
686 Ga0268266_10024477 3300028379 Bacteria 5133
687 Ga0268266_10040123 3300028379 Bacteria 3989
688 Ga0268266_10271557 3300028379 Bacteria 1574
689 Ga0268265_10011207 3300028380 Bacteria 6060
690 Ga0268265_10029780 3300028380 Bacteria 3924
691 Ga0268265_10137561 3300028380 Bacteria 2040
692 Ga0268265_10298618 3300028380 Bacteria 1449
693 Ga0268264_10003598 3300028381 Bacteria 13341
694 Ga0268264_10052836 3300028381 Bacteria 3389
695 Ga0268264_10086924 3300028381 Bacteria 2687
696 Ga0307517_10002655 3300028786 Bacteria 28561
697 Ga0307515_10000138 3300028794 Bacteria 173220
698 Ga0307515_10000322 3300028794 Bacteria 118563
699 Ga0307515_10001193 3300028794 Bacteria 59425
700 Ga0307515_10002234 3300028794 Bacteria 42472
701 Ga0307515_10023840 3300028794 Bacteria 10697
702 Ga0307515_10041898 3300028794 Bacteria 7183
703 Ga0307515_10067248 3300028794 Bacteria 4946
704 Ga0307515_10094964 3300028794 Bacteria 3676
705 Ga0307515_10096814 3300028794 Bacteria 3614
706 Ga0307515_10135512 3300028794 Bacteria 2680
707 Ga0307515_10146542 3300028794 Bacteria 2496
708 Ga0307512_10066347 3300030522 Bacteria 2727
709 Ga0316176_1141751 3300030732 Bacteria 1968
710 Ga0314311_1073339 3300030733 Bacteria 2422
711 Ga0316179_1111618 3300030734 Bacteria 1462
712 Ga0316183_1025835 3300030742 Bacteria 2932
713 Ga0265330_10014274 3300031235 Bacteria 3687
714 Ga0265330_10047066 3300031235 Bacteria 1899
715 Ga0265332_10035841 3300031238 Bacteria 2154
716 Ga0265329_10011414 3300031242 Bacteria 3228
717 Ga0265331_10043380 3300031250 Bacteria 2179
718 Ga0265327_10003094 3300031251 Bacteria 16421
719 Ga0265327_10005552 3300031251 Bacteria 10473
720 Ga0265316_10199220 3300031344 Bacteria 1485
721 Ga0307513_10000013 3300031456 Bacteria 325682
722 Ga0307513_10000246 3300031456 Bacteria 78455
723 Ga0307513_10007912 3300031456 Bacteria 13688
724 Ga0307513_10027457 3300031456 Bacteria 6536
725 Ga0307513_10075694 3300031456 Bacteria 3494
726 Ga0307513_10104696 3300031456 Bacteria 2842
727 Ga0307513_10122436 3300031456 Bacteria 2565
728 Ga0307513_10270462 3300031456 Bacteria 1483
729 Ga0307513_10325978 3300031456 Bacteria 1292
730 Ga0307509_10007099 3300031507 Bacteria 14778
731 Ga0307509_10019271 3300031507 Bacteria 7789
732 Ga0307509_10033367 3300031507 Bacteria 5666
733 Ga0307509_10164667 3300031507 Bacteria 2108
734 Ga0307408_100000008 3300031548 Bacteria 456355
735 Ga0307408_100006968 3300031548 Bacteria 7479
736 Ga0307408_100054021 3300031548 Bacteria 2903
737 Ga0307408_100086583 3300031548 Bacteria 2355
738 Ga0307408_100111446 3300031548 Bacteria 2102
739 Ga0307408_100152716 3300031548 Bacteria 1824
740 Ga0307508_10000450 3300031616 Bacteria 49283
741 Ga0307508_10008054 3300031616 Bacteria 9770
742 Ga0307508_10055717 3300031616 Bacteria 3501
743 Ga0307514_10001030 3300031649 Bacteria 40201
744 Ga0307514_10004889 3300031649 Bacteria 12181
745 Ga0307514_10008692 3300031649 Bacteria 8613
746 Ga0307514_10009061 3300031649 Bacteria 8406
747 Ga0307514_10109370 3300031649 Bacteria 1963
748 Ga0307514_10156290 3300031649 Bacteria 1520
749 Ga0265314_10008574 3300031711 Bacteria 8741
750 Ga0265314_10038564 3300031711 Bacteria 3450
751 Ga0265342_10038530 3300031712 Bacteria 2910
752 Ga0307516_10008482 3300031730 Bacteria 11617
753 Ga0307516_10077658 3300031730 Bacteria 3168
754 Ga0307516_10353428 3300031730 Bacteria 1135
755 Ga0307405_10252917 3300031731 Bacteria 1312
756 Ga0307518_10244042 3300031838 Bacteria 1149
757 Ga0307518_10330066 3300031838 Bacteria 904
758 Ga0307406_10004336 3300031901 Bacteria 7719
759 Ga0307406_10012119 3300031901 Bacteria 4907
760 Ga0307412_10000392 3300031911 Bacteria 27005
761 Ga0307412_10008739 3300031911 Bacteria 5795
762 Ga0307412_10193682 3300031911 Bacteria 1538
763 Ga0307412_10357730 3300031911 Bacteria 1174
764 Ga0307412_10517187 3300031911 Bacteria 996
765 Ga0307414_10115733 3300032004 Bacteria 2051
766 Ga0307414_10293586 3300032004 Bacteria 1371
767 Ga0307411_10002080 3300032005 Bacteria 8618
768 Ga0307415_100694203 3300032126 Bacteria 918
769 Ga0307510_10034007 3300033180 Bacteria 5714
770 Ga0373936_0043270 3300035113 Bacteria 1810
771 Ga0373957_0028893 3300035120 Bacteria 2023
772 Ga0373955_0292472 3300035172 Bacteria 981
773 Ga0373931_0025968 3300035691 Bacteria 2976
774 Ga0373933_0190358 3300035724 Bacteria 1310
775 Ga0373937_0040657 3300036401 Bacteria 4239
776 Ga0373925_0461305 3300037068 Bacteria 1041
777 Ga0395905_0052780 3300037471 Bacteria 3805
778 Ga0395901_0111180 3300038443 Bacteria 2877
779 Ga0436360_1081132 3300039438 Bacteria 1138
780 Ga0436361_0032066 3300039447 Bacteria 3843
781 Ga0436361_0206607 3300039447 Bacteria 3756
782 Ga0436363_0171481 3300039450 Bacteria 1096
783 Ga0439439_0003401 3300041406 Bacteria 3510
784 Ga0439466_0002610 3300041411 Bacteria 7054
785 Ga0439466_0020082 3300041411 Bacteria 2386
786 Ga0451839_0601462 3300041496 Bacteria 870
787 Ga0439445_0001509 3300042004 Bacteria 5056
788 Ga0439432_002290 3300042006 Bacteria 7216
789 Ga0439449_0000753 3300042007 Bacteria 12445
790 Ga0439449_0004213 3300042007 Bacteria 5558
791 Ga0439452_002755 3300042010 Bacteria 6353
792 Ga0450923_031374 3300042125 Bacteria 1085
793 Ga0450898_003737 3300042134 Bacteria 2203
794 Ga0450909_011691 3300042185 Bacteria 1286
795 Ga0439434_0001757 3300042435 Bacteria 6291
796 Ga0450918_002439 3300042531 Bacteria 3517
797 Ga0466972_0000880 3300044658 Bacteria 14429
798 Ga0466965_0002203 3300044683 Bacteria 8200
799 Ga0466964_0007106 3300044706 Bacteria 4188
800 Ga0466964_0012803 3300044706 Bacteria 3177
801 Ga0453684_0391028 3300044712 Bacteria 1560
802 Ga0466968_0008025 3300044735 Bacteria 4035
803 Ga0451576_0019302 3300045051 Bacteria 7442
804 Ga0451576_0039018 3300045051 Bacteria 5026
805 Ga0495638_0077305 3300046460 Bacteria 2027
806 Ga0495585_0074205 3300046492 Bacteria 1851
807 Ga0495596_0000064 3300046500 Bacteria 77744
808 Ga0495607_0000507 3300046501 Bacteria 38608
809 Ga0495610_0001367 3300046512 Bacteria 21670
810 Ga0495610_0019846 3300046512 Bacteria 3748
811 Ga0495616_0000866 3300046513 Bacteria 21983
812 Ga0495620_0051816 3300046515 Bacteria 1745
813 Ga0495632_0112483 3300046519 Bacteria 1277
814 Ga0495637_0005420 3300046520 Bacteria 6507
815 Ga0495648_0110383 3300046524 Bacteria 1498
816 Ga0495642_0033322 3300046528 Bacteria 2071
817 Ga0495642_0057359 3300046528 Bacteria 1610
818 Ga0495654_0000834 3300046530 Bacteria 23400
819 Ga0495609_0000244 3300046538 Bacteria 51384
820 Ga0495656_0000365 3300046615 Bacteria 15165
821 Ga0495625_0010498 3300046660 Bacteria 7655
822 Ga0495661_0008722 3300046665 Bacteria 6997
823 Ga0495588_0097715 3300046674 Bacteria 1541
824 Ga0495671_0000453 3300046692 Bacteria 32377
825 Ga0495649_0004212 3300046694 Bacteria 9435
826 Ga0495660_0031902 3300046810 Bacteria 2960
827 Ga0495672_0032883 3300047320 Bacteria 3219
828 Ga0495676_0089794 3300047321 Bacteria 2301
829 Ga0495687_027112 3300047443 Bacteria 2685
830 Ga0495685_001488 3300047447 Bacteria 7169
831 Ga0495686_0241770 3300047472 Bacteria 1018
832 Ga0495593_0037115 3300047673 Bacteria 2638
833 Ga0495614_0107705 3300048089 Bacteria 1222
834 Ga0496101_0379158 3300048904 Bacteria 1113
835 Ga0496102_0206626 3300048905 Bacteria 1851
836 Ga0496103_0084378 3300048906 Bacteria 2001
837 Ga0496104_0032473 3300048907 Bacteria 4859
838 Ga0496105_0012904 3300048908 Bacteria 6622
839 Ga0496106_0284822 3300048909 Bacteria 1324
840 Ga0496108_0452077 3300048911 Bacteria 1122
841 Ga0496109_0058519 3300048912 Bacteria 3520
842 Ga0496110_0537597 3300048913 Bacteria 1063
843 Ga0496114_0186150 3300048917 Bacteria 1815
844 Ga0496115_0025937 3300048918 Bacteria 4568
845 Ga0496116_0001004 3300048919 Bacteria 34438
846 Ga0496116_0011864 3300048919 Bacteria 7170
847 Ga0496116_0013245 3300048919 Bacteria 6667
848 Ga0496116_0067024 3300048919 Bacteria 2294
849 Ga0496116_0081581 3300048919 Bacteria 2004
850 Ga0496116_0125457 3300048919 Bacteria 1475
851 Ga0496117_0068338 3300048920 Bacteria 2399
852 Ga0496118_0019857 3300048921 Bacteria 5988
853 Ga0496118_0053756 3300048921 Bacteria 3057
854 Ga0496118_0085109 3300048921 Bacteria 2203
855 Ga0496119_0003325 3300048922 Bacteria 16773
856 Ga0496120_0003204 3300048923 Bacteria 15214
857 Ga0496121_0001404 3300048924 Bacteria 40784
858 Ga0496121_0005640 3300048924 Bacteria 15922
859 Ga0496121_0143282 3300048924 Bacteria 1769
860 Ga0496121_0218094 3300048924 Bacteria 1346
861 Ga0496121_0232548 3300048924 Bacteria 1290
862 Ga0496122_0000029 3300048925 Bacteria 336396
863 Ga0496122_0000317 3300048925 Bacteria 105883
864 Ga0496122_0004249 3300048925 Bacteria 17968
865 Ga0496122_0004463 3300048925 Bacteria 17342
866 Ga0496123_0000124 3300048926 Bacteria 158327
867 Ga0496123_0000531 3300048926 Bacteria 65624
868 Ga0496123_0001487 3300048926 Bacteria 32545
869 Ga0496123_0001761 3300048926 Bacteria 28565
870 Ga0496123_0003891 3300048926 Bacteria 16246
871 Ga0496124_0000024 3300048927 Bacteria 414291
872 Ga0496124_0004949 3300048927 Bacteria 15271
873 Ga0496124_0034977 3300048927 Bacteria 4399
874 Ga0496124_0122058 3300048927 Bacteria 2080
875 Ga0496124_0149259 3300048927 Bacteria 1836
876 Ga0496124_0223673 3300048927 Bacteria 1413
877 Ga0496125_0000244 3300048928 Bacteria 111663
878 Ga0496125_0015625 3300048928 Bacteria 7326
879 Ga0496125_0030924 3300048928 Bacteria 4779
880 Ga0496126_0043446 3300048929 Bacteria 4146
881 Ga0495682_0000003 3300049460 Bacteria 515787
882 Ga0501048_0160292 3300049582 Bacteria 1592
883 nmdc:mga00v17_56590_c1 3300050491 Bacteria 2398
884 nmdc:mga0yw44_243798_c1 3300050492 Bacteria 1195
885 nmdc:mga0k408_247959_c1 3300050493 Bacteria 1063
886 nmdc:mga0k408_254840_c1 3300050493 Bacteria 1048
887 nmdc:mga0k408_26319_c1 3300050493 Bacteria 3298
888 nmdc:mga0k408_4891_c2 3300050493 Bacteria 4094
889 nmdc:mga0k408_7822_c1 3300050493 Bacteria 5715
890 nmdc:mga07m45_10453_c1 3300050496 Bacteria 4848
891 nmdc:mga07m45_122_c1 3300050496 Bacteria 24374
892 nmdc:mga07m45_15544_c1 3300050496 Bacteria 4064
893 nmdc:mga07m45_196634_c1 3300050496 Bacteria 1173
894 nmdc:mga07m45_4239_c1 3300050496 Bacteria 7019
895 nmdc:mga07m45_93670_c1 3300050496 Bacteria 1722
896 nmdc:mga05p37_92917_c1 3300050507 Bacteria 3718
897 nmdc:mga09592_68309_c1 3300050508 Bacteria 3014
898 nmdc:mga09592_70483_c1 3300050508 Bacteria 2966
899 nmdc:mga0qj67_99755_c1 3300050509 Bacteria 2340
900 nmdc:mga06r32_51310_c1 3300050510 Bacteria 3947
901 nmdc:mga06r32_752362_c1 3300050510 Bacteria 938
902 nmdc:mga0sz30_123992_c1 3300050516 Bacteria 1136
903 nmdc:mga0sz30_147099_c1 3300050516 Bacteria 1041
904 nmdc:mga0sz30_15597_c1 3300050516 Bacteria 2709
905 Ga0495601_0156569 3300053077 Bacteria 1488
906 Ga0500610_0003992 3300053079 Bacteria 5774
907 Ga0500644_0000575 3300053088 Bacteria 14233
908 Ga0500571_006720 3300053110 Bacteria 6233
909 Ga0500593_000414 3300053117 Bacteria 16854
910 Ga0500593_003241 3300053117 Bacteria 6120
911 Ga0500594_0017153 3300053118 Bacteria 1768
912 Ga0500595_000002 3300053119 Bacteria 1074388
913 Ga0500618_002619 3300053125 Bacteria 6628
914 Ga0500658_0002081 3300053134 Bacteria 7784
915 Ga0500559_0000047 3300053136 Bacteria 95447
916 Ga0500568_0061648 3300053139 Bacteria 1450
917 Ga0500574_011876 3300053141 Bacteria 1978
918 Ga0500616_0000002 3300053153 Bacteria 1611257
919 Ga0500619_000077 3300053154 Bacteria 27224
920 Ga0500634_0013275 3300053161 Bacteria 4317
921 Ga0500636_0083949 3300053177 Bacteria 1832
922 Ga0500587_002315 3300053739 Bacteria 2709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0160292 Ga0501048_0160292_132_902 254
2 3300053161 Ga0500634_0013275 Ga0500634_0013275_1016_1795 254
3 iso_pu_bacteria 2842733646 2842737764 255
4 3300009176 Ga0105242_10448469 Ga0105242_104484692 256
5 3300049460 Ga0495682_0000003 Ga0495682_0000003_357529_358308 257
6 3300006846 Ga0075430_100109091 Ga0075430_1001090912 258
7 3300006847 Ga0075431_100052328 Ga0075431_1000523283 258
8 3300006880 Ga0075429_100193894 Ga0075429_1001938942 258
9 3300038443 Ga0395901_0111180 Ga0395901_0111180_1466_2299 258
10 3300050507 nmdc:mga05p37_92917_c1 nmdc:mga05p37_92917_c1_978_1811 258
11 3300050508 nmdc:mga09592_68309_c1 nmdc:mga09592_68309_c1_1220_2053 258
12 3300050510 nmdc:mga06r32_752362_c1 nmdc:mga06r32_752362_c1_61_894 258
13 3300046500 Ga0495596_0000064 Ga0495596_0000064_35797_36576 259
14 3300045051 Ga0451576_0039018 Ga0451576_0039018_986_1789 260
15 iso_pu_bacteria 2904449895 2904453000 260
16 iso_pu_bacteria 2904456579 2904459962 260
17 iso_pu_bacteria 2929520902 2929525959 260
18 3300025918 Ga0207662_10199852 Ga0207662_101998522 261
19 3300031235 Ga0265330_10047066 Ga0265330_100470662 263
20 iso_pu_bacteria 2521172590 2521557336 263
21 iso_pu_bacteria 2945972063 2945974136 263
22 3300003794 Ga0055531_10001116 Ga0055531_1000111617 264
23 3300005289 Ga0065704_10000444 Ga0065704_1000044436 264
24 3300005440 Ga0070705_100361539 Ga0070705_1003615391 264
25 3300005445 Ga0070708_100458382 Ga0070708_1004583822 264
26 3300005546 Ga0070696_100061266 Ga0070696_1000612663 264
27 3300009036 Ga0105244_10000031 Ga0105244_1000003147 264
28 3300013104 Ga0157370_10002003 Ga0157370_100020033 264
29 3300025303 Ga0209051_1000025 Ga0209051_1000025211 264
30 3300025304 Ga0209257_1000039 Ga0209257_1000039397 264
31 3300025728 Ga0207655_1000029 Ga0207655_1000029123 264
32 3300006186 Ga0075369_10205939 Ga0075369_102059391 265
33 3300010375 Ga0105239_10709275 Ga0105239_107092751 265
34 3300026095 Ga0207676_10250526 Ga0207676_102505262 265
35 3300041496 Ga0451839_0601462 Ga0451839_0601462_19_816 265
36 3300046528 Ga0495642_0033322 Ga0495642_0033322_773_1576 265
37 3300047443 Ga0495687_027112 Ga0495687_027112_272_1075 265
38 3300048918 Ga0496115_0025937 Ga0496115_0025937_1822_2658 265
39 3300048920 Ga0496117_0068338 Ga0496117_0068338_260_1081 265
40 3300053088 Ga0500644_0000575 Ga0500644_0000575_8227_9060 265
41 3300053119 Ga0500595_000002 Ga0500595_000002_810574_811407 265
42 3300053153 Ga0500616_0000002 Ga0500616_0000002_859459_860292 265
43 3300037471 Ga0395905_0052780 Ga0395905_0052780_2862_3671 266
44 3300048919 Ga0496116_0001004 Ga0496116_0001004_32448_33269 266
45 3300053077 Ga0495601_0156569 Ga0495601_0156569_641_1450 266
46 3300053154 Ga0500619_000077 Ga0500619_000077_11983_12786 266
47 iso_pu_bacteria 2551306416 2553005314 266
48 iso_pu_bacteria 2765235838 2765568462 266
49 iso_pu_bacteria 2818991449 2819617670 266
50 iso_pu_bacteria 2839094727 2839095299 266
51 iso_pu_bacteria 2904439833 2904439929 266
52 iso_pu_bacteria 2904530477 2904531126 266
53 iso_pu_bacteria 2904584206 2904587229 266
54 iso_pu_bacteria 2904589729 2904592736 266
55 iso_pu_bacteria 2904601388 2904604481 266
56 iso_pu_bacteria 2919046199 2919050246 266
57 iso_pu_bacteria 2919079590 2919082303 266
58 iso_pu_bacteria 2923510766 2923515996 266
59 3300006186 Ga0075369_10009596 Ga0075369_100095966 267
60 3300006353 Ga0075370_10063075 Ga0075370_100630752 267
61 3300006846 Ga0075430_100034456 Ga0075430_1000344563 267
62 3300006847 Ga0075431_100034361 Ga0075431_1000343614 267
63 3300006880 Ga0075429_100029093 Ga0075429_1000290934 267
64 3300014497 Ga0182008_10024475 Ga0182008_100244752 267
65 3300014497 Ga0182008_10037502 Ga0182008_100375024 267
66 3300025303 Ga0209051_1000530 Ga0209051_100053015 267
67 3300025923 Ga0207681_10098926 Ga0207681_100989263 267
68 3300028794 Ga0307515_10096814 Ga0307515_100968142 267
69 3300031456 Ga0307513_10122436 Ga0307513_101224362 267
70 3300031548 Ga0307408_100006968 Ga0307408_1000069682 267
71 3300031649 Ga0307514_10009061 Ga0307514_100090615 267
72 3300031901 Ga0307406_10004336 Ga0307406_100043367 267
73 3300041411 Ga0439466_0020082 Ga0439466_0020082_537_1379 267
74 3300048925 Ga0496122_0000317 Ga0496122_0000317_92799_93641 267
75 3300048926 Ga0496123_0001487 Ga0496123_0001487_9906_10748 267
76 3300048927 Ga0496124_0034977 Ga0496124_0034977_1790_2632 267
77 3300050492 nmdc:mga0yw44_243798_c1 nmdc:mga0yw44_243798_c1_103_945 267
78 3300050508 nmdc:mga09592_70483_c1 nmdc:mga09592_70483_c1_1099_1914 267
79 3300050509 nmdc:mga0qj67_99755_c1 nmdc:mga0qj67_99755_c1_26_841 267
80 3300050510 nmdc:mga06r32_51310_c1 nmdc:mga06r32_51310_c1_380_1195 267
81 3300050516 nmdc:mga0sz30_123992_c1 nmdc:mga0sz30_123992_c1_95_937 267
82 3300005347 Ga0070668_100133019 Ga0070668_1001330192 268
83 3300005459 Ga0068867_100008620 Ga0068867_1000086205 268
84 3300005842 Ga0068858_100252112 Ga0068858_1002521121 268
85 3300006881 Ga0068865_100006221 Ga0068865_1000062214 268
86 3300017792 Ga0163161_10032312 Ga0163161_100323124 268
87 3300025899 Ga0207642_10044161 Ga0207642_100441612 268
88 3300025940 Ga0207691_10012940 Ga0207691_100129407 268
89 3300026035 Ga0207703_10047463 Ga0207703_100474633 268
90 3300026142 Ga0207698_10253160 Ga0207698_102531602 268
91 3300048906 Ga0496103_0084378 Ga0496103_0084378_528_1346 268
92 3300048912 Ga0496109_0058519 Ga0496109_0058519_921_1739 268
93 3300048913 Ga0496110_0537597 Ga0496110_0537597_118_936 268
94 iso_pu_bacteria 2511231003 2511250033 268
95 iso_pu_bacteria 2599185292 2599906620 268
96 iso_pu_bacteria 2643221569 2643860823 268
97 iso_pu_bacteria 2643221594 2643981333 268
98 iso_pu_bacteria 2643221621 2644124117 268
99 iso_pu_bacteria 2808606395 2809035250 268
100 iso_pu_bacteria 2818991445 2819592017 268
101 iso_pu_bacteria 2857537821 2857542285 268
102 iso_pu_bacteria 2857542790 2857545049 268
103 iso_pu_bacteria 2858950400 2858953573 268
104 iso_pu_bacteria 2884811622 2884814033 268
105 iso_pu_bacteria 2884836552 2884840567 268
106 iso_pu_bacteria 2884852848 2884855824 268
107 iso_pu_bacteria 2896154374 2896157251 268
108 iso_pu_bacteria 2941479691 2941484660 268
109 3300003323 rootH1_10005172 rootH1_100051721 269
110 3300005459 Ga0068867_100001043 Ga0068867_10000104312 269
111 3300005543 Ga0070672_100010312 Ga0070672_1000103121 269
112 3300005615 Ga0070702_100199324 Ga0070702_1001993242 269
113 3300005616 Ga0068852_100209190 Ga0068852_1002091903 269
114 3300005617 Ga0068859_100473170 Ga0068859_1004731701 269
115 3300005841 Ga0068863_100152743 Ga0068863_1001527432 269
116 3300005842 Ga0068858_100325491 Ga0068858_1003254912 269
117 3300005843 Ga0068860_100008382 Ga0068860_1000083826 269
118 3300005844 Ga0068862_100145352 Ga0068862_1001453522 269
119 3300005844 Ga0068862_100634976 Ga0068862_1006349761 269
120 3300006195 Ga0075366_10002787 Ga0075366_100027878 269
121 3300006931 Ga0097620_100473176 Ga0097620_1004731761 269
122 3300009148 Ga0105243_10000765 Ga0105243_1000076512 269
123 3300009553 Ga0105249_10086300 Ga0105249_100863003 269
124 3300011119 Ga0105246_10165345 Ga0105246_101653452 269
125 3300013297 Ga0157378_10040681 Ga0157378_100406813 269
126 3300013306 Ga0163162_10047977 Ga0163162_100479775 269
127 3300013308 Ga0157375_10049483 Ga0157375_100494832 269
128 3300014326 Ga0157380_10009058 Ga0157380_100090582 269
129 3300014745 Ga0157377_10000016 Ga0157377_10000016149 269
130 3300014968 Ga0157379_10049079 Ga0157379_100490792 269
131 3300025923 Ga0207681_10079980 Ga0207681_100799802 269
132 3300025935 Ga0207709_10000602 Ga0207709_1000060212 269
133 3300025961 Ga0207712_10076268 Ga0207712_100762682 269
134 3300026035 Ga0207703_10085234 Ga0207703_100852342 269
135 3300026088 Ga0207641_10182140 Ga0207641_101821402 269
136 3300026089 Ga0207648_10000515 Ga0207648_1000051512 269
137 3300026118 Ga0207675_100004701 Ga0207675_1000047019 269
138 3300026142 Ga0207698_10146995 Ga0207698_101469952 269
139 3300028380 Ga0268265_10029780 Ga0268265_100297802 269
140 3300028381 Ga0268264_10003598 Ga0268264_100035984 269
141 3300044712 Ga0453684_0391028 Ga0453684_0391028_70_900 269
142 3300050493 nmdc:mga0k408_26319_c1 nmdc:mga0k408_26319_c1_1150_1989 269
143 iso_pu_bacteria 2585428062 2587759442 269
144 iso_pu_bacteria 2643221585 2643936098 269
145 iso_pu_bacteria 2643221609 2644060571 269
146 iso_pu_bacteria 2643221611 2644073899 269
147 iso_pu_bacteria 2643221639 2644221861 269
148 iso_pu_bacteria 2643221646 2644257345 269
149 iso_pu_bacteria 2643221656 2644316743 269
150 iso_pu_bacteria 2738543012 2739242601 269
151 iso_pu_bacteria 2816332133 2816473078 269
152 iso_pu_bacteria 2842747753 2842750713 269
153 iso_pu_bacteria 2855730933 2855731335 269
154 iso_pu_bacteria 2855767633 2855768041 269
155 iso_pu_bacteria 2857576091 2857577018 269
156 iso_pu_bacteria 2881412998 2881413781 269
157 iso_pu_bacteria 2904479285 2904482326 269
158 iso_pu_bacteria 2919704043 2919706843 269
159 iso_pu_bacteria 2928115317 2928118845 269
160 iso_pu_bacteria 8003400568 8003405435 269
161 3300003751 Ga0055538_1000013 Ga0055538_100001382 270
162 3300003752 Ga0055539_1000018 Ga0055539_100001882 270
163 3300003756 Ga0055533_1000022 Ga0055533_100002282 270
164 3300003759 Ga0055525_1000024 Ga0055525_100002482 270
165 3300003841 Ga0055541_1000013 Ga0055541_100001382 270
166 3300005367 Ga0070667_100063129 Ga0070667_1000631292 270
167 3300005563 Ga0068855_100011166 Ga0068855_1000111664 270
168 3300005577 Ga0068857_100159525 Ga0068857_1001595252 270
169 3300005578 Ga0068854_100052677 Ga0068854_1000526772 270
170 3300009545 Ga0105237_10103567 Ga0105237_101035672 270
171 3300009551 Ga0105238_10000065 Ga0105238_1000006511 270
172 3300010375 Ga0105239_10054735 Ga0105239_100547354 270
173 3300015261 Ga0182006_1002966 Ga0182006_10029662 270
174 3300021361 Ga0213872_10016125 Ga0213872_100161254 270
175 3300025224 Ga0209784_100005 Ga0209784_100005640 270
176 3300025225 Ga0209566_100005 Ga0209566_100005640 270
177 3300025226 Ga0209674_100009 Ga0209674_100009640 270
178 3300025230 Ga0209563_100012 Ga0209563_100012640 270
179 3300025253 Ga0209677_100006 Ga0209677_100006640 270
180 3300025913 Ga0207695_10002732 Ga0207695_100027327 270
181 3300025914 Ga0207671_10002693 Ga0207671_100026935 270
182 3300025924 Ga0207694_10000977 Ga0207694_1000097712 270
183 3300025949 Ga0207667_10016772 Ga0207667_100167722 270
184 3300025981 Ga0207640_10291698 Ga0207640_102916981 270
185 3300026116 Ga0207674_10076115 Ga0207674_100761153 270
186 3300039447 Ga0436361_0032066 Ga0436361_0032066_1515_2372 270
187 3300039447 Ga0436361_0206607 Ga0436361_0206607_280_1137 270
188 3300046492 Ga0495585_0074205 Ga0495585_0074205_814_1626 270
189 3300048919 Ga0496116_0011864 Ga0496116_0011864_376_1233 270
190 3300044658 Ga0466972_0000880 Ga0466972_0000880_8158_8976 271
191 3300044683 Ga0466965_0002203 Ga0466965_0002203_7126_7944 271
192 3300044706 Ga0466964_0007106 Ga0466964_0007106_3140_3958 271
193 3300044706 Ga0466964_0012803 Ga0466964_0012803_694_1512 271
194 3300044735 Ga0466968_0008025 Ga0466968_0008025_3020_3838 271
195 3300050493 nmdc:mga0k408_4891_c2 nmdc:mga0k408_4891_c2_380_1198 271
196 3300002704 JGI25155J39150_1000651 JGI25155J39150_10006511 272
197 3300002704 JGI25155J39150_1001094 JGI25155J39150_10010941 272
198 3300002705 JGI25156J39149_1000170 JGI25156J39149_10001702 272
199 3300002705 JGI25156J39149_1001869 JGI25156J39149_10018696 272
200 3300002705 JGI25156J39149_1007194 JGI25156J39149_10071942 272
201 3300002737 JGI25162J39368_1003814 JGI25162J39368_10038143 272
202 3300002738 JGI25154J39366_1000306 JGI25154J39366_10003062 272
203 3300002738 JGI25154J39366_1000455 JGI25154J39366_100045516 272
204 3300002741 JGI25157J39369_1000170 JGI25157J39369_100017011 272
205 3300003758 Ga0055532_1000017 Ga0055532_1000017113 272
206 3300003761 Ga0055535_1005719 Ga0055535_10057193 272
207 3300003775 Ga0055524_1000052 Ga0055524_100005269 272
208 3300003791 Ga0055530_10004911 Ga0055530_100049116 272
209 3300003792 Ga0055540_1000123 Ga0055540_100012367 272
210 3300003794 Ga0055531_10016084 Ga0055531_100160844 272
211 3300005293 Ga0065715_10020215 Ga0065715_100202153 272
212 3300005293 Ga0065715_10035108 Ga0065715_100351082 272
213 3300005328 Ga0070676_10002668 Ga0070676_1000266812 272
214 3300005330 Ga0070690_100031929 Ga0070690_1000319293 272
215 3300005331 Ga0070670_100014554 Ga0070670_1000145544 272
216 3300005333 Ga0070677_10010076 Ga0070677_100100762 272
217 3300005334 Ga0068869_100041131 Ga0068869_1000411313 272
218 3300005334 Ga0068869_100402150 Ga0068869_1004021502 272
219 3300005335 Ga0070666_10000758 Ga0070666_1000075816 272
220 3300005335 Ga0070666_10002174 Ga0070666_100021746 272
221 3300005338 Ga0068868_100001290 Ga0068868_1000012906 272
222 3300005338 Ga0068868_100011821 Ga0068868_1000118213 272
223 3300005338 Ga0068868_100100646 Ga0068868_1001006462 272
224 3300005340 Ga0070689_100008704 Ga0070689_1000087045 272
225 3300005340 Ga0070689_100186212 Ga0070689_1001862122 272
226 3300005343 Ga0070687_100192273 Ga0070687_1001922732 272
227 3300005344 Ga0070661_100345298 Ga0070661_1003452981 272
228 3300005347 Ga0070668_100003834 Ga0070668_10000383414 272
229 3300005347 Ga0070668_100036636 Ga0070668_1000366365 272
230 3300005347 Ga0070668_100510634 Ga0070668_1005106341 272
231 3300005354 Ga0070675_100001026 Ga0070675_1000010267 272
232 3300005354 Ga0070675_100011870 Ga0070675_1000118704 272
233 3300005354 Ga0070675_100022217 Ga0070675_1000222172 272
234 3300005354 Ga0070675_100060263 Ga0070675_1000602635 272
235 3300005355 Ga0070671_100010647 Ga0070671_1000106476 272
236 3300005355 Ga0070671_100067899 Ga0070671_1000678993 272
237 3300005355 Ga0070671_100079613 Ga0070671_1000796133 272
238 3300005355 Ga0070671_100220387 Ga0070671_1002203872 272
239 3300005356 Ga0070674_100000094 Ga0070674_10000009436 272
240 3300005356 Ga0070674_100017248 Ga0070674_1000172483 272
241 3300005356 Ga0070674_100064418 Ga0070674_1000644183 272
242 3300005364 Ga0070673_100000679 Ga0070673_10000067912 272
243 3300005364 Ga0070673_100000753 Ga0070673_10000075320 272
244 3300005364 Ga0070673_100056321 Ga0070673_1000563213 272
245 3300005365 Ga0070688_100027851 Ga0070688_1000278515 272
246 3300005367 Ga0070667_100001746 Ga0070667_10000174614 272
247 3300005367 Ga0070667_100009087 Ga0070667_1000090878 272
248 3300005367 Ga0070667_100059026 Ga0070667_1000590263 272
249 3300005367 Ga0070667_100153304 Ga0070667_1001533042 272
250 3300005367 Ga0070667_100201356 Ga0070667_1002013561 272
251 3300005367 Ga0070667_100580873 Ga0070667_1005808731 272
252 3300005455 Ga0070663_100010261 Ga0070663_1000102613 272
253 3300005456 Ga0070678_100000409 Ga0070678_10000040919 272
254 3300005456 Ga0070678_100015011 Ga0070678_1000150113 272
255 3300005456 Ga0070678_100022737 Ga0070678_1000227374 272
256 3300005456 Ga0070678_100213423 Ga0070678_1002134232 272
257 3300005457 Ga0070662_100004880 Ga0070662_1000048806 272
258 3300005457 Ga0070662_100036562 Ga0070662_1000365625 272
259 3300005459 Ga0068867_100017264 Ga0068867_1000172643 272
260 3300005459 Ga0068867_100069565 Ga0068867_1000695653 272
261 3300005543 Ga0070672_100000552 Ga0070672_10000055217 272
262 3300005543 Ga0070672_100047920 Ga0070672_1000479205 272
263 3300005543 Ga0070672_100056675 Ga0070672_1000566752 272
264 3300005543 Ga0070672_100200596 Ga0070672_1002005962 272
265 3300005548 Ga0070665_100002419 Ga0070665_10000241914 272
266 3300005548 Ga0070665_100004291 Ga0070665_1000042917 272
267 3300005548 Ga0070665_100243262 Ga0070665_1002432621 272
268 3300005563 Ga0068855_100068193 Ga0068855_1000681933 272
269 3300005564 Ga0070664_100175452 Ga0070664_1001754522 272
270 3300005614 Ga0068856_100151917 Ga0068856_1001519173 272
271 3300005615 Ga0070702_100059433 Ga0070702_1000594332 272
272 3300005615 Ga0070702_100309120 Ga0070702_1003091201 272
273 3300005616 Ga0068852_100027996 Ga0068852_1000279964 272
274 3300005616 Ga0068852_100042319 Ga0068852_1000423192 272
275 3300005617 Ga0068859_100023045 Ga0068859_1000230455 272
276 3300005617 Ga0068859_100121412 Ga0068859_1001214122 272
277 3300005618 Ga0068864_100000845 Ga0068864_10000084511 272
278 3300005618 Ga0068864_100024185 Ga0068864_1000241853 272
279 3300005618 Ga0068864_100071385 Ga0068864_1000713853 272
280 3300005618 Ga0068864_100078936 Ga0068864_1000789364 272
281 3300005719 Ga0068861_100393112 Ga0068861_1003931122 272
282 3300005719 Ga0068861_100460110 Ga0068861_1004601102 272
283 3300005834 Ga0068851_10000843 Ga0068851_1000084310 272
284 3300005840 Ga0068870_10065494 Ga0068870_100654942 272
285 3300005841 Ga0068863_100002048 Ga0068863_1000020488 272
286 3300005841 Ga0068863_100071222 Ga0068863_1000712224 272
287 3300005841 Ga0068863_100107675 Ga0068863_1001076753 272
288 3300005841 Ga0068863_100119529 Ga0068863_1001195293 272
289 3300005841 Ga0068863_100154405 Ga0068863_1001544052 272
290 3300005842 Ga0068858_100002570 Ga0068858_10000257012 272
291 3300005842 Ga0068858_100266980 Ga0068858_1002669803 272
292 3300005843 Ga0068860_100012965 Ga0068860_1000129655 272
293 3300005843 Ga0068860_100057346 Ga0068860_1000573463 272
294 3300005843 Ga0068860_100075322 Ga0068860_1000753223 272
295 3300005844 Ga0068862_100154254 Ga0068862_1001542542 272
296 3300005844 Ga0068862_100173498 Ga0068862_1001734982 272
297 3300006051 Ga0075364_10161447 Ga0075364_101614473 272
298 3300006051 Ga0075364_10302949 Ga0075364_103029492 272
299 3300006237 Ga0097621_100007338 Ga0097621_1000073389 272
300 3300006237 Ga0097621_100037524 Ga0097621_1000375243 272
301 3300006237 Ga0097621_100404665 Ga0097621_1004046652 272
302 3300006237 Ga0097621_100558114 Ga0097621_1005581141 272
303 3300006358 Ga0068871_100064731 Ga0068871_1000647314 272
304 3300006358 Ga0068871_100230418 Ga0068871_1002304182 272
305 3300006844 Ga0075428_100101687 Ga0075428_1001016875 272
306 3300006881 Ga0068865_100022991 Ga0068865_1000229912 272
307 3300006881 Ga0068865_100114232 Ga0068865_1001142322 272
308 3300006881 Ga0068865_100426501 Ga0068865_1004265012 272
309 3300006931 Ga0097620_100023045 Ga0097620_1000230453 272
310 3300006931 Ga0097620_100121412 Ga0097620_1001214122 272
311 3300006946 Ga0079104_1000206 Ga0079104_100020659 272
312 3300009011 Ga0105251_10159709 Ga0105251_101597092 272
313 3300009093 Ga0105240_10008920 Ga0105240_1000892010 272
314 3300009093 Ga0105240_10059308 Ga0105240_100593084 272
315 3300009094 Ga0111539_10058487 Ga0111539_100584876 272
316 3300009101 Ga0105247_10353938 Ga0105247_103539382 272
317 3300009148 Ga0105243_10024959 Ga0105243_100249593 272
318 3300009176 Ga0105242_10090130 Ga0105242_100901302 272
319 3300009177 Ga0105248_10086277 Ga0105248_100862773 272
320 3300009177 Ga0105248_10119263 Ga0105248_101192633 272
321 3300009177 Ga0105248_10268583 Ga0105248_102685833 272
322 3300009177 Ga0105248_10285586 Ga0105248_102855863 272
323 3300009545 Ga0105237_10175171 Ga0105237_101751712 272
324 3300009551 Ga0105238_10063764 Ga0105238_100637643 272
325 3300009553 Ga0105249_10091395 Ga0105249_100913953 272
326 3300013296 Ga0157374_10110971 Ga0157374_101109712 272
327 3300013296 Ga0157374_10146904 Ga0157374_101469043 272
328 3300013296 Ga0157374_10446048 Ga0157374_104460482 272
329 3300013297 Ga0157378_10070198 Ga0157378_100701983 272
330 3300013297 Ga0157378_10240961 Ga0157378_102409613 272
331 3300013306 Ga0163162_10077315 Ga0163162_100773153 272
332 3300013306 Ga0163162_10122403 Ga0163162_101224032 272
333 3300013306 Ga0163162_10221744 Ga0163162_102217441 272
334 3300013306 Ga0163162_10599824 Ga0163162_105998242 272
335 3300013308 Ga0157375_10011762 Ga0157375_100117623 272
336 3300013308 Ga0157375_10219009 Ga0157375_102190093 272
337 3300013308 Ga0157375_10233301 Ga0157375_102333012 272
338 3300014325 Ga0163163_10218492 Ga0163163_102184923 272
339 3300014968 Ga0157379_10008726 Ga0157379_100087266 272
340 3300014968 Ga0157379_10048728 Ga0157379_100487282 272
341 3300014968 Ga0157379_10281376 Ga0157379_102813761 272
342 3300014969 Ga0157376_10106693 Ga0157376_101066933 272
343 3300014969 Ga0157376_10328135 Ga0157376_103281352 272
344 3300017792 Ga0163161_10040898 Ga0163161_100408984 272
345 3300017792 Ga0163161_10141036 Ga0163161_101410361 272
346 3300017792 Ga0163161_10233374 Ga0163161_102333742 272
347 3300017792 Ga0163161_10272017 Ga0163161_102720171 272
348 3300025206 Ga0209435_100015 Ga0209435_100015127 272
349 3300025206 Ga0209435_100290 Ga0209435_1002906 272
350 3300025229 Ga0209147_100004 Ga0209147_1000041099 272
351 3300025233 Ga0209437_100758 Ga0209437_1007588 272
352 3300025242 Ga0209258_100226 Ga0209258_10022688 272
353 3300025246 Ga0209646_1000020 Ga0209646_1000020108 272
354 3300025246 Ga0209646_1000040 Ga0209646_1000040157 272
355 3300025250 Ga0209026_1000034 Ga0209026_1000034162 272
356 3300025250 Ga0209026_1003765 Ga0209026_10037651 272
357 3300025256 Ga0209759_1000049 Ga0209759_100004941 272
358 3300025256 Ga0209759_1000357 Ga0209759_100035711 272
359 3300025263 Ga0209565_1016361 Ga0209565_10163612 272
360 3300025291 Ga0209675_1016325 Ga0209675_10163253 272
361 3300025292 Ga0209676_1011949 Ga0209676_10119493 272
362 3300025298 Ga0209050_1000760 Ga0209050_100076036 272
363 3300025298 Ga0209050_1041968 Ga0209050_10419682 272
364 3300025299 Ga0209256_1000036 Ga0209256_1000036199 272
365 3300025303 Ga0209051_1000068 Ga0209051_100006812 272
366 3300025303 Ga0209051_1008921 Ga0209051_10089215 272
367 3300025304 Ga0209257_1003725 Ga0209257_10037253 272
368 3300025315 Ga0207697_10020918 Ga0207697_100209183 272
369 3300025893 Ga0207682_10001047 Ga0207682_100010473 272
370 3300025893 Ga0207682_10006237 Ga0207682_100062373 272
371 3300025893 Ga0207682_10095522 Ga0207682_100955222 272
372 3300025899 Ga0207642_10136047 Ga0207642_101360471 272
373 3300025903 Ga0207680_10001068 Ga0207680_100010687 272
374 3300025903 Ga0207680_10039848 Ga0207680_100398483 272
375 3300025903 Ga0207680_10424525 Ga0207680_104245252 272
376 3300025907 Ga0207645_10004706 Ga0207645_100047063 272
377 3300025907 Ga0207645_10014655 Ga0207645_100146552 272
378 3300025908 Ga0207643_10017706 Ga0207643_100177065 272
379 3300025908 Ga0207643_10080252 Ga0207643_100802522 272
380 3300025913 Ga0207695_10007216 Ga0207695_100072165 272
381 3300025913 Ga0207695_10082478 Ga0207695_100824782 272
382 3300025914 Ga0207671_10214023 Ga0207671_102140232 272
383 3300025918 Ga0207662_10027183 Ga0207662_100271832 272
384 3300025919 Ga0207657_10255358 Ga0207657_102553582 272
385 3300025924 Ga0207694_10349242 Ga0207694_103492421 272
386 3300025925 Ga0207650_10009975 Ga0207650_100099755 272
387 3300025925 Ga0207650_10101393 Ga0207650_101013933 272
388 3300025926 Ga0207659_10000322 Ga0207659_1000032215 272
389 3300025926 Ga0207659_10008726 Ga0207659_100087264 272
390 3300025926 Ga0207659_10015561 Ga0207659_100155614 272
391 3300025926 Ga0207659_10065728 Ga0207659_100657283 272
392 3300025931 Ga0207644_10001344 Ga0207644_100013442 272
393 3300025931 Ga0207644_10032216 Ga0207644_100322163 272
394 3300025931 Ga0207644_10104089 Ga0207644_101040892 272
395 3300025933 Ga0207706_10102503 Ga0207706_101025032 272
396 3300025935 Ga0207709_10022513 Ga0207709_100225133 272
397 3300025936 Ga0207670_10011674 Ga0207670_100116743 272
398 3300025936 Ga0207670_10048461 Ga0207670_100484611 272
399 3300025937 Ga0207669_10003485 Ga0207669_100034852 272
400 3300025940 Ga0207691_10000018 Ga0207691_10000018121 272
401 3300025940 Ga0207691_10186128 Ga0207691_101861282 272
402 3300025940 Ga0207691_10214481 Ga0207691_102144812 272
403 3300025940 Ga0207691_10234077 Ga0207691_102340772 272
404 3300025940 Ga0207691_10446115 Ga0207691_104461152 272
405 3300025941 Ga0207711_10042630 Ga0207711_100426304 272
406 3300025941 Ga0207711_10089412 Ga0207711_100894123 272
407 3300025941 Ga0207711_10211901 Ga0207711_102119012 272
408 3300025941 Ga0207711_10435873 Ga0207711_104358732 272
409 3300025942 Ga0207689_10061475 Ga0207689_100614753 272
410 3300025942 Ga0207689_10167766 Ga0207689_101677662 272
411 3300025942 Ga0207689_10367962 Ga0207689_103679622 272
412 3300025945 Ga0207679_10065938 Ga0207679_100659383 272
413 3300025949 Ga0207667_10011582 Ga0207667_1001158211 272
414 3300025949 Ga0207667_10644054 Ga0207667_106440542 272
415 3300025960 Ga0207651_10003638 Ga0207651_100036385 272
416 3300025960 Ga0207651_10037982 Ga0207651_100379823 272
417 3300025960 Ga0207651_10150357 Ga0207651_101503572 272
418 3300025960 Ga0207651_10192900 Ga0207651_101929002 272
419 3300025972 Ga0207668_10020765 Ga0207668_100207652 272
420 3300025972 Ga0207668_10211799 Ga0207668_102117992 272
421 3300025981 Ga0207640_10234350 Ga0207640_102343501 272
422 3300025986 Ga0207658_10006133 Ga0207658_100061335 272
423 3300025986 Ga0207658_10023598 Ga0207658_100235984 272
424 3300025986 Ga0207658_10032603 Ga0207658_100326032 272
425 3300025986 Ga0207658_10050765 Ga0207658_100507653 272
426 3300025986 Ga0207658_10118246 Ga0207658_101182462 272
427 3300025986 Ga0207658_10267976 Ga0207658_102679762 272
428 3300026023 Ga0207677_10004386 Ga0207677_100043866 272
429 3300026023 Ga0207677_10012052 Ga0207677_100120524 272
430 3300026023 Ga0207677_10195210 Ga0207677_101952102 272
431 3300026035 Ga0207703_10000817 Ga0207703_1000081715 272
432 3300026041 Ga0207639_10009051 Ga0207639_100090512 272
433 3300026088 Ga0207641_10005073 Ga0207641_1000507311 272
434 3300026088 Ga0207641_10049395 Ga0207641_100493955 272
435 3300026088 Ga0207641_10074666 Ga0207641_100746664 272
436 3300026088 Ga0207641_10083149 Ga0207641_100831492 272
437 3300026089 Ga0207648_10026670 Ga0207648_100266704 272
438 3300026089 Ga0207648_10077196 Ga0207648_100771963 272
439 3300026089 Ga0207648_10148502 Ga0207648_101485023 272
440 3300026089 Ga0207648_10244922 Ga0207648_102449222 272
441 3300026095 Ga0207676_10001475 Ga0207676_100014754 272
442 3300026095 Ga0207676_10011558 Ga0207676_100115584 272
443 3300026095 Ga0207676_10078691 Ga0207676_100786914 272
444 3300026116 Ga0207674_10050876 Ga0207674_100508763 272
445 3300026118 Ga0207675_100024107 Ga0207675_1000241077 272
446 3300026118 Ga0207675_100030188 Ga0207675_1000301886 272
447 3300026118 Ga0207675_100049796 Ga0207675_1000497964 272
448 3300026121 Ga0207683_10000020 Ga0207683_1000002065 272
449 3300026121 Ga0207683_10024111 Ga0207683_100241114 272
450 3300026121 Ga0207683_10044935 Ga0207683_100449352 272
451 3300026121 Ga0207683_10104296 Ga0207683_101042962 272
452 3300026121 Ga0207683_10113807 Ga0207683_101138072 272
453 3300026121 Ga0207683_10396596 Ga0207683_103965962 272
454 3300026142 Ga0207698_10007168 Ga0207698_1000716811 272
455 3300026142 Ga0207698_10038539 Ga0207698_100385392 272
456 3300027111 Ga0209281_1000259 Ga0209281_100025958 272
457 3300028379 Ga0268266_10018522 Ga0268266_100185226 272
458 3300028379 Ga0268266_10024477 Ga0268266_100244773 272
459 3300028380 Ga0268265_10137561 Ga0268265_101375612 272
460 3300028381 Ga0268264_10052836 Ga0268264_100528362 272
461 3300028381 Ga0268264_10086924 Ga0268264_100869242 272
462 3300031731 Ga0307405_10252917 Ga0307405_102529171 272
463 3300031911 Ga0307412_10000392 Ga0307412_100003926 272
464 3300031911 Ga0307412_10357730 Ga0307412_103577302 272
465 3300033180 Ga0307510_10034007 Ga0307510_100340073 272
466 3300046528 Ga0495642_0057359 Ga0495642_0057359_758_1576 272
467 3300046660 Ga0495625_0010498 Ga0495625_0010498_6391_7236 272
468 3300048905 Ga0496102_0206626 Ga0496102_0206626_883_1704 272
469 3300048907 Ga0496104_0032473 Ga0496104_0032473_2752_3570 272
470 3300048911 Ga0496108_0452077 Ga0496108_0452077_272_1090 272
471 3300048917 Ga0496114_0186150 Ga0496114_0186150_160_978 272
472 3300048919 Ga0496116_0013245 Ga0496116_0013245_352_1197 272
473 3300048919 Ga0496116_0081581 Ga0496116_0081581_1073_1894 272
474 3300048919 Ga0496116_0125457 Ga0496116_0125457_149_970 272
475 3300048921 Ga0496118_0019857 Ga0496118_0019857_4721_5542 272
476 3300048922 Ga0496119_0003325 Ga0496119_0003325_10409_11230 272
477 3300048923 Ga0496120_0003204 Ga0496120_0003204_6622_7443 272
478 3300048924 Ga0496121_0001404 Ga0496121_0001404_30144_30965 272
479 3300048924 Ga0496121_0218094 Ga0496121_0218094_328_1173 272
480 3300048924 Ga0496121_0232548 Ga0496121_0232548_166_1011 272
481 3300048925 Ga0496122_0000029 Ga0496122_0000029_29482_30303 272
482 3300048925 Ga0496122_0004463 Ga0496122_0004463_5516_6361 272
483 3300048926 Ga0496123_0000531 Ga0496123_0000531_35322_36143 272
484 3300048926 Ga0496123_0003891 Ga0496123_0003891_9906_10751 272
485 3300048927 Ga0496124_0000024 Ga0496124_0000024_290238_291059 272
486 3300048927 Ga0496124_0004949 Ga0496124_0004949_9220_10041 272
487 3300048927 Ga0496124_0122058 Ga0496124_0122058_246_1067 272
488 3300048928 Ga0496125_0000244 Ga0496125_0000244_21889_22710 272
489 3300048928 Ga0496125_0015625 Ga0496125_0015625_1740_2561 272
490 3300048928 Ga0496125_0030924 Ga0496125_0030924_522_1367 272
491 3300048929 Ga0496126_0043446 Ga0496126_0043446_561_1382 272
492 3300050491 nmdc:mga00v17_56590_c1 nmdc:mga00v17_56590_c1_678_1496 272
493 3300053117 Ga0500593_000414 Ga0500593_000414_3053_3874 272
494 3300053125 Ga0500618_002619 Ga0500618_002619_5537_6382 272
495 3300002987 JGI25159J45721_1002106 JGI25159J45721_10021063 273
496 3300003187 JGI25151J46595_10000301 JGI25151J46595_1000030128 273
497 3300003187 JGI25151J46595_10011183 JGI25151J46595_100111833 273
498 3300003322 rootL2_10017868 rootL2_100178689 273
499 3300003354 JGI25160J50197_1000227 JGI25160J50197_100022717 273
500 3300003374 JGI25161J50226_1000007 JGI25161J50226_100000717 273
501 3300003771 Ga0055526_1021281 Ga0055526_10212812 273
502 3300003773 Ga0055537_1002740 Ga0055537_10027404 273
503 3300003775 Ga0055524_1001441 Ga0055524_100144110 273
504 3300003784 Ga0055534_1002933 Ga0055534_10029332 273
505 3300003792 Ga0055540_1002288 Ga0055540_10022887 273
506 3300003794 Ga0055531_10000740 Ga0055531_1000074011 273
507 3300004625 Ga0055543_1000386 Ga0055543_10003866 273
508 3300005262 Ga0065165_1013879 Ga0065165_10138793 273
509 3300005293 Ga0065715_10125321 Ga0065715_101253213 273
510 3300005327 Ga0070658_10224146 Ga0070658_102241462 273
511 3300005328 Ga0070676_10277204 Ga0070676_102772041 273
512 3300005329 Ga0070683_100129404 Ga0070683_1001294042 273
513 3300005329 Ga0070683_100647230 Ga0070683_1006472301 273
514 3300005331 Ga0070670_100001971 Ga0070670_1000019713 273
515 3300005331 Ga0070670_100029888 Ga0070670_1000298883 273
516 3300005331 Ga0070670_100037645 Ga0070670_1000376455 273
517 3300005331 Ga0070670_100043346 Ga0070670_1000433463 273
518 3300005331 Ga0070670_100089726 Ga0070670_1000897262 273
519 3300005331 Ga0070670_100119461 Ga0070670_1001194613 273
520 3300005331 Ga0070670_100188056 Ga0070670_1001880563 273
521 3300005331 Ga0070670_100328284 Ga0070670_1003282842 273
522 3300005333 Ga0070677_10006417 Ga0070677_100064173 273
523 3300005333 Ga0070677_10009189 Ga0070677_100091895 273
524 3300005335 Ga0070666_10363788 Ga0070666_103637881 273
525 3300005338 Ga0068868_100045446 Ga0068868_1000454464 273
526 3300005338 Ga0068868_100123985 Ga0068868_1001239853 273
527 3300005340 Ga0070689_100335959 Ga0070689_1003359591 273
528 3300005344 Ga0070661_100298968 Ga0070661_1002989683 273
529 3300005347 Ga0070668_100412093 Ga0070668_1004120931 273
530 3300005353 Ga0070669_100094824 Ga0070669_1000948242 273
531 3300005353 Ga0070669_100108307 Ga0070669_1001083072 273
532 3300005354 Ga0070675_100014529 Ga0070675_1000145296 273
533 3300005354 Ga0070675_100617966 Ga0070675_1006179662 273
534 3300005355 Ga0070671_100043160 Ga0070671_1000431605 273
535 3300005355 Ga0070671_100075846 Ga0070671_1000758463 273
536 3300005355 Ga0070671_100129197 Ga0070671_1001291973 273
537 3300005355 Ga0070671_100186048 Ga0070671_1001860483 273
538 3300005356 Ga0070674_100036756 Ga0070674_1000367563 273
539 3300005364 Ga0070673_100061005 Ga0070673_1000610051 273
540 3300005364 Ga0070673_100070739 Ga0070673_1000707393 273
541 3300005364 Ga0070673_100086055 Ga0070673_1000860553 273
542 3300005367 Ga0070667_100089857 Ga0070667_1000898572 273
543 3300005455 Ga0070663_100032973 Ga0070663_1000329733 273
544 3300005455 Ga0070663_100060857 Ga0070663_1000608573 273
545 3300005456 Ga0070678_100030734 Ga0070678_1000307342 273
546 3300005456 Ga0070678_100136716 Ga0070678_1001367162 273
547 3300005456 Ga0070678_100153175 Ga0070678_1001531753 273
548 3300005456 Ga0070678_100179796 Ga0070678_1001797962 273
549 3300005456 Ga0070678_100325069 Ga0070678_1003250692 273
550 3300005457 Ga0070662_100104882 Ga0070662_1001048823 273
551 3300005457 Ga0070662_100440947 Ga0070662_1004409471 273
552 3300005459 Ga0068867_100012008 Ga0068867_1000120087 273
553 3300005459 Ga0068867_100021275 Ga0068867_1000212756 273
554 3300005459 Ga0068867_100049323 Ga0068867_1000493233 273
555 3300005459 Ga0068867_100153326 Ga0068867_1001533262 273
556 3300005467 Ga0070706_100002539 Ga0070706_1000025395 273
557 3300005468 Ga0070707_100036814 Ga0070707_1000368145 273
558 3300005535 Ga0070684_100049524 Ga0070684_1000495242 273
559 3300005543 Ga0070672_100067655 Ga0070672_1000676553 273
560 3300005543 Ga0070672_100137156 Ga0070672_1001371563 273
561 3300005543 Ga0070672_100242749 Ga0070672_1002427492 273
562 3300005548 Ga0070665_100414457 Ga0070665_1004144572 273
563 3300005564 Ga0070664_100026043 Ga0070664_1000260433 273
564 3300005564 Ga0070664_100072613 Ga0070664_1000726132 273
565 3300005564 Ga0070664_100196192 Ga0070664_1001961922 273
566 3300005577 Ga0068857_100017408 Ga0068857_1000174084 273
567 3300005577 Ga0068857_100157826 Ga0068857_1001578262 273
568 3300005578 Ga0068854_100110195 Ga0068854_1001101952 273
569 3300005578 Ga0068854_100352732 Ga0068854_1003527322 273
570 3300005616 Ga0068852_100084077 Ga0068852_1000840773 273
571 3300005616 Ga0068852_100161780 Ga0068852_1001617802 273
572 3300005617 Ga0068859_100098576 Ga0068859_1000985764 273
573 3300005618 Ga0068864_100021018 Ga0068864_1000210183 273
574 3300005618 Ga0068864_100044697 Ga0068864_1000446973 273
575 3300005618 Ga0068864_100096415 Ga0068864_1000964151 273
576 3300005618 Ga0068864_100184809 Ga0068864_1001848093 273
577 3300005719 Ga0068861_100105393 Ga0068861_1001053932 273
578 3300005841 Ga0068863_100034799 Ga0068863_1000347993 273
579 3300005841 Ga0068863_100152090 Ga0068863_1001520902 273
580 3300005842 Ga0068858_100539810 Ga0068858_1005398102 273
581 3300006028 Ga0070717_10179449 Ga0070717_101794492 273
582 3300006038 Ga0075365_10162457 Ga0075365_101624573 273
583 3300006042 Ga0075368_10114950 Ga0075368_101149501 273
584 3300006048 Ga0075363_100036983 Ga0075363_1000369832 273
585 3300006051 Ga0075364_10350918 Ga0075364_103509182 273
586 3300006177 Ga0075362_10062690 Ga0075362_100626902 273
587 3300006178 Ga0075367_10010982 Ga0075367_100109826 273
588 3300006178 Ga0075367_10018189 Ga0075367_100181893 273
589 3300006178 Ga0075367_10166400 Ga0075367_101664003 273
590 3300006186 Ga0075369_10086249 Ga0075369_100862492 273
591 3300006195 Ga0075366_10143252 Ga0075366_101432522 273
592 3300006195 Ga0075366_10210536 Ga0075366_102105362 273
593 3300006237 Ga0097621_100140720 Ga0097621_1001407203 273
594 3300006237 Ga0097621_100241368 Ga0097621_1002413682 273
595 3300006353 Ga0075370_10006766 Ga0075370_100067667 273
596 3300006353 Ga0075370_10027723 Ga0075370_100277232 273
597 3300006353 Ga0075370_10070550 Ga0075370_100705503 273
598 3300006353 Ga0075370_10127002 Ga0075370_101270022 273
599 3300006358 Ga0068871_100473496 Ga0068871_1004734962 273
600 3300006881 Ga0068865_100041947 Ga0068865_1000419474 273
601 3300006931 Ga0097620_100098578 Ga0097620_1000985784 273
602 3300006948 Ga0099826_10000021 Ga0099826_10000021125 273
603 3300009093 Ga0105240_10041470 Ga0105240_100414706 273
604 3300009098 Ga0105245_10105475 Ga0105245_101054753 273
605 3300009148 Ga0105243_10251968 Ga0105243_102519682 273
606 3300009148 Ga0105243_10438575 Ga0105243_104385752 273
607 3300009174 Ga0105241_10165743 Ga0105241_101657432 273
608 3300009177 Ga0105248_10116526 Ga0105248_101165263 273
609 3300009545 Ga0105237_10051964 Ga0105237_100519643 273
610 3300009545 Ga0105237_10279165 Ga0105237_102791653 273
611 3300010375 Ga0105239_10159772 Ga0105239_101597722 273
612 3300012497 Ga0157319_1000695 Ga0157319_10006951 273
613 3300013296 Ga0157374_10050728 Ga0157374_100507283 273
614 3300013296 Ga0157374_10482189 Ga0157374_104821892 273
615 3300013296 Ga0157374_10606869 Ga0157374_106068691 273
616 3300013297 Ga0157378_10378962 Ga0157378_103789623 273
617 3300013297 Ga0157378_10508236 Ga0157378_105082362 273
618 3300013297 Ga0157378_10516439 Ga0157378_105164392 273
619 3300013306 Ga0163162_10115597 Ga0163162_101155973 273
620 3300013308 Ga0157375_10035622 Ga0157375_100356221 273
621 3300013308 Ga0157375_10059297 Ga0157375_100592972 273
622 3300013308 Ga0157375_10064588 Ga0157375_100645882 273
623 3300014325 Ga0163163_10217309 Ga0163163_102173092 273
624 3300014969 Ga0157376_10215134 Ga0157376_102151342 273
625 3300025206 Ga0209435_100019 Ga0209435_100019195 273
626 3300025208 Ga0209436_104004 Ga0209436_1040045 273
627 3300025246 Ga0209646_1000038 Ga0209646_1000038196 273
628 3300025250 Ga0209026_1000048 Ga0209026_1000048195 273
629 3300025256 Ga0209759_1000038 Ga0209759_100003849 273
630 3300025263 Ga0209565_1000615 Ga0209565_100061511 273
631 3300025273 Ga0209673_1011259 Ga0209673_10112593 273
632 3300025273 Ga0209673_1027129 Ga0209673_10271293 273
633 3300025284 Ga0209130_1000289 Ga0209130_100028941 273
634 3300025284 Ga0209130_1012738 Ga0209130_10127383 273
635 3300025291 Ga0209675_1001778 Ga0209675_10017789 273
636 3300025291 Ga0209675_1010406 Ga0209675_10104063 273
637 3300025292 Ga0209676_1013043 Ga0209676_10130434 273
638 3300025294 Ga0209025_1000003 Ga0209025_10000031227 273
639 3300025294 Ga0209025_1001751 Ga0209025_10017516 273
640 3300025294 Ga0209025_1010755 Ga0209025_10107553 273
641 3300025294 Ga0209025_1018466 Ga0209025_10184664 273
642 3300025294 Ga0209025_1051447 Ga0209025_10514472 273
643 3300025295 Ga0209564_1001767 Ga0209564_10017677 273
644 3300025295 Ga0209564_1002258 Ga0209564_10022585 273
645 3300025297 Ga0209758_1040043 Ga0209758_10400432 273
646 3300025298 Ga0209050_1004794 Ga0209050_10047948 273
647 3300025299 Ga0209256_1000127 Ga0209256_1000127137 273
648 3300025299 Ga0209256_1000906 Ga0209256_10009065 273
649 3300025302 Ga0207426_1000091 Ga0207426_1000091203 273
650 3300025303 Ga0209051_1000351 Ga0209051_100035142 273
651 3300025303 Ga0209051_1015139 Ga0209051_10151392 273
652 3300025304 Ga0209257_1000015 Ga0209257_1000015284 273
653 3300025304 Ga0209257_1013914 Ga0209257_10139143 273
654 3300025321 Ga0207656_10087638 Ga0207656_100876382 273
655 3300025321 Ga0207656_10170628 Ga0207656_101706282 273
656 3300025901 Ga0207688_10043780 Ga0207688_100437802 273
657 3300025907 Ga0207645_10071087 Ga0207645_100710872 273
658 3300025907 Ga0207645_10094840 Ga0207645_100948402 273
659 3300025907 Ga0207645_10095900 Ga0207645_100959003 273
660 3300025908 Ga0207643_10042663 Ga0207643_100426633 273
661 3300025910 Ga0207684_10023176 Ga0207684_100231765 273
662 3300025913 Ga0207695_10123453 Ga0207695_101234533 273
663 3300025914 Ga0207671_10061344 Ga0207671_100613443 273
664 3300025914 Ga0207671_10126738 Ga0207671_101267382 273
665 3300025920 Ga0207649_10324495 Ga0207649_103244952 273
666 3300025923 Ga0207681_10006325 Ga0207681_100063254 273
667 3300025925 Ga0207650_10000710 Ga0207650_100007107 273
668 3300025925 Ga0207650_10028205 Ga0207650_100282054 273
669 3300025925 Ga0207650_10046048 Ga0207650_100460483 273
670 3300025925 Ga0207650_10066503 Ga0207650_100665032 273
671 3300025925 Ga0207650_10067275 Ga0207650_100672753 273
672 3300025925 Ga0207650_10164554 Ga0207650_101645541 273
673 3300025926 Ga0207659_10008216 Ga0207659_100082167 273
674 3300025926 Ga0207659_10165010 Ga0207659_101650102 273
675 3300025926 Ga0207659_10240214 Ga0207659_102402142 273
676 3300025931 Ga0207644_10001677 Ga0207644_100016773 273
677 3300025931 Ga0207644_10087523 Ga0207644_100875233 273
678 3300025931 Ga0207644_10129888 Ga0207644_101298883 273
679 3300025933 Ga0207706_10003941 Ga0207706_100039412 273
680 3300025933 Ga0207706_10348057 Ga0207706_103480572 273
681 3300025937 Ga0207669_10003984 Ga0207669_100039843 273
682 3300025937 Ga0207669_10343979 Ga0207669_103439791 273
683 3300025940 Ga0207691_10028725 Ga0207691_100287251 273
684 3300025940 Ga0207691_10182602 Ga0207691_101826023 273
685 3300025940 Ga0207691_10270263 Ga0207691_102702632 273
686 3300025941 Ga0207711_10005256 Ga0207711_100052565 273
687 3300025942 Ga0207689_10006735 Ga0207689_100067356 273
688 3300025942 Ga0207689_10007284 Ga0207689_100072842 273
689 3300025942 Ga0207689_10472244 Ga0207689_104722442 273
690 3300025944 Ga0207661_10192549 Ga0207661_101925492 273
691 3300025945 Ga0207679_10042747 Ga0207679_100427473 273
692 3300025945 Ga0207679_10091344 Ga0207679_100913442 273
693 3300025945 Ga0207679_10132589 Ga0207679_101325892 273
694 3300025981 Ga0207640_10211336 Ga0207640_102113362 273
695 3300026023 Ga0207677_10006410 Ga0207677_100064106 273
696 3300026023 Ga0207677_10006484 Ga0207677_100064844 273
697 3300026023 Ga0207677_10433020 Ga0207677_104330202 273
698 3300026067 Ga0207678_10048631 Ga0207678_100486313 273
699 3300026089 Ga0207648_10032136 Ga0207648_100321361 273
700 3300026089 Ga0207648_10052000 Ga0207648_100520005 273
701 3300026089 Ga0207648_10086284 Ga0207648_100862842 273
702 3300026089 Ga0207648_10124194 Ga0207648_101241943 273
703 3300026089 Ga0207648_10135345 Ga0207648_101353453 273
704 3300026095 Ga0207676_10010532 Ga0207676_100105323 273
705 3300026095 Ga0207676_10017436 Ga0207676_100174362 273
706 3300026095 Ga0207676_10019636 Ga0207676_100196363 273
707 3300026095 Ga0207676_10112667 Ga0207676_101126673 273
708 3300026116 Ga0207674_10012362 Ga0207674_100123627 273
709 3300026116 Ga0207674_10016088 Ga0207674_100160884 273
710 3300026116 Ga0207674_10202405 Ga0207674_102024052 273
711 3300026118 Ga0207675_100057248 Ga0207675_1000572485 273
712 3300026118 Ga0207675_100225865 Ga0207675_1002258653 273
713 3300026121 Ga0207683_10089845 Ga0207683_100898452 273
714 3300026121 Ga0207683_10219993 Ga0207683_102199933 273
715 3300027614 Ga0209970_1000196 Ga0209970_10001964 273
716 3300027666 Ga0209282_1000019 Ga0209282_1000019123 273
717 3300027866 Ga0209813_10024788 Ga0209813_100247882 273
718 3300028379 Ga0268266_10271557 Ga0268266_102715572 273
719 3300028380 Ga0268265_10298618 Ga0268265_102986181 273
720 3300028786 Ga0307517_10002655 Ga0307517_1000265526 273
721 3300028794 Ga0307515_10000138 Ga0307515_10000138109 273
722 3300028794 Ga0307515_10001193 Ga0307515_1000119329 273
723 3300028794 Ga0307515_10002234 Ga0307515_1000223441 273
724 3300028794 Ga0307515_10023840 Ga0307515_100238409 273
725 3300028794 Ga0307515_10041898 Ga0307515_100418984 273
726 3300028794 Ga0307515_10067248 Ga0307515_100672483 273
727 3300028794 Ga0307515_10094964 Ga0307515_100949644 273
728 3300028794 Ga0307515_10135512 Ga0307515_101355123 273
729 3300028794 Ga0307515_10146542 Ga0307515_101465422 273
730 3300031235 Ga0265330_10014274 Ga0265330_100142742 273
731 3300031238 Ga0265332_10035841 Ga0265332_100358413 273
732 3300031242 Ga0265329_10011414 Ga0265329_100114143 273
733 3300031250 Ga0265331_10043380 Ga0265331_100433802 273
734 3300031344 Ga0265316_10199220 Ga0265316_101992203 273
735 3300031456 Ga0307513_10000013 Ga0307513_1000001371 273
736 3300031456 Ga0307513_10000246 Ga0307513_1000024654 273
737 3300031456 Ga0307513_10007912 Ga0307513_1000791214 273
738 3300031456 Ga0307513_10027457 Ga0307513_100274576 273
739 3300031456 Ga0307513_10075694 Ga0307513_100756943 273
740 3300031456 Ga0307513_10104696 Ga0307513_101046962 273
741 3300031456 Ga0307513_10325978 Ga0307513_103259781 273
742 3300031507 Ga0307509_10007099 Ga0307509_100070997 273
743 3300031507 Ga0307509_10019271 Ga0307509_100192715 273
744 3300031507 Ga0307509_10033367 Ga0307509_100333676 273
745 3300031507 Ga0307509_10164667 Ga0307509_101646673 273
746 3300031548 Ga0307408_100000008 Ga0307408_100000008333 273
747 3300031616 Ga0307508_10000450 Ga0307508_100004508 273
748 3300031616 Ga0307508_10008054 Ga0307508_100080544 273
749 3300031616 Ga0307508_10055717 Ga0307508_100557174 273
750 3300031649 Ga0307514_10001030 Ga0307514_100010305 273
751 3300031649 Ga0307514_10008692 Ga0307514_100086929 273
752 3300031649 Ga0307514_10109370 Ga0307514_101093703 273
753 3300031649 Ga0307514_10156290 Ga0307514_101562902 273
754 3300031711 Ga0265314_10008574 Ga0265314_100085743 273
755 3300031711 Ga0265314_10038564 Ga0265314_100385643 273
756 3300031712 Ga0265342_10038530 Ga0265342_100385302 273
757 3300031730 Ga0307516_10008482 Ga0307516_100084822 273
758 3300031730 Ga0307516_10077658 Ga0307516_100776581 273
759 3300031730 Ga0307516_10353428 Ga0307516_103534281 273
760 3300031838 Ga0307518_10244042 Ga0307518_102440422 273
761 3300031838 Ga0307518_10330066 Ga0307518_103300661 273
762 3300032004 Ga0307414_10115733 Ga0307414_101157332 273
763 3300032005 Ga0307411_10002080 Ga0307411_100020803 273
764 3300035113 Ga0373936_0043270 Ga0373936_0043270_371_1192 273
765 3300035120 Ga0373957_0028893 Ga0373957_0028893_1117_1938 273
766 3300035172 Ga0373955_0292472 Ga0373955_0292472_32_853 273
767 3300035691 Ga0373931_0025968 Ga0373931_0025968_508_1329 273
768 3300035724 Ga0373933_0190358 Ga0373933_0190358_462_1283 273
769 3300036401 Ga0373937_0040657 Ga0373937_0040657_244_1065 273
770 3300045051 Ga0451576_0019302 Ga0451576_0019302_6395_7216 273
771 3300046460 Ga0495638_0077305 Ga0495638_0077305_252_1073 273
772 3300046501 Ga0495607_0000507 Ga0495607_0000507_37281_38108 273
773 3300046512 Ga0495610_0001367 Ga0495610_0001367_6483_7304 273
774 3300046513 Ga0495616_0000866 Ga0495616_0000866_3912_4733 273
775 3300046519 Ga0495632_0112483 Ga0495632_0112483_25_846 273
776 3300046524 Ga0495648_0110383 Ga0495648_0110383_318_1139 273
777 3300046530 Ga0495654_0000834 Ga0495654_0000834_2892_3713 273
778 3300046538 Ga0495609_0000244 Ga0495609_0000244_24450_25271 273
779 3300046665 Ga0495661_0008722 Ga0495661_0008722_339_1160 273
780 3300046692 Ga0495671_0000453 Ga0495671_0000453_2820_3641 273
781 3300046694 Ga0495649_0004212 Ga0495649_0004212_4232_5053 273
782 3300046810 Ga0495660_0031902 Ga0495660_0031902_1745_2566 273
783 3300047320 Ga0495672_0032883 Ga0495672_0032883_671_1492 273
784 3300047447 Ga0495685_001488 Ga0495685_001488_6153_6974 273
785 3300047472 Ga0495686_0241770 Ga0495686_0241770_45_866 273
786 3300048904 Ga0496101_0379158 Ga0496101_0379158_199_1041 273
787 3300048909 Ga0496106_0284822 Ga0496106_0284822_467_1288 273
788 3300048919 Ga0496116_0067024 Ga0496116_0067024_676_1497 273
789 3300048921 Ga0496118_0053756 Ga0496118_0053756_1635_2456 273
790 3300048924 Ga0496121_0005640 Ga0496121_0005640_3310_4131 273
791 3300048925 Ga0496122_0004249 Ga0496122_0004249_3672_4493 273
792 3300048926 Ga0496123_0000124 Ga0496123_0000124_147984_148805 273
793 3300048926 Ga0496123_0001761 Ga0496123_0001761_18094_18915 273
794 3300050493 nmdc:mga0k408_247959_c1 nmdc:mga0k408_247959_c1_22_843 273
795 3300050493 nmdc:mga0k408_254840_c1 nmdc:mga0k408_254840_c1_210_1031 273
796 3300050493 nmdc:mga0k408_7822_c1 nmdc:mga0k408_7822_c1_3194_4015 273
797 3300050496 nmdc:mga07m45_10453_c1 nmdc:mga07m45_10453_c1_954_1775 273
798 3300050496 nmdc:mga07m45_122_c1 nmdc:mga07m45_122_c1_23189_24010 273
799 3300050496 nmdc:mga07m45_196634_c1 nmdc:mga07m45_196634_c1_144_965 273
800 3300050496 nmdc:mga07m45_4239_c1 nmdc:mga07m45_4239_c1_4130_4951 273
801 3300050496 nmdc:mga07m45_93670_c1 nmdc:mga07m45_93670_c1_866_1687 273
802 3300050516 nmdc:mga0sz30_147099_c1 nmdc:mga0sz30_147099_c1_72_893 273
803 3300050516 nmdc:mga0sz30_15597_c1 nmdc:mga0sz30_15597_c1_69_890 273
804 3300053117 Ga0500593_003241 Ga0500593_003241_1159_1986 273
805 3300053118 Ga0500594_0017153 Ga0500594_0017153_128_949 273
806 3300053136 Ga0500559_0000047 Ga0500559_0000047_80815_81636 273
807 3300053739 Ga0500587_002315 Ga0500587_002315_113_934 273
808 iso_pu_bacteria 2599185214 2599622444 273
809 iso_pu_bacteria 2599185226 2599674464 273
810 iso_pu_bacteria 2599185227 2599680149 273
811 iso_pu_bacteria 2599185229 2599692165 273
812 iso_pu_bacteria 2643221628 2644160849 273
813 iso_pu_bacteria 2643221672 2644396904 273
814 iso_pu_bacteria 2738541277 2738719305 273
815 iso_pu_bacteria 2738541307 2738883349 273
816 iso_pu_bacteria 2738543013 2739247375 273
817 iso_pu_bacteria 2738543019 2739282964 273
818 iso_pu_bacteria 2818991446 2819599144 273
819 iso_pu_bacteria 2831265667 2831270925 273
820 iso_pu_bacteria 2838054893 2838058972 273
821 iso_pu_bacteria 2842677519 2842679286 273
822 iso_pu_bacteria 2842733646 2842738290 273
823 iso_pu_bacteria 2885192300 2885193976 273
824 iso_pu_bacteria 2885198086 2885202258 273
825 iso_pu_bacteria 2885211737 2885215911 273
826 iso_pu_bacteria 2899924645 2899929968 273
827 iso_pu_bacteria 2904449895 2904451618 273
828 iso_pu_bacteria 2904456579 2904461893 273
829 iso_pu_bacteria 2904541872 2904543295 273
830 iso_pu_bacteria 2919462493 2919464482 273
831 iso_pu_bacteria 2928037797 2928043503 273
832 iso_pu_bacteria 2928044640 2928049867 273
833 iso_pu_bacteria 2928051484 2928054442 273
834 iso_pu_bacteria 2928064002 2928070028 273
835 iso_pu_bacteria 2928070936 2928074353 273
836 iso_pu_bacteria 2928084124 2928086591 273
837 iso_pu_bacteria 2929160207 2929160527 273
838 iso_pu_bacteria 2929520902 2929526537 273
839 iso_pu_bacteria 2945909444 2945915519 273
840 iso_pu_bacteria 2945972063 2945974897 273
841 iso_pu_bacteria 2945984333 2945989083 273
842 3300039438 Ga0436360_1081132 Ga0436360_1081132_209_1033 274
843 3300039450 Ga0436363_0171481 Ga0436363_0171481_169_993 274
844 3300009093 Ga0105240_10290611 Ga0105240_102906112 275
845 3300025913 Ga0207695_10178105 Ga0207695_101781053 275
846 3300003215 JGI25153J46596_10012010 JGI25153J46596_100120105 276
847 3300005367 Ga0070667_100474046 Ga0070667_1004740461 276
848 3300013308 Ga0157375_10451319 Ga0157375_104513192 276
849 3300025273 Ga0209673_1026678 Ga0209673_10266782 276
850 3300025972 Ga0207668_10287717 Ga0207668_102877172 276
851 3300046615 Ga0495656_0000365 Ga0495656_0000365_11663_12493 276
852 3300001979 JGI24740J21852_10010263 JGI24740J21852_100102633 277
853 3300001989 JGI24739J22299_10015867 JGI24739J22299_100158673 277
854 3300002704 JGI25155J39150_1000042 JGI25155J39150_100004218 277
855 3300002705 JGI25156J39149_1000053 JGI25156J39149_100005363 277
856 3300002738 JGI25154J39366_1000082 JGI25154J39366_100008263 277
857 3300002741 JGI25157J39369_1000072 JGI25157J39369_100007218 277
858 3300002987 JGI25159J45721_1010517 JGI25159J45721_10105172 277
859 3300003761 Ga0055535_1000260 Ga0055535_10002605 277
860 3300003762 Ga0055542_1000013 Ga0055542_1000013199 277
861 3300003781 Ga0055536_1004462 Ga0055536_10044625 277
862 3300003784 Ga0055534_1001477 Ga0055534_10014778 277
863 3300003784 Ga0055534_1006234 Ga0055534_10062344 277
864 3300003791 Ga0055530_10003439 Ga0055530_100034395 277
865 3300003791 Ga0055530_10018827 Ga0055530_100188273 277
866 3300003792 Ga0055540_1013297 Ga0055540_10132972 277
867 3300005335 Ga0070666_10079624 Ga0070666_100796243 277
868 3300005366 Ga0070659_100310018 Ga0070659_1003100181 277
869 3300005539 Ga0068853_100072987 Ga0068853_1000729873 277
870 3300005539 Ga0068853_100454005 Ga0068853_1004540052 277
871 3300005564 Ga0070664_100074036 Ga0070664_1000740362 277
872 3300005577 Ga0068857_100330635 Ga0068857_1003306353 277
873 3300005578 Ga0068854_100072045 Ga0068854_1000720453 277
874 3300005616 Ga0068852_100063421 Ga0068852_1000634213 277
875 3300005844 Ga0068862_100113099 Ga0068862_1001130993 277
876 3300006038 Ga0075365_10299676 Ga0075365_102996762 277
877 3300006051 Ga0075364_10109509 Ga0075364_101095092 277
878 3300006186 Ga0075369_10059355 Ga0075369_100593552 277
879 3300006195 Ga0075366_10015678 Ga0075366_100156782 277
880 3300006195 Ga0075366_10064729 Ga0075366_100647292 277
881 3300006237 Ga0097621_100450408 Ga0097621_1004504082 277
882 3300006353 Ga0075370_10024220 Ga0075370_100242202 277
883 3300009036 Ga0105244_10003602 Ga0105244_100036023 277
884 3300009093 Ga0105240_10112031 Ga0105240_101120314 277
885 3300009148 Ga0105243_10041298 Ga0105243_100412983 277
886 3300009551 Ga0105238_10196657 Ga0105238_101966571 277
887 3300010375 Ga0105239_10063942 Ga0105239_100639423 277
888 3300011119 Ga0105246_10402965 Ga0105246_104029652 277
889 3300012505 Ga0157339_1001068 Ga0157339_10010682 277
890 3300013102 Ga0157371_10045298 Ga0157371_100452983 277
891 3300013104 Ga0157370_10310879 Ga0157370_103108791 277
892 3300013105 Ga0157369_10035810 Ga0157369_100358106 277
893 3300013307 Ga0157372_10060900 Ga0157372_100609003 277
894 3300014497 Ga0182008_10053291 Ga0182008_100532912 277
895 3300014497 Ga0182008_10079655 Ga0182008_100796552 277
896 3300015261 Ga0182006_1014559 Ga0182006_10145593 277
897 3300015262 Ga0182007_10002108 Ga0182007_100021088 277
898 3300015262 Ga0182007_10016980 Ga0182007_100169803 277
899 3300015683 Ga0183362_10004 Ga0183362_10004501 277
900 3300017792 Ga0163161_10155206 Ga0163161_101552063 277
901 3300025208 Ga0209436_105266 Ga0209436_1052663 277
902 3300025228 Ga0209672_102201 Ga0209672_1022013 277
903 3300025229 Ga0209147_100843 Ga0209147_1008439 277
904 3300025242 Ga0209258_100020 Ga0209258_100020355 277
905 3300025245 Ga0207425_1000814 Ga0207425_10008147 277
906 3300025254 Ga0209148_1000031 Ga0209148_1000031355 277
907 3300025258 Ga0209129_1000055 Ga0209129_1000055216 277
908 3300025258 Ga0209129_1006666 Ga0209129_10066662 277
909 3300025263 Ga0209565_1000078 Ga0209565_100007819 277
910 3300025263 Ga0209565_1000310 Ga0209565_100031037 277
911 3300025263 Ga0209565_1001707 Ga0209565_10017076 277
912 3300025273 Ga0209673_1000170 Ga0209673_1000170115 277
913 3300025273 Ga0209673_1001531 Ga0209673_10015318 277
914 3300025273 Ga0209673_1002628 Ga0209673_10026285 277
915 3300025284 Ga0209130_1000807 Ga0209130_100080720 277
916 3300025284 Ga0209130_1001274 Ga0209130_100127415 277
917 3300025284 Ga0209130_1011749 Ga0209130_10117492 277
918 3300025291 Ga0209675_1000055 Ga0209675_1000055115 277
919 3300025291 Ga0209675_1002139 Ga0209675_10021398 277
920 3300025291 Ga0209675_1018963 Ga0209675_10189633 277
921 3300025292 Ga0209676_1000040 Ga0209676_1000040247 277
922 3300025292 Ga0209676_1003179 Ga0209676_10031799 277
923 3300025292 Ga0209676_1017739 Ga0209676_10177393 277
924 3300025294 Ga0209025_1000409 Ga0209025_10004097 277
925 3300025294 Ga0209025_1009368 Ga0209025_10093686 277
926 3300025295 Ga0209564_1000157 Ga0209564_10001575 277
927 3300025295 Ga0209564_1000806 Ga0209564_10008066 277
928 3300025297 Ga0209758_1000042 Ga0209758_1000042144 277
929 3300025297 Ga0209758_1005953 Ga0209758_10059535 277
930 3300025298 Ga0209050_1000021 Ga0209050_1000021146 277
931 3300025298 Ga0209050_1003967 Ga0209050_10039679 277
932 3300025298 Ga0209050_1015628 Ga0209050_10156284 277
933 3300025299 Ga0209256_1000056 Ga0209256_1000056127 277
934 3300025299 Ga0209256_1000124 Ga0209256_100012460 277
935 3300025302 Ga0207426_1000055 Ga0207426_1000055187 277
936 3300025302 Ga0207426_1000079 Ga0207426_1000079144 277
937 3300025303 Ga0209051_1000423 Ga0209051_10004233 277
938 3300025303 Ga0209051_1000446 Ga0209051_10004462 277
939 3300025303 Ga0209051_1013428 Ga0209051_10134285 277
940 3300025304 Ga0209257_1000043 Ga0209257_1000043141 277
941 3300025304 Ga0209257_1001377 Ga0209257_10013779 277
942 3300025304 Ga0209257_1024395 Ga0209257_10243952 277
943 3300025728 Ga0207655_1005080 Ga0207655_10050803 277
944 3300025903 Ga0207680_10056911 Ga0207680_100569113 277
945 3300025913 Ga0207695_10628475 Ga0207695_106284752 277
946 3300025924 Ga0207694_10281387 Ga0207694_102813872 277
947 3300025932 Ga0207690_10313305 Ga0207690_103133052 277
948 3300025933 Ga0207706_10115153 Ga0207706_101151533 277
949 3300025935 Ga0207709_10040350 Ga0207709_100403503 277
950 3300025940 Ga0207691_10419650 Ga0207691_104196502 277
951 3300025949 Ga0207667_10433859 Ga0207667_104338593 277
952 3300026116 Ga0207674_10217177 Ga0207674_102171772 277
953 3300027666 Ga0209282_1000139 Ga0209282_100013919 277
954 3300028379 Ga0268266_10040123 Ga0268266_100401235 277
955 3300028380 Ga0268265_10011207 Ga0268265_100112076 277
956 3300028794 Ga0307515_10000322 Ga0307515_1000032274 277
957 3300030522 Ga0307512_10066347 Ga0307512_100663473 277
958 3300030732 Ga0316176_1141751 Ga0316176_11417513 277
959 3300030733 Ga0314311_1073339 Ga0314311_10733392 277
960 3300030734 Ga0316179_1111618 Ga0316179_11116182 277
961 3300030742 Ga0316183_1025835 Ga0316183_10258353 277
962 3300031251 Ga0265327_10003094 Ga0265327_1000309414 277
963 3300031251 Ga0265327_10005552 Ga0265327_100055523 277
964 3300031456 Ga0307513_10270462 Ga0307513_102704622 277
965 3300031548 Ga0307408_100054021 Ga0307408_1000540213 277
966 3300031548 Ga0307408_100086583 Ga0307408_1000865832 277
967 3300031548 Ga0307408_100111446 Ga0307408_1001114462 277
968 3300031548 Ga0307408_100152716 Ga0307408_1001527161 277
969 3300031649 Ga0307514_10004889 Ga0307514_100048897 277
970 3300031901 Ga0307406_10012119 Ga0307406_100121193 277
971 3300031911 Ga0307412_10008739 Ga0307412_100087396 277
972 3300031911 Ga0307412_10193682 Ga0307412_101936822 277
973 3300031911 Ga0307412_10517187 Ga0307412_105171871 277
974 3300032004 Ga0307414_10293586 Ga0307414_102935862 277
975 3300032126 Ga0307415_100694203 Ga0307415_1006942031 277
976 3300037068 Ga0373925_0461305 Ga0373925_0461305_121_954 277
977 3300041406 Ga0439439_0003401 Ga0439439_0003401_864_1697 277
978 3300041411 Ga0439466_0002610 Ga0439466_0002610_3928_4761 277
979 3300042004 Ga0439445_0001509 Ga0439445_0001509_1796_2629 277
980 3300042006 Ga0439432_002290 Ga0439432_002290_3139_3972 277
981 3300042007 Ga0439449_0000753 Ga0439449_0000753_2594_3427 277
982 3300042007 Ga0439449_0004213 Ga0439449_0004213_4572_5405 277
983 3300042010 Ga0439452_002755 Ga0439452_002755_4074_4907 277
984 3300042125 Ga0450923_031374 Ga0450923_031374_145_978 277
985 3300042134 Ga0450898_003737 Ga0450898_003737_1078_1911 277
986 3300042185 Ga0450909_011691 Ga0450909_011691_342_1175 277
987 3300042435 Ga0439434_0001757 Ga0439434_0001757_362_1195 277
988 3300042531 Ga0450918_002439 Ga0450918_002439_1518_2351 277
989 3300046512 Ga0495610_0019846 Ga0495610_0019846_1326_2159 277
990 3300046515 Ga0495620_0051816 Ga0495620_0051816_368_1201 277
991 3300046520 Ga0495637_0005420 Ga0495637_0005420_3307_4140 277
992 3300046674 Ga0495588_0097715 Ga0495588_0097715_456_1289 277
993 3300047321 Ga0495676_0089794 Ga0495676_0089794_1150_1983 277
994 3300047673 Ga0495593_0037115 Ga0495593_0037115_905_1738 277
995 3300048089 Ga0495614_0107705 Ga0495614_0107705_95_928 277
996 3300048908 Ga0496105_0012904 Ga0496105_0012904_2014_2847 277
997 3300048921 Ga0496118_0085109 Ga0496118_0085109_907_1740 277
998 3300048924 Ga0496121_0143282 Ga0496121_0143282_196_1029 277
999 3300048927 Ga0496124_0149259 Ga0496124_0149259_664_1497 277
1000 3300048927 Ga0496124_0223673 Ga0496124_0223673_278_1111 277
1001 3300050496 nmdc:mga07m45_15544_c1 nmdc:mga07m45_15544_c1_2240_3073 277
1002 3300053079 Ga0500610_0003992 Ga0500610_0003992_647_1480 277
1003 3300053110 Ga0500571_006720 Ga0500571_006720_611_1444 277
1004 3300053134 Ga0500658_0002081 Ga0500658_0002081_1317_2150 277
1005 3300053139 Ga0500568_0061648 Ga0500568_0061648_423_1256 277
1006 3300053141 Ga0500574_011876 Ga0500574_011876_118_951 277
1007 3300053177 Ga0500636_0083949 Ga0500636_0083949_152_985 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

85

225

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9147 29 245
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9133 30 241
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9128 29 241
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9127 30 243
5jsz-assembly1.cif.gz_A folate ecf transporter: apo state 0.9124 28 243
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9327 30 268 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.923 29 243 3.40.50.300
af_Q2FW34_4_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.92 28 243 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9191 29 243 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9188 28 241 3.40.50.300
ID Description Score Start End GO Terms
AF-K8E236-F1-model_v4 ABC transporter family protein 0.9335 102 243 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-K1SC20-F1-model_v4 ABC superfamily ATP binding cassette transporter, ABC protein 0.9327 29 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9285 29 221 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A524B8W3-F1-model_v4 ABC transporter 0.927 30 230 GO:0005524
GO:0016887
AF-K0DB19-F1-model_v4 ABC transporter ATP binding protein 0.9255 29 243 GO:0005524
GO:0016887
GO:0042626
GO:0043190

Feature Viewer

pLDDT pTM Quality
91.26 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map