F488022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1007 | 440 | 922 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300002704|JGI25155J39150_1000042|JGI25155J39150_100004218 |
| Length | 316 |
| Sequence | MRFPPRGPLRLRPGEAGSAAPTCMWEISGRSLLCLPITSLEYAMTAVLNAPVFADVPVREFQPGPAGTHITIRGLTKYFAGWPLYEDFNLDIPKHKIVSVFGPNGCGKSTLINMIAGLIPIDAGEILFDGKSLKDTKIGYVFQNYREAMFPWMRTIDNIAYPLKLEGKSKAEVDRRMAELVASFDVKFDLNRYPYELSGGQQQTASIMRALAPNPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAVYLADQVLLLTKRPTRVAEILPYGDARPRTVETLSEASFIRTKKLSLEIFQREVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 3 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 10 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 11 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 12 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 13 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 14 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 15 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 16 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 17 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 18 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 19 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 20 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 21 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 22 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 23 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 24 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 25 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 26 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 27 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 28 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 29 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 30 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 31 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 32 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 33 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 34 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 35 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 36 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 37 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 38 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 39 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 40 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 41 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 42 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 43 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 44 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 45 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 46 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 47 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 48 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 49 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 50 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 51 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 52 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 53 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 54 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 55 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 56 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 57 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 58 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 59 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 60 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 61 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 62 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 63 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 64 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 65 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 66 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 67 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 68 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 69 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 70 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 71 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 72 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 73 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 74 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 75 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 76 | 2941479691 | |||
| 77 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 78 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 79 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 80 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 81 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 82 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 83 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 84 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 85 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 86 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 87 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 88 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 89 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 90 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 91 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 92 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 93 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 94 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 95 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 97 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 98 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 102 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 103 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 105 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 106 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 107 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 108 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 110 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 111 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 112 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 113 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 114 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 118 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 121 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 123 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 133 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 141 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 145 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 149 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 151 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 152 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 153 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 155 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 156 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 157 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 158 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 159 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 160 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 161 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 162 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 163 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 164 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 166 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 167 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 168 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 169 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 170 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 171 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 172 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 173 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 175 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 176 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 177 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 178 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 179 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 180 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 181 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 183 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 184 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 200 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 201 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 212 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 216 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 217 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 218 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 220 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 221 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 232 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 233 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 236 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 239 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 241 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 244 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 247 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 305 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 306 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 307 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 308 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 309 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 310 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 311 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 312 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 313 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 314 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 315 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 316 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 317 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 318 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 319 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 320 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 321 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 322 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 323 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 324 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 325 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 326 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 327 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 328 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 329 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 330 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 331 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 332 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 333 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 334 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 335 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 336 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 337 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 338 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 341 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 342 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 343 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 344 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 345 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 346 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 347 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 348 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 349 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 350 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 351 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 352 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 353 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 354 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 355 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 356 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 357 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 358 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 359 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 360 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 361 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 362 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 363 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 396 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 415 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 417 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 428 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 430 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 440 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.56 |
| Metatranscriptomes | 0 |
| Isolates | 8.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.47 |
| Nodule | 0.99 |
| Rhizoplane | 1.49 |
| Rhizosphere | 63.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010263 | 3300001979 | Bacteria | 3618 |
| 2 | JGI24739J22299_10015867 | 3300001989 | Bacteria | 2733 |
| 3 | JGI25155J39150_1000042 | 3300002704 | Bacteria | 88585 |
| 4 | JGI25155J39150_1000651 | 3300002704 | Bacteria | 6849 |
| 5 | JGI25155J39150_1001094 | 3300002704 | Bacteria | 2726 |
| 6 | JGI25156J39149_1000053 | 3300002705 | Bacteria | 88796 |
| 7 | JGI25156J39149_1000170 | 3300002705 | Bacteria | 47634 |
| 8 | JGI25156J39149_1001869 | 3300002705 | Bacteria | 8231 |
| 9 | JGI25156J39149_1007194 | 3300002705 | Bacteria | 2953 |
| 10 | JGI25162J39368_1003814 | 3300002737 | Bacteria | 3981 |
| 11 | JGI25154J39366_1000082 | 3300002738 | Bacteria | 88767 |
| 12 | JGI25154J39366_1000306 | 3300002738 | Bacteria | 28725 |
| 13 | JGI25154J39366_1000455 | 3300002738 | Bacteria | 21495 |
| 14 | JGI25157J39369_1000072 | 3300002741 | Bacteria | 88796 |
| 15 | JGI25157J39369_1000170 | 3300002741 | Bacteria | 54809 |
| 16 | JGI25159J45721_1002106 | 3300002987 | Bacteria | 7812 |
| 17 | JGI25159J45721_1010517 | 3300002987 | Bacteria | 2348 |
| 18 | JGI25151J46595_10000301 | 3300003187 | Bacteria | 54192 |
| 19 | JGI25151J46595_10011183 | 3300003187 | Bacteria | 4134 |
| 20 | JGI25153J46596_10012010 | 3300003215 | Bacteria | 3781 |
| 21 | rootL2_10017868 | 3300003322 | Bacteria | 14919 |
| 22 | rootH1_10005172 | 3300003323 | Bacteria | 2973 |
| 23 | JGI25160J50197_1000227 | 3300003354 | Bacteria | 44493 |
| 24 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 25 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 26 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 27 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 28 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 29 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 30 | Ga0055535_1000260 | 3300003761 | Bacteria | 55578 |
| 31 | Ga0055535_1005719 | 3300003761 | Bacteria | 2661 |
| 32 | Ga0055542_1000013 | 3300003762 | Bacteria | 387560 |
| 33 | Ga0055526_1021281 | 3300003771 | Bacteria | 2263 |
| 34 | Ga0055537_1002740 | 3300003773 | Bacteria | 5717 |
| 35 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 36 | Ga0055524_1001441 | 3300003775 | Bacteria | 13654 |
| 37 | Ga0055536_1004462 | 3300003781 | Bacteria | 7148 |
| 38 | Ga0055534_1001477 | 3300003784 | Bacteria | 9327 |
| 39 | Ga0055534_1002933 | 3300003784 | Bacteria | 5651 |
| 40 | Ga0055534_1006234 | 3300003784 | Bacteria | 3040 |
| 41 | Ga0055530_10003439 | 3300003791 | Bacteria | 8999 |
| 42 | Ga0055530_10004911 | 3300003791 | Bacteria | 6630 |
| 43 | Ga0055530_10018827 | 3300003791 | Bacteria | 2114 |
| 44 | Ga0055540_1000123 | 3300003792 | Bacteria | 80351 |
| 45 | Ga0055540_1002288 | 3300003792 | Bacteria | 10318 |
| 46 | Ga0055540_1013297 | 3300003792 | Bacteria | 2524 |
| 47 | Ga0055531_10000740 | 3300003794 | Bacteria | 27497 |
| 48 | Ga0055531_10001116 | 3300003794 | Bacteria | 20815 |
| 49 | Ga0055531_10016084 | 3300003794 | Bacteria | 3251 |
| 50 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 51 | Ga0055543_1000386 | 3300004625 | Bacteria | 28622 |
| 52 | Ga0065165_1013879 | 3300005262 | Bacteria | 3166 |
| 53 | Ga0065704_10000444 | 3300005289 | Bacteria | 86255 |
| 54 | Ga0065715_10020215 | 3300005293 | Bacteria | 2452 |
| 55 | Ga0065715_10035108 | 3300005293 | Bacteria | 1466 |
| 56 | Ga0065715_10125321 | 3300005293 | Bacteria | 2133 |
| 57 | Ga0070658_10224146 | 3300005327 | Bacteria | 1591 |
| 58 | Ga0070676_10002668 | 3300005328 | Bacteria | 9187 |
| 59 | Ga0070676_10277204 | 3300005328 | Bacteria | 1128 |
| 60 | Ga0070683_100129404 | 3300005329 | Bacteria | 2388 |
| 61 | Ga0070683_100647230 | 3300005329 | Bacteria | 1012 |
| 62 | Ga0070690_100031929 | 3300005330 | Bacteria | 3284 |
| 63 | Ga0070670_100001971 | 3300005331 | Bacteria | 16798 |
| 64 | Ga0070670_100014554 | 3300005331 | Bacteria | 6754 |
| 65 | Ga0070670_100029888 | 3300005331 | Bacteria | 4693 |
| 66 | Ga0070670_100037645 | 3300005331 | Bacteria | 4161 |
| 67 | Ga0070670_100043346 | 3300005331 | Bacteria | 3868 |
| 68 | Ga0070670_100089726 | 3300005331 | Bacteria | 2642 |
| 69 | Ga0070670_100119461 | 3300005331 | Bacteria | 2273 |
| 70 | Ga0070670_100188056 | 3300005331 | Bacteria | 1793 |
| 71 | Ga0070670_100328284 | 3300005331 | Bacteria | 1341 |
| 72 | Ga0070677_10006417 | 3300005333 | Bacteria | 3907 |
| 73 | Ga0070677_10009189 | 3300005333 | Bacteria | 3350 |
| 74 | Ga0070677_10010076 | 3300005333 | Bacteria | 3221 |
| 75 | Ga0068869_100041131 | 3300005334 | Bacteria | 3309 |
| 76 | Ga0068869_100402150 | 3300005334 | Bacteria | 1127 |
| 77 | Ga0070666_10000758 | 3300005335 | Bacteria | 19568 |
| 78 | Ga0070666_10002174 | 3300005335 | Bacteria | 11914 |
| 79 | Ga0070666_10079624 | 3300005335 | Bacteria | 2238 |
| 80 | Ga0070666_10363788 | 3300005335 | Bacteria | 1037 |
| 81 | Ga0068868_100001290 | 3300005338 | Bacteria | 17256 |
| 82 | Ga0068868_100011821 | 3300005338 | Bacteria | 6365 |
| 83 | Ga0068868_100045446 | 3300005338 | Bacteria | 3435 |
| 84 | Ga0068868_100100646 | 3300005338 | Bacteria | 2338 |
| 85 | Ga0068868_100123985 | 3300005338 | Bacteria | 2109 |
| 86 | Ga0070689_100008704 | 3300005340 | Bacteria | 7162 |
| 87 | Ga0070689_100186212 | 3300005340 | Bacteria | 1688 |
| 88 | Ga0070689_100335959 | 3300005340 | Bacteria | 1265 |
| 89 | Ga0070687_100192273 | 3300005343 | Bacteria | 1230 |
| 90 | Ga0070661_100298968 | 3300005344 | Bacteria | 1252 |
| 91 | Ga0070661_100345298 | 3300005344 | Bacteria | 1167 |
| 92 | Ga0070668_100003834 | 3300005347 | Bacteria | 11107 |
| 93 | Ga0070668_100036636 | 3300005347 | Bacteria | 3744 |
| 94 | Ga0070668_100133019 | 3300005347 | Bacteria | 1998 |
| 95 | Ga0070668_100412093 | 3300005347 | Bacteria | 1155 |
| 96 | Ga0070668_100510634 | 3300005347 | Bacteria | 1042 |
| 97 | Ga0070669_100094824 | 3300005353 | Bacteria | 2243 |
| 98 | Ga0070669_100108307 | 3300005353 | Bacteria | 2106 |
| 99 | Ga0070675_100001026 | 3300005354 | Bacteria | 20075 |
| 100 | Ga0070675_100011870 | 3300005354 | Bacteria | 6826 |
| 101 | Ga0070675_100014529 | 3300005354 | Bacteria | 6210 |
| 102 | Ga0070675_100022217 | 3300005354 | Bacteria | 5067 |
| 103 | Ga0070675_100060263 | 3300005354 | Bacteria | 3133 |
| 104 | Ga0070675_100617966 | 3300005354 | Bacteria | 983 |
| 105 | Ga0070671_100010647 | 3300005355 | Bacteria | 7381 |
| 106 | Ga0070671_100043160 | 3300005355 | Bacteria | 3748 |
| 107 | Ga0070671_100067899 | 3300005355 | Bacteria | 2973 |
| 108 | Ga0070671_100075846 | 3300005355 | Bacteria | 2809 |
| 109 | Ga0070671_100079613 | 3300005355 | Bacteria | 2739 |
| 110 | Ga0070671_100129197 | 3300005355 | Bacteria | 2127 |
| 111 | Ga0070671_100186048 | 3300005355 | Bacteria | 1760 |
| 112 | Ga0070671_100220387 | 3300005355 | Bacteria | 1609 |
| 113 | Ga0070674_100000094 | 3300005356 | Bacteria | 41372 |
| 114 | Ga0070674_100017248 | 3300005356 | Bacteria | 4538 |
| 115 | Ga0070674_100036756 | 3300005356 | Bacteria | 3290 |
| 116 | Ga0070674_100064418 | 3300005356 | Bacteria | 2568 |
| 117 | Ga0070673_100000679 | 3300005364 | Bacteria | 18764 |
| 118 | Ga0070673_100000753 | 3300005364 | Bacteria | 17978 |
| 119 | Ga0070673_100056321 | 3300005364 | Bacteria | 3101 |
| 120 | Ga0070673_100061005 | 3300005364 | Bacteria | 2990 |
| 121 | Ga0070673_100070739 | 3300005364 | Bacteria | 2801 |
| 122 | Ga0070673_100086055 | 3300005364 | Bacteria | 2560 |
| 123 | Ga0070688_100027851 | 3300005365 | Bacteria | 3367 |
| 124 | Ga0070659_100310018 | 3300005366 | Bacteria | 1318 |
| 125 | Ga0070667_100001746 | 3300005367 | Bacteria | 19433 |
| 126 | Ga0070667_100009087 | 3300005367 | Bacteria | 8223 |
| 127 | Ga0070667_100059026 | 3300005367 | Bacteria | 3245 |
| 128 | Ga0070667_100063129 | 3300005367 | Bacteria | 3138 |
| 129 | Ga0070667_100089857 | 3300005367 | Bacteria | 2639 |
| 130 | Ga0070667_100153304 | 3300005367 | Bacteria | 2026 |
| 131 | Ga0070667_100201356 | 3300005367 | Bacteria | 1767 |
| 132 | Ga0070667_100474046 | 3300005367 | Bacteria | 1145 |
| 133 | Ga0070667_100580873 | 3300005367 | Bacteria | 1031 |
| 134 | Ga0070705_100361539 | 3300005440 | Bacteria | 1062 |
| 135 | Ga0070708_100458382 | 3300005445 | Bacteria | 1203 |
| 136 | Ga0070663_100010261 | 3300005455 | Bacteria | 5835 |
| 137 | Ga0070663_100032973 | 3300005455 | Bacteria | 3575 |
| 138 | Ga0070663_100060857 | 3300005455 | Bacteria | 2717 |
| 139 | Ga0070678_100000409 | 3300005456 | Bacteria | 20280 |
| 140 | Ga0070678_100015011 | 3300005456 | Bacteria | 4906 |
| 141 | Ga0070678_100022737 | 3300005456 | Bacteria | 4161 |
| 142 | Ga0070678_100030734 | 3300005456 | Bacteria | 3695 |
| 143 | Ga0070678_100136716 | 3300005456 | Bacteria | 1955 |
| 144 | Ga0070678_100153175 | 3300005456 | Bacteria | 1859 |
| 145 | Ga0070678_100179796 | 3300005456 | Bacteria | 1730 |
| 146 | Ga0070678_100213423 | 3300005456 | Bacteria | 1601 |
| 147 | Ga0070678_100325069 | 3300005456 | Bacteria | 1314 |
| 148 | Ga0070662_100004880 | 3300005457 | Bacteria | 8510 |
| 149 | Ga0070662_100036562 | 3300005457 | Bacteria | 3474 |
| 150 | Ga0070662_100104882 | 3300005457 | Bacteria | 2145 |
| 151 | Ga0070662_100440947 | 3300005457 | Bacteria | 1079 |
| 152 | Ga0068867_100001043 | 3300005459 | Bacteria | 18890 |
| 153 | Ga0068867_100008620 | 3300005459 | Bacteria | 7200 |
| 154 | Ga0068867_100012008 | 3300005459 | Bacteria | 6118 |
| 155 | Ga0068867_100017264 | 3300005459 | Bacteria | 5125 |
| 156 | Ga0068867_100021275 | 3300005459 | Bacteria | 4629 |
| 157 | Ga0068867_100049323 | 3300005459 | Bacteria | 3099 |
| 158 | Ga0068867_100069565 | 3300005459 | Bacteria | 2629 |
| 159 | Ga0068867_100153326 | 3300005459 | Bacteria | 1811 |
| 160 | Ga0070706_100002539 | 3300005467 | Bacteria | 18347 |
| 161 | Ga0070707_100036814 | 3300005468 | Bacteria | 4670 |
| 162 | Ga0070684_100049524 | 3300005535 | Bacteria | 3646 |
| 163 | Ga0068853_100072987 | 3300005539 | Bacteria | 2991 |
| 164 | Ga0068853_100454005 | 3300005539 | Bacteria | 1206 |
| 165 | Ga0070672_100000552 | 3300005543 | Bacteria | 22019 |
| 166 | Ga0070672_100010312 | 3300005543 | Bacteria | 6477 |
| 167 | Ga0070672_100047920 | 3300005543 | Bacteria | 3318 |
| 168 | Ga0070672_100056675 | 3300005543 | Bacteria | 3074 |
| 169 | Ga0070672_100067655 | 3300005543 | Bacteria | 2831 |
| 170 | Ga0070672_100137156 | 3300005543 | Bacteria | 2015 |
| 171 | Ga0070672_100200596 | 3300005543 | Bacteria | 1668 |
| 172 | Ga0070672_100242749 | 3300005543 | Bacteria | 1515 |
| 173 | Ga0070696_100061266 | 3300005546 | Bacteria | 2632 |
| 174 | Ga0070665_100002419 | 3300005548 | Bacteria | 20581 |
| 175 | Ga0070665_100004291 | 3300005548 | Bacteria | 14986 |
| 176 | Ga0070665_100243262 | 3300005548 | Bacteria | 1800 |
| 177 | Ga0070665_100414457 | 3300005548 | Bacteria | 1356 |
| 178 | Ga0068855_100011166 | 3300005563 | Bacteria | 10845 |
| 179 | Ga0068855_100068193 | 3300005563 | Bacteria | 4141 |
| 180 | Ga0070664_100026043 | 3300005564 | Bacteria | 4849 |
| 181 | Ga0070664_100072613 | 3300005564 | Bacteria | 2951 |
| 182 | Ga0070664_100074036 | 3300005564 | Bacteria | 2922 |
| 183 | Ga0070664_100175452 | 3300005564 | Bacteria | 1902 |
| 184 | Ga0070664_100196192 | 3300005564 | Bacteria | 1800 |
| 185 | Ga0068857_100017408 | 3300005577 | Bacteria | 6297 |
| 186 | Ga0068857_100157826 | 3300005577 | Bacteria | 2057 |
| 187 | Ga0068857_100159525 | 3300005577 | Bacteria | 2046 |
| 188 | Ga0068857_100330635 | 3300005577 | Bacteria | 1408 |
| 189 | Ga0068854_100052677 | 3300005578 | Bacteria | 2919 |
| 190 | Ga0068854_100072045 | 3300005578 | Bacteria | 2529 |
| 191 | Ga0068854_100110195 | 3300005578 | Bacteria | 2075 |
| 192 | Ga0068854_100352732 | 3300005578 | Bacteria | 1205 |
| 193 | Ga0068856_100151917 | 3300005614 | Bacteria | 2325 |
| 194 | Ga0070702_100059433 | 3300005615 | Bacteria | 2218 |
| 195 | Ga0070702_100199324 | 3300005615 | Bacteria | 1324 |
| 196 | Ga0070702_100309120 | 3300005615 | Bacteria | 1097 |
| 197 | Ga0068852_100027996 | 3300005616 | Bacteria | 4604 |
| 198 | Ga0068852_100042319 | 3300005616 | Bacteria | 3856 |
| 199 | Ga0068852_100063421 | 3300005616 | Bacteria | 3217 |
| 200 | Ga0068852_100084077 | 3300005616 | Bacteria | 2831 |
| 201 | Ga0068852_100161780 | 3300005616 | Bacteria | 2091 |
| 202 | Ga0068852_100209190 | 3300005616 | Bacteria | 1850 |
| 203 | Ga0068859_100023045 | 3300005617 | Bacteria | 6243 |
| 204 | Ga0068859_100098576 | 3300005617 | Bacteria | 2977 |
| 205 | Ga0068859_100121412 | 3300005617 | Bacteria | 2679 |
| 206 | Ga0068859_100473170 | 3300005617 | Bacteria | 1348 |
| 207 | Ga0068864_100000845 | 3300005618 | Bacteria | 25824 |
| 208 | Ga0068864_100021018 | 3300005618 | Bacteria | 5465 |
| 209 | Ga0068864_100024185 | 3300005618 | Bacteria | 5107 |
| 210 | Ga0068864_100044697 | 3300005618 | Bacteria | 3798 |
| 211 | Ga0068864_100071385 | 3300005618 | Bacteria | 3023 |
| 212 | Ga0068864_100078936 | 3300005618 | Bacteria | 2881 |
| 213 | Ga0068864_100096415 | 3300005618 | Bacteria | 2617 |
| 214 | Ga0068864_100184809 | 3300005618 | Bacteria | 1907 |
| 215 | Ga0068861_100105393 | 3300005719 | Bacteria | 2251 |
| 216 | Ga0068861_100393112 | 3300005719 | Bacteria | 1228 |
| 217 | Ga0068861_100460110 | 3300005719 | Bacteria | 1142 |
| 218 | Ga0068851_10000843 | 3300005834 | Bacteria | 13213 |
| 219 | Ga0068870_10065494 | 3300005840 | Bacteria | 1966 |
| 220 | Ga0068863_100002048 | 3300005841 | Bacteria | 19982 |
| 221 | Ga0068863_100034799 | 3300005841 | Bacteria | 4797 |
| 222 | Ga0068863_100071222 | 3300005841 | Bacteria | 3289 |
| 223 | Ga0068863_100107675 | 3300005841 | Bacteria | 2652 |
| 224 | Ga0068863_100119529 | 3300005841 | Bacteria | 2512 |
| 225 | Ga0068863_100152090 | 3300005841 | Bacteria | 2214 |
| 226 | Ga0068863_100152743 | 3300005841 | Bacteria | 2210 |
| 227 | Ga0068863_100154405 | 3300005841 | Bacteria | 2197 |
| 228 | Ga0068858_100002570 | 3300005842 | Bacteria | 18284 |
| 229 | Ga0068858_100252112 | 3300005842 | Bacteria | 1677 |
| 230 | Ga0068858_100266980 | 3300005842 | Bacteria | 1628 |
| 231 | Ga0068858_100325491 | 3300005842 | Bacteria | 1469 |
| 232 | Ga0068858_100539810 | 3300005842 | Bacteria | 1129 |
| 233 | Ga0068860_100008382 | 3300005843 | Bacteria | 10293 |
| 234 | Ga0068860_100012965 | 3300005843 | Bacteria | 8187 |
| 235 | Ga0068860_100057346 | 3300005843 | Bacteria | 3702 |
| 236 | Ga0068860_100075322 | 3300005843 | Bacteria | 3210 |
| 237 | Ga0068862_100113099 | 3300005844 | Bacteria | 2385 |
| 238 | Ga0068862_100145352 | 3300005844 | Bacteria | 2107 |
| 239 | Ga0068862_100154254 | 3300005844 | Bacteria | 2046 |
| 240 | Ga0068862_100173498 | 3300005844 | Bacteria | 1931 |
| 241 | Ga0068862_100634976 | 3300005844 | Bacteria | 1028 |
| 242 | Ga0070717_10179449 | 3300006028 | Bacteria | 1845 |
| 243 | Ga0075365_10162457 | 3300006038 | Bacteria | 1557 |
| 244 | Ga0075365_10299676 | 3300006038 | Bacteria | 1131 |
| 245 | Ga0075368_10114950 | 3300006042 | Bacteria | 1111 |
| 246 | Ga0075363_100036983 | 3300006048 | Bacteria | 2562 |
| 247 | Ga0075364_10109509 | 3300006051 | Bacteria | 1842 |
| 248 | Ga0075364_10161447 | 3300006051 | Bacteria | 1513 |
| 249 | Ga0075364_10302949 | 3300006051 | Bacteria | 1088 |
| 250 | Ga0075364_10350918 | 3300006051 | Bacteria | 1006 |
| 251 | Ga0075362_10062690 | 3300006177 | Bacteria | 1685 |
| 252 | Ga0075367_10010982 | 3300006178 | Bacteria | 4774 |
| 253 | Ga0075367_10018189 | 3300006178 | Bacteria | 3873 |
| 254 | Ga0075367_10166400 | 3300006178 | Bacteria | 1372 |
| 255 | Ga0075369_10009596 | 3300006186 | Bacteria | 3764 |
| 256 | Ga0075369_10059355 | 3300006186 | Bacteria | 1666 |
| 257 | Ga0075369_10086249 | 3300006186 | Bacteria | 1397 |
| 258 | Ga0075369_10205939 | 3300006186 | Bacteria | 908 |
| 259 | Ga0075366_10002787 | 3300006195 | Bacteria | 9038 |
| 260 | Ga0075366_10015678 | 3300006195 | Bacteria | 4349 |
| 261 | Ga0075366_10064729 | 3300006195 | Bacteria | 2174 |
| 262 | Ga0075366_10143252 | 3300006195 | Bacteria | 1445 |
| 263 | Ga0075366_10210536 | 3300006195 | Bacteria | 1183 |
| 264 | Ga0097621_100007338 | 3300006237 | Bacteria | 7881 |
| 265 | Ga0097621_100037524 | 3300006237 | Bacteria | 3884 |
| 266 | Ga0097621_100140720 | 3300006237 | Bacteria | 2061 |
| 267 | Ga0097621_100241368 | 3300006237 | Bacteria | 1579 |
| 268 | Ga0097621_100404665 | 3300006237 | Bacteria | 1222 |
| 269 | Ga0097621_100450408 | 3300006237 | Bacteria | 1160 |
| 270 | Ga0097621_100558114 | 3300006237 | Bacteria | 1043 |
| 271 | Ga0075370_10006766 | 3300006353 | Bacteria | 5792 |
| 272 | Ga0075370_10024220 | 3300006353 | Bacteria | 3351 |
| 273 | Ga0075370_10027723 | 3300006353 | Bacteria | 3145 |
| 274 | Ga0075370_10063075 | 3300006353 | Bacteria | 2112 |
| 275 | Ga0075370_10070550 | 3300006353 | Bacteria | 1998 |
| 276 | Ga0075370_10127002 | 3300006353 | Bacteria | 1487 |
| 277 | Ga0068871_100064731 | 3300006358 | Bacteria | 2993 |
| 278 | Ga0068871_100230418 | 3300006358 | Bacteria | 1608 |
| 279 | Ga0068871_100473496 | 3300006358 | Bacteria | 1126 |
| 280 | Ga0075428_100101687 | 3300006844 | Bacteria | 3133 |
| 281 | Ga0075430_100034456 | 3300006846 | Bacteria | 4297 |
| 282 | Ga0075430_100109091 | 3300006846 | Bacteria | 2309 |
| 283 | Ga0075431_100034361 | 3300006847 | Bacteria | 5223 |
| 284 | Ga0075431_100052328 | 3300006847 | Bacteria | 4211 |
| 285 | Ga0075429_100029093 | 3300006880 | Bacteria | 4799 |
| 286 | Ga0075429_100193894 | 3300006880 | Bacteria | 1780 |
| 287 | Ga0068865_100006221 | 3300006881 | Bacteria | 7277 |
| 288 | Ga0068865_100022991 | 3300006881 | Bacteria | 4075 |
| 289 | Ga0068865_100041947 | 3300006881 | Bacteria | 3117 |
| 290 | Ga0068865_100114232 | 3300006881 | Bacteria | 1997 |
| 291 | Ga0068865_100426501 | 3300006881 | Bacteria | 1091 |
| 292 | Ga0097620_100023045 | 3300006931 | Bacteria | 6243 |
| 293 | Ga0097620_100098578 | 3300006931 | Bacteria | 2977 |
| 294 | Ga0097620_100121412 | 3300006931 | Bacteria | 2679 |
| 295 | Ga0097620_100473176 | 3300006931 | Bacteria | 1348 |
| 296 | Ga0079104_1000206 | 3300006946 | Bacteria | 82424 |
| 297 | Ga0099826_10000021 | 3300006948 | Bacteria | 173580 |
| 298 | Ga0105251_10159709 | 3300009011 | Bacteria | 1016 |
| 299 | Ga0105244_10000031 | 3300009036 | Bacteria | 177606 |
| 300 | Ga0105244_10003602 | 3300009036 | Bacteria | 11001 |
| 301 | Ga0105240_10008920 | 3300009093 | Bacteria | 14257 |
| 302 | Ga0105240_10041470 | 3300009093 | Bacteria | 5875 |
| 303 | Ga0105240_10059308 | 3300009093 | Bacteria | 4776 |
| 304 | Ga0105240_10112031 | 3300009093 | Bacteria | 3299 |
| 305 | Ga0105240_10290611 | 3300009093 | Bacteria | 1874 |
| 306 | Ga0111539_10058487 | 3300009094 | Bacteria | 4573 |
| 307 | Ga0105245_10105475 | 3300009098 | Bacteria | 2614 |
| 308 | Ga0105247_10353938 | 3300009101 | Bacteria | 1033 |
| 309 | Ga0105243_10000765 | 3300009148 | Bacteria | 30835 |
| 310 | Ga0105243_10024959 | 3300009148 | Bacteria | 4564 |
| 311 | Ga0105243_10041298 | 3300009148 | Bacteria | 3607 |
| 312 | Ga0105243_10251968 | 3300009148 | Bacteria | 1577 |
| 313 | Ga0105243_10438575 | 3300009148 | Bacteria | 1222 |
| 314 | Ga0105241_10165743 | 3300009174 | Bacteria | 1821 |
| 315 | Ga0105242_10090130 | 3300009176 | Bacteria | 2579 |
| 316 | Ga0105242_10448469 | 3300009176 | Bacteria | 1216 |
| 317 | Ga0105248_10086277 | 3300009177 | Bacteria | 3532 |
| 318 | Ga0105248_10116526 | 3300009177 | Bacteria | 3013 |
| 319 | Ga0105248_10119263 | 3300009177 | Bacteria | 2976 |
| 320 | Ga0105248_10268583 | 3300009177 | Bacteria | 1921 |
| 321 | Ga0105248_10285586 | 3300009177 | Bacteria | 1858 |
| 322 | Ga0105237_10051964 | 3300009545 | Bacteria | 4116 |
| 323 | Ga0105237_10103567 | 3300009545 | Bacteria | 2838 |
| 324 | Ga0105237_10175171 | 3300009545 | Bacteria | 2145 |
| 325 | Ga0105237_10279165 | 3300009545 | Bacteria | 1673 |
| 326 | Ga0105238_10000065 | 3300009551 | Bacteria | 121196 |
| 327 | Ga0105238_10063764 | 3300009551 | Bacteria | 3686 |
| 328 | Ga0105238_10196657 | 3300009551 | Bacteria | 1992 |
| 329 | Ga0105249_10086300 | 3300009553 | Bacteria | 2927 |
| 330 | Ga0105249_10091395 | 3300009553 | Bacteria | 2848 |
| 331 | Ga0105239_10054735 | 3300010375 | Bacteria | 4377 |
| 332 | Ga0105239_10063942 | 3300010375 | Bacteria | 4040 |
| 333 | Ga0105239_10159772 | 3300010375 | Bacteria | 2517 |
| 334 | Ga0105239_10709275 | 3300010375 | Bacteria | 1150 |
| 335 | Ga0105246_10165345 | 3300011119 | Bacteria | 1689 |
| 336 | Ga0105246_10402965 | 3300011119 | Bacteria | 1136 |
| 337 | Ga0157319_1000695 | 3300012497 | Bacteria | 1560 |
| 338 | Ga0157339_1001068 | 3300012505 | Bacteria | 1581 |
| 339 | Ga0157371_10045298 | 3300013102 | Bacteria | 3130 |
| 340 | Ga0157370_10002003 | 3300013104 | Bacteria | 25038 |
| 341 | Ga0157370_10310879 | 3300013104 | Bacteria | 1454 |
| 342 | Ga0157369_10035810 | 3300013105 | Bacteria | 5441 |
| 343 | Ga0157374_10050728 | 3300013296 | Bacteria | 3858 |
| 344 | Ga0157374_10110971 | 3300013296 | Bacteria | 2638 |
| 345 | Ga0157374_10146904 | 3300013296 | Bacteria | 2290 |
| 346 | Ga0157374_10446048 | 3300013296 | Bacteria | 1295 |
| 347 | Ga0157374_10482189 | 3300013296 | Bacteria | 1243 |
| 348 | Ga0157374_10606869 | 3300013296 | Bacteria | 1104 |
| 349 | Ga0157378_10040681 | 3300013297 | Bacteria | 4123 |
| 350 | Ga0157378_10070198 | 3300013297 | Bacteria | 3144 |
| 351 | Ga0157378_10240961 | 3300013297 | Bacteria | 1727 |
| 352 | Ga0157378_10378962 | 3300013297 | Bacteria | 1389 |
| 353 | Ga0157378_10508236 | 3300013297 | Bacteria | 1205 |
| 354 | Ga0157378_10516439 | 3300013297 | Bacteria | 1195 |
| 355 | Ga0163162_10047977 | 3300013306 | Bacteria | 4279 |
| 356 | Ga0163162_10077315 | 3300013306 | Bacteria | 3391 |
| 357 | Ga0163162_10115597 | 3300013306 | Bacteria | 2783 |
| 358 | Ga0163162_10122403 | 3300013306 | Bacteria | 2706 |
| 359 | Ga0163162_10221744 | 3300013306 | Bacteria | 2021 |
| 360 | Ga0163162_10599824 | 3300013306 | Bacteria | 1227 |
| 361 | Ga0157372_10060900 | 3300013307 | Bacteria | 4224 |
| 362 | Ga0157375_10011762 | 3300013308 | Bacteria | 7738 |
| 363 | Ga0157375_10035622 | 3300013308 | Bacteria | 4752 |
| 364 | Ga0157375_10049483 | 3300013308 | Bacteria | 4118 |
| 365 | Ga0157375_10059297 | 3300013308 | Bacteria | 3791 |
| 366 | Ga0157375_10064588 | 3300013308 | Bacteria | 3645 |
| 367 | Ga0157375_10219009 | 3300013308 | Bacteria | 2062 |
| 368 | Ga0157375_10233301 | 3300013308 | Bacteria | 1999 |
| 369 | Ga0157375_10451319 | 3300013308 | Bacteria | 1451 |
| 370 | Ga0163163_10217309 | 3300014325 | Bacteria | 1960 |
| 371 | Ga0163163_10218492 | 3300014325 | Bacteria | 1954 |
| 372 | Ga0157380_10009058 | 3300014326 | Bacteria | 7112 |
| 373 | Ga0182008_10024475 | 3300014497 | Bacteria | 3075 |
| 374 | Ga0182008_10037502 | 3300014497 | Bacteria | 2425 |
| 375 | Ga0182008_10053291 | 3300014497 | Bacteria | 2003 |
| 376 | Ga0182008_10079655 | 3300014497 | Bacteria | 1612 |
| 377 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 378 | Ga0157379_10008726 | 3300014968 | Bacteria | 8833 |
| 379 | Ga0157379_10048728 | 3300014968 | Bacteria | 3782 |
| 380 | Ga0157379_10049079 | 3300014968 | Bacteria | 3768 |
| 381 | Ga0157379_10281376 | 3300014968 | Bacteria | 1514 |
| 382 | Ga0157376_10106693 | 3300014969 | Bacteria | 2458 |
| 383 | Ga0157376_10215134 | 3300014969 | Bacteria | 1776 |
| 384 | Ga0157376_10328135 | 3300014969 | Bacteria | 1457 |
| 385 | Ga0182006_1002966 | 3300015261 | Bacteria | 8953 |
| 386 | Ga0182006_1014559 | 3300015261 | Bacteria | 3387 |
| 387 | Ga0182007_10002108 | 3300015262 | Bacteria | 10177 |
| 388 | Ga0182007_10016980 | 3300015262 | Bacteria | 2670 |
| 389 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 390 | Ga0163161_10032312 | 3300017792 | Bacteria | 3736 |
| 391 | Ga0163161_10040898 | 3300017792 | Bacteria | 3330 |
| 392 | Ga0163161_10141036 | 3300017792 | Bacteria | 1825 |
| 393 | Ga0163161_10155206 | 3300017792 | Bacteria | 1742 |
| 394 | Ga0163161_10233374 | 3300017792 | Bacteria | 1428 |
| 395 | Ga0163161_10272017 | 3300017792 | Bacteria | 1326 |
| 396 | Ga0213872_10016125 | 3300021361 | Bacteria | 3469 |
| 397 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 398 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 399 | Ga0209435_100290 | 3300025206 | Bacteria | 12177 |
| 400 | Ga0209436_104004 | 3300025208 | Bacteria | 3726 |
| 401 | Ga0209436_105266 | 3300025208 | Bacteria | 3005 |
| 402 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 403 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 404 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 405 | Ga0209672_102201 | 3300025228 | Bacteria | 5090 |
| 406 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 407 | Ga0209147_100843 | 3300025229 | Bacteria | 14406 |
| 408 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 409 | Ga0209437_100758 | 3300025233 | Bacteria | 15571 |
| 410 | Ga0209258_100020 | 3300025242 | Bacteria | 565241 |
| 411 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 412 | Ga0207425_1000814 | 3300025245 | Bacteria | 15617 |
| 413 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 414 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 415 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 416 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 417 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 418 | Ga0209026_1003765 | 3300025250 | Bacteria | 4808 |
| 419 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 420 | Ga0209148_1000031 | 3300025254 | Bacteria | 564601 |
| 421 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 422 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 423 | Ga0209759_1000357 | 3300025256 | Bacteria | 59208 |
| 424 | Ga0209129_1000055 | 3300025258 | Bacteria | 261708 |
| 425 | Ga0209129_1006666 | 3300025258 | Bacteria | 3660 |
| 426 | Ga0209565_1000078 | 3300025263 | Bacteria | 160838 |
| 427 | Ga0209565_1000310 | 3300025263 | Bacteria | 45322 |
| 428 | Ga0209565_1000615 | 3300025263 | Bacteria | 23470 |
| 429 | Ga0209565_1001707 | 3300025263 | Bacteria | 9041 |
| 430 | Ga0209565_1016361 | 3300025263 | Bacteria | 1651 |
| 431 | Ga0209673_1000170 | 3300025273 | Bacteria | 133933 |
| 432 | Ga0209673_1001531 | 3300025273 | Bacteria | 21069 |
| 433 | Ga0209673_1002628 | 3300025273 | Bacteria | 12057 |
| 434 | Ga0209673_1011259 | 3300025273 | Bacteria | 3700 |
| 435 | Ga0209673_1026678 | 3300025273 | Bacteria | 1892 |
| 436 | Ga0209673_1027129 | 3300025273 | Bacteria | 1868 |
| 437 | Ga0209130_1000289 | 3300025284 | Bacteria | 61485 |
| 438 | Ga0209130_1000807 | 3300025284 | Bacteria | 26513 |
| 439 | Ga0209130_1001274 | 3300025284 | Bacteria | 17481 |
| 440 | Ga0209130_1011749 | 3300025284 | Bacteria | 2329 |
| 441 | Ga0209130_1012738 | 3300025284 | Bacteria | 2184 |
| 442 | Ga0209675_1000055 | 3300025291 | Bacteria | 193129 |
| 443 | Ga0209675_1001778 | 3300025291 | Bacteria | 11775 |
| 444 | Ga0209675_1002139 | 3300025291 | Bacteria | 10421 |
| 445 | Ga0209675_1010406 | 3300025291 | Bacteria | 3179 |
| 446 | Ga0209675_1016325 | 3300025291 | Bacteria | 2168 |
| 447 | Ga0209675_1018963 | 3300025291 | Bacteria | 1908 |
| 448 | Ga0209676_1000040 | 3300025292 | Bacteria | 438184 |
| 449 | Ga0209676_1003179 | 3300025292 | Bacteria | 10438 |
| 450 | Ga0209676_1011949 | 3300025292 | Bacteria | 3455 |
| 451 | Ga0209676_1013043 | 3300025292 | Bacteria | 3219 |
| 452 | Ga0209676_1017739 | 3300025292 | Bacteria | 2507 |
| 453 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 454 | Ga0209025_1000409 | 3300025294 | Bacteria | 86577 |
| 455 | Ga0209025_1001751 | 3300025294 | Bacteria | 26059 |
| 456 | Ga0209025_1009368 | 3300025294 | Bacteria | 6843 |
| 457 | Ga0209025_1010755 | 3300025294 | Bacteria | 6151 |
| 458 | Ga0209025_1018466 | 3300025294 | Bacteria | 3947 |
| 459 | Ga0209025_1051447 | 3300025294 | Bacteria | 1636 |
| 460 | Ga0209564_1000157 | 3300025295 | Bacteria | 164758 |
| 461 | Ga0209564_1000806 | 3300025295 | Bacteria | 42875 |
| 462 | Ga0209564_1001767 | 3300025295 | Bacteria | 20130 |
| 463 | Ga0209564_1002258 | 3300025295 | Bacteria | 15792 |
| 464 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 465 | Ga0209758_1005953 | 3300025297 | Bacteria | 9040 |
| 466 | Ga0209758_1040043 | 3300025297 | Bacteria | 1773 |
| 467 | Ga0209050_1000021 | 3300025298 | Bacteria | 574406 |
| 468 | Ga0209050_1000760 | 3300025298 | Bacteria | 46346 |
| 469 | Ga0209050_1003967 | 3300025298 | Bacteria | 10438 |
| 470 | Ga0209050_1004794 | 3300025298 | Bacteria | 8911 |
| 471 | Ga0209050_1015628 | 3300025298 | Bacteria | 3170 |
| 472 | Ga0209050_1041968 | 3300025298 | Bacteria | 1255 |
| 473 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 474 | Ga0209256_1000056 | 3300025299 | Bacteria | 283044 |
| 475 | Ga0209256_1000124 | 3300025299 | Bacteria | 165390 |
| 476 | Ga0209256_1000127 | 3300025299 | Bacteria | 164393 |
| 477 | Ga0209256_1000906 | 3300025299 | Bacteria | 36323 |
| 478 | Ga0207426_1000055 | 3300025302 | Bacteria | 374450 |
| 479 | Ga0207426_1000079 | 3300025302 | Bacteria | 314709 |
| 480 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 481 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 482 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 483 | Ga0209051_1000351 | 3300025303 | Bacteria | 68445 |
| 484 | Ga0209051_1000423 | 3300025303 | Bacteria | 58174 |
| 485 | Ga0209051_1000446 | 3300025303 | Bacteria | 55218 |
| 486 | Ga0209051_1000530 | 3300025303 | Bacteria | 47308 |
| 487 | Ga0209051_1008921 | 3300025303 | Bacteria | 5237 |
| 488 | Ga0209051_1013428 | 3300025303 | Bacteria | 3898 |
| 489 | Ga0209051_1015139 | 3300025303 | Bacteria | 3562 |
| 490 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 491 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 492 | Ga0209257_1000043 | 3300025304 | Bacteria | 512127 |
| 493 | Ga0209257_1001377 | 3300025304 | Bacteria | 29185 |
| 494 | Ga0209257_1003725 | 3300025304 | Bacteria | 12653 |
| 495 | Ga0209257_1013914 | 3300025304 | Bacteria | 3516 |
| 496 | Ga0209257_1024395 | 3300025304 | Bacteria | 2094 |
| 497 | Ga0207697_10020918 | 3300025315 | Bacteria | 2679 |
| 498 | Ga0207656_10087638 | 3300025321 | Bacteria | 1408 |
| 499 | Ga0207656_10170628 | 3300025321 | Bacteria | 1040 |
| 500 | Ga0207655_1000029 | 3300025728 | Bacteria | 432187 |
| 501 | Ga0207655_1005080 | 3300025728 | Bacteria | 9094 |
| 502 | Ga0207682_10001047 | 3300025893 | Bacteria | 12739 |
| 503 | Ga0207682_10006237 | 3300025893 | Bacteria | 4818 |
| 504 | Ga0207682_10095522 | 3300025893 | Bacteria | 1294 |
| 505 | Ga0207642_10044161 | 3300025899 | Bacteria | 1971 |
| 506 | Ga0207642_10136047 | 3300025899 | Bacteria | 1289 |
| 507 | Ga0207688_10043780 | 3300025901 | Bacteria | 2494 |
| 508 | Ga0207680_10001068 | 3300025903 | Bacteria | 12931 |
| 509 | Ga0207680_10039848 | 3300025903 | Bacteria | 2729 |
| 510 | Ga0207680_10056911 | 3300025903 | Bacteria | 2364 |
| 511 | Ga0207680_10424525 | 3300025903 | Bacteria | 942 |
| 512 | Ga0207645_10004706 | 3300025907 | Bacteria | 10041 |
| 513 | Ga0207645_10014655 | 3300025907 | Bacteria | 5235 |
| 514 | Ga0207645_10071087 | 3300025907 | Bacteria | 2227 |
| 515 | Ga0207645_10094840 | 3300025907 | Bacteria | 1921 |
| 516 | Ga0207645_10095900 | 3300025907 | Bacteria | 1910 |
| 517 | Ga0207643_10017706 | 3300025908 | Bacteria | 3899 |
| 518 | Ga0207643_10042663 | 3300025908 | Bacteria | 2558 |
| 519 | Ga0207643_10080252 | 3300025908 | Bacteria | 1890 |
| 520 | Ga0207684_10023176 | 3300025910 | Bacteria | 5302 |
| 521 | Ga0207695_10002732 | 3300025913 | Bacteria | 25730 |
| 522 | Ga0207695_10007216 | 3300025913 | Bacteria | 14208 |
| 523 | Ga0207695_10082478 | 3300025913 | Bacteria | 3250 |
| 524 | Ga0207695_10123453 | 3300025913 | Bacteria | 2555 |
| 525 | Ga0207695_10178105 | 3300025913 | Bacteria | 2048 |
| 526 | Ga0207695_10628475 | 3300025913 | Bacteria | 955 |
| 527 | Ga0207671_10002693 | 3300025914 | Bacteria | 18627 |
| 528 | Ga0207671_10061344 | 3300025914 | Bacteria | 2790 |
| 529 | Ga0207671_10126738 | 3300025914 | Bacteria | 1956 |
| 530 | Ga0207671_10214023 | 3300025914 | Bacteria | 1508 |
| 531 | Ga0207662_10027183 | 3300025918 | Bacteria | 3303 |
| 532 | Ga0207662_10199852 | 3300025918 | Bacteria | 1293 |
| 533 | Ga0207657_10255358 | 3300025919 | Bacteria | 1396 |
| 534 | Ga0207649_10324495 | 3300025920 | Bacteria | 1132 |
| 535 | Ga0207681_10006325 | 3300025923 | Bacteria | 7268 |
| 536 | Ga0207681_10079980 | 3300025923 | Bacteria | 2304 |
| 537 | Ga0207681_10098926 | 3300025923 | Bacteria | 2099 |
| 538 | Ga0207694_10000977 | 3300025924 | Bacteria | 25038 |
| 539 | Ga0207694_10281387 | 3300025924 | Bacteria | 1366 |
| 540 | Ga0207694_10349242 | 3300025924 | Bacteria | 1224 |
| 541 | Ga0207650_10000710 | 3300025925 | Bacteria | 25994 |
| 542 | Ga0207650_10009975 | 3300025925 | Bacteria | 6501 |
| 543 | Ga0207650_10028205 | 3300025925 | Bacteria | 4023 |
| 544 | Ga0207650_10046048 | 3300025925 | Bacteria | 3211 |
| 545 | Ga0207650_10066503 | 3300025925 | Bacteria | 2703 |
| 546 | Ga0207650_10067275 | 3300025925 | Bacteria | 2688 |
| 547 | Ga0207650_10101393 | 3300025925 | Bacteria | 2216 |
| 548 | Ga0207650_10164554 | 3300025925 | Bacteria | 1759 |
| 549 | Ga0207659_10000322 | 3300025926 | Bacteria | 28877 |
| 550 | Ga0207659_10008216 | 3300025926 | Bacteria | 6469 |
| 551 | Ga0207659_10008726 | 3300025926 | Bacteria | 6309 |
| 552 | Ga0207659_10015561 | 3300025926 | Bacteria | 4932 |
| 553 | Ga0207659_10065728 | 3300025926 | Bacteria | 2629 |
| 554 | Ga0207659_10165010 | 3300025926 | Bacteria | 1742 |
| 555 | Ga0207659_10240214 | 3300025926 | Bacteria | 1465 |
| 556 | Ga0207644_10001344 | 3300025931 | Bacteria | 15805 |
| 557 | Ga0207644_10001677 | 3300025931 | Bacteria | 14280 |
| 558 | Ga0207644_10032216 | 3300025931 | Bacteria | 3655 |
| 559 | Ga0207644_10087523 | 3300025931 | Bacteria | 2315 |
| 560 | Ga0207644_10104089 | 3300025931 | Bacteria | 2136 |
| 561 | Ga0207644_10129888 | 3300025931 | Bacteria | 1927 |
| 562 | Ga0207690_10313305 | 3300025932 | Bacteria | 1231 |
| 563 | Ga0207706_10003941 | 3300025933 | Bacteria | 14064 |
| 564 | Ga0207706_10102503 | 3300025933 | Bacteria | 2518 |
| 565 | Ga0207706_10115153 | 3300025933 | Bacteria | 2364 |
| 566 | Ga0207706_10348057 | 3300025933 | Bacteria | 1289 |
| 567 | Ga0207709_10000602 | 3300025935 | Bacteria | 29841 |
| 568 | Ga0207709_10022513 | 3300025935 | Bacteria | 3574 |
| 569 | Ga0207709_10040350 | 3300025935 | Bacteria | 2795 |
| 570 | Ga0207670_10011674 | 3300025936 | Bacteria | 5110 |
| 571 | Ga0207670_10048461 | 3300025936 | Bacteria | 2835 |
| 572 | Ga0207669_10003485 | 3300025937 | Bacteria | 6803 |
| 573 | Ga0207669_10003984 | 3300025937 | Bacteria | 6454 |
| 574 | Ga0207669_10343979 | 3300025937 | Bacteria | 1149 |
| 575 | Ga0207691_10000018 | 3300025940 | Bacteria | 134343 |
| 576 | Ga0207691_10012940 | 3300025940 | Bacteria | 7991 |
| 577 | Ga0207691_10028725 | 3300025940 | Bacteria | 5204 |
| 578 | Ga0207691_10182602 | 3300025940 | Bacteria | 1833 |
| 579 | Ga0207691_10186128 | 3300025940 | Bacteria | 1813 |
| 580 | Ga0207691_10214481 | 3300025940 | Bacteria | 1671 |
| 581 | Ga0207691_10234077 | 3300025940 | Bacteria | 1590 |
| 582 | Ga0207691_10270263 | 3300025940 | Bacteria | 1464 |
| 583 | Ga0207691_10419650 | 3300025940 | Bacteria | 1140 |
| 584 | Ga0207691_10446115 | 3300025940 | Bacteria | 1101 |
| 585 | Ga0207711_10005256 | 3300025941 | Bacteria | 10975 |
| 586 | Ga0207711_10042630 | 3300025941 | Bacteria | 3867 |
| 587 | Ga0207711_10089412 | 3300025941 | Bacteria | 2706 |
| 588 | Ga0207711_10211901 | 3300025941 | Bacteria | 1770 |
| 589 | Ga0207711_10435873 | 3300025941 | Bacteria | 1219 |
| 590 | Ga0207689_10006735 | 3300025942 | Bacteria | 10132 |
| 591 | Ga0207689_10007284 | 3300025942 | Bacteria | 9712 |
| 592 | Ga0207689_10061475 | 3300025942 | Bacteria | 3089 |
| 593 | Ga0207689_10167766 | 3300025942 | Bacteria | 1809 |
| 594 | Ga0207689_10367962 | 3300025942 | Bacteria | 1196 |
| 595 | Ga0207689_10472244 | 3300025942 | Bacteria | 1050 |
| 596 | Ga0207661_10192549 | 3300025944 | Bacteria | 1788 |
| 597 | Ga0207679_10042747 | 3300025945 | Bacteria | 3259 |
| 598 | Ga0207679_10065938 | 3300025945 | Bacteria | 2711 |
| 599 | Ga0207679_10091344 | 3300025945 | Bacteria | 2356 |
| 600 | Ga0207679_10132589 | 3300025945 | Bacteria | 2001 |
| 601 | Ga0207667_10011582 | 3300025949 | Bacteria | 10240 |
| 602 | Ga0207667_10016772 | 3300025949 | Bacteria | 8264 |
| 603 | Ga0207667_10433859 | 3300025949 | Bacteria | 1336 |
| 604 | Ga0207667_10644054 | 3300025949 | Bacteria | 1066 |
| 605 | Ga0207651_10003638 | 3300025960 | Bacteria | 7603 |
| 606 | Ga0207651_10037982 | 3300025960 | Bacteria | 3159 |
| 607 | Ga0207651_10150357 | 3300025960 | Bacteria | 1811 |
| 608 | Ga0207651_10192900 | 3300025960 | Bacteria | 1626 |
| 609 | Ga0207712_10076268 | 3300025961 | Bacteria | 2426 |
| 610 | Ga0207668_10020765 | 3300025972 | Bacteria | 4180 |
| 611 | Ga0207668_10211799 | 3300025972 | Bacteria | 1550 |
| 612 | Ga0207668_10287717 | 3300025972 | Bacteria | 1351 |
| 613 | Ga0207640_10211336 | 3300025981 | Bacteria | 1478 |
| 614 | Ga0207640_10234350 | 3300025981 | Bacteria | 1414 |
| 615 | Ga0207640_10291698 | 3300025981 | Bacteria | 1286 |
| 616 | Ga0207658_10006133 | 3300025986 | Bacteria | 8204 |
| 617 | Ga0207658_10023598 | 3300025986 | Bacteria | 4295 |
| 618 | Ga0207658_10032603 | 3300025986 | Bacteria | 3709 |
| 619 | Ga0207658_10050765 | 3300025986 | Bacteria | 3054 |
| 620 | Ga0207658_10118246 | 3300025986 | Bacteria | 2108 |
| 621 | Ga0207658_10267976 | 3300025986 | Bacteria | 1458 |
| 622 | Ga0207677_10004386 | 3300026023 | Bacteria | 7561 |
| 623 | Ga0207677_10006410 | 3300026023 | Bacteria | 6452 |
| 624 | Ga0207677_10006484 | 3300026023 | Bacteria | 6427 |
| 625 | Ga0207677_10012052 | 3300026023 | Bacteria | 4952 |
| 626 | Ga0207677_10195210 | 3300026023 | Bacteria | 1604 |
| 627 | Ga0207677_10433020 | 3300026023 | Bacteria | 1123 |
| 628 | Ga0207703_10000817 | 3300026035 | Bacteria | 30675 |
| 629 | Ga0207703_10047463 | 3300026035 | Bacteria | 3463 |
| 630 | Ga0207703_10085234 | 3300026035 | Bacteria | 2643 |
| 631 | Ga0207639_10009051 | 3300026041 | Bacteria | 6860 |
| 632 | Ga0207678_10048631 | 3300026067 | Bacteria | 3665 |
| 633 | Ga0207641_10005073 | 3300026088 | Bacteria | 11290 |
| 634 | Ga0207641_10049395 | 3300026088 | Bacteria | 3555 |
| 635 | Ga0207641_10074666 | 3300026088 | Bacteria | 2925 |
| 636 | Ga0207641_10083149 | 3300026088 | Bacteria | 2783 |
| 637 | Ga0207641_10182140 | 3300026088 | Bacteria | 1925 |
| 638 | Ga0207648_10000515 | 3300026089 | Bacteria | 43207 |
| 639 | Ga0207648_10026670 | 3300026089 | Bacteria | 5132 |
| 640 | Ga0207648_10032136 | 3300026089 | Bacteria | 4637 |
| 641 | Ga0207648_10052000 | 3300026089 | Bacteria | 3581 |
| 642 | Ga0207648_10077196 | 3300026089 | Bacteria | 2903 |
| 643 | Ga0207648_10086284 | 3300026089 | Bacteria | 2738 |
| 644 | Ga0207648_10124194 | 3300026089 | Bacteria | 2270 |
| 645 | Ga0207648_10135345 | 3300026089 | Bacteria | 2170 |
| 646 | Ga0207648_10148502 | 3300026089 | Bacteria | 2068 |
| 647 | Ga0207648_10244922 | 3300026089 | Bacteria | 1597 |
| 648 | Ga0207676_10001475 | 3300026095 | Bacteria | 17445 |
| 649 | Ga0207676_10010532 | 3300026095 | Bacteria | 6588 |
| 650 | Ga0207676_10011558 | 3300026095 | Bacteria | 6314 |
| 651 | Ga0207676_10017436 | 3300026095 | Bacteria | 5203 |
| 652 | Ga0207676_10019636 | 3300026095 | Bacteria | 4933 |
| 653 | Ga0207676_10078691 | 3300026095 | Bacteria | 2671 |
| 654 | Ga0207676_10112667 | 3300026095 | Bacteria | 2279 |
| 655 | Ga0207676_10250526 | 3300026095 | Bacteria | 1594 |
| 656 | Ga0207674_10012362 | 3300026116 | Bacteria | 9542 |
| 657 | Ga0207674_10016088 | 3300026116 | Bacteria | 8193 |
| 658 | Ga0207674_10050876 | 3300026116 | Bacteria | 4230 |
| 659 | Ga0207674_10076115 | 3300026116 | Bacteria | 3365 |
| 660 | Ga0207674_10202405 | 3300026116 | Bacteria | 1935 |
| 661 | Ga0207674_10217177 | 3300026116 | Bacteria | 1860 |
| 662 | Ga0207675_100004701 | 3300026118 | Bacteria | 13140 |
| 663 | Ga0207675_100024107 | 3300026118 | Bacteria | 5657 |
| 664 | Ga0207675_100030188 | 3300026118 | Bacteria | 5049 |
| 665 | Ga0207675_100049796 | 3300026118 | Bacteria | 3909 |
| 666 | Ga0207675_100057248 | 3300026118 | Bacteria | 3637 |
| 667 | Ga0207675_100225865 | 3300026118 | Bacteria | 1805 |
| 668 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 669 | Ga0207683_10024111 | 3300026121 | Bacteria | 5236 |
| 670 | Ga0207683_10044935 | 3300026121 | Bacteria | 3862 |
| 671 | Ga0207683_10089845 | 3300026121 | Bacteria | 2734 |
| 672 | Ga0207683_10104296 | 3300026121 | Bacteria | 2534 |
| 673 | Ga0207683_10113807 | 3300026121 | Bacteria | 2424 |
| 674 | Ga0207683_10219993 | 3300026121 | Bacteria | 1730 |
| 675 | Ga0207683_10396596 | 3300026121 | Bacteria | 1269 |
| 676 | Ga0207698_10007168 | 3300026142 | Bacteria | 6981 |
| 677 | Ga0207698_10038539 | 3300026142 | Bacteria | 3532 |
| 678 | Ga0207698_10146995 | 3300026142 | Bacteria | 2040 |
| 679 | Ga0207698_10253160 | 3300026142 | Bacteria | 1613 |
| 680 | Ga0209281_1000259 | 3300027111 | Bacteria | 101905 |
| 681 | Ga0209970_1000196 | 3300027614 | Bacteria | 9671 |
| 682 | Ga0209282_1000019 | 3300027666 | Bacteria | 184034 |
| 683 | Ga0209282_1000139 | 3300027666 | Bacteria | 42847 |
| 684 | Ga0209813_10024788 | 3300027866 | Bacteria | 1719 |
| 685 | Ga0268266_10018522 | 3300028379 | Bacteria | 5933 |
| 686 | Ga0268266_10024477 | 3300028379 | Bacteria | 5133 |
| 687 | Ga0268266_10040123 | 3300028379 | Bacteria | 3989 |
| 688 | Ga0268266_10271557 | 3300028379 | Bacteria | 1574 |
| 689 | Ga0268265_10011207 | 3300028380 | Bacteria | 6060 |
| 690 | Ga0268265_10029780 | 3300028380 | Bacteria | 3924 |
| 691 | Ga0268265_10137561 | 3300028380 | Bacteria | 2040 |
| 692 | Ga0268265_10298618 | 3300028380 | Bacteria | 1449 |
| 693 | Ga0268264_10003598 | 3300028381 | Bacteria | 13341 |
| 694 | Ga0268264_10052836 | 3300028381 | Bacteria | 3389 |
| 695 | Ga0268264_10086924 | 3300028381 | Bacteria | 2687 |
| 696 | Ga0307517_10002655 | 3300028786 | Bacteria | 28561 |
| 697 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 698 | Ga0307515_10000322 | 3300028794 | Bacteria | 118563 |
| 699 | Ga0307515_10001193 | 3300028794 | Bacteria | 59425 |
| 700 | Ga0307515_10002234 | 3300028794 | Bacteria | 42472 |
| 701 | Ga0307515_10023840 | 3300028794 | Bacteria | 10697 |
| 702 | Ga0307515_10041898 | 3300028794 | Bacteria | 7183 |
| 703 | Ga0307515_10067248 | 3300028794 | Bacteria | 4946 |
| 704 | Ga0307515_10094964 | 3300028794 | Bacteria | 3676 |
| 705 | Ga0307515_10096814 | 3300028794 | Bacteria | 3614 |
| 706 | Ga0307515_10135512 | 3300028794 | Bacteria | 2680 |
| 707 | Ga0307515_10146542 | 3300028794 | Bacteria | 2496 |
| 708 | Ga0307512_10066347 | 3300030522 | Bacteria | 2727 |
| 709 | Ga0316176_1141751 | 3300030732 | Bacteria | 1968 |
| 710 | Ga0314311_1073339 | 3300030733 | Bacteria | 2422 |
| 711 | Ga0316179_1111618 | 3300030734 | Bacteria | 1462 |
| 712 | Ga0316183_1025835 | 3300030742 | Bacteria | 2932 |
| 713 | Ga0265330_10014274 | 3300031235 | Bacteria | 3687 |
| 714 | Ga0265330_10047066 | 3300031235 | Bacteria | 1899 |
| 715 | Ga0265332_10035841 | 3300031238 | Bacteria | 2154 |
| 716 | Ga0265329_10011414 | 3300031242 | Bacteria | 3228 |
| 717 | Ga0265331_10043380 | 3300031250 | Bacteria | 2179 |
| 718 | Ga0265327_10003094 | 3300031251 | Bacteria | 16421 |
| 719 | Ga0265327_10005552 | 3300031251 | Bacteria | 10473 |
| 720 | Ga0265316_10199220 | 3300031344 | Bacteria | 1485 |
| 721 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 722 | Ga0307513_10000246 | 3300031456 | Bacteria | 78455 |
| 723 | Ga0307513_10007912 | 3300031456 | Bacteria | 13688 |
| 724 | Ga0307513_10027457 | 3300031456 | Bacteria | 6536 |
| 725 | Ga0307513_10075694 | 3300031456 | Bacteria | 3494 |
| 726 | Ga0307513_10104696 | 3300031456 | Bacteria | 2842 |
| 727 | Ga0307513_10122436 | 3300031456 | Bacteria | 2565 |
| 728 | Ga0307513_10270462 | 3300031456 | Bacteria | 1483 |
| 729 | Ga0307513_10325978 | 3300031456 | Bacteria | 1292 |
| 730 | Ga0307509_10007099 | 3300031507 | Bacteria | 14778 |
| 731 | Ga0307509_10019271 | 3300031507 | Bacteria | 7789 |
| 732 | Ga0307509_10033367 | 3300031507 | Bacteria | 5666 |
| 733 | Ga0307509_10164667 | 3300031507 | Bacteria | 2108 |
| 734 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 735 | Ga0307408_100006968 | 3300031548 | Bacteria | 7479 |
| 736 | Ga0307408_100054021 | 3300031548 | Bacteria | 2903 |
| 737 | Ga0307408_100086583 | 3300031548 | Bacteria | 2355 |
| 738 | Ga0307408_100111446 | 3300031548 | Bacteria | 2102 |
| 739 | Ga0307408_100152716 | 3300031548 | Bacteria | 1824 |
| 740 | Ga0307508_10000450 | 3300031616 | Bacteria | 49283 |
| 741 | Ga0307508_10008054 | 3300031616 | Bacteria | 9770 |
| 742 | Ga0307508_10055717 | 3300031616 | Bacteria | 3501 |
| 743 | Ga0307514_10001030 | 3300031649 | Bacteria | 40201 |
| 744 | Ga0307514_10004889 | 3300031649 | Bacteria | 12181 |
| 745 | Ga0307514_10008692 | 3300031649 | Bacteria | 8613 |
| 746 | Ga0307514_10009061 | 3300031649 | Bacteria | 8406 |
| 747 | Ga0307514_10109370 | 3300031649 | Bacteria | 1963 |
| 748 | Ga0307514_10156290 | 3300031649 | Bacteria | 1520 |
| 749 | Ga0265314_10008574 | 3300031711 | Bacteria | 8741 |
| 750 | Ga0265314_10038564 | 3300031711 | Bacteria | 3450 |
| 751 | Ga0265342_10038530 | 3300031712 | Bacteria | 2910 |
| 752 | Ga0307516_10008482 | 3300031730 | Bacteria | 11617 |
| 753 | Ga0307516_10077658 | 3300031730 | Bacteria | 3168 |
| 754 | Ga0307516_10353428 | 3300031730 | Bacteria | 1135 |
| 755 | Ga0307405_10252917 | 3300031731 | Bacteria | 1312 |
| 756 | Ga0307518_10244042 | 3300031838 | Bacteria | 1149 |
| 757 | Ga0307518_10330066 | 3300031838 | Bacteria | 904 |
| 758 | Ga0307406_10004336 | 3300031901 | Bacteria | 7719 |
| 759 | Ga0307406_10012119 | 3300031901 | Bacteria | 4907 |
| 760 | Ga0307412_10000392 | 3300031911 | Bacteria | 27005 |
| 761 | Ga0307412_10008739 | 3300031911 | Bacteria | 5795 |
| 762 | Ga0307412_10193682 | 3300031911 | Bacteria | 1538 |
| 763 | Ga0307412_10357730 | 3300031911 | Bacteria | 1174 |
| 764 | Ga0307412_10517187 | 3300031911 | Bacteria | 996 |
| 765 | Ga0307414_10115733 | 3300032004 | Bacteria | 2051 |
| 766 | Ga0307414_10293586 | 3300032004 | Bacteria | 1371 |
| 767 | Ga0307411_10002080 | 3300032005 | Bacteria | 8618 |
| 768 | Ga0307415_100694203 | 3300032126 | Bacteria | 918 |
| 769 | Ga0307510_10034007 | 3300033180 | Bacteria | 5714 |
| 770 | Ga0373936_0043270 | 3300035113 | Bacteria | 1810 |
| 771 | Ga0373957_0028893 | 3300035120 | Bacteria | 2023 |
| 772 | Ga0373955_0292472 | 3300035172 | Bacteria | 981 |
| 773 | Ga0373931_0025968 | 3300035691 | Bacteria | 2976 |
| 774 | Ga0373933_0190358 | 3300035724 | Bacteria | 1310 |
| 775 | Ga0373937_0040657 | 3300036401 | Bacteria | 4239 |
| 776 | Ga0373925_0461305 | 3300037068 | Bacteria | 1041 |
| 777 | Ga0395905_0052780 | 3300037471 | Bacteria | 3805 |
| 778 | Ga0395901_0111180 | 3300038443 | Bacteria | 2877 |
| 779 | Ga0436360_1081132 | 3300039438 | Bacteria | 1138 |
| 780 | Ga0436361_0032066 | 3300039447 | Bacteria | 3843 |
| 781 | Ga0436361_0206607 | 3300039447 | Bacteria | 3756 |
| 782 | Ga0436363_0171481 | 3300039450 | Bacteria | 1096 |
| 783 | Ga0439439_0003401 | 3300041406 | Bacteria | 3510 |
| 784 | Ga0439466_0002610 | 3300041411 | Bacteria | 7054 |
| 785 | Ga0439466_0020082 | 3300041411 | Bacteria | 2386 |
| 786 | Ga0451839_0601462 | 3300041496 | Bacteria | 870 |
| 787 | Ga0439445_0001509 | 3300042004 | Bacteria | 5056 |
| 788 | Ga0439432_002290 | 3300042006 | Bacteria | 7216 |
| 789 | Ga0439449_0000753 | 3300042007 | Bacteria | 12445 |
| 790 | Ga0439449_0004213 | 3300042007 | Bacteria | 5558 |
| 791 | Ga0439452_002755 | 3300042010 | Bacteria | 6353 |
| 792 | Ga0450923_031374 | 3300042125 | Bacteria | 1085 |
| 793 | Ga0450898_003737 | 3300042134 | Bacteria | 2203 |
| 794 | Ga0450909_011691 | 3300042185 | Bacteria | 1286 |
| 795 | Ga0439434_0001757 | 3300042435 | Bacteria | 6291 |
| 796 | Ga0450918_002439 | 3300042531 | Bacteria | 3517 |
| 797 | Ga0466972_0000880 | 3300044658 | Bacteria | 14429 |
| 798 | Ga0466965_0002203 | 3300044683 | Bacteria | 8200 |
| 799 | Ga0466964_0007106 | 3300044706 | Bacteria | 4188 |
| 800 | Ga0466964_0012803 | 3300044706 | Bacteria | 3177 |
| 801 | Ga0453684_0391028 | 3300044712 | Bacteria | 1560 |
| 802 | Ga0466968_0008025 | 3300044735 | Bacteria | 4035 |
| 803 | Ga0451576_0019302 | 3300045051 | Bacteria | 7442 |
| 804 | Ga0451576_0039018 | 3300045051 | Bacteria | 5026 |
| 805 | Ga0495638_0077305 | 3300046460 | Bacteria | 2027 |
| 806 | Ga0495585_0074205 | 3300046492 | Bacteria | 1851 |
| 807 | Ga0495596_0000064 | 3300046500 | Bacteria | 77744 |
| 808 | Ga0495607_0000507 | 3300046501 | Bacteria | 38608 |
| 809 | Ga0495610_0001367 | 3300046512 | Bacteria | 21670 |
| 810 | Ga0495610_0019846 | 3300046512 | Bacteria | 3748 |
| 811 | Ga0495616_0000866 | 3300046513 | Bacteria | 21983 |
| 812 | Ga0495620_0051816 | 3300046515 | Bacteria | 1745 |
| 813 | Ga0495632_0112483 | 3300046519 | Bacteria | 1277 |
| 814 | Ga0495637_0005420 | 3300046520 | Bacteria | 6507 |
| 815 | Ga0495648_0110383 | 3300046524 | Bacteria | 1498 |
| 816 | Ga0495642_0033322 | 3300046528 | Bacteria | 2071 |
| 817 | Ga0495642_0057359 | 3300046528 | Bacteria | 1610 |
| 818 | Ga0495654_0000834 | 3300046530 | Bacteria | 23400 |
| 819 | Ga0495609_0000244 | 3300046538 | Bacteria | 51384 |
| 820 | Ga0495656_0000365 | 3300046615 | Bacteria | 15165 |
| 821 | Ga0495625_0010498 | 3300046660 | Bacteria | 7655 |
| 822 | Ga0495661_0008722 | 3300046665 | Bacteria | 6997 |
| 823 | Ga0495588_0097715 | 3300046674 | Bacteria | 1541 |
| 824 | Ga0495671_0000453 | 3300046692 | Bacteria | 32377 |
| 825 | Ga0495649_0004212 | 3300046694 | Bacteria | 9435 |
| 826 | Ga0495660_0031902 | 3300046810 | Bacteria | 2960 |
| 827 | Ga0495672_0032883 | 3300047320 | Bacteria | 3219 |
| 828 | Ga0495676_0089794 | 3300047321 | Bacteria | 2301 |
| 829 | Ga0495687_027112 | 3300047443 | Bacteria | 2685 |
| 830 | Ga0495685_001488 | 3300047447 | Bacteria | 7169 |
| 831 | Ga0495686_0241770 | 3300047472 | Bacteria | 1018 |
| 832 | Ga0495593_0037115 | 3300047673 | Bacteria | 2638 |
| 833 | Ga0495614_0107705 | 3300048089 | Bacteria | 1222 |
| 834 | Ga0496101_0379158 | 3300048904 | Bacteria | 1113 |
| 835 | Ga0496102_0206626 | 3300048905 | Bacteria | 1851 |
| 836 | Ga0496103_0084378 | 3300048906 | Bacteria | 2001 |
| 837 | Ga0496104_0032473 | 3300048907 | Bacteria | 4859 |
| 838 | Ga0496105_0012904 | 3300048908 | Bacteria | 6622 |
| 839 | Ga0496106_0284822 | 3300048909 | Bacteria | 1324 |
| 840 | Ga0496108_0452077 | 3300048911 | Bacteria | 1122 |
| 841 | Ga0496109_0058519 | 3300048912 | Bacteria | 3520 |
| 842 | Ga0496110_0537597 | 3300048913 | Bacteria | 1063 |
| 843 | Ga0496114_0186150 | 3300048917 | Bacteria | 1815 |
| 844 | Ga0496115_0025937 | 3300048918 | Bacteria | 4568 |
| 845 | Ga0496116_0001004 | 3300048919 | Bacteria | 34438 |
| 846 | Ga0496116_0011864 | 3300048919 | Bacteria | 7170 |
| 847 | Ga0496116_0013245 | 3300048919 | Bacteria | 6667 |
| 848 | Ga0496116_0067024 | 3300048919 | Bacteria | 2294 |
| 849 | Ga0496116_0081581 | 3300048919 | Bacteria | 2004 |
| 850 | Ga0496116_0125457 | 3300048919 | Bacteria | 1475 |
| 851 | Ga0496117_0068338 | 3300048920 | Bacteria | 2399 |
| 852 | Ga0496118_0019857 | 3300048921 | Bacteria | 5988 |
| 853 | Ga0496118_0053756 | 3300048921 | Bacteria | 3057 |
| 854 | Ga0496118_0085109 | 3300048921 | Bacteria | 2203 |
| 855 | Ga0496119_0003325 | 3300048922 | Bacteria | 16773 |
| 856 | Ga0496120_0003204 | 3300048923 | Bacteria | 15214 |
| 857 | Ga0496121_0001404 | 3300048924 | Bacteria | 40784 |
| 858 | Ga0496121_0005640 | 3300048924 | Bacteria | 15922 |
| 859 | Ga0496121_0143282 | 3300048924 | Bacteria | 1769 |
| 860 | Ga0496121_0218094 | 3300048924 | Bacteria | 1346 |
| 861 | Ga0496121_0232548 | 3300048924 | Bacteria | 1290 |
| 862 | Ga0496122_0000029 | 3300048925 | Bacteria | 336396 |
| 863 | Ga0496122_0000317 | 3300048925 | Bacteria | 105883 |
| 864 | Ga0496122_0004249 | 3300048925 | Bacteria | 17968 |
| 865 | Ga0496122_0004463 | 3300048925 | Bacteria | 17342 |
| 866 | Ga0496123_0000124 | 3300048926 | Bacteria | 158327 |
| 867 | Ga0496123_0000531 | 3300048926 | Bacteria | 65624 |
| 868 | Ga0496123_0001487 | 3300048926 | Bacteria | 32545 |
| 869 | Ga0496123_0001761 | 3300048926 | Bacteria | 28565 |
| 870 | Ga0496123_0003891 | 3300048926 | Bacteria | 16246 |
| 871 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 872 | Ga0496124_0004949 | 3300048927 | Bacteria | 15271 |
| 873 | Ga0496124_0034977 | 3300048927 | Bacteria | 4399 |
| 874 | Ga0496124_0122058 | 3300048927 | Bacteria | 2080 |
| 875 | Ga0496124_0149259 | 3300048927 | Bacteria | 1836 |
| 876 | Ga0496124_0223673 | 3300048927 | Bacteria | 1413 |
| 877 | Ga0496125_0000244 | 3300048928 | Bacteria | 111663 |
| 878 | Ga0496125_0015625 | 3300048928 | Bacteria | 7326 |
| 879 | Ga0496125_0030924 | 3300048928 | Bacteria | 4779 |
| 880 | Ga0496126_0043446 | 3300048929 | Bacteria | 4146 |
| 881 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 882 | Ga0501048_0160292 | 3300049582 | Bacteria | 1592 |
| 883 | nmdc:mga00v17_56590_c1 | 3300050491 | Bacteria | 2398 |
| 884 | nmdc:mga0yw44_243798_c1 | 3300050492 | Bacteria | 1195 |
| 885 | nmdc:mga0k408_247959_c1 | 3300050493 | Bacteria | 1063 |
| 886 | nmdc:mga0k408_254840_c1 | 3300050493 | Bacteria | 1048 |
| 887 | nmdc:mga0k408_26319_c1 | 3300050493 | Bacteria | 3298 |
| 888 | nmdc:mga0k408_4891_c2 | 3300050493 | Bacteria | 4094 |
| 889 | nmdc:mga0k408_7822_c1 | 3300050493 | Bacteria | 5715 |
| 890 | nmdc:mga07m45_10453_c1 | 3300050496 | Bacteria | 4848 |
| 891 | nmdc:mga07m45_122_c1 | 3300050496 | Bacteria | 24374 |
| 892 | nmdc:mga07m45_15544_c1 | 3300050496 | Bacteria | 4064 |
| 893 | nmdc:mga07m45_196634_c1 | 3300050496 | Bacteria | 1173 |
| 894 | nmdc:mga07m45_4239_c1 | 3300050496 | Bacteria | 7019 |
| 895 | nmdc:mga07m45_93670_c1 | 3300050496 | Bacteria | 1722 |
| 896 | nmdc:mga05p37_92917_c1 | 3300050507 | Bacteria | 3718 |
| 897 | nmdc:mga09592_68309_c1 | 3300050508 | Bacteria | 3014 |
| 898 | nmdc:mga09592_70483_c1 | 3300050508 | Bacteria | 2966 |
| 899 | nmdc:mga0qj67_99755_c1 | 3300050509 | Bacteria | 2340 |
| 900 | nmdc:mga06r32_51310_c1 | 3300050510 | Bacteria | 3947 |
| 901 | nmdc:mga06r32_752362_c1 | 3300050510 | Bacteria | 938 |
| 902 | nmdc:mga0sz30_123992_c1 | 3300050516 | Bacteria | 1136 |
| 903 | nmdc:mga0sz30_147099_c1 | 3300050516 | Bacteria | 1041 |
| 904 | nmdc:mga0sz30_15597_c1 | 3300050516 | Bacteria | 2709 |
| 905 | Ga0495601_0156569 | 3300053077 | Bacteria | 1488 |
| 906 | Ga0500610_0003992 | 3300053079 | Bacteria | 5774 |
| 907 | Ga0500644_0000575 | 3300053088 | Bacteria | 14233 |
| 908 | Ga0500571_006720 | 3300053110 | Bacteria | 6233 |
| 909 | Ga0500593_000414 | 3300053117 | Bacteria | 16854 |
| 910 | Ga0500593_003241 | 3300053117 | Bacteria | 6120 |
| 911 | Ga0500594_0017153 | 3300053118 | Bacteria | 1768 |
| 912 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 913 | Ga0500618_002619 | 3300053125 | Bacteria | 6628 |
| 914 | Ga0500658_0002081 | 3300053134 | Bacteria | 7784 |
| 915 | Ga0500559_0000047 | 3300053136 | Bacteria | 95447 |
| 916 | Ga0500568_0061648 | 3300053139 | Bacteria | 1450 |
| 917 | Ga0500574_011876 | 3300053141 | Bacteria | 1978 |
| 918 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 919 | Ga0500619_000077 | 3300053154 | Bacteria | 27224 |
| 920 | Ga0500634_0013275 | 3300053161 | Bacteria | 4317 |
| 921 | Ga0500636_0083949 | 3300053177 | Bacteria | 1832 |
| 922 | Ga0500587_002315 | 3300053739 | Bacteria | 2709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0160292 | Ga0501048_0160292_132_902 | 254 |
| 2 | 3300053161 | Ga0500634_0013275 | Ga0500634_0013275_1016_1795 | 254 |
| 3 | iso_pu_bacteria | 2842733646 | 2842737764 | 255 |
| 4 | 3300009176 | Ga0105242_10448469 | Ga0105242_104484692 | 256 |
| 5 | 3300049460 | Ga0495682_0000003 | Ga0495682_0000003_357529_358308 | 257 |
| 6 | 3300006846 | Ga0075430_100109091 | Ga0075430_1001090912 | 258 |
| 7 | 3300006847 | Ga0075431_100052328 | Ga0075431_1000523283 | 258 |
| 8 | 3300006880 | Ga0075429_100193894 | Ga0075429_1001938942 | 258 |
| 9 | 3300038443 | Ga0395901_0111180 | Ga0395901_0111180_1466_2299 | 258 |
| 10 | 3300050507 | nmdc:mga05p37_92917_c1 | nmdc:mga05p37_92917_c1_978_1811 | 258 |
| 11 | 3300050508 | nmdc:mga09592_68309_c1 | nmdc:mga09592_68309_c1_1220_2053 | 258 |
| 12 | 3300050510 | nmdc:mga06r32_752362_c1 | nmdc:mga06r32_752362_c1_61_894 | 258 |
| 13 | 3300046500 | Ga0495596_0000064 | Ga0495596_0000064_35797_36576 | 259 |
| 14 | 3300045051 | Ga0451576_0039018 | Ga0451576_0039018_986_1789 | 260 |
| 15 | iso_pu_bacteria | 2904449895 | 2904453000 | 260 |
| 16 | iso_pu_bacteria | 2904456579 | 2904459962 | 260 |
| 17 | iso_pu_bacteria | 2929520902 | 2929525959 | 260 |
| 18 | 3300025918 | Ga0207662_10199852 | Ga0207662_101998522 | 261 |
| 19 | 3300031235 | Ga0265330_10047066 | Ga0265330_100470662 | 263 |
| 20 | iso_pu_bacteria | 2521172590 | 2521557336 | 263 |
| 21 | iso_pu_bacteria | 2945972063 | 2945974136 | 263 |
| 22 | 3300003794 | Ga0055531_10001116 | Ga0055531_1000111617 | 264 |
| 23 | 3300005289 | Ga0065704_10000444 | Ga0065704_1000044436 | 264 |
| 24 | 3300005440 | Ga0070705_100361539 | Ga0070705_1003615391 | 264 |
| 25 | 3300005445 | Ga0070708_100458382 | Ga0070708_1004583822 | 264 |
| 26 | 3300005546 | Ga0070696_100061266 | Ga0070696_1000612663 | 264 |
| 27 | 3300009036 | Ga0105244_10000031 | Ga0105244_1000003147 | 264 |
| 28 | 3300013104 | Ga0157370_10002003 | Ga0157370_100020033 | 264 |
| 29 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025211 | 264 |
| 30 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039397 | 264 |
| 31 | 3300025728 | Ga0207655_1000029 | Ga0207655_1000029123 | 264 |
| 32 | 3300006186 | Ga0075369_10205939 | Ga0075369_102059391 | 265 |
| 33 | 3300010375 | Ga0105239_10709275 | Ga0105239_107092751 | 265 |
| 34 | 3300026095 | Ga0207676_10250526 | Ga0207676_102505262 | 265 |
| 35 | 3300041496 | Ga0451839_0601462 | Ga0451839_0601462_19_816 | 265 |
| 36 | 3300046528 | Ga0495642_0033322 | Ga0495642_0033322_773_1576 | 265 |
| 37 | 3300047443 | Ga0495687_027112 | Ga0495687_027112_272_1075 | 265 |
| 38 | 3300048918 | Ga0496115_0025937 | Ga0496115_0025937_1822_2658 | 265 |
| 39 | 3300048920 | Ga0496117_0068338 | Ga0496117_0068338_260_1081 | 265 |
| 40 | 3300053088 | Ga0500644_0000575 | Ga0500644_0000575_8227_9060 | 265 |
| 41 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_810574_811407 | 265 |
| 42 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_859459_860292 | 265 |
| 43 | 3300037471 | Ga0395905_0052780 | Ga0395905_0052780_2862_3671 | 266 |
| 44 | 3300048919 | Ga0496116_0001004 | Ga0496116_0001004_32448_33269 | 266 |
| 45 | 3300053077 | Ga0495601_0156569 | Ga0495601_0156569_641_1450 | 266 |
| 46 | 3300053154 | Ga0500619_000077 | Ga0500619_000077_11983_12786 | 266 |
| 47 | iso_pu_bacteria | 2551306416 | 2553005314 | 266 |
| 48 | iso_pu_bacteria | 2765235838 | 2765568462 | 266 |
| 49 | iso_pu_bacteria | 2818991449 | 2819617670 | 266 |
| 50 | iso_pu_bacteria | 2839094727 | 2839095299 | 266 |
| 51 | iso_pu_bacteria | 2904439833 | 2904439929 | 266 |
| 52 | iso_pu_bacteria | 2904530477 | 2904531126 | 266 |
| 53 | iso_pu_bacteria | 2904584206 | 2904587229 | 266 |
| 54 | iso_pu_bacteria | 2904589729 | 2904592736 | 266 |
| 55 | iso_pu_bacteria | 2904601388 | 2904604481 | 266 |
| 56 | iso_pu_bacteria | 2919046199 | 2919050246 | 266 |
| 57 | iso_pu_bacteria | 2919079590 | 2919082303 | 266 |
| 58 | iso_pu_bacteria | 2923510766 | 2923515996 | 266 |
| 59 | 3300006186 | Ga0075369_10009596 | Ga0075369_100095966 | 267 |
| 60 | 3300006353 | Ga0075370_10063075 | Ga0075370_100630752 | 267 |
| 61 | 3300006846 | Ga0075430_100034456 | Ga0075430_1000344563 | 267 |
| 62 | 3300006847 | Ga0075431_100034361 | Ga0075431_1000343614 | 267 |
| 63 | 3300006880 | Ga0075429_100029093 | Ga0075429_1000290934 | 267 |
| 64 | 3300014497 | Ga0182008_10024475 | Ga0182008_100244752 | 267 |
| 65 | 3300014497 | Ga0182008_10037502 | Ga0182008_100375024 | 267 |
| 66 | 3300025303 | Ga0209051_1000530 | Ga0209051_100053015 | 267 |
| 67 | 3300025923 | Ga0207681_10098926 | Ga0207681_100989263 | 267 |
| 68 | 3300028794 | Ga0307515_10096814 | Ga0307515_100968142 | 267 |
| 69 | 3300031456 | Ga0307513_10122436 | Ga0307513_101224362 | 267 |
| 70 | 3300031548 | Ga0307408_100006968 | Ga0307408_1000069682 | 267 |
| 71 | 3300031649 | Ga0307514_10009061 | Ga0307514_100090615 | 267 |
| 72 | 3300031901 | Ga0307406_10004336 | Ga0307406_100043367 | 267 |
| 73 | 3300041411 | Ga0439466_0020082 | Ga0439466_0020082_537_1379 | 267 |
| 74 | 3300048925 | Ga0496122_0000317 | Ga0496122_0000317_92799_93641 | 267 |
| 75 | 3300048926 | Ga0496123_0001487 | Ga0496123_0001487_9906_10748 | 267 |
| 76 | 3300048927 | Ga0496124_0034977 | Ga0496124_0034977_1790_2632 | 267 |
| 77 | 3300050492 | nmdc:mga0yw44_243798_c1 | nmdc:mga0yw44_243798_c1_103_945 | 267 |
| 78 | 3300050508 | nmdc:mga09592_70483_c1 | nmdc:mga09592_70483_c1_1099_1914 | 267 |
| 79 | 3300050509 | nmdc:mga0qj67_99755_c1 | nmdc:mga0qj67_99755_c1_26_841 | 267 |
| 80 | 3300050510 | nmdc:mga06r32_51310_c1 | nmdc:mga06r32_51310_c1_380_1195 | 267 |
| 81 | 3300050516 | nmdc:mga0sz30_123992_c1 | nmdc:mga0sz30_123992_c1_95_937 | 267 |
| 82 | 3300005347 | Ga0070668_100133019 | Ga0070668_1001330192 | 268 |
| 83 | 3300005459 | Ga0068867_100008620 | Ga0068867_1000086205 | 268 |
| 84 | 3300005842 | Ga0068858_100252112 | Ga0068858_1002521121 | 268 |
| 85 | 3300006881 | Ga0068865_100006221 | Ga0068865_1000062214 | 268 |
| 86 | 3300017792 | Ga0163161_10032312 | Ga0163161_100323124 | 268 |
| 87 | 3300025899 | Ga0207642_10044161 | Ga0207642_100441612 | 268 |
| 88 | 3300025940 | Ga0207691_10012940 | Ga0207691_100129407 | 268 |
| 89 | 3300026035 | Ga0207703_10047463 | Ga0207703_100474633 | 268 |
| 90 | 3300026142 | Ga0207698_10253160 | Ga0207698_102531602 | 268 |
| 91 | 3300048906 | Ga0496103_0084378 | Ga0496103_0084378_528_1346 | 268 |
| 92 | 3300048912 | Ga0496109_0058519 | Ga0496109_0058519_921_1739 | 268 |
| 93 | 3300048913 | Ga0496110_0537597 | Ga0496110_0537597_118_936 | 268 |
| 94 | iso_pu_bacteria | 2511231003 | 2511250033 | 268 |
| 95 | iso_pu_bacteria | 2599185292 | 2599906620 | 268 |
| 96 | iso_pu_bacteria | 2643221569 | 2643860823 | 268 |
| 97 | iso_pu_bacteria | 2643221594 | 2643981333 | 268 |
| 98 | iso_pu_bacteria | 2643221621 | 2644124117 | 268 |
| 99 | iso_pu_bacteria | 2808606395 | 2809035250 | 268 |
| 100 | iso_pu_bacteria | 2818991445 | 2819592017 | 268 |
| 101 | iso_pu_bacteria | 2857537821 | 2857542285 | 268 |
| 102 | iso_pu_bacteria | 2857542790 | 2857545049 | 268 |
| 103 | iso_pu_bacteria | 2858950400 | 2858953573 | 268 |
| 104 | iso_pu_bacteria | 2884811622 | 2884814033 | 268 |
| 105 | iso_pu_bacteria | 2884836552 | 2884840567 | 268 |
| 106 | iso_pu_bacteria | 2884852848 | 2884855824 | 268 |
| 107 | iso_pu_bacteria | 2896154374 | 2896157251 | 268 |
| 108 | iso_pu_bacteria | 2941479691 | 2941484660 | 268 |
| 109 | 3300003323 | rootH1_10005172 | rootH1_100051721 | 269 |
| 110 | 3300005459 | Ga0068867_100001043 | Ga0068867_10000104312 | 269 |
| 111 | 3300005543 | Ga0070672_100010312 | Ga0070672_1000103121 | 269 |
| 112 | 3300005615 | Ga0070702_100199324 | Ga0070702_1001993242 | 269 |
| 113 | 3300005616 | Ga0068852_100209190 | Ga0068852_1002091903 | 269 |
| 114 | 3300005617 | Ga0068859_100473170 | Ga0068859_1004731701 | 269 |
| 115 | 3300005841 | Ga0068863_100152743 | Ga0068863_1001527432 | 269 |
| 116 | 3300005842 | Ga0068858_100325491 | Ga0068858_1003254912 | 269 |
| 117 | 3300005843 | Ga0068860_100008382 | Ga0068860_1000083826 | 269 |
| 118 | 3300005844 | Ga0068862_100145352 | Ga0068862_1001453522 | 269 |
| 119 | 3300005844 | Ga0068862_100634976 | Ga0068862_1006349761 | 269 |
| 120 | 3300006195 | Ga0075366_10002787 | Ga0075366_100027878 | 269 |
| 121 | 3300006931 | Ga0097620_100473176 | Ga0097620_1004731761 | 269 |
| 122 | 3300009148 | Ga0105243_10000765 | Ga0105243_1000076512 | 269 |
| 123 | 3300009553 | Ga0105249_10086300 | Ga0105249_100863003 | 269 |
| 124 | 3300011119 | Ga0105246_10165345 | Ga0105246_101653452 | 269 |
| 125 | 3300013297 | Ga0157378_10040681 | Ga0157378_100406813 | 269 |
| 126 | 3300013306 | Ga0163162_10047977 | Ga0163162_100479775 | 269 |
| 127 | 3300013308 | Ga0157375_10049483 | Ga0157375_100494832 | 269 |
| 128 | 3300014326 | Ga0157380_10009058 | Ga0157380_100090582 | 269 |
| 129 | 3300014745 | Ga0157377_10000016 | Ga0157377_10000016149 | 269 |
| 130 | 3300014968 | Ga0157379_10049079 | Ga0157379_100490792 | 269 |
| 131 | 3300025923 | Ga0207681_10079980 | Ga0207681_100799802 | 269 |
| 132 | 3300025935 | Ga0207709_10000602 | Ga0207709_1000060212 | 269 |
| 133 | 3300025961 | Ga0207712_10076268 | Ga0207712_100762682 | 269 |
| 134 | 3300026035 | Ga0207703_10085234 | Ga0207703_100852342 | 269 |
| 135 | 3300026088 | Ga0207641_10182140 | Ga0207641_101821402 | 269 |
| 136 | 3300026089 | Ga0207648_10000515 | Ga0207648_1000051512 | 269 |
| 137 | 3300026118 | Ga0207675_100004701 | Ga0207675_1000047019 | 269 |
| 138 | 3300026142 | Ga0207698_10146995 | Ga0207698_101469952 | 269 |
| 139 | 3300028380 | Ga0268265_10029780 | Ga0268265_100297802 | 269 |
| 140 | 3300028381 | Ga0268264_10003598 | Ga0268264_100035984 | 269 |
| 141 | 3300044712 | Ga0453684_0391028 | Ga0453684_0391028_70_900 | 269 |
| 142 | 3300050493 | nmdc:mga0k408_26319_c1 | nmdc:mga0k408_26319_c1_1150_1989 | 269 |
| 143 | iso_pu_bacteria | 2585428062 | 2587759442 | 269 |
| 144 | iso_pu_bacteria | 2643221585 | 2643936098 | 269 |
| 145 | iso_pu_bacteria | 2643221609 | 2644060571 | 269 |
| 146 | iso_pu_bacteria | 2643221611 | 2644073899 | 269 |
| 147 | iso_pu_bacteria | 2643221639 | 2644221861 | 269 |
| 148 | iso_pu_bacteria | 2643221646 | 2644257345 | 269 |
| 149 | iso_pu_bacteria | 2643221656 | 2644316743 | 269 |
| 150 | iso_pu_bacteria | 2738543012 | 2739242601 | 269 |
| 151 | iso_pu_bacteria | 2816332133 | 2816473078 | 269 |
| 152 | iso_pu_bacteria | 2842747753 | 2842750713 | 269 |
| 153 | iso_pu_bacteria | 2855730933 | 2855731335 | 269 |
| 154 | iso_pu_bacteria | 2855767633 | 2855768041 | 269 |
| 155 | iso_pu_bacteria | 2857576091 | 2857577018 | 269 |
| 156 | iso_pu_bacteria | 2881412998 | 2881413781 | 269 |
| 157 | iso_pu_bacteria | 2904479285 | 2904482326 | 269 |
| 158 | iso_pu_bacteria | 2919704043 | 2919706843 | 269 |
| 159 | iso_pu_bacteria | 2928115317 | 2928118845 | 269 |
| 160 | iso_pu_bacteria | 8003400568 | 8003405435 | 269 |
| 161 | 3300003751 | Ga0055538_1000013 | Ga0055538_100001382 | 270 |
| 162 | 3300003752 | Ga0055539_1000018 | Ga0055539_100001882 | 270 |
| 163 | 3300003756 | Ga0055533_1000022 | Ga0055533_100002282 | 270 |
| 164 | 3300003759 | Ga0055525_1000024 | Ga0055525_100002482 | 270 |
| 165 | 3300003841 | Ga0055541_1000013 | Ga0055541_100001382 | 270 |
| 166 | 3300005367 | Ga0070667_100063129 | Ga0070667_1000631292 | 270 |
| 167 | 3300005563 | Ga0068855_100011166 | Ga0068855_1000111664 | 270 |
| 168 | 3300005577 | Ga0068857_100159525 | Ga0068857_1001595252 | 270 |
| 169 | 3300005578 | Ga0068854_100052677 | Ga0068854_1000526772 | 270 |
| 170 | 3300009545 | Ga0105237_10103567 | Ga0105237_101035672 | 270 |
| 171 | 3300009551 | Ga0105238_10000065 | Ga0105238_1000006511 | 270 |
| 172 | 3300010375 | Ga0105239_10054735 | Ga0105239_100547354 | 270 |
| 173 | 3300015261 | Ga0182006_1002966 | Ga0182006_10029662 | 270 |
| 174 | 3300021361 | Ga0213872_10016125 | Ga0213872_100161254 | 270 |
| 175 | 3300025224 | Ga0209784_100005 | Ga0209784_100005640 | 270 |
| 176 | 3300025225 | Ga0209566_100005 | Ga0209566_100005640 | 270 |
| 177 | 3300025226 | Ga0209674_100009 | Ga0209674_100009640 | 270 |
| 178 | 3300025230 | Ga0209563_100012 | Ga0209563_100012640 | 270 |
| 179 | 3300025253 | Ga0209677_100006 | Ga0209677_100006640 | 270 |
| 180 | 3300025913 | Ga0207695_10002732 | Ga0207695_100027327 | 270 |
| 181 | 3300025914 | Ga0207671_10002693 | Ga0207671_100026935 | 270 |
| 182 | 3300025924 | Ga0207694_10000977 | Ga0207694_1000097712 | 270 |
| 183 | 3300025949 | Ga0207667_10016772 | Ga0207667_100167722 | 270 |
| 184 | 3300025981 | Ga0207640_10291698 | Ga0207640_102916981 | 270 |
| 185 | 3300026116 | Ga0207674_10076115 | Ga0207674_100761153 | 270 |
| 186 | 3300039447 | Ga0436361_0032066 | Ga0436361_0032066_1515_2372 | 270 |
| 187 | 3300039447 | Ga0436361_0206607 | Ga0436361_0206607_280_1137 | 270 |
| 188 | 3300046492 | Ga0495585_0074205 | Ga0495585_0074205_814_1626 | 270 |
| 189 | 3300048919 | Ga0496116_0011864 | Ga0496116_0011864_376_1233 | 270 |
| 190 | 3300044658 | Ga0466972_0000880 | Ga0466972_0000880_8158_8976 | 271 |
| 191 | 3300044683 | Ga0466965_0002203 | Ga0466965_0002203_7126_7944 | 271 |
| 192 | 3300044706 | Ga0466964_0007106 | Ga0466964_0007106_3140_3958 | 271 |
| 193 | 3300044706 | Ga0466964_0012803 | Ga0466964_0012803_694_1512 | 271 |
| 194 | 3300044735 | Ga0466968_0008025 | Ga0466968_0008025_3020_3838 | 271 |
| 195 | 3300050493 | nmdc:mga0k408_4891_c2 | nmdc:mga0k408_4891_c2_380_1198 | 271 |
| 196 | 3300002704 | JGI25155J39150_1000651 | JGI25155J39150_10006511 | 272 |
| 197 | 3300002704 | JGI25155J39150_1001094 | JGI25155J39150_10010941 | 272 |
| 198 | 3300002705 | JGI25156J39149_1000170 | JGI25156J39149_10001702 | 272 |
| 199 | 3300002705 | JGI25156J39149_1001869 | JGI25156J39149_10018696 | 272 |
| 200 | 3300002705 | JGI25156J39149_1007194 | JGI25156J39149_10071942 | 272 |
| 201 | 3300002737 | JGI25162J39368_1003814 | JGI25162J39368_10038143 | 272 |
| 202 | 3300002738 | JGI25154J39366_1000306 | JGI25154J39366_10003062 | 272 |
| 203 | 3300002738 | JGI25154J39366_1000455 | JGI25154J39366_100045516 | 272 |
| 204 | 3300002741 | JGI25157J39369_1000170 | JGI25157J39369_100017011 | 272 |
| 205 | 3300003758 | Ga0055532_1000017 | Ga0055532_1000017113 | 272 |
| 206 | 3300003761 | Ga0055535_1005719 | Ga0055535_10057193 | 272 |
| 207 | 3300003775 | Ga0055524_1000052 | Ga0055524_100005269 | 272 |
| 208 | 3300003791 | Ga0055530_10004911 | Ga0055530_100049116 | 272 |
| 209 | 3300003792 | Ga0055540_1000123 | Ga0055540_100012367 | 272 |
| 210 | 3300003794 | Ga0055531_10016084 | Ga0055531_100160844 | 272 |
| 211 | 3300005293 | Ga0065715_10020215 | Ga0065715_100202153 | 272 |
| 212 | 3300005293 | Ga0065715_10035108 | Ga0065715_100351082 | 272 |
| 213 | 3300005328 | Ga0070676_10002668 | Ga0070676_1000266812 | 272 |
| 214 | 3300005330 | Ga0070690_100031929 | Ga0070690_1000319293 | 272 |
| 215 | 3300005331 | Ga0070670_100014554 | Ga0070670_1000145544 | 272 |
| 216 | 3300005333 | Ga0070677_10010076 | Ga0070677_100100762 | 272 |
| 217 | 3300005334 | Ga0068869_100041131 | Ga0068869_1000411313 | 272 |
| 218 | 3300005334 | Ga0068869_100402150 | Ga0068869_1004021502 | 272 |
| 219 | 3300005335 | Ga0070666_10000758 | Ga0070666_1000075816 | 272 |
| 220 | 3300005335 | Ga0070666_10002174 | Ga0070666_100021746 | 272 |
| 221 | 3300005338 | Ga0068868_100001290 | Ga0068868_1000012906 | 272 |
| 222 | 3300005338 | Ga0068868_100011821 | Ga0068868_1000118213 | 272 |
| 223 | 3300005338 | Ga0068868_100100646 | Ga0068868_1001006462 | 272 |
| 224 | 3300005340 | Ga0070689_100008704 | Ga0070689_1000087045 | 272 |
| 225 | 3300005340 | Ga0070689_100186212 | Ga0070689_1001862122 | 272 |
| 226 | 3300005343 | Ga0070687_100192273 | Ga0070687_1001922732 | 272 |
| 227 | 3300005344 | Ga0070661_100345298 | Ga0070661_1003452981 | 272 |
| 228 | 3300005347 | Ga0070668_100003834 | Ga0070668_10000383414 | 272 |
| 229 | 3300005347 | Ga0070668_100036636 | Ga0070668_1000366365 | 272 |
| 230 | 3300005347 | Ga0070668_100510634 | Ga0070668_1005106341 | 272 |
| 231 | 3300005354 | Ga0070675_100001026 | Ga0070675_1000010267 | 272 |
| 232 | 3300005354 | Ga0070675_100011870 | Ga0070675_1000118704 | 272 |
| 233 | 3300005354 | Ga0070675_100022217 | Ga0070675_1000222172 | 272 |
| 234 | 3300005354 | Ga0070675_100060263 | Ga0070675_1000602635 | 272 |
| 235 | 3300005355 | Ga0070671_100010647 | Ga0070671_1000106476 | 272 |
| 236 | 3300005355 | Ga0070671_100067899 | Ga0070671_1000678993 | 272 |
| 237 | 3300005355 | Ga0070671_100079613 | Ga0070671_1000796133 | 272 |
| 238 | 3300005355 | Ga0070671_100220387 | Ga0070671_1002203872 | 272 |
| 239 | 3300005356 | Ga0070674_100000094 | Ga0070674_10000009436 | 272 |
| 240 | 3300005356 | Ga0070674_100017248 | Ga0070674_1000172483 | 272 |
| 241 | 3300005356 | Ga0070674_100064418 | Ga0070674_1000644183 | 272 |
| 242 | 3300005364 | Ga0070673_100000679 | Ga0070673_10000067912 | 272 |
| 243 | 3300005364 | Ga0070673_100000753 | Ga0070673_10000075320 | 272 |
| 244 | 3300005364 | Ga0070673_100056321 | Ga0070673_1000563213 | 272 |
| 245 | 3300005365 | Ga0070688_100027851 | Ga0070688_1000278515 | 272 |
| 246 | 3300005367 | Ga0070667_100001746 | Ga0070667_10000174614 | 272 |
| 247 | 3300005367 | Ga0070667_100009087 | Ga0070667_1000090878 | 272 |
| 248 | 3300005367 | Ga0070667_100059026 | Ga0070667_1000590263 | 272 |
| 249 | 3300005367 | Ga0070667_100153304 | Ga0070667_1001533042 | 272 |
| 250 | 3300005367 | Ga0070667_100201356 | Ga0070667_1002013561 | 272 |
| 251 | 3300005367 | Ga0070667_100580873 | Ga0070667_1005808731 | 272 |
| 252 | 3300005455 | Ga0070663_100010261 | Ga0070663_1000102613 | 272 |
| 253 | 3300005456 | Ga0070678_100000409 | Ga0070678_10000040919 | 272 |
| 254 | 3300005456 | Ga0070678_100015011 | Ga0070678_1000150113 | 272 |
| 255 | 3300005456 | Ga0070678_100022737 | Ga0070678_1000227374 | 272 |
| 256 | 3300005456 | Ga0070678_100213423 | Ga0070678_1002134232 | 272 |
| 257 | 3300005457 | Ga0070662_100004880 | Ga0070662_1000048806 | 272 |
| 258 | 3300005457 | Ga0070662_100036562 | Ga0070662_1000365625 | 272 |
| 259 | 3300005459 | Ga0068867_100017264 | Ga0068867_1000172643 | 272 |
| 260 | 3300005459 | Ga0068867_100069565 | Ga0068867_1000695653 | 272 |
| 261 | 3300005543 | Ga0070672_100000552 | Ga0070672_10000055217 | 272 |
| 262 | 3300005543 | Ga0070672_100047920 | Ga0070672_1000479205 | 272 |
| 263 | 3300005543 | Ga0070672_100056675 | Ga0070672_1000566752 | 272 |
| 264 | 3300005543 | Ga0070672_100200596 | Ga0070672_1002005962 | 272 |
| 265 | 3300005548 | Ga0070665_100002419 | Ga0070665_10000241914 | 272 |
| 266 | 3300005548 | Ga0070665_100004291 | Ga0070665_1000042917 | 272 |
| 267 | 3300005548 | Ga0070665_100243262 | Ga0070665_1002432621 | 272 |
| 268 | 3300005563 | Ga0068855_100068193 | Ga0068855_1000681933 | 272 |
| 269 | 3300005564 | Ga0070664_100175452 | Ga0070664_1001754522 | 272 |
| 270 | 3300005614 | Ga0068856_100151917 | Ga0068856_1001519173 | 272 |
| 271 | 3300005615 | Ga0070702_100059433 | Ga0070702_1000594332 | 272 |
| 272 | 3300005615 | Ga0070702_100309120 | Ga0070702_1003091201 | 272 |
| 273 | 3300005616 | Ga0068852_100027996 | Ga0068852_1000279964 | 272 |
| 274 | 3300005616 | Ga0068852_100042319 | Ga0068852_1000423192 | 272 |
| 275 | 3300005617 | Ga0068859_100023045 | Ga0068859_1000230455 | 272 |
| 276 | 3300005617 | Ga0068859_100121412 | Ga0068859_1001214122 | 272 |
| 277 | 3300005618 | Ga0068864_100000845 | Ga0068864_10000084511 | 272 |
| 278 | 3300005618 | Ga0068864_100024185 | Ga0068864_1000241853 | 272 |
| 279 | 3300005618 | Ga0068864_100071385 | Ga0068864_1000713853 | 272 |
| 280 | 3300005618 | Ga0068864_100078936 | Ga0068864_1000789364 | 272 |
| 281 | 3300005719 | Ga0068861_100393112 | Ga0068861_1003931122 | 272 |
| 282 | 3300005719 | Ga0068861_100460110 | Ga0068861_1004601102 | 272 |
| 283 | 3300005834 | Ga0068851_10000843 | Ga0068851_1000084310 | 272 |
| 284 | 3300005840 | Ga0068870_10065494 | Ga0068870_100654942 | 272 |
| 285 | 3300005841 | Ga0068863_100002048 | Ga0068863_1000020488 | 272 |
| 286 | 3300005841 | Ga0068863_100071222 | Ga0068863_1000712224 | 272 |
| 287 | 3300005841 | Ga0068863_100107675 | Ga0068863_1001076753 | 272 |
| 288 | 3300005841 | Ga0068863_100119529 | Ga0068863_1001195293 | 272 |
| 289 | 3300005841 | Ga0068863_100154405 | Ga0068863_1001544052 | 272 |
| 290 | 3300005842 | Ga0068858_100002570 | Ga0068858_10000257012 | 272 |
| 291 | 3300005842 | Ga0068858_100266980 | Ga0068858_1002669803 | 272 |
| 292 | 3300005843 | Ga0068860_100012965 | Ga0068860_1000129655 | 272 |
| 293 | 3300005843 | Ga0068860_100057346 | Ga0068860_1000573463 | 272 |
| 294 | 3300005843 | Ga0068860_100075322 | Ga0068860_1000753223 | 272 |
| 295 | 3300005844 | Ga0068862_100154254 | Ga0068862_1001542542 | 272 |
| 296 | 3300005844 | Ga0068862_100173498 | Ga0068862_1001734982 | 272 |
| 297 | 3300006051 | Ga0075364_10161447 | Ga0075364_101614473 | 272 |
| 298 | 3300006051 | Ga0075364_10302949 | Ga0075364_103029492 | 272 |
| 299 | 3300006237 | Ga0097621_100007338 | Ga0097621_1000073389 | 272 |
| 300 | 3300006237 | Ga0097621_100037524 | Ga0097621_1000375243 | 272 |
| 301 | 3300006237 | Ga0097621_100404665 | Ga0097621_1004046652 | 272 |
| 302 | 3300006237 | Ga0097621_100558114 | Ga0097621_1005581141 | 272 |
| 303 | 3300006358 | Ga0068871_100064731 | Ga0068871_1000647314 | 272 |
| 304 | 3300006358 | Ga0068871_100230418 | Ga0068871_1002304182 | 272 |
| 305 | 3300006844 | Ga0075428_100101687 | Ga0075428_1001016875 | 272 |
| 306 | 3300006881 | Ga0068865_100022991 | Ga0068865_1000229912 | 272 |
| 307 | 3300006881 | Ga0068865_100114232 | Ga0068865_1001142322 | 272 |
| 308 | 3300006881 | Ga0068865_100426501 | Ga0068865_1004265012 | 272 |
| 309 | 3300006931 | Ga0097620_100023045 | Ga0097620_1000230453 | 272 |
| 310 | 3300006931 | Ga0097620_100121412 | Ga0097620_1001214122 | 272 |
| 311 | 3300006946 | Ga0079104_1000206 | Ga0079104_100020659 | 272 |
| 312 | 3300009011 | Ga0105251_10159709 | Ga0105251_101597092 | 272 |
| 313 | 3300009093 | Ga0105240_10008920 | Ga0105240_1000892010 | 272 |
| 314 | 3300009093 | Ga0105240_10059308 | Ga0105240_100593084 | 272 |
| 315 | 3300009094 | Ga0111539_10058487 | Ga0111539_100584876 | 272 |
| 316 | 3300009101 | Ga0105247_10353938 | Ga0105247_103539382 | 272 |
| 317 | 3300009148 | Ga0105243_10024959 | Ga0105243_100249593 | 272 |
| 318 | 3300009176 | Ga0105242_10090130 | Ga0105242_100901302 | 272 |
| 319 | 3300009177 | Ga0105248_10086277 | Ga0105248_100862773 | 272 |
| 320 | 3300009177 | Ga0105248_10119263 | Ga0105248_101192633 | 272 |
| 321 | 3300009177 | Ga0105248_10268583 | Ga0105248_102685833 | 272 |
| 322 | 3300009177 | Ga0105248_10285586 | Ga0105248_102855863 | 272 |
| 323 | 3300009545 | Ga0105237_10175171 | Ga0105237_101751712 | 272 |
| 324 | 3300009551 | Ga0105238_10063764 | Ga0105238_100637643 | 272 |
| 325 | 3300009553 | Ga0105249_10091395 | Ga0105249_100913953 | 272 |
| 326 | 3300013296 | Ga0157374_10110971 | Ga0157374_101109712 | 272 |
| 327 | 3300013296 | Ga0157374_10146904 | Ga0157374_101469043 | 272 |
| 328 | 3300013296 | Ga0157374_10446048 | Ga0157374_104460482 | 272 |
| 329 | 3300013297 | Ga0157378_10070198 | Ga0157378_100701983 | 272 |
| 330 | 3300013297 | Ga0157378_10240961 | Ga0157378_102409613 | 272 |
| 331 | 3300013306 | Ga0163162_10077315 | Ga0163162_100773153 | 272 |
| 332 | 3300013306 | Ga0163162_10122403 | Ga0163162_101224032 | 272 |
| 333 | 3300013306 | Ga0163162_10221744 | Ga0163162_102217441 | 272 |
| 334 | 3300013306 | Ga0163162_10599824 | Ga0163162_105998242 | 272 |
| 335 | 3300013308 | Ga0157375_10011762 | Ga0157375_100117623 | 272 |
| 336 | 3300013308 | Ga0157375_10219009 | Ga0157375_102190093 | 272 |
| 337 | 3300013308 | Ga0157375_10233301 | Ga0157375_102333012 | 272 |
| 338 | 3300014325 | Ga0163163_10218492 | Ga0163163_102184923 | 272 |
| 339 | 3300014968 | Ga0157379_10008726 | Ga0157379_100087266 | 272 |
| 340 | 3300014968 | Ga0157379_10048728 | Ga0157379_100487282 | 272 |
| 341 | 3300014968 | Ga0157379_10281376 | Ga0157379_102813761 | 272 |
| 342 | 3300014969 | Ga0157376_10106693 | Ga0157376_101066933 | 272 |
| 343 | 3300014969 | Ga0157376_10328135 | Ga0157376_103281352 | 272 |
| 344 | 3300017792 | Ga0163161_10040898 | Ga0163161_100408984 | 272 |
| 345 | 3300017792 | Ga0163161_10141036 | Ga0163161_101410361 | 272 |
| 346 | 3300017792 | Ga0163161_10233374 | Ga0163161_102333742 | 272 |
| 347 | 3300017792 | Ga0163161_10272017 | Ga0163161_102720171 | 272 |
| 348 | 3300025206 | Ga0209435_100015 | Ga0209435_100015127 | 272 |
| 349 | 3300025206 | Ga0209435_100290 | Ga0209435_1002906 | 272 |
| 350 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041099 | 272 |
| 351 | 3300025233 | Ga0209437_100758 | Ga0209437_1007588 | 272 |
| 352 | 3300025242 | Ga0209258_100226 | Ga0209258_10022688 | 272 |
| 353 | 3300025246 | Ga0209646_1000020 | Ga0209646_1000020108 | 272 |
| 354 | 3300025246 | Ga0209646_1000040 | Ga0209646_1000040157 | 272 |
| 355 | 3300025250 | Ga0209026_1000034 | Ga0209026_1000034162 | 272 |
| 356 | 3300025250 | Ga0209026_1003765 | Ga0209026_10037651 | 272 |
| 357 | 3300025256 | Ga0209759_1000049 | Ga0209759_100004941 | 272 |
| 358 | 3300025256 | Ga0209759_1000357 | Ga0209759_100035711 | 272 |
| 359 | 3300025263 | Ga0209565_1016361 | Ga0209565_10163612 | 272 |
| 360 | 3300025291 | Ga0209675_1016325 | Ga0209675_10163253 | 272 |
| 361 | 3300025292 | Ga0209676_1011949 | Ga0209676_10119493 | 272 |
| 362 | 3300025298 | Ga0209050_1000760 | Ga0209050_100076036 | 272 |
| 363 | 3300025298 | Ga0209050_1041968 | Ga0209050_10419682 | 272 |
| 364 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036199 | 272 |
| 365 | 3300025303 | Ga0209051_1000068 | Ga0209051_100006812 | 272 |
| 366 | 3300025303 | Ga0209051_1008921 | Ga0209051_10089215 | 272 |
| 367 | 3300025304 | Ga0209257_1003725 | Ga0209257_10037253 | 272 |
| 368 | 3300025315 | Ga0207697_10020918 | Ga0207697_100209183 | 272 |
| 369 | 3300025893 | Ga0207682_10001047 | Ga0207682_100010473 | 272 |
| 370 | 3300025893 | Ga0207682_10006237 | Ga0207682_100062373 | 272 |
| 371 | 3300025893 | Ga0207682_10095522 | Ga0207682_100955222 | 272 |
| 372 | 3300025899 | Ga0207642_10136047 | Ga0207642_101360471 | 272 |
| 373 | 3300025903 | Ga0207680_10001068 | Ga0207680_100010687 | 272 |
| 374 | 3300025903 | Ga0207680_10039848 | Ga0207680_100398483 | 272 |
| 375 | 3300025903 | Ga0207680_10424525 | Ga0207680_104245252 | 272 |
| 376 | 3300025907 | Ga0207645_10004706 | Ga0207645_100047063 | 272 |
| 377 | 3300025907 | Ga0207645_10014655 | Ga0207645_100146552 | 272 |
| 378 | 3300025908 | Ga0207643_10017706 | Ga0207643_100177065 | 272 |
| 379 | 3300025908 | Ga0207643_10080252 | Ga0207643_100802522 | 272 |
| 380 | 3300025913 | Ga0207695_10007216 | Ga0207695_100072165 | 272 |
| 381 | 3300025913 | Ga0207695_10082478 | Ga0207695_100824782 | 272 |
| 382 | 3300025914 | Ga0207671_10214023 | Ga0207671_102140232 | 272 |
| 383 | 3300025918 | Ga0207662_10027183 | Ga0207662_100271832 | 272 |
| 384 | 3300025919 | Ga0207657_10255358 | Ga0207657_102553582 | 272 |
| 385 | 3300025924 | Ga0207694_10349242 | Ga0207694_103492421 | 272 |
| 386 | 3300025925 | Ga0207650_10009975 | Ga0207650_100099755 | 272 |
| 387 | 3300025925 | Ga0207650_10101393 | Ga0207650_101013933 | 272 |
| 388 | 3300025926 | Ga0207659_10000322 | Ga0207659_1000032215 | 272 |
| 389 | 3300025926 | Ga0207659_10008726 | Ga0207659_100087264 | 272 |
| 390 | 3300025926 | Ga0207659_10015561 | Ga0207659_100155614 | 272 |
| 391 | 3300025926 | Ga0207659_10065728 | Ga0207659_100657283 | 272 |
| 392 | 3300025931 | Ga0207644_10001344 | Ga0207644_100013442 | 272 |
| 393 | 3300025931 | Ga0207644_10032216 | Ga0207644_100322163 | 272 |
| 394 | 3300025931 | Ga0207644_10104089 | Ga0207644_101040892 | 272 |
| 395 | 3300025933 | Ga0207706_10102503 | Ga0207706_101025032 | 272 |
| 396 | 3300025935 | Ga0207709_10022513 | Ga0207709_100225133 | 272 |
| 397 | 3300025936 | Ga0207670_10011674 | Ga0207670_100116743 | 272 |
| 398 | 3300025936 | Ga0207670_10048461 | Ga0207670_100484611 | 272 |
| 399 | 3300025937 | Ga0207669_10003485 | Ga0207669_100034852 | 272 |
| 400 | 3300025940 | Ga0207691_10000018 | Ga0207691_10000018121 | 272 |
| 401 | 3300025940 | Ga0207691_10186128 | Ga0207691_101861282 | 272 |
| 402 | 3300025940 | Ga0207691_10214481 | Ga0207691_102144812 | 272 |
| 403 | 3300025940 | Ga0207691_10234077 | Ga0207691_102340772 | 272 |
| 404 | 3300025940 | Ga0207691_10446115 | Ga0207691_104461152 | 272 |
| 405 | 3300025941 | Ga0207711_10042630 | Ga0207711_100426304 | 272 |
| 406 | 3300025941 | Ga0207711_10089412 | Ga0207711_100894123 | 272 |
| 407 | 3300025941 | Ga0207711_10211901 | Ga0207711_102119012 | 272 |
| 408 | 3300025941 | Ga0207711_10435873 | Ga0207711_104358732 | 272 |
| 409 | 3300025942 | Ga0207689_10061475 | Ga0207689_100614753 | 272 |
| 410 | 3300025942 | Ga0207689_10167766 | Ga0207689_101677662 | 272 |
| 411 | 3300025942 | Ga0207689_10367962 | Ga0207689_103679622 | 272 |
| 412 | 3300025945 | Ga0207679_10065938 | Ga0207679_100659383 | 272 |
| 413 | 3300025949 | Ga0207667_10011582 | Ga0207667_1001158211 | 272 |
| 414 | 3300025949 | Ga0207667_10644054 | Ga0207667_106440542 | 272 |
| 415 | 3300025960 | Ga0207651_10003638 | Ga0207651_100036385 | 272 |
| 416 | 3300025960 | Ga0207651_10037982 | Ga0207651_100379823 | 272 |
| 417 | 3300025960 | Ga0207651_10150357 | Ga0207651_101503572 | 272 |
| 418 | 3300025960 | Ga0207651_10192900 | Ga0207651_101929002 | 272 |
| 419 | 3300025972 | Ga0207668_10020765 | Ga0207668_100207652 | 272 |
| 420 | 3300025972 | Ga0207668_10211799 | Ga0207668_102117992 | 272 |
| 421 | 3300025981 | Ga0207640_10234350 | Ga0207640_102343501 | 272 |
| 422 | 3300025986 | Ga0207658_10006133 | Ga0207658_100061335 | 272 |
| 423 | 3300025986 | Ga0207658_10023598 | Ga0207658_100235984 | 272 |
| 424 | 3300025986 | Ga0207658_10032603 | Ga0207658_100326032 | 272 |
| 425 | 3300025986 | Ga0207658_10050765 | Ga0207658_100507653 | 272 |
| 426 | 3300025986 | Ga0207658_10118246 | Ga0207658_101182462 | 272 |
| 427 | 3300025986 | Ga0207658_10267976 | Ga0207658_102679762 | 272 |
| 428 | 3300026023 | Ga0207677_10004386 | Ga0207677_100043866 | 272 |
| 429 | 3300026023 | Ga0207677_10012052 | Ga0207677_100120524 | 272 |
| 430 | 3300026023 | Ga0207677_10195210 | Ga0207677_101952102 | 272 |
| 431 | 3300026035 | Ga0207703_10000817 | Ga0207703_1000081715 | 272 |
| 432 | 3300026041 | Ga0207639_10009051 | Ga0207639_100090512 | 272 |
| 433 | 3300026088 | Ga0207641_10005073 | Ga0207641_1000507311 | 272 |
| 434 | 3300026088 | Ga0207641_10049395 | Ga0207641_100493955 | 272 |
| 435 | 3300026088 | Ga0207641_10074666 | Ga0207641_100746664 | 272 |
| 436 | 3300026088 | Ga0207641_10083149 | Ga0207641_100831492 | 272 |
| 437 | 3300026089 | Ga0207648_10026670 | Ga0207648_100266704 | 272 |
| 438 | 3300026089 | Ga0207648_10077196 | Ga0207648_100771963 | 272 |
| 439 | 3300026089 | Ga0207648_10148502 | Ga0207648_101485023 | 272 |
| 440 | 3300026089 | Ga0207648_10244922 | Ga0207648_102449222 | 272 |
| 441 | 3300026095 | Ga0207676_10001475 | Ga0207676_100014754 | 272 |
| 442 | 3300026095 | Ga0207676_10011558 | Ga0207676_100115584 | 272 |
| 443 | 3300026095 | Ga0207676_10078691 | Ga0207676_100786914 | 272 |
| 444 | 3300026116 | Ga0207674_10050876 | Ga0207674_100508763 | 272 |
| 445 | 3300026118 | Ga0207675_100024107 | Ga0207675_1000241077 | 272 |
| 446 | 3300026118 | Ga0207675_100030188 | Ga0207675_1000301886 | 272 |
| 447 | 3300026118 | Ga0207675_100049796 | Ga0207675_1000497964 | 272 |
| 448 | 3300026121 | Ga0207683_10000020 | Ga0207683_1000002065 | 272 |
| 449 | 3300026121 | Ga0207683_10024111 | Ga0207683_100241114 | 272 |
| 450 | 3300026121 | Ga0207683_10044935 | Ga0207683_100449352 | 272 |
| 451 | 3300026121 | Ga0207683_10104296 | Ga0207683_101042962 | 272 |
| 452 | 3300026121 | Ga0207683_10113807 | Ga0207683_101138072 | 272 |
| 453 | 3300026121 | Ga0207683_10396596 | Ga0207683_103965962 | 272 |
| 454 | 3300026142 | Ga0207698_10007168 | Ga0207698_1000716811 | 272 |
| 455 | 3300026142 | Ga0207698_10038539 | Ga0207698_100385392 | 272 |
| 456 | 3300027111 | Ga0209281_1000259 | Ga0209281_100025958 | 272 |
| 457 | 3300028379 | Ga0268266_10018522 | Ga0268266_100185226 | 272 |
| 458 | 3300028379 | Ga0268266_10024477 | Ga0268266_100244773 | 272 |
| 459 | 3300028380 | Ga0268265_10137561 | Ga0268265_101375612 | 272 |
| 460 | 3300028381 | Ga0268264_10052836 | Ga0268264_100528362 | 272 |
| 461 | 3300028381 | Ga0268264_10086924 | Ga0268264_100869242 | 272 |
| 462 | 3300031731 | Ga0307405_10252917 | Ga0307405_102529171 | 272 |
| 463 | 3300031911 | Ga0307412_10000392 | Ga0307412_100003926 | 272 |
| 464 | 3300031911 | Ga0307412_10357730 | Ga0307412_103577302 | 272 |
| 465 | 3300033180 | Ga0307510_10034007 | Ga0307510_100340073 | 272 |
| 466 | 3300046528 | Ga0495642_0057359 | Ga0495642_0057359_758_1576 | 272 |
| 467 | 3300046660 | Ga0495625_0010498 | Ga0495625_0010498_6391_7236 | 272 |
| 468 | 3300048905 | Ga0496102_0206626 | Ga0496102_0206626_883_1704 | 272 |
| 469 | 3300048907 | Ga0496104_0032473 | Ga0496104_0032473_2752_3570 | 272 |
| 470 | 3300048911 | Ga0496108_0452077 | Ga0496108_0452077_272_1090 | 272 |
| 471 | 3300048917 | Ga0496114_0186150 | Ga0496114_0186150_160_978 | 272 |
| 472 | 3300048919 | Ga0496116_0013245 | Ga0496116_0013245_352_1197 | 272 |
| 473 | 3300048919 | Ga0496116_0081581 | Ga0496116_0081581_1073_1894 | 272 |
| 474 | 3300048919 | Ga0496116_0125457 | Ga0496116_0125457_149_970 | 272 |
| 475 | 3300048921 | Ga0496118_0019857 | Ga0496118_0019857_4721_5542 | 272 |
| 476 | 3300048922 | Ga0496119_0003325 | Ga0496119_0003325_10409_11230 | 272 |
| 477 | 3300048923 | Ga0496120_0003204 | Ga0496120_0003204_6622_7443 | 272 |
| 478 | 3300048924 | Ga0496121_0001404 | Ga0496121_0001404_30144_30965 | 272 |
| 479 | 3300048924 | Ga0496121_0218094 | Ga0496121_0218094_328_1173 | 272 |
| 480 | 3300048924 | Ga0496121_0232548 | Ga0496121_0232548_166_1011 | 272 |
| 481 | 3300048925 | Ga0496122_0000029 | Ga0496122_0000029_29482_30303 | 272 |
| 482 | 3300048925 | Ga0496122_0004463 | Ga0496122_0004463_5516_6361 | 272 |
| 483 | 3300048926 | Ga0496123_0000531 | Ga0496123_0000531_35322_36143 | 272 |
| 484 | 3300048926 | Ga0496123_0003891 | Ga0496123_0003891_9906_10751 | 272 |
| 485 | 3300048927 | Ga0496124_0000024 | Ga0496124_0000024_290238_291059 | 272 |
| 486 | 3300048927 | Ga0496124_0004949 | Ga0496124_0004949_9220_10041 | 272 |
| 487 | 3300048927 | Ga0496124_0122058 | Ga0496124_0122058_246_1067 | 272 |
| 488 | 3300048928 | Ga0496125_0000244 | Ga0496125_0000244_21889_22710 | 272 |
| 489 | 3300048928 | Ga0496125_0015625 | Ga0496125_0015625_1740_2561 | 272 |
| 490 | 3300048928 | Ga0496125_0030924 | Ga0496125_0030924_522_1367 | 272 |
| 491 | 3300048929 | Ga0496126_0043446 | Ga0496126_0043446_561_1382 | 272 |
| 492 | 3300050491 | nmdc:mga00v17_56590_c1 | nmdc:mga00v17_56590_c1_678_1496 | 272 |
| 493 | 3300053117 | Ga0500593_000414 | Ga0500593_000414_3053_3874 | 272 |
| 494 | 3300053125 | Ga0500618_002619 | Ga0500618_002619_5537_6382 | 272 |
| 495 | 3300002987 | JGI25159J45721_1002106 | JGI25159J45721_10021063 | 273 |
| 496 | 3300003187 | JGI25151J46595_10000301 | JGI25151J46595_1000030128 | 273 |
| 497 | 3300003187 | JGI25151J46595_10011183 | JGI25151J46595_100111833 | 273 |
| 498 | 3300003322 | rootL2_10017868 | rootL2_100178689 | 273 |
| 499 | 3300003354 | JGI25160J50197_1000227 | JGI25160J50197_100022717 | 273 |
| 500 | 3300003374 | JGI25161J50226_1000007 | JGI25161J50226_100000717 | 273 |
| 501 | 3300003771 | Ga0055526_1021281 | Ga0055526_10212812 | 273 |
| 502 | 3300003773 | Ga0055537_1002740 | Ga0055537_10027404 | 273 |
| 503 | 3300003775 | Ga0055524_1001441 | Ga0055524_100144110 | 273 |
| 504 | 3300003784 | Ga0055534_1002933 | Ga0055534_10029332 | 273 |
| 505 | 3300003792 | Ga0055540_1002288 | Ga0055540_10022887 | 273 |
| 506 | 3300003794 | Ga0055531_10000740 | Ga0055531_1000074011 | 273 |
| 507 | 3300004625 | Ga0055543_1000386 | Ga0055543_10003866 | 273 |
| 508 | 3300005262 | Ga0065165_1013879 | Ga0065165_10138793 | 273 |
| 509 | 3300005293 | Ga0065715_10125321 | Ga0065715_101253213 | 273 |
| 510 | 3300005327 | Ga0070658_10224146 | Ga0070658_102241462 | 273 |
| 511 | 3300005328 | Ga0070676_10277204 | Ga0070676_102772041 | 273 |
| 512 | 3300005329 | Ga0070683_100129404 | Ga0070683_1001294042 | 273 |
| 513 | 3300005329 | Ga0070683_100647230 | Ga0070683_1006472301 | 273 |
| 514 | 3300005331 | Ga0070670_100001971 | Ga0070670_1000019713 | 273 |
| 515 | 3300005331 | Ga0070670_100029888 | Ga0070670_1000298883 | 273 |
| 516 | 3300005331 | Ga0070670_100037645 | Ga0070670_1000376455 | 273 |
| 517 | 3300005331 | Ga0070670_100043346 | Ga0070670_1000433463 | 273 |
| 518 | 3300005331 | Ga0070670_100089726 | Ga0070670_1000897262 | 273 |
| 519 | 3300005331 | Ga0070670_100119461 | Ga0070670_1001194613 | 273 |
| 520 | 3300005331 | Ga0070670_100188056 | Ga0070670_1001880563 | 273 |
| 521 | 3300005331 | Ga0070670_100328284 | Ga0070670_1003282842 | 273 |
| 522 | 3300005333 | Ga0070677_10006417 | Ga0070677_100064173 | 273 |
| 523 | 3300005333 | Ga0070677_10009189 | Ga0070677_100091895 | 273 |
| 524 | 3300005335 | Ga0070666_10363788 | Ga0070666_103637881 | 273 |
| 525 | 3300005338 | Ga0068868_100045446 | Ga0068868_1000454464 | 273 |
| 526 | 3300005338 | Ga0068868_100123985 | Ga0068868_1001239853 | 273 |
| 527 | 3300005340 | Ga0070689_100335959 | Ga0070689_1003359591 | 273 |
| 528 | 3300005344 | Ga0070661_100298968 | Ga0070661_1002989683 | 273 |
| 529 | 3300005347 | Ga0070668_100412093 | Ga0070668_1004120931 | 273 |
| 530 | 3300005353 | Ga0070669_100094824 | Ga0070669_1000948242 | 273 |
| 531 | 3300005353 | Ga0070669_100108307 | Ga0070669_1001083072 | 273 |
| 532 | 3300005354 | Ga0070675_100014529 | Ga0070675_1000145296 | 273 |
| 533 | 3300005354 | Ga0070675_100617966 | Ga0070675_1006179662 | 273 |
| 534 | 3300005355 | Ga0070671_100043160 | Ga0070671_1000431605 | 273 |
| 535 | 3300005355 | Ga0070671_100075846 | Ga0070671_1000758463 | 273 |
| 536 | 3300005355 | Ga0070671_100129197 | Ga0070671_1001291973 | 273 |
| 537 | 3300005355 | Ga0070671_100186048 | Ga0070671_1001860483 | 273 |
| 538 | 3300005356 | Ga0070674_100036756 | Ga0070674_1000367563 | 273 |
| 539 | 3300005364 | Ga0070673_100061005 | Ga0070673_1000610051 | 273 |
| 540 | 3300005364 | Ga0070673_100070739 | Ga0070673_1000707393 | 273 |
| 541 | 3300005364 | Ga0070673_100086055 | Ga0070673_1000860553 | 273 |
| 542 | 3300005367 | Ga0070667_100089857 | Ga0070667_1000898572 | 273 |
| 543 | 3300005455 | Ga0070663_100032973 | Ga0070663_1000329733 | 273 |
| 544 | 3300005455 | Ga0070663_100060857 | Ga0070663_1000608573 | 273 |
| 545 | 3300005456 | Ga0070678_100030734 | Ga0070678_1000307342 | 273 |
| 546 | 3300005456 | Ga0070678_100136716 | Ga0070678_1001367162 | 273 |
| 547 | 3300005456 | Ga0070678_100153175 | Ga0070678_1001531753 | 273 |
| 548 | 3300005456 | Ga0070678_100179796 | Ga0070678_1001797962 | 273 |
| 549 | 3300005456 | Ga0070678_100325069 | Ga0070678_1003250692 | 273 |
| 550 | 3300005457 | Ga0070662_100104882 | Ga0070662_1001048823 | 273 |
| 551 | 3300005457 | Ga0070662_100440947 | Ga0070662_1004409471 | 273 |
| 552 | 3300005459 | Ga0068867_100012008 | Ga0068867_1000120087 | 273 |
| 553 | 3300005459 | Ga0068867_100021275 | Ga0068867_1000212756 | 273 |
| 554 | 3300005459 | Ga0068867_100049323 | Ga0068867_1000493233 | 273 |
| 555 | 3300005459 | Ga0068867_100153326 | Ga0068867_1001533262 | 273 |
| 556 | 3300005467 | Ga0070706_100002539 | Ga0070706_1000025395 | 273 |
| 557 | 3300005468 | Ga0070707_100036814 | Ga0070707_1000368145 | 273 |
| 558 | 3300005535 | Ga0070684_100049524 | Ga0070684_1000495242 | 273 |
| 559 | 3300005543 | Ga0070672_100067655 | Ga0070672_1000676553 | 273 |
| 560 | 3300005543 | Ga0070672_100137156 | Ga0070672_1001371563 | 273 |
| 561 | 3300005543 | Ga0070672_100242749 | Ga0070672_1002427492 | 273 |
| 562 | 3300005548 | Ga0070665_100414457 | Ga0070665_1004144572 | 273 |
| 563 | 3300005564 | Ga0070664_100026043 | Ga0070664_1000260433 | 273 |
| 564 | 3300005564 | Ga0070664_100072613 | Ga0070664_1000726132 | 273 |
| 565 | 3300005564 | Ga0070664_100196192 | Ga0070664_1001961922 | 273 |
| 566 | 3300005577 | Ga0068857_100017408 | Ga0068857_1000174084 | 273 |
| 567 | 3300005577 | Ga0068857_100157826 | Ga0068857_1001578262 | 273 |
| 568 | 3300005578 | Ga0068854_100110195 | Ga0068854_1001101952 | 273 |
| 569 | 3300005578 | Ga0068854_100352732 | Ga0068854_1003527322 | 273 |
| 570 | 3300005616 | Ga0068852_100084077 | Ga0068852_1000840773 | 273 |
| 571 | 3300005616 | Ga0068852_100161780 | Ga0068852_1001617802 | 273 |
| 572 | 3300005617 | Ga0068859_100098576 | Ga0068859_1000985764 | 273 |
| 573 | 3300005618 | Ga0068864_100021018 | Ga0068864_1000210183 | 273 |
| 574 | 3300005618 | Ga0068864_100044697 | Ga0068864_1000446973 | 273 |
| 575 | 3300005618 | Ga0068864_100096415 | Ga0068864_1000964151 | 273 |
| 576 | 3300005618 | Ga0068864_100184809 | Ga0068864_1001848093 | 273 |
| 577 | 3300005719 | Ga0068861_100105393 | Ga0068861_1001053932 | 273 |
| 578 | 3300005841 | Ga0068863_100034799 | Ga0068863_1000347993 | 273 |
| 579 | 3300005841 | Ga0068863_100152090 | Ga0068863_1001520902 | 273 |
| 580 | 3300005842 | Ga0068858_100539810 | Ga0068858_1005398102 | 273 |
| 581 | 3300006028 | Ga0070717_10179449 | Ga0070717_101794492 | 273 |
| 582 | 3300006038 | Ga0075365_10162457 | Ga0075365_101624573 | 273 |
| 583 | 3300006042 | Ga0075368_10114950 | Ga0075368_101149501 | 273 |
| 584 | 3300006048 | Ga0075363_100036983 | Ga0075363_1000369832 | 273 |
| 585 | 3300006051 | Ga0075364_10350918 | Ga0075364_103509182 | 273 |
| 586 | 3300006177 | Ga0075362_10062690 | Ga0075362_100626902 | 273 |
| 587 | 3300006178 | Ga0075367_10010982 | Ga0075367_100109826 | 273 |
| 588 | 3300006178 | Ga0075367_10018189 | Ga0075367_100181893 | 273 |
| 589 | 3300006178 | Ga0075367_10166400 | Ga0075367_101664003 | 273 |
| 590 | 3300006186 | Ga0075369_10086249 | Ga0075369_100862492 | 273 |
| 591 | 3300006195 | Ga0075366_10143252 | Ga0075366_101432522 | 273 |
| 592 | 3300006195 | Ga0075366_10210536 | Ga0075366_102105362 | 273 |
| 593 | 3300006237 | Ga0097621_100140720 | Ga0097621_1001407203 | 273 |
| 594 | 3300006237 | Ga0097621_100241368 | Ga0097621_1002413682 | 273 |
| 595 | 3300006353 | Ga0075370_10006766 | Ga0075370_100067667 | 273 |
| 596 | 3300006353 | Ga0075370_10027723 | Ga0075370_100277232 | 273 |
| 597 | 3300006353 | Ga0075370_10070550 | Ga0075370_100705503 | 273 |
| 598 | 3300006353 | Ga0075370_10127002 | Ga0075370_101270022 | 273 |
| 599 | 3300006358 | Ga0068871_100473496 | Ga0068871_1004734962 | 273 |
| 600 | 3300006881 | Ga0068865_100041947 | Ga0068865_1000419474 | 273 |
| 601 | 3300006931 | Ga0097620_100098578 | Ga0097620_1000985784 | 273 |
| 602 | 3300006948 | Ga0099826_10000021 | Ga0099826_10000021125 | 273 |
| 603 | 3300009093 | Ga0105240_10041470 | Ga0105240_100414706 | 273 |
| 604 | 3300009098 | Ga0105245_10105475 | Ga0105245_101054753 | 273 |
| 605 | 3300009148 | Ga0105243_10251968 | Ga0105243_102519682 | 273 |
| 606 | 3300009148 | Ga0105243_10438575 | Ga0105243_104385752 | 273 |
| 607 | 3300009174 | Ga0105241_10165743 | Ga0105241_101657432 | 273 |
| 608 | 3300009177 | Ga0105248_10116526 | Ga0105248_101165263 | 273 |
| 609 | 3300009545 | Ga0105237_10051964 | Ga0105237_100519643 | 273 |
| 610 | 3300009545 | Ga0105237_10279165 | Ga0105237_102791653 | 273 |
| 611 | 3300010375 | Ga0105239_10159772 | Ga0105239_101597722 | 273 |
| 612 | 3300012497 | Ga0157319_1000695 | Ga0157319_10006951 | 273 |
| 613 | 3300013296 | Ga0157374_10050728 | Ga0157374_100507283 | 273 |
| 614 | 3300013296 | Ga0157374_10482189 | Ga0157374_104821892 | 273 |
| 615 | 3300013296 | Ga0157374_10606869 | Ga0157374_106068691 | 273 |
| 616 | 3300013297 | Ga0157378_10378962 | Ga0157378_103789623 | 273 |
| 617 | 3300013297 | Ga0157378_10508236 | Ga0157378_105082362 | 273 |
| 618 | 3300013297 | Ga0157378_10516439 | Ga0157378_105164392 | 273 |
| 619 | 3300013306 | Ga0163162_10115597 | Ga0163162_101155973 | 273 |
| 620 | 3300013308 | Ga0157375_10035622 | Ga0157375_100356221 | 273 |
| 621 | 3300013308 | Ga0157375_10059297 | Ga0157375_100592972 | 273 |
| 622 | 3300013308 | Ga0157375_10064588 | Ga0157375_100645882 | 273 |
| 623 | 3300014325 | Ga0163163_10217309 | Ga0163163_102173092 | 273 |
| 624 | 3300014969 | Ga0157376_10215134 | Ga0157376_102151342 | 273 |
| 625 | 3300025206 | Ga0209435_100019 | Ga0209435_100019195 | 273 |
| 626 | 3300025208 | Ga0209436_104004 | Ga0209436_1040045 | 273 |
| 627 | 3300025246 | Ga0209646_1000038 | Ga0209646_1000038196 | 273 |
| 628 | 3300025250 | Ga0209026_1000048 | Ga0209026_1000048195 | 273 |
| 629 | 3300025256 | Ga0209759_1000038 | Ga0209759_100003849 | 273 |
| 630 | 3300025263 | Ga0209565_1000615 | Ga0209565_100061511 | 273 |
| 631 | 3300025273 | Ga0209673_1011259 | Ga0209673_10112593 | 273 |
| 632 | 3300025273 | Ga0209673_1027129 | Ga0209673_10271293 | 273 |
| 633 | 3300025284 | Ga0209130_1000289 | Ga0209130_100028941 | 273 |
| 634 | 3300025284 | Ga0209130_1012738 | Ga0209130_10127383 | 273 |
| 635 | 3300025291 | Ga0209675_1001778 | Ga0209675_10017789 | 273 |
| 636 | 3300025291 | Ga0209675_1010406 | Ga0209675_10104063 | 273 |
| 637 | 3300025292 | Ga0209676_1013043 | Ga0209676_10130434 | 273 |
| 638 | 3300025294 | Ga0209025_1000003 | Ga0209025_10000031227 | 273 |
| 639 | 3300025294 | Ga0209025_1001751 | Ga0209025_10017516 | 273 |
| 640 | 3300025294 | Ga0209025_1010755 | Ga0209025_10107553 | 273 |
| 641 | 3300025294 | Ga0209025_1018466 | Ga0209025_10184664 | 273 |
| 642 | 3300025294 | Ga0209025_1051447 | Ga0209025_10514472 | 273 |
| 643 | 3300025295 | Ga0209564_1001767 | Ga0209564_10017677 | 273 |
| 644 | 3300025295 | Ga0209564_1002258 | Ga0209564_10022585 | 273 |
| 645 | 3300025297 | Ga0209758_1040043 | Ga0209758_10400432 | 273 |
| 646 | 3300025298 | Ga0209050_1004794 | Ga0209050_10047948 | 273 |
| 647 | 3300025299 | Ga0209256_1000127 | Ga0209256_1000127137 | 273 |
| 648 | 3300025299 | Ga0209256_1000906 | Ga0209256_10009065 | 273 |
| 649 | 3300025302 | Ga0207426_1000091 | Ga0207426_1000091203 | 273 |
| 650 | 3300025303 | Ga0209051_1000351 | Ga0209051_100035142 | 273 |
| 651 | 3300025303 | Ga0209051_1015139 | Ga0209051_10151392 | 273 |
| 652 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015284 | 273 |
| 653 | 3300025304 | Ga0209257_1013914 | Ga0209257_10139143 | 273 |
| 654 | 3300025321 | Ga0207656_10087638 | Ga0207656_100876382 | 273 |
| 655 | 3300025321 | Ga0207656_10170628 | Ga0207656_101706282 | 273 |
| 656 | 3300025901 | Ga0207688_10043780 | Ga0207688_100437802 | 273 |
| 657 | 3300025907 | Ga0207645_10071087 | Ga0207645_100710872 | 273 |
| 658 | 3300025907 | Ga0207645_10094840 | Ga0207645_100948402 | 273 |
| 659 | 3300025907 | Ga0207645_10095900 | Ga0207645_100959003 | 273 |
| 660 | 3300025908 | Ga0207643_10042663 | Ga0207643_100426633 | 273 |
| 661 | 3300025910 | Ga0207684_10023176 | Ga0207684_100231765 | 273 |
| 662 | 3300025913 | Ga0207695_10123453 | Ga0207695_101234533 | 273 |
| 663 | 3300025914 | Ga0207671_10061344 | Ga0207671_100613443 | 273 |
| 664 | 3300025914 | Ga0207671_10126738 | Ga0207671_101267382 | 273 |
| 665 | 3300025920 | Ga0207649_10324495 | Ga0207649_103244952 | 273 |
| 666 | 3300025923 | Ga0207681_10006325 | Ga0207681_100063254 | 273 |
| 667 | 3300025925 | Ga0207650_10000710 | Ga0207650_100007107 | 273 |
| 668 | 3300025925 | Ga0207650_10028205 | Ga0207650_100282054 | 273 |
| 669 | 3300025925 | Ga0207650_10046048 | Ga0207650_100460483 | 273 |
| 670 | 3300025925 | Ga0207650_10066503 | Ga0207650_100665032 | 273 |
| 671 | 3300025925 | Ga0207650_10067275 | Ga0207650_100672753 | 273 |
| 672 | 3300025925 | Ga0207650_10164554 | Ga0207650_101645541 | 273 |
| 673 | 3300025926 | Ga0207659_10008216 | Ga0207659_100082167 | 273 |
| 674 | 3300025926 | Ga0207659_10165010 | Ga0207659_101650102 | 273 |
| 675 | 3300025926 | Ga0207659_10240214 | Ga0207659_102402142 | 273 |
| 676 | 3300025931 | Ga0207644_10001677 | Ga0207644_100016773 | 273 |
| 677 | 3300025931 | Ga0207644_10087523 | Ga0207644_100875233 | 273 |
| 678 | 3300025931 | Ga0207644_10129888 | Ga0207644_101298883 | 273 |
| 679 | 3300025933 | Ga0207706_10003941 | Ga0207706_100039412 | 273 |
| 680 | 3300025933 | Ga0207706_10348057 | Ga0207706_103480572 | 273 |
| 681 | 3300025937 | Ga0207669_10003984 | Ga0207669_100039843 | 273 |
| 682 | 3300025937 | Ga0207669_10343979 | Ga0207669_103439791 | 273 |
| 683 | 3300025940 | Ga0207691_10028725 | Ga0207691_100287251 | 273 |
| 684 | 3300025940 | Ga0207691_10182602 | Ga0207691_101826023 | 273 |
| 685 | 3300025940 | Ga0207691_10270263 | Ga0207691_102702632 | 273 |
| 686 | 3300025941 | Ga0207711_10005256 | Ga0207711_100052565 | 273 |
| 687 | 3300025942 | Ga0207689_10006735 | Ga0207689_100067356 | 273 |
| 688 | 3300025942 | Ga0207689_10007284 | Ga0207689_100072842 | 273 |
| 689 | 3300025942 | Ga0207689_10472244 | Ga0207689_104722442 | 273 |
| 690 | 3300025944 | Ga0207661_10192549 | Ga0207661_101925492 | 273 |
| 691 | 3300025945 | Ga0207679_10042747 | Ga0207679_100427473 | 273 |
| 692 | 3300025945 | Ga0207679_10091344 | Ga0207679_100913442 | 273 |
| 693 | 3300025945 | Ga0207679_10132589 | Ga0207679_101325892 | 273 |
| 694 | 3300025981 | Ga0207640_10211336 | Ga0207640_102113362 | 273 |
| 695 | 3300026023 | Ga0207677_10006410 | Ga0207677_100064106 | 273 |
| 696 | 3300026023 | Ga0207677_10006484 | Ga0207677_100064844 | 273 |
| 697 | 3300026023 | Ga0207677_10433020 | Ga0207677_104330202 | 273 |
| 698 | 3300026067 | Ga0207678_10048631 | Ga0207678_100486313 | 273 |
| 699 | 3300026089 | Ga0207648_10032136 | Ga0207648_100321361 | 273 |
| 700 | 3300026089 | Ga0207648_10052000 | Ga0207648_100520005 | 273 |
| 701 | 3300026089 | Ga0207648_10086284 | Ga0207648_100862842 | 273 |
| 702 | 3300026089 | Ga0207648_10124194 | Ga0207648_101241943 | 273 |
| 703 | 3300026089 | Ga0207648_10135345 | Ga0207648_101353453 | 273 |
| 704 | 3300026095 | Ga0207676_10010532 | Ga0207676_100105323 | 273 |
| 705 | 3300026095 | Ga0207676_10017436 | Ga0207676_100174362 | 273 |
| 706 | 3300026095 | Ga0207676_10019636 | Ga0207676_100196363 | 273 |
| 707 | 3300026095 | Ga0207676_10112667 | Ga0207676_101126673 | 273 |
| 708 | 3300026116 | Ga0207674_10012362 | Ga0207674_100123627 | 273 |
| 709 | 3300026116 | Ga0207674_10016088 | Ga0207674_100160884 | 273 |
| 710 | 3300026116 | Ga0207674_10202405 | Ga0207674_102024052 | 273 |
| 711 | 3300026118 | Ga0207675_100057248 | Ga0207675_1000572485 | 273 |
| 712 | 3300026118 | Ga0207675_100225865 | Ga0207675_1002258653 | 273 |
| 713 | 3300026121 | Ga0207683_10089845 | Ga0207683_100898452 | 273 |
| 714 | 3300026121 | Ga0207683_10219993 | Ga0207683_102199933 | 273 |
| 715 | 3300027614 | Ga0209970_1000196 | Ga0209970_10001964 | 273 |
| 716 | 3300027666 | Ga0209282_1000019 | Ga0209282_1000019123 | 273 |
| 717 | 3300027866 | Ga0209813_10024788 | Ga0209813_100247882 | 273 |
| 718 | 3300028379 | Ga0268266_10271557 | Ga0268266_102715572 | 273 |
| 719 | 3300028380 | Ga0268265_10298618 | Ga0268265_102986181 | 273 |
| 720 | 3300028786 | Ga0307517_10002655 | Ga0307517_1000265526 | 273 |
| 721 | 3300028794 | Ga0307515_10000138 | Ga0307515_10000138109 | 273 |
| 722 | 3300028794 | Ga0307515_10001193 | Ga0307515_1000119329 | 273 |
| 723 | 3300028794 | Ga0307515_10002234 | Ga0307515_1000223441 | 273 |
| 724 | 3300028794 | Ga0307515_10023840 | Ga0307515_100238409 | 273 |
| 725 | 3300028794 | Ga0307515_10041898 | Ga0307515_100418984 | 273 |
| 726 | 3300028794 | Ga0307515_10067248 | Ga0307515_100672483 | 273 |
| 727 | 3300028794 | Ga0307515_10094964 | Ga0307515_100949644 | 273 |
| 728 | 3300028794 | Ga0307515_10135512 | Ga0307515_101355123 | 273 |
| 729 | 3300028794 | Ga0307515_10146542 | Ga0307515_101465422 | 273 |
| 730 | 3300031235 | Ga0265330_10014274 | Ga0265330_100142742 | 273 |
| 731 | 3300031238 | Ga0265332_10035841 | Ga0265332_100358413 | 273 |
| 732 | 3300031242 | Ga0265329_10011414 | Ga0265329_100114143 | 273 |
| 733 | 3300031250 | Ga0265331_10043380 | Ga0265331_100433802 | 273 |
| 734 | 3300031344 | Ga0265316_10199220 | Ga0265316_101992203 | 273 |
| 735 | 3300031456 | Ga0307513_10000013 | Ga0307513_1000001371 | 273 |
| 736 | 3300031456 | Ga0307513_10000246 | Ga0307513_1000024654 | 273 |
| 737 | 3300031456 | Ga0307513_10007912 | Ga0307513_1000791214 | 273 |
| 738 | 3300031456 | Ga0307513_10027457 | Ga0307513_100274576 | 273 |
| 739 | 3300031456 | Ga0307513_10075694 | Ga0307513_100756943 | 273 |
| 740 | 3300031456 | Ga0307513_10104696 | Ga0307513_101046962 | 273 |
| 741 | 3300031456 | Ga0307513_10325978 | Ga0307513_103259781 | 273 |
| 742 | 3300031507 | Ga0307509_10007099 | Ga0307509_100070997 | 273 |
| 743 | 3300031507 | Ga0307509_10019271 | Ga0307509_100192715 | 273 |
| 744 | 3300031507 | Ga0307509_10033367 | Ga0307509_100333676 | 273 |
| 745 | 3300031507 | Ga0307509_10164667 | Ga0307509_101646673 | 273 |
| 746 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008333 | 273 |
| 747 | 3300031616 | Ga0307508_10000450 | Ga0307508_100004508 | 273 |
| 748 | 3300031616 | Ga0307508_10008054 | Ga0307508_100080544 | 273 |
| 749 | 3300031616 | Ga0307508_10055717 | Ga0307508_100557174 | 273 |
| 750 | 3300031649 | Ga0307514_10001030 | Ga0307514_100010305 | 273 |
| 751 | 3300031649 | Ga0307514_10008692 | Ga0307514_100086929 | 273 |
| 752 | 3300031649 | Ga0307514_10109370 | Ga0307514_101093703 | 273 |
| 753 | 3300031649 | Ga0307514_10156290 | Ga0307514_101562902 | 273 |
| 754 | 3300031711 | Ga0265314_10008574 | Ga0265314_100085743 | 273 |
| 755 | 3300031711 | Ga0265314_10038564 | Ga0265314_100385643 | 273 |
| 756 | 3300031712 | Ga0265342_10038530 | Ga0265342_100385302 | 273 |
| 757 | 3300031730 | Ga0307516_10008482 | Ga0307516_100084822 | 273 |
| 758 | 3300031730 | Ga0307516_10077658 | Ga0307516_100776581 | 273 |
| 759 | 3300031730 | Ga0307516_10353428 | Ga0307516_103534281 | 273 |
| 760 | 3300031838 | Ga0307518_10244042 | Ga0307518_102440422 | 273 |
| 761 | 3300031838 | Ga0307518_10330066 | Ga0307518_103300661 | 273 |
| 762 | 3300032004 | Ga0307414_10115733 | Ga0307414_101157332 | 273 |
| 763 | 3300032005 | Ga0307411_10002080 | Ga0307411_100020803 | 273 |
| 764 | 3300035113 | Ga0373936_0043270 | Ga0373936_0043270_371_1192 | 273 |
| 765 | 3300035120 | Ga0373957_0028893 | Ga0373957_0028893_1117_1938 | 273 |
| 766 | 3300035172 | Ga0373955_0292472 | Ga0373955_0292472_32_853 | 273 |
| 767 | 3300035691 | Ga0373931_0025968 | Ga0373931_0025968_508_1329 | 273 |
| 768 | 3300035724 | Ga0373933_0190358 | Ga0373933_0190358_462_1283 | 273 |
| 769 | 3300036401 | Ga0373937_0040657 | Ga0373937_0040657_244_1065 | 273 |
| 770 | 3300045051 | Ga0451576_0019302 | Ga0451576_0019302_6395_7216 | 273 |
| 771 | 3300046460 | Ga0495638_0077305 | Ga0495638_0077305_252_1073 | 273 |
| 772 | 3300046501 | Ga0495607_0000507 | Ga0495607_0000507_37281_38108 | 273 |
| 773 | 3300046512 | Ga0495610_0001367 | Ga0495610_0001367_6483_7304 | 273 |
| 774 | 3300046513 | Ga0495616_0000866 | Ga0495616_0000866_3912_4733 | 273 |
| 775 | 3300046519 | Ga0495632_0112483 | Ga0495632_0112483_25_846 | 273 |
| 776 | 3300046524 | Ga0495648_0110383 | Ga0495648_0110383_318_1139 | 273 |
| 777 | 3300046530 | Ga0495654_0000834 | Ga0495654_0000834_2892_3713 | 273 |
| 778 | 3300046538 | Ga0495609_0000244 | Ga0495609_0000244_24450_25271 | 273 |
| 779 | 3300046665 | Ga0495661_0008722 | Ga0495661_0008722_339_1160 | 273 |
| 780 | 3300046692 | Ga0495671_0000453 | Ga0495671_0000453_2820_3641 | 273 |
| 781 | 3300046694 | Ga0495649_0004212 | Ga0495649_0004212_4232_5053 | 273 |
| 782 | 3300046810 | Ga0495660_0031902 | Ga0495660_0031902_1745_2566 | 273 |
| 783 | 3300047320 | Ga0495672_0032883 | Ga0495672_0032883_671_1492 | 273 |
| 784 | 3300047447 | Ga0495685_001488 | Ga0495685_001488_6153_6974 | 273 |
| 785 | 3300047472 | Ga0495686_0241770 | Ga0495686_0241770_45_866 | 273 |
| 786 | 3300048904 | Ga0496101_0379158 | Ga0496101_0379158_199_1041 | 273 |
| 787 | 3300048909 | Ga0496106_0284822 | Ga0496106_0284822_467_1288 | 273 |
| 788 | 3300048919 | Ga0496116_0067024 | Ga0496116_0067024_676_1497 | 273 |
| 789 | 3300048921 | Ga0496118_0053756 | Ga0496118_0053756_1635_2456 | 273 |
| 790 | 3300048924 | Ga0496121_0005640 | Ga0496121_0005640_3310_4131 | 273 |
| 791 | 3300048925 | Ga0496122_0004249 | Ga0496122_0004249_3672_4493 | 273 |
| 792 | 3300048926 | Ga0496123_0000124 | Ga0496123_0000124_147984_148805 | 273 |
| 793 | 3300048926 | Ga0496123_0001761 | Ga0496123_0001761_18094_18915 | 273 |
| 794 | 3300050493 | nmdc:mga0k408_247959_c1 | nmdc:mga0k408_247959_c1_22_843 | 273 |
| 795 | 3300050493 | nmdc:mga0k408_254840_c1 | nmdc:mga0k408_254840_c1_210_1031 | 273 |
| 796 | 3300050493 | nmdc:mga0k408_7822_c1 | nmdc:mga0k408_7822_c1_3194_4015 | 273 |
| 797 | 3300050496 | nmdc:mga07m45_10453_c1 | nmdc:mga07m45_10453_c1_954_1775 | 273 |
| 798 | 3300050496 | nmdc:mga07m45_122_c1 | nmdc:mga07m45_122_c1_23189_24010 | 273 |
| 799 | 3300050496 | nmdc:mga07m45_196634_c1 | nmdc:mga07m45_196634_c1_144_965 | 273 |
| 800 | 3300050496 | nmdc:mga07m45_4239_c1 | nmdc:mga07m45_4239_c1_4130_4951 | 273 |
| 801 | 3300050496 | nmdc:mga07m45_93670_c1 | nmdc:mga07m45_93670_c1_866_1687 | 273 |
| 802 | 3300050516 | nmdc:mga0sz30_147099_c1 | nmdc:mga0sz30_147099_c1_72_893 | 273 |
| 803 | 3300050516 | nmdc:mga0sz30_15597_c1 | nmdc:mga0sz30_15597_c1_69_890 | 273 |
| 804 | 3300053117 | Ga0500593_003241 | Ga0500593_003241_1159_1986 | 273 |
| 805 | 3300053118 | Ga0500594_0017153 | Ga0500594_0017153_128_949 | 273 |
| 806 | 3300053136 | Ga0500559_0000047 | Ga0500559_0000047_80815_81636 | 273 |
| 807 | 3300053739 | Ga0500587_002315 | Ga0500587_002315_113_934 | 273 |
| 808 | iso_pu_bacteria | 2599185214 | 2599622444 | 273 |
| 809 | iso_pu_bacteria | 2599185226 | 2599674464 | 273 |
| 810 | iso_pu_bacteria | 2599185227 | 2599680149 | 273 |
| 811 | iso_pu_bacteria | 2599185229 | 2599692165 | 273 |
| 812 | iso_pu_bacteria | 2643221628 | 2644160849 | 273 |
| 813 | iso_pu_bacteria | 2643221672 | 2644396904 | 273 |
| 814 | iso_pu_bacteria | 2738541277 | 2738719305 | 273 |
| 815 | iso_pu_bacteria | 2738541307 | 2738883349 | 273 |
| 816 | iso_pu_bacteria | 2738543013 | 2739247375 | 273 |
| 817 | iso_pu_bacteria | 2738543019 | 2739282964 | 273 |
| 818 | iso_pu_bacteria | 2818991446 | 2819599144 | 273 |
| 819 | iso_pu_bacteria | 2831265667 | 2831270925 | 273 |
| 820 | iso_pu_bacteria | 2838054893 | 2838058972 | 273 |
| 821 | iso_pu_bacteria | 2842677519 | 2842679286 | 273 |
| 822 | iso_pu_bacteria | 2842733646 | 2842738290 | 273 |
| 823 | iso_pu_bacteria | 2885192300 | 2885193976 | 273 |
| 824 | iso_pu_bacteria | 2885198086 | 2885202258 | 273 |
| 825 | iso_pu_bacteria | 2885211737 | 2885215911 | 273 |
| 826 | iso_pu_bacteria | 2899924645 | 2899929968 | 273 |
| 827 | iso_pu_bacteria | 2904449895 | 2904451618 | 273 |
| 828 | iso_pu_bacteria | 2904456579 | 2904461893 | 273 |
| 829 | iso_pu_bacteria | 2904541872 | 2904543295 | 273 |
| 830 | iso_pu_bacteria | 2919462493 | 2919464482 | 273 |
| 831 | iso_pu_bacteria | 2928037797 | 2928043503 | 273 |
| 832 | iso_pu_bacteria | 2928044640 | 2928049867 | 273 |
| 833 | iso_pu_bacteria | 2928051484 | 2928054442 | 273 |
| 834 | iso_pu_bacteria | 2928064002 | 2928070028 | 273 |
| 835 | iso_pu_bacteria | 2928070936 | 2928074353 | 273 |
| 836 | iso_pu_bacteria | 2928084124 | 2928086591 | 273 |
| 837 | iso_pu_bacteria | 2929160207 | 2929160527 | 273 |
| 838 | iso_pu_bacteria | 2929520902 | 2929526537 | 273 |
| 839 | iso_pu_bacteria | 2945909444 | 2945915519 | 273 |
| 840 | iso_pu_bacteria | 2945972063 | 2945974897 | 273 |
| 841 | iso_pu_bacteria | 2945984333 | 2945989083 | 273 |
| 842 | 3300039438 | Ga0436360_1081132 | Ga0436360_1081132_209_1033 | 274 |
| 843 | 3300039450 | Ga0436363_0171481 | Ga0436363_0171481_169_993 | 274 |
| 844 | 3300009093 | Ga0105240_10290611 | Ga0105240_102906112 | 275 |
| 845 | 3300025913 | Ga0207695_10178105 | Ga0207695_101781053 | 275 |
| 846 | 3300003215 | JGI25153J46596_10012010 | JGI25153J46596_100120105 | 276 |
| 847 | 3300005367 | Ga0070667_100474046 | Ga0070667_1004740461 | 276 |
| 848 | 3300013308 | Ga0157375_10451319 | Ga0157375_104513192 | 276 |
| 849 | 3300025273 | Ga0209673_1026678 | Ga0209673_10266782 | 276 |
| 850 | 3300025972 | Ga0207668_10287717 | Ga0207668_102877172 | 276 |
| 851 | 3300046615 | Ga0495656_0000365 | Ga0495656_0000365_11663_12493 | 276 |
| 852 | 3300001979 | JGI24740J21852_10010263 | JGI24740J21852_100102633 | 277 |
| 853 | 3300001989 | JGI24739J22299_10015867 | JGI24739J22299_100158673 | 277 |
| 854 | 3300002704 | JGI25155J39150_1000042 | JGI25155J39150_100004218 | 277 |
| 855 | 3300002705 | JGI25156J39149_1000053 | JGI25156J39149_100005363 | 277 |
| 856 | 3300002738 | JGI25154J39366_1000082 | JGI25154J39366_100008263 | 277 |
| 857 | 3300002741 | JGI25157J39369_1000072 | JGI25157J39369_100007218 | 277 |
| 858 | 3300002987 | JGI25159J45721_1010517 | JGI25159J45721_10105172 | 277 |
| 859 | 3300003761 | Ga0055535_1000260 | Ga0055535_10002605 | 277 |
| 860 | 3300003762 | Ga0055542_1000013 | Ga0055542_1000013199 | 277 |
| 861 | 3300003781 | Ga0055536_1004462 | Ga0055536_10044625 | 277 |
| 862 | 3300003784 | Ga0055534_1001477 | Ga0055534_10014778 | 277 |
| 863 | 3300003784 | Ga0055534_1006234 | Ga0055534_10062344 | 277 |
| 864 | 3300003791 | Ga0055530_10003439 | Ga0055530_100034395 | 277 |
| 865 | 3300003791 | Ga0055530_10018827 | Ga0055530_100188273 | 277 |
| 866 | 3300003792 | Ga0055540_1013297 | Ga0055540_10132972 | 277 |
| 867 | 3300005335 | Ga0070666_10079624 | Ga0070666_100796243 | 277 |
| 868 | 3300005366 | Ga0070659_100310018 | Ga0070659_1003100181 | 277 |
| 869 | 3300005539 | Ga0068853_100072987 | Ga0068853_1000729873 | 277 |
| 870 | 3300005539 | Ga0068853_100454005 | Ga0068853_1004540052 | 277 |
| 871 | 3300005564 | Ga0070664_100074036 | Ga0070664_1000740362 | 277 |
| 872 | 3300005577 | Ga0068857_100330635 | Ga0068857_1003306353 | 277 |
| 873 | 3300005578 | Ga0068854_100072045 | Ga0068854_1000720453 | 277 |
| 874 | 3300005616 | Ga0068852_100063421 | Ga0068852_1000634213 | 277 |
| 875 | 3300005844 | Ga0068862_100113099 | Ga0068862_1001130993 | 277 |
| 876 | 3300006038 | Ga0075365_10299676 | Ga0075365_102996762 | 277 |
| 877 | 3300006051 | Ga0075364_10109509 | Ga0075364_101095092 | 277 |
| 878 | 3300006186 | Ga0075369_10059355 | Ga0075369_100593552 | 277 |
| 879 | 3300006195 | Ga0075366_10015678 | Ga0075366_100156782 | 277 |
| 880 | 3300006195 | Ga0075366_10064729 | Ga0075366_100647292 | 277 |
| 881 | 3300006237 | Ga0097621_100450408 | Ga0097621_1004504082 | 277 |
| 882 | 3300006353 | Ga0075370_10024220 | Ga0075370_100242202 | 277 |
| 883 | 3300009036 | Ga0105244_10003602 | Ga0105244_100036023 | 277 |
| 884 | 3300009093 | Ga0105240_10112031 | Ga0105240_101120314 | 277 |
| 885 | 3300009148 | Ga0105243_10041298 | Ga0105243_100412983 | 277 |
| 886 | 3300009551 | Ga0105238_10196657 | Ga0105238_101966571 | 277 |
| 887 | 3300010375 | Ga0105239_10063942 | Ga0105239_100639423 | 277 |
| 888 | 3300011119 | Ga0105246_10402965 | Ga0105246_104029652 | 277 |
| 889 | 3300012505 | Ga0157339_1001068 | Ga0157339_10010682 | 277 |
| 890 | 3300013102 | Ga0157371_10045298 | Ga0157371_100452983 | 277 |
| 891 | 3300013104 | Ga0157370_10310879 | Ga0157370_103108791 | 277 |
| 892 | 3300013105 | Ga0157369_10035810 | Ga0157369_100358106 | 277 |
| 893 | 3300013307 | Ga0157372_10060900 | Ga0157372_100609003 | 277 |
| 894 | 3300014497 | Ga0182008_10053291 | Ga0182008_100532912 | 277 |
| 895 | 3300014497 | Ga0182008_10079655 | Ga0182008_100796552 | 277 |
| 896 | 3300015261 | Ga0182006_1014559 | Ga0182006_10145593 | 277 |
| 897 | 3300015262 | Ga0182007_10002108 | Ga0182007_100021088 | 277 |
| 898 | 3300015262 | Ga0182007_10016980 | Ga0182007_100169803 | 277 |
| 899 | 3300015683 | Ga0183362_10004 | Ga0183362_10004501 | 277 |
| 900 | 3300017792 | Ga0163161_10155206 | Ga0163161_101552063 | 277 |
| 901 | 3300025208 | Ga0209436_105266 | Ga0209436_1052663 | 277 |
| 902 | 3300025228 | Ga0209672_102201 | Ga0209672_1022013 | 277 |
| 903 | 3300025229 | Ga0209147_100843 | Ga0209147_1008439 | 277 |
| 904 | 3300025242 | Ga0209258_100020 | Ga0209258_100020355 | 277 |
| 905 | 3300025245 | Ga0207425_1000814 | Ga0207425_10008147 | 277 |
| 906 | 3300025254 | Ga0209148_1000031 | Ga0209148_1000031355 | 277 |
| 907 | 3300025258 | Ga0209129_1000055 | Ga0209129_1000055216 | 277 |
| 908 | 3300025258 | Ga0209129_1006666 | Ga0209129_10066662 | 277 |
| 909 | 3300025263 | Ga0209565_1000078 | Ga0209565_100007819 | 277 |
| 910 | 3300025263 | Ga0209565_1000310 | Ga0209565_100031037 | 277 |
| 911 | 3300025263 | Ga0209565_1001707 | Ga0209565_10017076 | 277 |
| 912 | 3300025273 | Ga0209673_1000170 | Ga0209673_1000170115 | 277 |
| 913 | 3300025273 | Ga0209673_1001531 | Ga0209673_10015318 | 277 |
| 914 | 3300025273 | Ga0209673_1002628 | Ga0209673_10026285 | 277 |
| 915 | 3300025284 | Ga0209130_1000807 | Ga0209130_100080720 | 277 |
| 916 | 3300025284 | Ga0209130_1001274 | Ga0209130_100127415 | 277 |
| 917 | 3300025284 | Ga0209130_1011749 | Ga0209130_10117492 | 277 |
| 918 | 3300025291 | Ga0209675_1000055 | Ga0209675_1000055115 | 277 |
| 919 | 3300025291 | Ga0209675_1002139 | Ga0209675_10021398 | 277 |
| 920 | 3300025291 | Ga0209675_1018963 | Ga0209675_10189633 | 277 |
| 921 | 3300025292 | Ga0209676_1000040 | Ga0209676_1000040247 | 277 |
| 922 | 3300025292 | Ga0209676_1003179 | Ga0209676_10031799 | 277 |
| 923 | 3300025292 | Ga0209676_1017739 | Ga0209676_10177393 | 277 |
| 924 | 3300025294 | Ga0209025_1000409 | Ga0209025_10004097 | 277 |
| 925 | 3300025294 | Ga0209025_1009368 | Ga0209025_10093686 | 277 |
| 926 | 3300025295 | Ga0209564_1000157 | Ga0209564_10001575 | 277 |
| 927 | 3300025295 | Ga0209564_1000806 | Ga0209564_10008066 | 277 |
| 928 | 3300025297 | Ga0209758_1000042 | Ga0209758_1000042144 | 277 |
| 929 | 3300025297 | Ga0209758_1005953 | Ga0209758_10059535 | 277 |
| 930 | 3300025298 | Ga0209050_1000021 | Ga0209050_1000021146 | 277 |
| 931 | 3300025298 | Ga0209050_1003967 | Ga0209050_10039679 | 277 |
| 932 | 3300025298 | Ga0209050_1015628 | Ga0209050_10156284 | 277 |
| 933 | 3300025299 | Ga0209256_1000056 | Ga0209256_1000056127 | 277 |
| 934 | 3300025299 | Ga0209256_1000124 | Ga0209256_100012460 | 277 |
| 935 | 3300025302 | Ga0207426_1000055 | Ga0207426_1000055187 | 277 |
| 936 | 3300025302 | Ga0207426_1000079 | Ga0207426_1000079144 | 277 |
| 937 | 3300025303 | Ga0209051_1000423 | Ga0209051_10004233 | 277 |
| 938 | 3300025303 | Ga0209051_1000446 | Ga0209051_10004462 | 277 |
| 939 | 3300025303 | Ga0209051_1013428 | Ga0209051_10134285 | 277 |
| 940 | 3300025304 | Ga0209257_1000043 | Ga0209257_1000043141 | 277 |
| 941 | 3300025304 | Ga0209257_1001377 | Ga0209257_10013779 | 277 |
| 942 | 3300025304 | Ga0209257_1024395 | Ga0209257_10243952 | 277 |
| 943 | 3300025728 | Ga0207655_1005080 | Ga0207655_10050803 | 277 |
| 944 | 3300025903 | Ga0207680_10056911 | Ga0207680_100569113 | 277 |
| 945 | 3300025913 | Ga0207695_10628475 | Ga0207695_106284752 | 277 |
| 946 | 3300025924 | Ga0207694_10281387 | Ga0207694_102813872 | 277 |
| 947 | 3300025932 | Ga0207690_10313305 | Ga0207690_103133052 | 277 |
| 948 | 3300025933 | Ga0207706_10115153 | Ga0207706_101151533 | 277 |
| 949 | 3300025935 | Ga0207709_10040350 | Ga0207709_100403503 | 277 |
| 950 | 3300025940 | Ga0207691_10419650 | Ga0207691_104196502 | 277 |
| 951 | 3300025949 | Ga0207667_10433859 | Ga0207667_104338593 | 277 |
| 952 | 3300026116 | Ga0207674_10217177 | Ga0207674_102171772 | 277 |
| 953 | 3300027666 | Ga0209282_1000139 | Ga0209282_100013919 | 277 |
| 954 | 3300028379 | Ga0268266_10040123 | Ga0268266_100401235 | 277 |
| 955 | 3300028380 | Ga0268265_10011207 | Ga0268265_100112076 | 277 |
| 956 | 3300028794 | Ga0307515_10000322 | Ga0307515_1000032274 | 277 |
| 957 | 3300030522 | Ga0307512_10066347 | Ga0307512_100663473 | 277 |
| 958 | 3300030732 | Ga0316176_1141751 | Ga0316176_11417513 | 277 |
| 959 | 3300030733 | Ga0314311_1073339 | Ga0314311_10733392 | 277 |
| 960 | 3300030734 | Ga0316179_1111618 | Ga0316179_11116182 | 277 |
| 961 | 3300030742 | Ga0316183_1025835 | Ga0316183_10258353 | 277 |
| 962 | 3300031251 | Ga0265327_10003094 | Ga0265327_1000309414 | 277 |
| 963 | 3300031251 | Ga0265327_10005552 | Ga0265327_100055523 | 277 |
| 964 | 3300031456 | Ga0307513_10270462 | Ga0307513_102704622 | 277 |
| 965 | 3300031548 | Ga0307408_100054021 | Ga0307408_1000540213 | 277 |
| 966 | 3300031548 | Ga0307408_100086583 | Ga0307408_1000865832 | 277 |
| 967 | 3300031548 | Ga0307408_100111446 | Ga0307408_1001114462 | 277 |
| 968 | 3300031548 | Ga0307408_100152716 | Ga0307408_1001527161 | 277 |
| 969 | 3300031649 | Ga0307514_10004889 | Ga0307514_100048897 | 277 |
| 970 | 3300031901 | Ga0307406_10012119 | Ga0307406_100121193 | 277 |
| 971 | 3300031911 | Ga0307412_10008739 | Ga0307412_100087396 | 277 |
| 972 | 3300031911 | Ga0307412_10193682 | Ga0307412_101936822 | 277 |
| 973 | 3300031911 | Ga0307412_10517187 | Ga0307412_105171871 | 277 |
| 974 | 3300032004 | Ga0307414_10293586 | Ga0307414_102935862 | 277 |
| 975 | 3300032126 | Ga0307415_100694203 | Ga0307415_1006942031 | 277 |
| 976 | 3300037068 | Ga0373925_0461305 | Ga0373925_0461305_121_954 | 277 |
| 977 | 3300041406 | Ga0439439_0003401 | Ga0439439_0003401_864_1697 | 277 |
| 978 | 3300041411 | Ga0439466_0002610 | Ga0439466_0002610_3928_4761 | 277 |
| 979 | 3300042004 | Ga0439445_0001509 | Ga0439445_0001509_1796_2629 | 277 |
| 980 | 3300042006 | Ga0439432_002290 | Ga0439432_002290_3139_3972 | 277 |
| 981 | 3300042007 | Ga0439449_0000753 | Ga0439449_0000753_2594_3427 | 277 |
| 982 | 3300042007 | Ga0439449_0004213 | Ga0439449_0004213_4572_5405 | 277 |
| 983 | 3300042010 | Ga0439452_002755 | Ga0439452_002755_4074_4907 | 277 |
| 984 | 3300042125 | Ga0450923_031374 | Ga0450923_031374_145_978 | 277 |
| 985 | 3300042134 | Ga0450898_003737 | Ga0450898_003737_1078_1911 | 277 |
| 986 | 3300042185 | Ga0450909_011691 | Ga0450909_011691_342_1175 | 277 |
| 987 | 3300042435 | Ga0439434_0001757 | Ga0439434_0001757_362_1195 | 277 |
| 988 | 3300042531 | Ga0450918_002439 | Ga0450918_002439_1518_2351 | 277 |
| 989 | 3300046512 | Ga0495610_0019846 | Ga0495610_0019846_1326_2159 | 277 |
| 990 | 3300046515 | Ga0495620_0051816 | Ga0495620_0051816_368_1201 | 277 |
| 991 | 3300046520 | Ga0495637_0005420 | Ga0495637_0005420_3307_4140 | 277 |
| 992 | 3300046674 | Ga0495588_0097715 | Ga0495588_0097715_456_1289 | 277 |
| 993 | 3300047321 | Ga0495676_0089794 | Ga0495676_0089794_1150_1983 | 277 |
| 994 | 3300047673 | Ga0495593_0037115 | Ga0495593_0037115_905_1738 | 277 |
| 995 | 3300048089 | Ga0495614_0107705 | Ga0495614_0107705_95_928 | 277 |
| 996 | 3300048908 | Ga0496105_0012904 | Ga0496105_0012904_2014_2847 | 277 |
| 997 | 3300048921 | Ga0496118_0085109 | Ga0496118_0085109_907_1740 | 277 |
| 998 | 3300048924 | Ga0496121_0143282 | Ga0496121_0143282_196_1029 | 277 |
| 999 | 3300048927 | Ga0496124_0149259 | Ga0496124_0149259_664_1497 | 277 |
| 1000 | 3300048927 | Ga0496124_0223673 | Ga0496124_0223673_278_1111 | 277 |
| 1001 | 3300050496 | nmdc:mga07m45_15544_c1 | nmdc:mga07m45_15544_c1_2240_3073 | 277 |
| 1002 | 3300053079 | Ga0500610_0003992 | Ga0500610_0003992_647_1480 | 277 |
| 1003 | 3300053110 | Ga0500571_006720 | Ga0500571_006720_611_1444 | 277 |
| 1004 | 3300053134 | Ga0500658_0002081 | Ga0500658_0002081_1317_2150 | 277 |
| 1005 | 3300053139 | Ga0500568_0061648 | Ga0500568_0061648_423_1256 | 277 |
| 1006 | 3300053141 | Ga0500574_011876 | Ga0500574_011876_118_951 | 277 |
| 1007 | 3300053177 | Ga0500636_0083949 | Ga0500636_0083949_152_985 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9147 | 29 | 245 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9133 | 30 | 241 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9128 | 29 | 241 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9127 | 30 | 243 |
| 5jsz-assembly1.cif.gz_A | folate ecf transporter: apo state | 0.9124 | 28 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9327 | 30 | 268 | 3.40.50.300 |
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.923 | 29 | 243 | 3.40.50.300 |
| af_Q2FW34_4_263_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.92 | 28 | 243 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9191 | 29 | 243 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9188 | 28 | 241 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8E236-F1-model_v4 | ABC transporter family protein | 0.9335 | 102 | 243 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
| AF-K1SC20-F1-model_v4 | ABC superfamily ATP binding cassette transporter, ABC protein | 0.9327 | 29 | 217 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A382Y1F8-F1-model_v4 | ABC transporter domain-containing protein | 0.9285 | 29 | 221 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A524B8W3-F1-model_v4 | ABC transporter | 0.927 | 30 | 230 |
GO:0005524
GO:0016887 |
| AF-K0DB19-F1-model_v4 | ABC transporter ATP binding protein | 0.9255 | 29 | 243 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar