F487982
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1005 | 457 | 981 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10165338|Ga0075365_101653382 |
| Length | 288 |
| Sequence | MLAIAGPITSVRYDSPDKGGTHNQTAISVLAQRQTSLNEGTRLMFDLTGKTALVTGATGGIGNAIARALHHQGATVAISGTRREVLDQFAGELNERVHVLPCNLAEKDEVEALVPKSEEAMGQLDILVANAGITKDNLLVQLRDEDWDQVVAVNLTATFRLARAALRGMMRRRFGRIIGIASVVGVTGNPGQGNYTATKAGMIGMIKSIAGEYAKRGVTANSIAPGFIATAMTDKLNDKQRDAILARVPAGRLGAGADVAAATVFLASDEAGYVTGQTLHVNGGMAMI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 3 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 4 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 5 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 6 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 7 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 8 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 9 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 10 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 11 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 12 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 13 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 14 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 15 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 16 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 17 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 18 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 19 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 20 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 21 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 22 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 146 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 274 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 275 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 278 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 418 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 420 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 421 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 426 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 427 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 429 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 430 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 431 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 435 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 438 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 441 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 442 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 444 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 446 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 448 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 450 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 451 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 452 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 456 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 457 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.15 |
| Nodule | 0.1 |
| Rhizoplane | 3.68 |
| Rhizosphere | 80.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000054 | 3300003215 | Bacteria | 136806 |
| 2 | JGI25153J46596_10005338 | 3300003215 | Bacteria | 6754 |
| 3 | rootH1_10164059 | 3300003316 | Bacteria | 1658 |
| 4 | rootH2_10052210 | 3300003320 | Bacteria | 35441 |
| 5 | rootL2_10218209 | 3300003322 | Unclassified | 2979 |
| 6 | rootH1_10219969 | 3300003323 | Bacteria | 1300 |
| 7 | Ga0055530_10000135 | 3300003791 | Bacteria | 65036 |
| 8 | Ga0055531_10040955 | 3300003794 | Bacteria | 1349 |
| 9 | Ga0055531_10042648 | 3300003794 | Bacteria | 1294 |
| 10 | JGI25405J52794_10026189 | 3300003911 | Bacteria | 1197 |
| 11 | Ga0065165_1000563 | 3300005262 | Bacteria | 55229 |
| 12 | Ga0065704_10171961 | 3300005289 | Bacteria | 1286 |
| 13 | Ga0065704_10204155 | 3300005289 | Bacteria | 1134 |
| 14 | Ga0065715_10166128 | 3300005293 | Unclassified | 1584 |
| 15 | Ga0070658_10000059 | 3300005327 | Bacteria | 112781 |
| 16 | Ga0070658_10008345 | 3300005327 | Bacteria | 8332 |
| 17 | Ga0070658_10026519 | 3300005327 | Bacteria | 4649 |
| 18 | Ga0070658_10185814 | 3300005327 | Unclassified | 1750 |
| 19 | Ga0070676_10007291 | 3300005328 | Bacteria | 5931 |
| 20 | Ga0070676_10016919 | 3300005328 | Bacteria | 4031 |
| 21 | Ga0070683_100023828 | 3300005329 | Bacteria | 5478 |
| 22 | Ga0070690_100150919 | 3300005330 | Bacteria | 1585 |
| 23 | Ga0070670_100004475 | 3300005331 | Bacteria | 11708 |
| 24 | Ga0070670_100151241 | 3300005331 | Bacteria | 2009 |
| 25 | Ga0070677_10017189 | 3300005333 | Bacteria | 2586 |
| 26 | Ga0068869_100009547 | 3300005334 | Bacteria | 6299 |
| 27 | Ga0070666_10070550 | 3300005335 | Bacteria | 2377 |
| 28 | Ga0070680_100012557 | 3300005336 | Bacteria | 6584 |
| 29 | Ga0070680_100015196 | 3300005336 | Bacteria | 6030 |
| 30 | Ga0070680_100054683 | 3300005336 | Bacteria | 3260 |
| 31 | Ga0070680_100069381 | 3300005336 | Bacteria | 2894 |
| 32 | Ga0070680_100085886 | 3300005336 | Bacteria | 2600 |
| 33 | Ga0070682_100392218 | 3300005337 | Bacteria | 1047 |
| 34 | Ga0068868_100803488 | 3300005338 | Bacteria | 849 |
| 35 | Ga0070660_100048416 | 3300005339 | Bacteria | 3265 |
| 36 | Ga0070689_100021631 | 3300005340 | Bacteria | 4791 |
| 37 | Ga0070689_100187038 | 3300005340 | Bacteria | 1685 |
| 38 | Ga0070689_100310547 | 3300005340 | Bacteria | 1314 |
| 39 | Ga0070691_10052485 | 3300005341 | Bacteria | 1949 |
| 40 | Ga0070691_10333279 | 3300005341 | Bacteria | 838 |
| 41 | Ga0070661_100006288 | 3300005344 | Bacteria | 8194 |
| 42 | Ga0070661_100075453 | 3300005344 | Bacteria | 2484 |
| 43 | Ga0070668_100005964 | 3300005347 | Bacteria | 9036 |
| 44 | Ga0070668_100064590 | 3300005347 | Bacteria | 2838 |
| 45 | Ga0070668_100117910 | 3300005347 | Bacteria | 2119 |
| 46 | Ga0070668_100219341 | 3300005347 | Bacteria | 1568 |
| 47 | Ga0070668_100339965 | 3300005347 | Bacteria | 1268 |
| 48 | Ga0070669_100010472 | 3300005353 | Bacteria | 6586 |
| 49 | Ga0070669_100339713 | 3300005353 | Bacteria | 1216 |
| 50 | Ga0070675_100203670 | 3300005354 | Bacteria | 1718 |
| 51 | Ga0070671_100103151 | 3300005355 | Bacteria | 2393 |
| 52 | Ga0070673_100344741 | 3300005364 | Bacteria | 1321 |
| 53 | Ga0070688_100004472 | 3300005365 | Bacteria | 7280 |
| 54 | Ga0070688_100048736 | 3300005365 | Unclassified | 2633 |
| 55 | Ga0070688_100237137 | 3300005365 | Bacteria | 1293 |
| 56 | Ga0070659_100053819 | 3300005366 | Bacteria | 3169 |
| 57 | Ga0070659_100143047 | 3300005366 | Bacteria | 1947 |
| 58 | Ga0070667_100226114 | 3300005367 | Bacteria | 1667 |
| 59 | Ga0070709_10013740 | 3300005434 | Bacteria | 4559 |
| 60 | Ga0070709_10068208 | 3300005434 | Bacteria | 2286 |
| 61 | Ga0070714_100000490 | 3300005435 | Bacteria | 28629 |
| 62 | Ga0070713_100000278 | 3300005436 | Bacteria | 33610 |
| 63 | Ga0070713_100092449 | 3300005436 | Bacteria | 2605 |
| 64 | Ga0070713_100461690 | 3300005436 | Bacteria | 1194 |
| 65 | Ga0070710_10003676 | 3300005437 | Bacteria | 7254 |
| 66 | Ga0070710_10004304 | 3300005437 | Bacteria | 6748 |
| 67 | Ga0070701_10177097 | 3300005438 | Bacteria | 1246 |
| 68 | Ga0070711_100003976 | 3300005439 | Bacteria | 8689 |
| 69 | Ga0070711_100053143 | 3300005439 | Bacteria | 2790 |
| 70 | Ga0070700_100451148 | 3300005441 | Bacteria | 979 |
| 71 | Ga0070678_100017547 | 3300005456 | Bacteria | 4614 |
| 72 | Ga0070678_100021018 | 3300005456 | Bacteria | 4295 |
| 73 | Ga0070678_100216832 | 3300005456 | Bacteria | 1589 |
| 74 | Ga0070681_10006100 | 3300005458 | Bacteria | 11695 |
| 75 | Ga0070681_10008082 | 3300005458 | Bacteria | 10294 |
| 76 | Ga0070681_10044484 | 3300005458 | Bacteria | 4445 |
| 77 | Ga0068867_100087828 | 3300005459 | Unclassified | 2355 |
| 78 | Ga0070685_10004976 | 3300005466 | Bacteria | 6730 |
| 79 | Ga0070685_10047083 | 3300005466 | Bacteria | 2478 |
| 80 | Ga0070685_10129927 | 3300005466 | Bacteria | 1574 |
| 81 | Ga0070699_100187786 | 3300005518 | Bacteria | 1835 |
| 82 | Ga0070679_100032781 | 3300005530 | Bacteria | 5141 |
| 83 | Ga0070684_100117049 | 3300005535 | Bacteria | 2394 |
| 84 | Ga0070684_100266404 | 3300005535 | Bacteria | 1568 |
| 85 | Ga0070697_100283296 | 3300005536 | Bacteria | 1422 |
| 86 | Ga0068853_100005273 | 3300005539 | Bacteria | 10121 |
| 87 | Ga0068853_100078999 | 3300005539 | Bacteria | 2876 |
| 88 | Ga0068853_100341419 | 3300005539 | Bacteria | 1391 |
| 89 | Ga0070672_100016229 | 3300005543 | Bacteria | 5327 |
| 90 | Ga0070672_100153850 | 3300005543 | Bacteria | 1904 |
| 91 | Ga0070672_100195947 | 3300005543 | Bacteria | 1688 |
| 92 | Ga0070696_100069257 | 3300005546 | Bacteria | 2478 |
| 93 | Ga0070696_100469248 | 3300005546 | Bacteria | 996 |
| 94 | Ga0070693_100003633 | 3300005547 | Bacteria | 7208 |
| 95 | Ga0070665_100047432 | 3300005548 | Bacteria | 4312 |
| 96 | Ga0070665_100318342 | 3300005548 | Bacteria | 1560 |
| 97 | Ga0070665_100378526 | 3300005548 | Bacteria | 1423 |
| 98 | Ga0070704_100346552 | 3300005549 | Bacteria | 1252 |
| 99 | Ga0070704_100370403 | 3300005549 | Bacteria | 1214 |
| 100 | Ga0070704_100446949 | 3300005549 | Bacteria | 1112 |
| 101 | Ga0068855_100000009 | 3300005563 | Bacteria | 246035 |
| 102 | Ga0068855_100000093 | 3300005563 | Bacteria | 106968 |
| 103 | Ga0068855_100002770 | 3300005563 | Bacteria | 21581 |
| 104 | Ga0068855_100079212 | 3300005563 | Bacteria | 3811 |
| 105 | Ga0068855_100101153 | 3300005563 | Bacteria | 3318 |
| 106 | Ga0068855_100214717 | 3300005563 | Bacteria | 2160 |
| 107 | Ga0068855_100276319 | 3300005563 | Bacteria | 1867 |
| 108 | Ga0070664_100671954 | 3300005564 | Bacteria | 963 |
| 109 | Ga0068857_100106220 | 3300005577 | Bacteria | 2521 |
| 110 | Ga0068857_100585764 | 3300005577 | Bacteria | 1053 |
| 111 | Ga0068857_100595835 | 3300005577 | Bacteria | 1044 |
| 112 | Ga0068857_100942842 | 3300005577 | Bacteria | 829 |
| 113 | Ga0068854_100133504 | 3300005578 | Bacteria | 1898 |
| 114 | Ga0068854_100290918 | 3300005578 | Bacteria | 1318 |
| 115 | Ga0068854_100703289 | 3300005578 | Bacteria | 872 |
| 116 | Ga0068856_100014274 | 3300005614 | Bacteria | 7681 |
| 117 | Ga0068856_100049571 | 3300005614 | Bacteria | 4138 |
| 118 | Ga0068856_100081363 | 3300005614 | Bacteria | 3213 |
| 119 | Ga0068856_100246423 | 3300005614 | Bacteria | 1802 |
| 120 | Ga0070702_100429686 | 3300005615 | Bacteria | 953 |
| 121 | Ga0068852_100273793 | 3300005616 | Bacteria | 1625 |
| 122 | Ga0068859_100021820 | 3300005617 | Bacteria | 6421 |
| 123 | Ga0068859_100142510 | 3300005617 | Bacteria | 2470 |
| 124 | Ga0068859_100206335 | 3300005617 | Unclassified | 2050 |
| 125 | Ga0068864_100000154 | 3300005618 | Bacteria | 63744 |
| 126 | Ga0068864_100041370 | 3300005618 | Bacteria | 3942 |
| 127 | Ga0068861_100084612 | 3300005719 | Unclassified | 2490 |
| 128 | Ga0068870_10102381 | 3300005840 | Bacteria | 1621 |
| 129 | Ga0068863_100000172 | 3300005841 | Bacteria | 68888 |
| 130 | Ga0068863_100254720 | 3300005841 | Bacteria | 1696 |
| 131 | Ga0068858_100000639 | 3300005842 | Bacteria | 36426 |
| 132 | Ga0068858_100166226 | 3300005842 | Bacteria | 2079 |
| 133 | Ga0068858_100595772 | 3300005842 | Bacteria | 1072 |
| 134 | Ga0068860_100000151 | 3300005843 | Bacteria | 112208 |
| 135 | Ga0068860_100008879 | 3300005843 | Bacteria | 10013 |
| 136 | Ga0068860_100011656 | 3300005843 | Bacteria | 8668 |
| 137 | Ga0068860_100754858 | 3300005843 | Bacteria | 985 |
| 138 | Ga0068860_100902311 | 3300005843 | Bacteria | 900 |
| 139 | Ga0068862_100007610 | 3300005844 | Bacteria | 8974 |
| 140 | Ga0068862_100014501 | 3300005844 | Bacteria | 6541 |
| 141 | Ga0068862_100057627 | 3300005844 | Bacteria | 3332 |
| 142 | Ga0068862_100263434 | 3300005844 | Bacteria | 1574 |
| 143 | Ga0081455_10000347 | 3300005937 | Bacteria | 60756 |
| 144 | Ga0081455_10000477 | 3300005937 | Bacteria | 51914 |
| 145 | Ga0081455_10002412 | 3300005937 | Bacteria | 22295 |
| 146 | Ga0081455_10012372 | 3300005937 | Bacteria | 8515 |
| 147 | Ga0081455_10029489 | 3300005937 | Bacteria | 5002 |
| 148 | Ga0081455_10046937 | 3300005937 | Bacteria | 3744 |
| 149 | Ga0081455_10078322 | 3300005937 | Bacteria | 2716 |
| 150 | Ga0081538_10001364 | 3300005981 | Bacteria | 25135 |
| 151 | Ga0081540_1000015 | 3300005983 | Bacteria | 178704 |
| 152 | Ga0081540_1004841 | 3300005983 | Bacteria | 10144 |
| 153 | Ga0081540_1030763 | 3300005983 | Bacteria | 2967 |
| 154 | Ga0081539_10005853 | 3300005985 | Bacteria | 12191 |
| 155 | Ga0070717_10000297 | 3300006028 | Bacteria | 33338 |
| 156 | Ga0070717_10124057 | 3300006028 | Bacteria | 2215 |
| 157 | Ga0070717_10141223 | 3300006028 | Bacteria | 2077 |
| 158 | Ga0070717_10420344 | 3300006028 | Bacteria | 1202 |
| 159 | Ga0070717_10735450 | 3300006028 | Bacteria | 897 |
| 160 | Ga0075365_10030532 | 3300006038 | Bacteria | 3452 |
| 161 | Ga0075365_10165338 | 3300006038 | Bacteria | 1543 |
| 162 | Ga0075363_100077948 | 3300006048 | Bacteria | 1809 |
| 163 | Ga0075364_10157580 | 3300006051 | Bacteria | 1531 |
| 164 | Ga0075364_10179402 | 3300006051 | Bacteria | 1432 |
| 165 | Ga0070715_10005158 | 3300006163 | Bacteria | 4339 |
| 166 | Ga0070712_100000896 | 3300006175 | Bacteria | 17862 |
| 167 | Ga0070712_100015199 | 3300006175 | Bacteria | 4951 |
| 168 | Ga0070712_100036096 | 3300006175 | Bacteria | 3360 |
| 169 | Ga0075367_10026095 | 3300006178 | Bacteria | 3309 |
| 170 | Ga0075367_10308272 | 3300006178 | Bacteria | 997 |
| 171 | Ga0075366_10027423 | 3300006195 | Bacteria | 3341 |
| 172 | Ga0075366_10220123 | 3300006195 | Bacteria | 1156 |
| 173 | Ga0097621_100397803 | 3300006237 | Bacteria | 1233 |
| 174 | Ga0075370_10061817 | 3300006353 | Bacteria | 2134 |
| 175 | Ga0075370_10062100 | 3300006353 | Bacteria | 2129 |
| 176 | Ga0068871_100265200 | 3300006358 | Unclassified | 1499 |
| 177 | Ga0075428_100000430 | 3300006844 | Bacteria | 41652 |
| 178 | Ga0075428_100181493 | 3300006844 | Bacteria | 2278 |
| 179 | Ga0075428_100214466 | 3300006844 | Bacteria | 2079 |
| 180 | Ga0075428_100382111 | 3300006844 | Bacteria | 1510 |
| 181 | Ga0075430_100128522 | 3300006846 | Bacteria | 2112 |
| 182 | Ga0075431_100000086 | 3300006847 | Bacteria | 56252 |
| 183 | Ga0075431_100019049 | 3300006847 | Bacteria | 6993 |
| 184 | Ga0075431_100123707 | 3300006847 | Bacteria | 2669 |
| 185 | Ga0075431_100360403 | 3300006847 | Bacteria | 1460 |
| 186 | Ga0075433_10029411 | 3300006852 | Bacteria | 4681 |
| 187 | Ga0075433_10071279 | 3300006852 | Bacteria | 3055 |
| 188 | Ga0075433_10162923 | 3300006852 | Bacteria | 1985 |
| 189 | Ga0075434_100018441 | 3300006871 | Bacteria | 6743 |
| 190 | Ga0075434_100288912 | 3300006871 | Bacteria | 1659 |
| 191 | Ga0075434_100788154 | 3300006871 | Bacteria | 967 |
| 192 | Ga0075429_100082076 | 3300006880 | Bacteria | 2810 |
| 193 | Ga0075429_100326146 | 3300006880 | Bacteria | 1344 |
| 194 | Ga0068865_100211830 | 3300006881 | Bacteria | 1510 |
| 195 | Ga0097620_100021824 | 3300006931 | Bacteria | 6421 |
| 196 | Ga0097620_100142526 | 3300006931 | Bacteria | 2470 |
| 197 | Ga0097620_100206334 | 3300006931 | Unclassified | 2050 |
| 198 | Ga0075435_100032914 | 3300007076 | Bacteria | 4097 |
| 199 | Ga0075435_100213931 | 3300007076 | Bacteria | 1636 |
| 200 | Ga0075435_100634722 | 3300007076 | Bacteria | 927 |
| 201 | Ga0099794_10000814 | 3300007265 | Bacteria | 10538 |
| 202 | Ga0105240_10000094 | 3300009093 | Bacteria | 181637 |
| 203 | Ga0105240_10001341 | 3300009093 | Bacteria | 42205 |
| 204 | Ga0105240_10012709 | 3300009093 | Bacteria | 11605 |
| 205 | Ga0105240_10091571 | 3300009093 | Bacteria | 3714 |
| 206 | Ga0105240_10131409 | 3300009093 | Bacteria | 3002 |
| 207 | Ga0105240_10299790 | 3300009093 | Bacteria | 1839 |
| 208 | Ga0111539_10001374 | 3300009094 | Bacteria | 32371 |
| 209 | Ga0111539_10019117 | 3300009094 | Bacteria | 8466 |
| 210 | Ga0111539_10029219 | 3300009094 | Bacteria | 6718 |
| 211 | Ga0111539_10054138 | 3300009094 | Bacteria | 4775 |
| 212 | Ga0111539_10297775 | 3300009094 | Bacteria | 1877 |
| 213 | Ga0111539_10779185 | 3300009094 | Bacteria | 1113 |
| 214 | Ga0105245_10101542 | 3300009098 | Bacteria | 2663 |
| 215 | Ga0114129_10000243 | 3300009147 | Bacteria | 61230 |
| 216 | Ga0114129_10007283 | 3300009147 | Bacteria | 15749 |
| 217 | Ga0114129_10013235 | 3300009147 | Bacteria | 11749 |
| 218 | Ga0114129_10035725 | 3300009147 | Bacteria | 7020 |
| 219 | Ga0114129_10184579 | 3300009147 | Bacteria | 2836 |
| 220 | Ga0114129_10205921 | 3300009147 | Bacteria | 2662 |
| 221 | Ga0105248_10024422 | 3300009177 | Bacteria | 6721 |
| 222 | Ga0105248_10060900 | 3300009177 | Bacteria | 4237 |
| 223 | Ga0105248_10065402 | 3300009177 | Bacteria | 4083 |
| 224 | Ga0105237_10784813 | 3300009545 | Bacteria | 959 |
| 225 | Ga0105237_10972741 | 3300009545 | Bacteria | 856 |
| 226 | Ga0105238_10039621 | 3300009551 | Bacteria | 4778 |
| 227 | Ga0105238_10118377 | 3300009551 | Bacteria | 2629 |
| 228 | Ga0105238_10295610 | 3300009551 | Bacteria | 1603 |
| 229 | Ga0105238_10822266 | 3300009551 | Bacteria | 945 |
| 230 | Ga0105238_11027720 | 3300009551 | Bacteria | 845 |
| 231 | Ga0105249_10109094 | 3300009553 | Bacteria | 2613 |
| 232 | Ga0105249_10352395 | 3300009553 | Bacteria | 1491 |
| 233 | Ga0105249_10383816 | 3300009553 | Bacteria | 1431 |
| 234 | Ga0105249_10820214 | 3300009553 | Bacteria | 995 |
| 235 | Ga0105239_10243793 | 3300010375 | Bacteria | 2017 |
| 236 | Ga0105239_11154845 | 3300010375 | Bacteria | 892 |
| 237 | Ga0105246_10296963 | 3300011119 | Bacteria | 1302 |
| 238 | Ga0157371_10020758 | 3300013102 | Bacteria | 4832 |
| 239 | Ga0157371_10223626 | 3300013102 | Bacteria | 1352 |
| 240 | Ga0157370_10002875 | 3300013104 | Bacteria | 20517 |
| 241 | Ga0157370_10011925 | 3300013104 | Bacteria | 9062 |
| 242 | Ga0157370_10193886 | 3300013104 | Bacteria | 1886 |
| 243 | Ga0157369_10196501 | 3300013105 | Bacteria | 2118 |
| 244 | Ga0157369_10651347 | 3300013105 | Bacteria | 1086 |
| 245 | Ga0157374_10006020 | 3300013296 | Bacteria | 10263 |
| 246 | Ga0157374_11057301 | 3300013296 | Bacteria | 832 |
| 247 | Ga0157378_10113810 | 3300013297 | Bacteria | 2485 |
| 248 | Ga0157378_10216303 | 3300013297 | Bacteria | 1820 |
| 249 | Ga0157378_10242253 | 3300013297 | Bacteria | 1723 |
| 250 | Ga0163162_10037368 | 3300013306 | Unclassified | 4846 |
| 251 | Ga0163162_10385835 | 3300013306 | Unclassified | 1534 |
| 252 | Ga0157372_10025787 | 3300013307 | Bacteria | 6393 |
| 253 | Ga0157375_10053720 | 3300013308 | Bacteria | 3965 |
| 254 | Ga0157375_11682575 | 3300013308 | Unclassified | 751 |
| 255 | Ga0163163_10019627 | 3300014325 | Bacteria | 6349 |
| 256 | Ga0163163_10059375 | 3300014325 | Bacteria | 3783 |
| 257 | Ga0163163_10918670 | 3300014325 | Bacteria | 939 |
| 258 | Ga0157380_10034981 | 3300014326 | Bacteria | 3877 |
| 259 | Ga0157380_10096177 | 3300014326 | Bacteria | 2455 |
| 260 | Ga0157380_10154705 | 3300014326 | Bacteria | 1986 |
| 261 | Ga0157377_10024421 | 3300014745 | Unclassified | 3213 |
| 262 | Ga0157377_10068405 | 3300014745 | Bacteria | 2046 |
| 263 | Ga0157379_10427938 | 3300014968 | Bacteria | 1220 |
| 264 | Ga0157376_10257362 | 3300014969 | Bacteria | 1633 |
| 265 | Ga0157376_10359570 | 3300014969 | Bacteria | 1396 |
| 266 | Ga0157376_10546622 | 3300014969 | Bacteria | 1145 |
| 267 | Ga0163161_10091543 | 3300017792 | Bacteria | 2251 |
| 268 | Ga0163161_10207866 | 3300017792 | Unclassified | 1511 |
| 269 | Ga0213872_10003321 | 3300021361 | Bacteria | 8966 |
| 270 | Ga0213872_10147704 | 3300021361 | Bacteria | 1028 |
| 271 | Ga0213876_10000134 | 3300021384 | Bacteria | 80875 |
| 272 | Ga0213876_10004326 | 3300021384 | Bacteria | 7958 |
| 273 | Ga0213876_10112654 | 3300021384 | Bacteria | 1444 |
| 274 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 275 | Ga0213875_10002695 | 3300021388 | Bacteria | 10484 |
| 276 | Ga0213875_10008291 | 3300021388 | Bacteria | 5327 |
| 277 | Ga0213875_10086068 | 3300021388 | Bacteria | 1466 |
| 278 | Ga0213875_10093515 | 3300021388 | Bacteria | 1402 |
| 279 | Ga0213871_10001032 | 3300021441 | Bacteria | 4386 |
| 280 | Ga0213871_10061498 | 3300021441 | Bacteria | 1047 |
| 281 | Ga0209026_1001732 | 3300025250 | Bacteria | 9090 |
| 282 | Ga0209026_1010008 | 3300025250 | Bacteria | 1803 |
| 283 | Ga0209148_1009797 | 3300025254 | Bacteria | 1846 |
| 284 | Ga0209758_1000119 | 3300025297 | Bacteria | 195545 |
| 285 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 286 | Ga0209758_1000682 | 3300025297 | Bacteria | 50599 |
| 287 | Ga0209050_1000141 | 3300025298 | Bacteria | 173116 |
| 288 | Ga0209050_1003817 | 3300025298 | Bacteria | 10753 |
| 289 | Ga0207426_1026381 | 3300025302 | Bacteria | 1946 |
| 290 | Ga0207426_1050950 | 3300025302 | Bacteria | 1232 |
| 291 | Ga0207426_1053149 | 3300025302 | Bacteria | 1197 |
| 292 | Ga0209257_1000190 | 3300025304 | Bacteria | 153686 |
| 293 | Ga0209257_1000288 | 3300025304 | Bacteria | 111141 |
| 294 | Ga0209257_1000562 | 3300025304 | Bacteria | 63202 |
| 295 | Ga0207653_10010527 | 3300025885 | Bacteria | 2884 |
| 296 | Ga0207682_10009231 | 3300025893 | Bacteria | 3897 |
| 297 | Ga0207692_10001592 | 3300025898 | Bacteria | 8547 |
| 298 | Ga0207642_10092372 | 3300025899 | Bacteria | 1498 |
| 299 | Ga0207680_10095618 | 3300025903 | Bacteria | 1899 |
| 300 | Ga0207680_10416950 | 3300025903 | Bacteria | 950 |
| 301 | Ga0207685_10002629 | 3300025905 | Bacteria | 4168 |
| 302 | Ga0207699_10009773 | 3300025906 | Bacteria | 4791 |
| 303 | Ga0207699_10035071 | 3300025906 | Bacteria | 2852 |
| 304 | Ga0207645_10009341 | 3300025907 | Bacteria | 6789 |
| 305 | Ga0207645_10281570 | 3300025907 | Bacteria | 1104 |
| 306 | Ga0207643_10015054 | 3300025908 | Bacteria | 4206 |
| 307 | Ga0207643_10152198 | 3300025908 | Bacteria | 1387 |
| 308 | Ga0207705_10000195 | 3300025909 | Bacteria | 61397 |
| 309 | Ga0207705_10144164 | 3300025909 | Bacteria | 1781 |
| 310 | Ga0207705_10197352 | 3300025909 | Bacteria | 1524 |
| 311 | Ga0207684_10022472 | 3300025910 | Bacteria | 5383 |
| 312 | Ga0207707_10006763 | 3300025912 | Bacteria | 10012 |
| 313 | Ga0207707_10049755 | 3300025912 | Bacteria | 3651 |
| 314 | Ga0207707_10081952 | 3300025912 | Bacteria | 2816 |
| 315 | Ga0207707_10093101 | 3300025912 | Bacteria | 2633 |
| 316 | Ga0207707_10760750 | 3300025912 | Bacteria | 809 |
| 317 | Ga0207695_10000419 | 3300025913 | Bacteria | 94504 |
| 318 | Ga0207695_10001861 | 3300025913 | Bacteria | 33054 |
| 319 | Ga0207695_10385409 | 3300025913 | Bacteria | 1287 |
| 320 | Ga0207695_10391725 | 3300025913 | Bacteria | 1274 |
| 321 | Ga0207671_10356418 | 3300025914 | Bacteria | 1160 |
| 322 | Ga0207693_10005248 | 3300025915 | Bacteria | 10840 |
| 323 | Ga0207693_10045878 | 3300025915 | Bacteria | 3433 |
| 324 | Ga0207663_10007163 | 3300025916 | Bacteria | 5767 |
| 325 | Ga0207663_10242979 | 3300025916 | Bacteria | 1321 |
| 326 | Ga0207663_10471939 | 3300025916 | Bacteria | 971 |
| 327 | Ga0207660_10043058 | 3300025917 | Bacteria | 3171 |
| 328 | Ga0207660_10101300 | 3300025917 | Bacteria | 2151 |
| 329 | Ga0207660_10124343 | 3300025917 | Bacteria | 1957 |
| 330 | Ga0207660_10132914 | 3300025917 | Bacteria | 1896 |
| 331 | Ga0207660_10185168 | 3300025917 | Bacteria | 1619 |
| 332 | Ga0207657_10021183 | 3300025919 | Bacteria | 6124 |
| 333 | Ga0207649_10397255 | 3300025920 | Bacteria | 1031 |
| 334 | Ga0207652_10018761 | 3300025921 | Bacteria | 5678 |
| 335 | Ga0207652_10281177 | 3300025921 | Bacteria | 1501 |
| 336 | Ga0207646_10438762 | 3300025922 | Bacteria | 1178 |
| 337 | Ga0207681_10040157 | 3300025923 | Bacteria | 3112 |
| 338 | Ga0207681_10060574 | 3300025923 | Bacteria | 2599 |
| 339 | Ga0207681_10306321 | 3300025923 | Bacteria | 1258 |
| 340 | Ga0207694_10030714 | 3300025924 | Bacteria | 4102 |
| 341 | Ga0207694_10120857 | 3300025924 | Bacteria | 2091 |
| 342 | Ga0207650_10010512 | 3300025925 | Bacteria | 6348 |
| 343 | Ga0207687_10182829 | 3300025927 | Bacteria | 1625 |
| 344 | Ga0207700_10000380 | 3300025928 | Bacteria | 25773 |
| 345 | Ga0207700_10121010 | 3300025928 | Bacteria | 2122 |
| 346 | Ga0207700_10254317 | 3300025928 | Bacteria | 1502 |
| 347 | Ga0207700_10679945 | 3300025928 | Bacteria | 918 |
| 348 | Ga0207664_10005464 | 3300025929 | Bacteria | 8690 |
| 349 | Ga0207664_10008858 | 3300025929 | Bacteria | 7040 |
| 350 | Ga0207664_10810576 | 3300025929 | Bacteria | 842 |
| 351 | Ga0207690_10379830 | 3300025932 | Bacteria | 1122 |
| 352 | Ga0207706_10081394 | 3300025933 | Bacteria | 2845 |
| 353 | Ga0207686_10150068 | 3300025934 | Bacteria | 1622 |
| 354 | Ga0207670_10001178 | 3300025936 | Bacteria | 13805 |
| 355 | Ga0207670_10002994 | 3300025936 | Bacteria | 8920 |
| 356 | Ga0207670_10036512 | 3300025936 | Bacteria | 3196 |
| 357 | Ga0207670_10161876 | 3300025936 | Bacteria | 1671 |
| 358 | Ga0207670_10369997 | 3300025936 | Bacteria | 1139 |
| 359 | Ga0207665_10034393 | 3300025939 | Bacteria | 3362 |
| 360 | Ga0207665_10077328 | 3300025939 | Bacteria | 2284 |
| 361 | Ga0207691_10079984 | 3300025940 | Bacteria | 2941 |
| 362 | Ga0207691_10105100 | 3300025940 | Bacteria | 2515 |
| 363 | Ga0207711_10021082 | 3300025941 | Bacteria | 5442 |
| 364 | Ga0207711_10028623 | 3300025941 | Bacteria | 4691 |
| 365 | Ga0207711_10073803 | 3300025941 | Bacteria | 2966 |
| 366 | Ga0207689_10006787 | 3300025942 | Bacteria | 10075 |
| 367 | Ga0207689_10309093 | 3300025942 | Bacteria | 1311 |
| 368 | Ga0207679_10476363 | 3300025945 | Bacteria | 1111 |
| 369 | Ga0207667_10000045 | 3300025949 | Bacteria | 246053 |
| 370 | Ga0207667_10000588 | 3300025949 | Bacteria | 47296 |
| 371 | Ga0207667_10005483 | 3300025949 | Bacteria | 15466 |
| 372 | Ga0207667_10146786 | 3300025949 | Bacteria | 2428 |
| 373 | Ga0207667_10177908 | 3300025949 | Bacteria | 2185 |
| 374 | Ga0207667_10300231 | 3300025949 | Bacteria | 1641 |
| 375 | Ga0207667_10304937 | 3300025949 | Bacteria | 1627 |
| 376 | Ga0207667_10691039 | 3300025949 | Bacteria | 1023 |
| 377 | Ga0207651_10004995 | 3300025960 | Bacteria | 6762 |
| 378 | Ga0207651_10105642 | 3300025960 | Bacteria | 2101 |
| 379 | Ga0207651_10113471 | 3300025960 | Bacteria | 2039 |
| 380 | Ga0207712_10004918 | 3300025961 | Bacteria | 8449 |
| 381 | Ga0207712_10172730 | 3300025961 | Bacteria | 1691 |
| 382 | Ga0207712_10248547 | 3300025961 | Bacteria | 1436 |
| 383 | Ga0207712_10332399 | 3300025961 | Bacteria | 1257 |
| 384 | Ga0207668_10029854 | 3300025972 | Bacteria | 3578 |
| 385 | Ga0207668_10459451 | 3300025972 | Bacteria | 1088 |
| 386 | Ga0207668_10516854 | 3300025972 | Bacteria | 1029 |
| 387 | Ga0207640_10110400 | 3300025981 | Bacteria | 1948 |
| 388 | Ga0207658_10124226 | 3300025986 | Bacteria | 2063 |
| 389 | Ga0207658_10178234 | 3300025986 | Bacteria | 1757 |
| 390 | Ga0207677_10436448 | 3300026023 | Bacteria | 1119 |
| 391 | Ga0207677_10497113 | 3300026023 | Bacteria | 1054 |
| 392 | Ga0207703_10000289 | 3300026035 | Bacteria | 55525 |
| 393 | Ga0207703_10444934 | 3300026035 | Bacteria | 1209 |
| 394 | Ga0207703_10495861 | 3300026035 | Bacteria | 1146 |
| 395 | Ga0207639_10236214 | 3300026041 | Bacteria | 1587 |
| 396 | Ga0207678_10464079 | 3300026067 | Bacteria | 1102 |
| 397 | Ga0207678_10790741 | 3300026067 | Bacteria | 837 |
| 398 | Ga0207708_10054966 | 3300026075 | Bacteria | 3036 |
| 399 | Ga0207702_10062359 | 3300026078 | Bacteria | 3183 |
| 400 | Ga0207702_10070400 | 3300026078 | Bacteria | 3008 |
| 401 | Ga0207702_10117617 | 3300026078 | Bacteria | 2374 |
| 402 | Ga0207702_10161501 | 3300026078 | Bacteria | 2046 |
| 403 | Ga0207702_10196561 | 3300026078 | Bacteria | 1867 |
| 404 | Ga0207641_10000160 | 3300026088 | Bacteria | 95407 |
| 405 | Ga0207641_10200544 | 3300026088 | Bacteria | 1839 |
| 406 | Ga0207641_10296121 | 3300026088 | Bacteria | 1527 |
| 407 | Ga0207641_10481912 | 3300026088 | Bacteria | 1202 |
| 408 | Ga0207648_10134622 | 3300026089 | Bacteria | 2176 |
| 409 | Ga0207648_10157664 | 3300026089 | Bacteria | 2004 |
| 410 | Ga0207676_10000375 | 3300026095 | Bacteria | 38069 |
| 411 | Ga0207676_10385140 | 3300026095 | Bacteria | 1306 |
| 412 | Ga0207674_10031884 | 3300026116 | Bacteria | 5532 |
| 413 | Ga0207674_10049513 | 3300026116 | Bacteria | 4297 |
| 414 | Ga0207674_10121839 | 3300026116 | Bacteria | 2575 |
| 415 | Ga0207674_10386736 | 3300026116 | Bacteria | 1352 |
| 416 | Ga0207674_10591405 | 3300026116 | Bacteria | 1072 |
| 417 | Ga0207675_100008841 | 3300026118 | Bacteria | 9452 |
| 418 | Ga0207675_100059146 | 3300026118 | Bacteria | 3576 |
| 419 | Ga0207675_100444674 | 3300026118 | Bacteria | 1284 |
| 420 | Ga0207683_10009099 | 3300026121 | Bacteria | 8465 |
| 421 | Ga0207683_10027341 | 3300026121 | Bacteria | 4929 |
| 422 | Ga0209981_1000501 | 3300027378 | Bacteria | 4989 |
| 423 | Ga0207428_10007141 | 3300027907 | Bacteria | 10218 |
| 424 | Ga0207428_10084960 | 3300027907 | Bacteria | 2465 |
| 425 | Ga0207428_10264931 | 3300027907 | Bacteria | 1279 |
| 426 | Ga0207428_10337781 | 3300027907 | Bacteria | 1110 |
| 427 | Ga0268266_10331239 | 3300028379 | Bacteria | 1427 |
| 428 | Ga0268265_10006267 | 3300028380 | Bacteria | 8057 |
| 429 | Ga0268265_10011714 | 3300028380 | Bacteria | 5930 |
| 430 | Ga0268265_10031043 | 3300028380 | Bacteria | 3855 |
| 431 | Ga0268265_10067990 | 3300028380 | Unclassified | 2760 |
| 432 | Ga0268265_10224239 | 3300028380 | Bacteria | 1647 |
| 433 | Ga0268265_10374729 | 3300028380 | Bacteria | 1307 |
| 434 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 435 | Ga0268264_10195286 | 3300028381 | Bacteria | 1847 |
| 436 | Ga0268264_10754189 | 3300028381 | Bacteria | 970 |
| 437 | Ga0265334_10006434 | 3300028573 | Bacteria | 5058 |
| 438 | Ga0265334_10068347 | 3300028573 | Bacteria | 1327 |
| 439 | Ga0265318_10025807 | 3300028577 | Bacteria | 2317 |
| 440 | Ga0307517_10127623 | 3300028786 | Bacteria | 1848 |
| 441 | Ga0307515_10286314 | 3300028794 | Bacteria | 1349 |
| 442 | Ga0265338_10020456 | 3300028800 | Bacteria | 6960 |
| 443 | Ga0265338_10021228 | 3300028800 | Bacteria | 6782 |
| 444 | Ga0265338_10022862 | 3300028800 | Bacteria | 6451 |
| 445 | Ga0265338_10044555 | 3300028800 | Bacteria | 4095 |
| 446 | Ga0265338_10143331 | 3300028800 | Bacteria | 1868 |
| 447 | Ga0307511_10025571 | 3300030521 | Bacteria | 5436 |
| 448 | Ga0265332_10000535 | 3300031238 | Bacteria | 25809 |
| 449 | Ga0265325_10002369 | 3300031241 | Bacteria | 12747 |
| 450 | Ga0265329_10033233 | 3300031242 | Bacteria | 1668 |
| 451 | Ga0265340_10003508 | 3300031247 | Bacteria | 8827 |
| 452 | Ga0265340_10079674 | 3300031247 | Bacteria | 1543 |
| 453 | Ga0265340_10167149 | 3300031247 | Bacteria | 997 |
| 454 | Ga0265339_10002291 | 3300031249 | Bacteria | 13811 |
| 455 | Ga0265339_10005076 | 3300031249 | Bacteria | 8843 |
| 456 | Ga0265339_10005282 | 3300031249 | Bacteria | 8613 |
| 457 | Ga0265331_10015628 | 3300031250 | Bacteria | 4003 |
| 458 | Ga0265327_10000054 | 3300031251 | Bacteria | 250337 |
| 459 | Ga0265327_10000190 | 3300031251 | Bacteria | 130086 |
| 460 | Ga0265327_10004615 | 3300031251 | Bacteria | 12107 |
| 461 | Ga0265327_10071826 | 3300031251 | Bacteria | 1730 |
| 462 | Ga0265327_10203634 | 3300031251 | Bacteria | 895 |
| 463 | Ga0265316_10013043 | 3300031344 | Bacteria | 7413 |
| 464 | Ga0307513_10014691 | 3300031456 | Bacteria | 9529 |
| 465 | Ga0307513_10155963 | 3300031456 | Bacteria | 2183 |
| 466 | Ga0265313_10000116 | 3300031595 | Bacteria | 80097 |
| 467 | Ga0265313_10000183 | 3300031595 | Bacteria | 66629 |
| 468 | Ga0307508_10060187 | 3300031616 | Bacteria | 3359 |
| 469 | Ga0307508_10100583 | 3300031616 | Bacteria | 2486 |
| 470 | Ga0265314_10004504 | 3300031711 | Bacteria | 12906 |
| 471 | Ga0265314_10007258 | 3300031711 | Bacteria | 9630 |
| 472 | Ga0265314_10024611 | 3300031711 | Bacteria | 4562 |
| 473 | Ga0265314_10036586 | 3300031711 | Bacteria | 3566 |
| 474 | Ga0265314_10090235 | 3300031711 | Bacteria | 1997 |
| 475 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 476 | Ga0316576_10107675 | 3300031727 | Bacteria | 2088 |
| 477 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 478 | Ga0307516_10248986 | 3300031730 | Bacteria | 1472 |
| 479 | Ga0307405_10045036 | 3300031731 | Bacteria | 2701 |
| 480 | Ga0307413_10137086 | 3300031824 | Bacteria | 1684 |
| 481 | Ga0307413_10219368 | 3300031824 | Bacteria | 1388 |
| 482 | Ga0307413_10260538 | 3300031824 | Bacteria | 1292 |
| 483 | Ga0307410_10106049 | 3300031852 | Bacteria | 2024 |
| 484 | Ga0307407_10199576 | 3300031903 | Bacteria | 1340 |
| 485 | Ga0307409_100229211 | 3300031995 | Bacteria | 1683 |
| 486 | Ga0307416_100497318 | 3300032002 | Bacteria | 1283 |
| 487 | Ga0307414_10091171 | 3300032004 | Bacteria | 2264 |
| 488 | Ga0307414_10416830 | 3300032004 | Bacteria | 1170 |
| 489 | Ga0307414_10456584 | 3300032004 | Bacteria | 1122 |
| 490 | Ga0307411_10131431 | 3300032005 | Bacteria | 1830 |
| 491 | Ga0307411_10157678 | 3300032005 | Bacteria | 1695 |
| 492 | Ga0307411_10339649 | 3300032005 | Bacteria | 1220 |
| 493 | Ga0316583_10000712 | 3300032133 | Bacteria | 10310 |
| 494 | Ga0316583_10046548 | 3300032133 | Bacteria | 1531 |
| 495 | Ga0307510_10056928 | 3300033180 | Bacteria | 4065 |
| 496 | Ga0373948_0044476 | 3300034817 | Bacteria | 939 |
| 497 | Ga0373958_0022235 | 3300034819 | Bacteria | 1183 |
| 498 | Ga0373928_0022630 | 3300035084 | Bacteria | 1334 |
| 499 | Ga0373928_0023704 | 3300035084 | Bacteria | 1311 |
| 500 | Ga0373940_0066669 | 3300035088 | Bacteria | 1040 |
| 501 | Ga0373944_0024197 | 3300035089 | Bacteria | 1778 |
| 502 | Ga0373949_0020589 | 3300035090 | Bacteria | 1511 |
| 503 | Ga0373951_0080872 | 3300035091 | Bacteria | 841 |
| 504 | Ga0373923_0145113 | 3300035111 | Bacteria | 1075 |
| 505 | Ga0373932_0010736 | 3300035112 | Bacteria | 2223 |
| 506 | Ga0373941_0103506 | 3300035115 | Bacteria | 994 |
| 507 | Ga0373945_0005510 | 3300035116 | Bacteria | 4053 |
| 508 | Ga0373956_0094151 | 3300035119 | Bacteria | 1384 |
| 509 | Ga0373943_0239082 | 3300035170 | Bacteria | 1017 |
| 510 | Ga0373946_0006872 | 3300035171 | Bacteria | 4143 |
| 511 | Ga0373946_0011339 | 3300035171 | Bacteria | 3323 |
| 512 | Ga0373955_0171615 | 3300035172 | Bacteria | 1284 |
| 513 | Ga0373955_0277100 | 3300035172 | Bacteria | 1009 |
| 514 | Ga0373931_0014133 | 3300035691 | Bacteria | 3898 |
| 515 | Ga0373931_0045000 | 3300035691 | Bacteria | 2329 |
| 516 | Ga0373931_0080049 | 3300035691 | Bacteria | 1801 |
| 517 | Ga0373935_0350407 | 3300035692 | Bacteria | 1052 |
| 518 | Ga0373927_0036738 | 3300035695 | Bacteria | 3184 |
| 519 | Ga0373927_0245304 | 3300035695 | Bacteria | 1177 |
| 520 | Ga0373947_0044945 | 3300035725 | Bacteria | 2642 |
| 521 | Ga0373947_0084690 | 3300035725 | Bacteria | 1968 |
| 522 | Ga0373947_0090790 | 3300035725 | Bacteria | 1905 |
| 523 | Ga0373937_0006315 | 3300036401 | Bacteria | 10219 |
| 524 | Ga0373937_0173087 | 3300036401 | Bacteria | 2026 |
| 525 | Ga0316584_0050930 | 3300036712 | Bacteria | 3096 |
| 526 | Ga0316584_0103663 | 3300036712 | Bacteria | 2129 |
| 527 | Ga0373925_0099950 | 3300037068 | Bacteria | 2228 |
| 528 | Ga0373925_0105806 | 3300037068 | Bacteria | 2168 |
| 529 | Ga0373925_0604110 | 3300037068 | Bacteria | 903 |
| 530 | Ga0395899_0000070 | 3300037312 | Bacteria | 189668 |
| 531 | Ga0395899_0121527 | 3300037312 | Bacteria | 1870 |
| 532 | Ga0395900_0000128 | 3300037418 | Bacteria | 127446 |
| 533 | Ga0395900_0034389 | 3300037418 | Bacteria | 5218 |
| 534 | Ga0395900_0177445 | 3300037418 | Bacteria | 2166 |
| 535 | Ga0395900_0235095 | 3300037418 | Bacteria | 1841 |
| 536 | Ga0395898_0185201 | 3300037466 | Bacteria | 1989 |
| 537 | Ga0395898_0675117 | 3300037466 | Bacteria | 975 |
| 538 | Ga0395905_0038497 | 3300037471 | Bacteria | 4488 |
| 539 | Ga0395905_0417347 | 3300037471 | Bacteria | 1238 |
| 540 | Ga0436364_0013783 | 3300037853 | Bacteria | 29941 |
| 541 | Ga0436364_0186560 | 3300037853 | Bacteria | 2805 |
| 542 | Ga0436364_0382668 | 3300037853 | Bacteria | 4228 |
| 543 | Ga0436364_0955256 | 3300037853 | Bacteria | 35556 |
| 544 | Ga0436364_1026771 | 3300037853 | Bacteria | 10513 |
| 545 | Ga0436364_1438211 | 3300037853 | Bacteria | 1326 |
| 546 | Ga0395901_0000225 | 3300038443 | Bacteria | 70878 |
| 547 | Ga0395901_0001835 | 3300038443 | Bacteria | 21949 |
| 548 | Ga0395901_0017625 | 3300038443 | Bacteria | 7292 |
| 549 | Ga0395901_0133080 | 3300038443 | Bacteria | 2613 |
| 550 | Ga0436365_0029939 | 3300039437 | Bacteria | 3270 |
| 551 | Ga0436365_0316565 | 3300039437 | Bacteria | 4011 |
| 552 | Ga0436365_0525757 | 3300039437 | Bacteria | 2335 |
| 553 | Ga0436365_0742782 | 3300039437 | Bacteria | 1270 |
| 554 | Ga0436365_1136540 | 3300039437 | Bacteria | 40433 |
| 555 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 556 | Ga0436360_0157856 | 3300039438 | Bacteria | 21123 |
| 557 | Ga0436360_1273015 | 3300039438 | Bacteria | 1851 |
| 558 | Ga0436361_0092439 | 3300039447 | Bacteria | 1517 |
| 559 | Ga0436361_0217171 | 3300039447 | Bacteria | 1775 |
| 560 | Ga0436361_0235144 | 3300039447 | Bacteria | 2839 |
| 561 | Ga0436361_0348195 | 3300039447 | Bacteria | 1485 |
| 562 | Ga0436361_0525734 | 3300039447 | Bacteria | 37715 |
| 563 | Ga0436361_0722234 | 3300039447 | Bacteria | 1205 |
| 564 | Ga0436361_0736152 | 3300039447 | Bacteria | 1222 |
| 565 | Ga0436361_0839114 | 3300039447 | Bacteria | 1258 |
| 566 | Ga0436363_0339486 | 3300039450 | Bacteria | 1456 |
| 567 | Ga0436363_0930428 | 3300039450 | Bacteria | 4099 |
| 568 | Ga0436363_1129020 | 3300039450 | Bacteria | 946 |
| 569 | Ga0436363_1143576 | 3300039450 | Bacteria | 4251 |
| 570 | Ga0436362_0302375 | 3300039453 | Bacteria | 12952 |
| 571 | Ga0436362_0694438 | 3300039453 | Bacteria | 2474 |
| 572 | Ga0436362_0697649 | 3300039453 | Bacteria | 1196 |
| 573 | Ga0436362_0900943 | 3300039453 | Bacteria | 2378 |
| 574 | Ga0436362_1201384 | 3300039453 | Bacteria | 1352 |
| 575 | Ga0439453_0017902 | 3300041408 | Bacteria | 1248 |
| 576 | Ga0439465_0016110 | 3300041413 | Bacteria | 2331 |
| 577 | Ga0439445_0008563 | 3300042004 | Bacteria | 2396 |
| 578 | Ga0439445_0016409 | 3300042004 | Bacteria | 1822 |
| 579 | Ga0439448_0096077 | 3300042005 | Bacteria | 1004 |
| 580 | Ga0451577_0053495 | 3300042876 | Bacteria | 3604 |
| 581 | Ga0451577_0355087 | 3300042876 | Bacteria | 1330 |
| 582 | Ga0453683_0506275 | 3300044673 | Bacteria | 784 |
| 583 | Ga0466966_0013591 | 3300044684 | Bacteria | 5385 |
| 584 | Ga0466966_0111882 | 3300044684 | Bacteria | 1683 |
| 585 | Ga0466963_0095857 | 3300044694 | Bacteria | 2026 |
| 586 | Ga0466963_0196059 | 3300044694 | Bacteria | 1412 |
| 587 | Ga0453684_0005311 | 3300044712 | Bacteria | 25685 |
| 588 | Ga0453684_0025337 | 3300044712 | Bacteria | 8617 |
| 589 | Ga0453684_0293152 | 3300044712 | Bacteria | 1852 |
| 590 | Ga0466960_0173997 | 3300044901 | Bacteria | 1163 |
| 591 | Ga0466959_0002189 | 3300045049 | Bacteria | 12429 |
| 592 | Ga0466959_0017658 | 3300045049 | Bacteria | 5232 |
| 593 | Ga0451576_0009668 | 3300045051 | Bacteria | 11155 |
| 594 | Ga0451576_0526043 | 3300045051 | Bacteria | 1242 |
| 595 | Ga0495617_151033 | 3300046452 | Bacteria | 739 |
| 596 | Ga0495603_0129734 | 3300046455 | Bacteria | 1468 |
| 597 | Ga0495629_0030687 | 3300046459 | Bacteria | 3809 |
| 598 | Ga0495651_0204340 | 3300046462 | Bacteria | 1380 |
| 599 | Ga0495580_0105332 | 3300046472 | Bacteria | 1960 |
| 600 | Ga0495582_0032586 | 3300046473 | Bacteria | 2865 |
| 601 | Ga0495605_0066289 | 3300046474 | Bacteria | 1716 |
| 602 | Ga0495662_0065385 | 3300046476 | Bacteria | 1758 |
| 603 | Ga0495664_0275482 | 3300046477 | Bacteria | 1017 |
| 604 | Ga0495584_0006976 | 3300046491 | Bacteria | 5900 |
| 605 | Ga0495584_0137124 | 3300046491 | Bacteria | 1242 |
| 606 | Ga0495594_0089846 | 3300046499 | Bacteria | 1721 |
| 607 | Ga0495607_0082480 | 3300046501 | Bacteria | 1764 |
| 608 | Ga0495583_0106877 | 3300046506 | Bacteria | 1189 |
| 609 | Ga0495606_0056869 | 3300046507 | Bacteria | 2522 |
| 610 | Ga0495616_0152338 | 3300046513 | Bacteria | 1045 |
| 611 | Ga0495618_0083823 | 3300046514 | Bacteria | 2036 |
| 612 | Ga0495620_0044994 | 3300046515 | Bacteria | 1915 |
| 613 | Ga0495630_0323263 | 3300046517 | Bacteria | 1179 |
| 614 | Ga0495631_0120716 | 3300046518 | Bacteria | 1127 |
| 615 | Ga0495637_0010029 | 3300046520 | Bacteria | 4601 |
| 616 | Ga0495637_0124954 | 3300046520 | Bacteria | 987 |
| 617 | Ga0495643_0036969 | 3300046522 | Bacteria | 2680 |
| 618 | Ga0495643_0117134 | 3300046522 | Bacteria | 1349 |
| 619 | Ga0495644_0029126 | 3300046523 | Bacteria | 2087 |
| 620 | Ga0495666_0009590 | 3300046526 | Bacteria | 4840 |
| 621 | Ga0495654_0031099 | 3300046530 | Bacteria | 2711 |
| 622 | Ga0495665_0030883 | 3300046531 | Bacteria | 2866 |
| 623 | Ga0495665_0058095 | 3300046531 | Bacteria | 2043 |
| 624 | Ga0495640_0047961 | 3300046533 | Bacteria | 2954 |
| 625 | Ga0495586_0149863 | 3300046535 | Bacteria | 1312 |
| 626 | Ga0495587_0191124 | 3300046536 | Bacteria | 1159 |
| 627 | Ga0495598_0000412 | 3300046537 | Bacteria | 7686 |
| 628 | Ga0495609_0147653 | 3300046538 | Bacteria | 1001 |
| 629 | Ga0495621_0022276 | 3300046539 | Bacteria | 2098 |
| 630 | Ga0495597_0003340 | 3300046542 | Bacteria | 9456 |
| 631 | Ga0495622_0002993 | 3300046557 | Bacteria | 8021 |
| 632 | Ga0495667_0085752 | 3300046559 | Bacteria | 2044 |
| 633 | Ga0495656_0003218 | 3300046615 | Bacteria | 5508 |
| 634 | Ga0495668_0033575 | 3300046616 | Bacteria | 2882 |
| 635 | Ga0495668_0118851 | 3300046616 | Bacteria | 1445 |
| 636 | Ga0495634_0078900 | 3300046642 | Bacteria | 2157 |
| 637 | Ga0495625_0370338 | 3300046660 | Bacteria | 901 |
| 638 | Ga0495659_0008319 | 3300046664 | Bacteria | 3303 |
| 639 | Ga0495661_0180792 | 3300046665 | Bacteria | 1118 |
| 640 | Ga0495588_0045800 | 3300046674 | Bacteria | 2243 |
| 641 | Ga0495657_0257678 | 3300046675 | Bacteria | 1049 |
| 642 | Ga0495658_0036189 | 3300046683 | Unclassified | 2722 |
| 643 | Ga0495658_0101707 | 3300046683 | Bacteria | 1716 |
| 644 | Ga0495658_0305393 | 3300046683 | Bacteria | 1007 |
| 645 | Ga0495658_0417816 | 3300046683 | Bacteria | 855 |
| 646 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 647 | Ga0495613_0171563 | 3300046689 | Bacteria | 1539 |
| 648 | Ga0495613_0248288 | 3300046689 | Bacteria | 1242 |
| 649 | Ga0495624_0011870 | 3300046690 | Bacteria | 5974 |
| 650 | Ga0495670_0010915 | 3300046691 | Bacteria | 4464 |
| 651 | Ga0495649_0060603 | 3300046694 | Bacteria | 2036 |
| 652 | Ga0495674_0291973 | 3300047319 | Bacteria | 1333 |
| 653 | Ga0495674_0334792 | 3300047319 | Bacteria | 1231 |
| 654 | Ga0495672_0000739 | 3300047320 | Bacteria | 35757 |
| 655 | Ga0495676_0211685 | 3300047321 | Bacteria | 1341 |
| 656 | Ga0495676_0333307 | 3300047321 | Unclassified | 1017 |
| 657 | Ga0495677_0046685 | 3300047445 | Bacteria | 1589 |
| 658 | Ga0495685_024034 | 3300047447 | Bacteria | 2098 |
| 659 | Ga0495684_0082641 | 3300047471 | Bacteria | 2436 |
| 660 | Ga0495686_0002708 | 3300047472 | Bacteria | 16223 |
| 661 | Ga0495686_0024345 | 3300047472 | Bacteria | 3980 |
| 662 | Ga0495593_0033310 | 3300047673 | Bacteria | 2806 |
| 663 | Ga0495593_0072136 | 3300047673 | Bacteria | 1793 |
| 664 | Ga0495602_0087653 | 3300048088 | Bacteria | 2594 |
| 665 | Ga0495614_0106855 | 3300048089 | Bacteria | 1227 |
| 666 | Ga0496101_0027324 | 3300048904 | Bacteria | 3975 |
| 667 | Ga0496101_0031882 | 3300048904 | Bacteria | 3707 |
| 668 | Ga0496101_0052513 | 3300048904 | Bacteria | 2939 |
| 669 | Ga0496101_0633755 | 3300048904 | Bacteria | 845 |
| 670 | Ga0496102_0055595 | 3300048905 | Bacteria | 3609 |
| 671 | Ga0496102_0274148 | 3300048905 | Bacteria | 1590 |
| 672 | Ga0496102_0404797 | 3300048905 | Bacteria | 1283 |
| 673 | Ga0496103_0001539 | 3300048906 | Bacteria | 15366 |
| 674 | Ga0496104_0003183 | 3300048907 | Bacteria | 14111 |
| 675 | Ga0496104_0006755 | 3300048907 | Bacteria | 10105 |
| 676 | Ga0496104_0079346 | 3300048907 | Bacteria | 3129 |
| 677 | Ga0496105_0000653 | 3300048908 | Bacteria | 23216 |
| 678 | Ga0496105_0003358 | 3300048908 | Bacteria | 11834 |
| 679 | Ga0496105_0019423 | 3300048908 | Bacteria | 5480 |
| 680 | Ga0496106_0004405 | 3300048909 | Bacteria | 10438 |
| 681 | Ga0496106_0051764 | 3300048909 | Bacteria | 3097 |
| 682 | Ga0496107_0021330 | 3300048910 | Bacteria | 4578 |
| 683 | Ga0496108_0004848 | 3300048911 | Bacteria | 10859 |
| 684 | Ga0496109_0001027 | 3300048912 | Bacteria | 23090 |
| 685 | Ga0496110_0011290 | 3300048913 | Bacteria | 7303 |
| 686 | Ga0496110_0018675 | 3300048913 | Bacteria | 5818 |
| 687 | Ga0496110_0030717 | 3300048913 | Bacteria | 4632 |
| 688 | Ga0496110_0090979 | 3300048913 | Bacteria | 2729 |
| 689 | Ga0496111_0076955 | 3300048914 | Bacteria | 2432 |
| 690 | Ga0496111_0389404 | 3300048914 | Bacteria | 1030 |
| 691 | Ga0496112_0000804 | 3300048915 | Bacteria | 22118 |
| 692 | Ga0496112_0059344 | 3300048915 | Bacteria | 3769 |
| 693 | Ga0496112_0465746 | 3300048915 | Bacteria | 1201 |
| 694 | Ga0496113_0001499 | 3300048916 | Bacteria | 13066 |
| 695 | Ga0496114_0021309 | 3300048917 | Bacteria | 5271 |
| 696 | Ga0496114_0030137 | 3300048917 | Bacteria | 4463 |
| 697 | Ga0496114_0211420 | 3300048917 | Bacteria | 1701 |
| 698 | Ga0496114_0383113 | 3300048917 | Bacteria | 1245 |
| 699 | Ga0496115_0004230 | 3300048918 | Bacteria | 10380 |
| 700 | Ga0496115_0088393 | 3300048918 | Bacteria | 2530 |
| 701 | Ga0496115_0263184 | 3300048918 | Bacteria | 1418 |
| 702 | Ga0496115_0407802 | 3300048918 | Bacteria | 1102 |
| 703 | Ga0496119_0002497 | 3300048922 | Bacteria | 20107 |
| 704 | Ga0496121_0254805 | 3300048924 | Bacteria | 1215 |
| 705 | Ga0496126_0010389 | 3300048929 | Bacteria | 9766 |
| 706 | Ga0496126_0278719 | 3300048929 | Bacteria | 1385 |
| 707 | Ga0496126_0569822 | 3300048929 | Bacteria | 896 |
| 708 | Ga0501031_0019630 | 3300049568 | Bacteria | 4402 |
| 709 | Ga0501031_0037957 | 3300049568 | Bacteria | 3144 |
| 710 | Ga0501032_0001016 | 3300049569 | Bacteria | 22671 |
| 711 | Ga0501032_0006036 | 3300049569 | Bacteria | 8938 |
| 712 | Ga0501032_0023092 | 3300049569 | Bacteria | 4305 |
| 713 | Ga0501032_0157399 | 3300049569 | Bacteria | 1492 |
| 714 | Ga0501033_0005237 | 3300049570 | Bacteria | 10295 |
| 715 | Ga0501033_0011204 | 3300049570 | Bacteria | 6868 |
| 716 | Ga0501033_0173782 | 3300049570 | Bacteria | 1547 |
| 717 | Ga0501033_0230645 | 3300049570 | Bacteria | 1315 |
| 718 | Ga0501034_0000244 | 3300049571 | Bacteria | 100222 |
| 719 | Ga0501034_0000623 | 3300049571 | Bacteria | 55353 |
| 720 | Ga0501034_0006211 | 3300049571 | Bacteria | 12862 |
| 721 | Ga0501034_0009574 | 3300049571 | Bacteria | 10139 |
| 722 | Ga0501034_0015930 | 3300049571 | Bacteria | 7715 |
| 723 | Ga0501034_0029889 | 3300049571 | Bacteria | 5538 |
| 724 | Ga0501034_0030592 | 3300049571 | Bacteria | 5472 |
| 725 | Ga0501034_0049229 | 3300049571 | Bacteria | 4252 |
| 726 | Ga0501034_0058001 | 3300049571 | Bacteria | 3892 |
| 727 | Ga0501034_0085320 | 3300049571 | Bacteria | 3159 |
| 728 | Ga0501034_0091153 | 3300049571 | Bacteria | 3046 |
| 729 | Ga0501034_0136565 | 3300049571 | Bacteria | 2433 |
| 730 | Ga0501034_0161820 | 3300049571 | Bacteria | 2209 |
| 731 | Ga0501034_0266304 | 3300049571 | Bacteria | 1655 |
| 732 | Ga0501034_0455552 | 3300049571 | Bacteria | 1197 |
| 733 | Ga0501034_0483485 | 3300049571 | Bacteria | 1153 |
| 734 | Ga0501034_0494303 | 3300049571 | Bacteria | 1137 |
| 735 | Ga0501034_0682207 | 3300049571 | Bacteria | 927 |
| 736 | Ga0501034_0689621 | 3300049571 | Bacteria | 920 |
| 737 | Ga0501036_0000402 | 3300049572 | Bacteria | 30483 |
| 738 | Ga0501036_0009704 | 3300049572 | Bacteria | 7923 |
| 739 | Ga0501036_0131876 | 3300049572 | Bacteria | 2109 |
| 740 | Ga0501036_0184419 | 3300049572 | Bacteria | 1756 |
| 741 | Ga0501036_0242745 | 3300049572 | Bacteria | 1510 |
| 742 | Ga0501036_0263206 | 3300049572 | Bacteria | 1444 |
| 743 | Ga0501036_0299640 | 3300049572 | Bacteria | 1345 |
| 744 | Ga0501036_0348569 | 3300049572 | Bacteria | 1236 |
| 745 | Ga0501037_0008825 | 3300049573 | Bacteria | 7386 |
| 746 | Ga0501037_0009635 | 3300049573 | Bacteria | 7087 |
| 747 | Ga0501037_0014018 | 3300049573 | Bacteria | 5905 |
| 748 | Ga0501037_0072271 | 3300049573 | Bacteria | 2509 |
| 749 | Ga0501037_0115814 | 3300049573 | Bacteria | 1929 |
| 750 | Ga0501037_0169540 | 3300049573 | Bacteria | 1552 |
| 751 | Ga0501037_0374783 | 3300049573 | Bacteria | 979 |
| 752 | Ga0501038_0004074 | 3300049574 | Bacteria | 13588 |
| 753 | Ga0501038_0012791 | 3300049574 | Bacteria | 7663 |
| 754 | Ga0501038_0021786 | 3300049574 | Bacteria | 5750 |
| 755 | Ga0501038_0035364 | 3300049574 | Bacteria | 4386 |
| 756 | Ga0501038_0100969 | 3300049574 | Bacteria | 2402 |
| 757 | Ga0501038_0151329 | 3300049574 | Bacteria | 1891 |
| 758 | Ga0501038_0481171 | 3300049574 | Bacteria | 951 |
| 759 | Ga0501038_0481291 | 3300049574 | Bacteria | 951 |
| 760 | Ga0501039_0107608 | 3300049575 | Bacteria | 2178 |
| 761 | Ga0501039_0306851 | 3300049575 | Bacteria | 1247 |
| 762 | Ga0501039_0320305 | 3300049575 | Bacteria | 1219 |
| 763 | Ga0501040_0004593 | 3300049576 | Bacteria | 8960 |
| 764 | Ga0501042_0022449 | 3300049578 | Bacteria | 4407 |
| 765 | Ga0501042_0185854 | 3300049578 | Bacteria | 1499 |
| 766 | Ga0501042_0198660 | 3300049578 | Bacteria | 1446 |
| 767 | Ga0501043_0001890 | 3300049579 | Bacteria | 17946 |
| 768 | Ga0501043_0032700 | 3300049579 | Bacteria | 4090 |
| 769 | Ga0501043_0076674 | 3300049579 | Bacteria | 2626 |
| 770 | Ga0501043_0179838 | 3300049579 | Bacteria | 1648 |
| 771 | Ga0501043_0365493 | 3300049579 | Bacteria | 1094 |
| 772 | Ga0501046_0035676 | 3300049580 | Bacteria | 4007 |
| 773 | Ga0501046_0081176 | 3300049580 | Bacteria | 2504 |
| 774 | Ga0501046_0170270 | 3300049580 | Bacteria | 1635 |
| 775 | Ga0501046_0256573 | 3300049580 | Bacteria | 1285 |
| 776 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 777 | Ga0501047_0006124 | 3300049581 | Bacteria | 11304 |
| 778 | Ga0501047_0008824 | 3300049581 | Bacteria | 9512 |
| 779 | Ga0501047_0009108 | 3300049581 | Bacteria | 9375 |
| 780 | Ga0501047_0019030 | 3300049581 | Bacteria | 6587 |
| 781 | Ga0501047_0020190 | 3300049581 | Bacteria | 6397 |
| 782 | Ga0501047_0048484 | 3300049581 | Bacteria | 4102 |
| 783 | Ga0501047_0121098 | 3300049581 | Bacteria | 2499 |
| 784 | Ga0501047_0288600 | 3300049581 | Bacteria | 1484 |
| 785 | Ga0501047_0636817 | 3300049581 | Bacteria | 886 |
| 786 | Ga0501048_0001467 | 3300049582 | Bacteria | 17883 |
| 787 | Ga0501048_0006405 | 3300049582 | Bacteria | 8948 |
| 788 | Ga0501048_0031281 | 3300049582 | Bacteria | 3850 |
| 789 | Ga0501067_0000137 | 3300049583 | Bacteria | 40123 |
| 790 | Ga0501067_0000637 | 3300049583 | Bacteria | 18857 |
| 791 | Ga0501067_0007532 | 3300049583 | Bacteria | 6050 |
| 792 | Ga0501067_0071752 | 3300049583 | Bacteria | 1918 |
| 793 | Ga0501067_0080972 | 3300049583 | Bacteria | 1800 |
| 794 | Ga0501067_0095780 | 3300049583 | Bacteria | 1648 |
| 795 | Ga0501067_0187574 | 3300049583 | Bacteria | 1151 |
| 796 | Ga0501068_0000436 | 3300049584 | Bacteria | 21206 |
| 797 | Ga0501068_0001773 | 3300049584 | Bacteria | 11475 |
| 798 | Ga0501068_0004997 | 3300049584 | Bacteria | 7221 |
| 799 | Ga0501068_0008618 | 3300049584 | Bacteria | 5682 |
| 800 | Ga0501068_0190503 | 3300049584 | Bacteria | 1299 |
| 801 | Ga0501068_0245350 | 3300049584 | Bacteria | 1140 |
| 802 | Ga0501070_0083324 | 3300049586 | Bacteria | 2647 |
| 803 | Ga0501070_0126211 | 3300049586 | Bacteria | 2115 |
| 804 | Ga0501070_0213504 | 3300049586 | Bacteria | 1583 |
| 805 | Ga0501070_0287230 | 3300049586 | Bacteria | 1341 |
| 806 | Ga0501070_0326225 | 3300049586 | Bacteria | 1248 |
| 807 | Ga0501071_0050273 | 3300049587 | Bacteria | 3003 |
| 808 | Ga0501071_0142607 | 3300049587 | Bacteria | 1784 |
| 809 | Ga0501071_0573494 | 3300049587 | Bacteria | 867 |
| 810 | Ga0501072_0013992 | 3300049588 | Bacteria | 6149 |
| 811 | Ga0501072_0042845 | 3300049588 | Bacteria | 3556 |
| 812 | Ga0501072_0116565 | 3300049588 | Bacteria | 2127 |
| 813 | Ga0501072_0371741 | 3300049588 | Bacteria | 1135 |
| 814 | Ga0501073_0000003 | 3300049589 | Bacteria | 294975 |
| 815 | Ga0501073_0000284 | 3300049589 | Bacteria | 33459 |
| 816 | Ga0501073_0003399 | 3300049589 | Bacteria | 11970 |
| 817 | Ga0501073_0019022 | 3300049589 | Bacteria | 4963 |
| 818 | Ga0501073_0047757 | 3300049589 | Bacteria | 3007 |
| 819 | Ga0501073_0098835 | 3300049589 | Bacteria | 2026 |
| 820 | Ga0501074_0015059 | 3300049590 | Bacteria | 5626 |
| 821 | Ga0501074_0083490 | 3300049590 | Bacteria | 2290 |
| 822 | Ga0501074_0264219 | 3300049590 | Bacteria | 1223 |
| 823 | Ga0501074_0383166 | 3300049590 | Bacteria | 997 |
| 824 | Ga0501075_0080363 | 3300049591 | Bacteria | 2468 |
| 825 | Ga0501076_0123319 | 3300049592 | Bacteria | 2098 |
| 826 | Ga0501076_0132604 | 3300049592 | Bacteria | 2021 |
| 827 | Ga0501077_0000016 | 3300049593 | Bacteria | 88500 |
| 828 | Ga0501077_0046830 | 3300049593 | Bacteria | 2747 |
| 829 | Ga0501077_0444866 | 3300049593 | Bacteria | 830 |
| 830 | Ga0501079_0007367 | 3300049741 | Bacteria | 8321 |
| 831 | Ga0501080_0000148 | 3300049742 | Bacteria | 50074 |
| 832 | Ga0501080_0000777 | 3300049742 | Bacteria | 25921 |
| 833 | Ga0501080_0000954 | 3300049742 | Bacteria | 23683 |
| 834 | Ga0501080_0012166 | 3300049742 | Bacteria | 7885 |
| 835 | Ga0501080_0036219 | 3300049742 | Bacteria | 4606 |
| 836 | Ga0501080_0402339 | 3300049742 | Bacteria | 1231 |
| 837 | Ga0501080_0405291 | 3300049742 | Bacteria | 1226 |
| 838 | Ga0501081_0039906 | 3300049743 | Bacteria | 3214 |
| 839 | Ga0501083_0001616 | 3300049744 | Bacteria | 15406 |
| 840 | Ga0501083_0005602 | 3300049744 | Bacteria | 8890 |
| 841 | Ga0501083_0006643 | 3300049744 | Bacteria | 8204 |
| 842 | Ga0501083_0021194 | 3300049744 | Bacteria | 4517 |
| 843 | Ga0501083_0221209 | 3300049744 | Bacteria | 1233 |
| 844 | Ga0501083_0270455 | 3300049744 | Bacteria | 1106 |
| 845 | Ga0501035_0000715 | 3300049822 | Bacteria | 35903 |
| 846 | Ga0501035_0053381 | 3300049822 | Bacteria | 3615 |
| 847 | Ga0501035_0054708 | 3300049822 | Bacteria | 3565 |
| 848 | Ga0501035_0150690 | 3300049822 | Bacteria | 2018 |
| 849 | Ga0501035_0238619 | 3300049822 | Bacteria | 1547 |
| 850 | Ga0501035_0337393 | 3300049822 | Bacteria | 1263 |
| 851 | Ga0501035_0396108 | 3300049822 | Bacteria | 1149 |
| 852 | Ga0501044_0001007 | 3300049823 | Bacteria | 33907 |
| 853 | Ga0501044_0002725 | 3300049823 | Bacteria | 20097 |
| 854 | Ga0501044_0003468 | 3300049823 | Bacteria | 17770 |
| 855 | Ga0501044_0045787 | 3300049823 | Bacteria | 4531 |
| 856 | Ga0501044_0105507 | 3300049823 | Bacteria | 2830 |
| 857 | Ga0501044_0173805 | 3300049823 | Bacteria | 2124 |
| 858 | Ga0501044_0187458 | 3300049823 | Bacteria | 2032 |
| 859 | Ga0501044_0269283 | 3300049823 | Bacteria | 1639 |
| 860 | Ga0501044_0279781 | 3300049823 | Bacteria | 1602 |
| 861 | Ga0501044_0360262 | 3300049823 | Bacteria | 1372 |
| 862 | Ga0501044_0399893 | 3300049823 | Bacteria | 1286 |
| 863 | Ga0501044_0573076 | 3300049823 | Bacteria | 1024 |
| 864 | Ga0501044_0788866 | 3300049823 | Bacteria | 830 |
| 865 | Ga0501045_0002871 | 3300049824 | Bacteria | 11773 |
| 866 | Ga0501045_0080562 | 3300049824 | Bacteria | 2401 |
| 867 | Ga0501045_0160963 | 3300049824 | Bacteria | 1671 |
| 868 | nmdc:mga03683_22577_c1 | 3300050489 | Bacteria | 2441 |
| 869 | nmdc:mga03n38_90280_c1 | 3300050490 | Bacteria | 1457 |
| 870 | nmdc:mga00v17_188552_c1 | 3300050491 | Bacteria | 1331 |
| 871 | nmdc:mga00v17_41055_c1 | 3300050491 | Bacteria | 2777 |
| 872 | nmdc:mga0yw44_275362_c1 | 3300050492 | Bacteria | 1124 |
| 873 | nmdc:mga0k408_11597_c2 | 3300050493 | Bacteria | 3488 |
| 874 | nmdc:mga0k408_66682_c1 | 3300050493 | Bacteria | 2097 |
| 875 | nmdc:mga06z11_255298_c1 | 3300050494 | Bacteria | 1033 |
| 876 | nmdc:mga06z11_56709_c1 | 3300050494 | Bacteria | 2027 |
| 877 | nmdc:mga07m45_29751_c1 | 3300050496 | Bacteria | 3023 |
| 878 | nmdc:mga05p37_1364_c1 | 3300050507 | Bacteria | 28406 |
| 879 | nmdc:mga05p37_1370_c1 | 3300050507 | Bacteria | 28331 |
| 880 | nmdc:mga05p37_415904_c1 | 3300050507 | Bacteria | 1566 |
| 881 | nmdc:mga05p37_43817_c1 | 3300050507 | Bacteria | 5505 |
| 882 | nmdc:mga05p37_59746_c1 | 3300050507 | Bacteria | 4694 |
| 883 | nmdc:mga05p37_726882_c1 | 3300050507 | Bacteria | 1098 |
| 884 | nmdc:mga09592_17705_c1 | 3300050508 | Bacteria | 5839 |
| 885 | nmdc:mga09592_17818_c1 | 3300050508 | Bacteria | 5819 |
| 886 | nmdc:mga09592_361626_c1 | 3300050508 | Bacteria | 1256 |
| 887 | nmdc:mga0qj67_123792_c1 | 3300050509 | Bacteria | 2092 |
| 888 | nmdc:mga0qj67_54837_c1 | 3300050509 | Bacteria | 3156 |
| 889 | nmdc:mga06r32_151_c1 | 3300050510 | Bacteria | 52848 |
| 890 | nmdc:mga06r32_23835_c1 | 3300050510 | Bacteria | 5670 |
| 891 | nmdc:mga06r32_50711_c1 | 3300050510 | Bacteria | 3969 |
| 892 | nmdc:mga08y16_170896_c1 | 3300050511 | Bacteria | 2258 |
| 893 | nmdc:mga08y16_194666_c1 | 3300050511 | Bacteria | 2102 |
| 894 | nmdc:mga08y16_207627_c1 | 3300050511 | Bacteria | 2029 |
| 895 | nmdc:mga08y16_86_c1 | 3300050511 | Bacteria | 78136 |
| 896 | nmdc:mga08y16_965277_c1 | 3300050511 | Bacteria | 834 |
| 897 | nmdc:mga0n895_127360_c1 | 3300050512 | Bacteria | 2570 |
| 898 | nmdc:mga0n895_160300_c1 | 3300050512 | Bacteria | 2281 |
| 899 | nmdc:mga0n895_98008_c1 | 3300050512 | Bacteria | 2938 |
| 900 | nmdc:mga0rr50_147851_c1 | 3300050513 | Bacteria | 1896 |
| 901 | nmdc:mga0rr50_56681_c1 | 3300050513 | Bacteria | 2928 |
| 902 | nmdc:mga0rr50_605984_c1 | 3300050513 | Bacteria | 934 |
| 903 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 904 | nmdc:mga0a205_101195_c1 | 3300050515 | Bacteria | 2780 |
| 905 | nmdc:mga0a205_36209_c1 | 3300050515 | Bacteria | 4741 |
| 906 | nmdc:mga0a205_48308_c1 | 3300050515 | Bacteria | 4107 |
| 907 | nmdc:mga0a205_597394_c1 | 3300050515 | Bacteria | 957 |
| 908 | nmdc:mga0sz30_469_c1 | 3300050516 | Bacteria | 15301 |
| 909 | Ga0495612_0060917 | 3300053078 | Bacteria | 1563 |
| 910 | Ga0500635_0000080 | 3300053080 | Bacteria | 63214 |
| 911 | Ga0495595_0015517 | 3300053084 | Bacteria | 3250 |
| 912 | Ga0495619_0019642 | 3300053085 | Bacteria | 4297 |
| 913 | Ga0495619_0089895 | 3300053085 | Bacteria | 2078 |
| 914 | Ga0495619_0103208 | 3300053085 | Bacteria | 1942 |
| 915 | Ga0495619_0321850 | 3300053085 | Bacteria | 1070 |
| 916 | Ga0495619_0418340 | 3300053085 | Bacteria | 925 |
| 917 | Ga0500578_0119769 | 3300053086 | Bacteria | 1655 |
| 918 | Ga0500578_0154959 | 3300053086 | Bacteria | 1425 |
| 919 | Ga0500643_002563 | 3300053087 | Bacteria | 9261 |
| 920 | Ga0500643_009378 | 3300053087 | Bacteria | 3744 |
| 921 | Ga0500643_043611 | 3300053087 | Bacteria | 1307 |
| 922 | Ga0500646_0011647 | 3300053090 | Bacteria | 2263 |
| 923 | Ga0500647_0099551 | 3300053091 | Bacteria | 1388 |
| 924 | Ga0500583_0050564 | 3300053092 | Bacteria | 1928 |
| 925 | Ga0500651_0041785 | 3300053093 | Bacteria | 2890 |
| 926 | Ga0500651_0072450 | 3300053093 | Bacteria | 2142 |
| 927 | Ga0500566_0008660 | 3300053094 | Bacteria | 6017 |
| 928 | Ga0500566_0128903 | 3300053094 | Bacteria | 1356 |
| 929 | Ga0500641_0000281 | 3300053096 | Bacteria | 19016 |
| 930 | Ga0500641_0002911 | 3300053096 | Bacteria | 6073 |
| 931 | Ga0500641_0042425 | 3300053096 | Bacteria | 1843 |
| 932 | Ga0500654_072357 | 3300053099 | Bacteria | 1670 |
| 933 | Ga0500556_0061718 | 3300053104 | Bacteria | 1382 |
| 934 | Ga0500556_0099158 | 3300053104 | Bacteria | 1120 |
| 935 | Ga0500562_083394 | 3300053108 | Bacteria | 866 |
| 936 | Ga0500569_000298 | 3300053109 | Bacteria | 7944 |
| 937 | Ga0500595_002391 | 3300053119 | Bacteria | 9372 |
| 938 | Ga0500595_028795 | 3300053119 | Bacteria | 1891 |
| 939 | Ga0500607_132198 | 3300053121 | Bacteria | 1188 |
| 940 | Ga0500608_001366 | 3300053122 | Bacteria | 8732 |
| 941 | Ga0500614_007297 | 3300053123 | Bacteria | 2328 |
| 942 | Ga0500618_037128 | 3300053125 | Bacteria | 1127 |
| 943 | Ga0500628_044927 | 3300053129 | Bacteria | 1025 |
| 944 | Ga0500642_0171449 | 3300053130 | Bacteria | 1016 |
| 945 | Ga0500655_031147 | 3300053133 | Bacteria | 1028 |
| 946 | Ga0500658_0008025 | 3300053134 | Bacteria | 3902 |
| 947 | Ga0500658_0018884 | 3300053134 | Bacteria | 2590 |
| 948 | Ga0500559_0152059 | 3300053136 | Bacteria | 1087 |
| 949 | Ga0500573_0185731 | 3300053140 | Bacteria | 1114 |
| 950 | Ga0500590_008183 | 3300053148 | Bacteria | 5207 |
| 951 | Ga0500603_046359 | 3300053150 | Bacteria | 1176 |
| 952 | Ga0500604_0003297 | 3300053151 | Bacteria | 4346 |
| 953 | Ga0500604_0009823 | 3300053151 | Bacteria | 2551 |
| 954 | Ga0500604_0148306 | 3300053151 | Bacteria | 795 |
| 955 | Ga0500616_0013469 | 3300053153 | Bacteria | 4746 |
| 956 | Ga0500616_0034243 | 3300053153 | Bacteria | 2767 |
| 957 | Ga0500624_001445 | 3300053157 | Bacteria | 3852 |
| 958 | Ga0500634_0000087 | 3300053161 | Bacteria | 35438 |
| 959 | Ga0500638_058152 | 3300053162 | Bacteria | 1862 |
| 960 | Ga0500639_114379 | 3300053163 | Bacteria | 1307 |
| 961 | Ga0500636_0002254 | 3300053177 | Bacteria | 10696 |
| 962 | Ga0500637_0022327 | 3300053178 | Bacteria | 3446 |
| 963 | Ga0500637_0183722 | 3300053178 | Bacteria | 1197 |
| 964 | Ga0500576_019706 | 3300053725 | Bacteria | 3076 |
| 965 | Ga0500625_047661 | 3300053729 | Bacteria | 1992 |
| 966 | Ga0500609_000390 | 3300053731 | Bacteria | 6488 |
| 967 | Ga0500596_000190 | 3300053735 | Bacteria | 10041 |
| 968 | Ga0501084_0007012 | 3300054114 | Bacteria | 9288 |
| 969 | Ga0501084_0021772 | 3300054114 | Bacteria | 5346 |
| 970 | Ga0501084_0048484 | 3300054114 | Bacteria | 3556 |
| 971 | Ga0501084_0075497 | 3300054114 | Bacteria | 2824 |
| 972 | Ga0501084_0094788 | 3300054114 | Bacteria | 2506 |
| 973 | Ga0501084_0707123 | 3300054114 | Bacteria | 850 |
| 974 | Ga0587073_0031457 | 3300059492 | Bacteria | 1099 |
| 975 | Ga0501082_0004670 | 3300060353 | Bacteria | 11950 |
| 976 | Ga0501082_0006711 | 3300060353 | Bacteria | 9955 |
| 977 | Ga0501082_0195719 | 3300060353 | Bacteria | 1759 |
| 978 | Ga0501082_0492114 | 3300060353 | Bacteria | 1072 |
| 979 | Ga0501082_0496140 | 3300060353 | Bacteria | 1067 |
| 980 | Ga0501082_0657327 | 3300060353 | Bacteria | 917 |
| 981 | Ga0530510_0145921 | 3300061734 | Bacteria | 1745 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100012557 | Ga0070680_1000125574 | 191 |
| 2 | 3300005344 | Ga0070661_100075453 | Ga0070661_1000754531 | 191 |
| 3 | 3300005458 | Ga0070681_10006100 | Ga0070681_100061009 | 191 |
| 4 | 3300005530 | Ga0070679_100032781 | Ga0070679_1000327812 | 191 |
| 5 | 3300005577 | Ga0068857_100595835 | Ga0068857_1005958352 | 191 |
| 6 | 3300025912 | Ga0207707_10093101 | Ga0207707_100931012 | 191 |
| 7 | 3300025917 | Ga0207660_10132914 | Ga0207660_101329142 | 191 |
| 8 | 3300025921 | Ga0207652_10018761 | Ga0207652_100187612 | 191 |
| 9 | 3300046452 | Ga0495617_151033 | Ga0495617_151033_100_714 | 194 |
| 10 | 3300005327 | Ga0070658_10026519 | Ga0070658_100265194 | 197 |
| 11 | 3300005563 | Ga0068855_100214717 | Ga0068855_1002147172 | 197 |
| 12 | 3300025949 | Ga0207667_10304937 | Ga0207667_103049372 | 197 |
| 13 | 3300005563 | Ga0068855_100000009 | Ga0068855_100000009136 | 198 |
| 14 | 3300005563 | Ga0068855_100000093 | Ga0068855_10000009321 | 198 |
| 15 | 3300025949 | Ga0207667_10000045 | Ga0207667_1000004599 | 198 |
| 16 | 3300025949 | Ga0207667_10000588 | Ga0207667_1000058816 | 198 |
| 17 | 3300046523 | Ga0495644_0029126 | Ga0495644_0029126_222_959 | 198 |
| 18 | 3300047447 | Ga0495685_024034 | Ga0495685_024034_898_1635 | 198 |
| 19 | 3300042876 | Ga0451577_0355087 | Ga0451577_0355087_238_870 | 199 |
| 20 | 3300005347 | Ga0070668_100117910 | Ga0070668_1001179102 | 200 |
| 21 | 3300044673 | Ga0453683_0506275 | Ga0453683_0506275_41_676 | 200 |
| 22 | 3300031251 | Ga0265327_10000054 | Ga0265327_1000005464 | 203 |
| 23 | 3300047472 | Ga0495686_0002708 | Ga0495686_0002708_12449_13192 | 203 |
| 24 | 3300005333 | Ga0070677_10017189 | Ga0070677_100171893 | 204 |
| 25 | 3300025940 | Ga0207691_10105100 | Ga0207691_101051003 | 204 |
| 26 | 3300046515 | Ga0495620_0044994 | Ga0495620_0044994_1257_1901 | 205 |
| 27 | 3300005577 | Ga0068857_100585764 | Ga0068857_1005857641 | 207 |
| 28 | 3300009545 | Ga0105237_10972741 | Ga0105237_109727411 | 207 |
| 29 | 3300010375 | Ga0105239_10243793 | Ga0105239_102437933 | 207 |
| 30 | 3300013102 | Ga0157371_10020758 | Ga0157371_100207583 | 207 |
| 31 | 3300005614 | Ga0068856_100014274 | Ga0068856_1000142748 | 209 |
| 32 | 3300026078 | Ga0207702_10161501 | Ga0207702_101615012 | 209 |
| 33 | 3300005844 | Ga0068862_100057627 | Ga0068862_1000576273 | 211 |
| 34 | 3300013104 | Ga0157370_10002875 | Ga0157370_100028756 | 211 |
| 35 | 3300013296 | Ga0157374_10006020 | Ga0157374_100060202 | 211 |
| 36 | 3300013306 | Ga0163162_10385835 | Ga0163162_103858352 | 211 |
| 37 | 3300013308 | Ga0157375_11682575 | Ga0157375_116825751 | 211 |
| 38 | 3300031251 | Ga0265327_10071826 | Ga0265327_100718262 | 212 |
| 39 | 3300005327 | Ga0070658_10185814 | Ga0070658_101858142 | 213 |
| 40 | 3300025909 | Ga0207705_10197352 | Ga0207705_101973522 | 213 |
| 41 | 3300035119 | Ga0373956_0094151 | Ga0373956_0094151_588_1262 | 213 |
| 42 | 3300005843 | Ga0068860_100011656 | Ga0068860_1000116563 | 215 |
| 43 | 3300006358 | Ga0068871_100265200 | Ga0068871_1002652002 | 215 |
| 44 | 3300046675 | Ga0495657_0257678 | Ga0495657_0257678_10_693 | 216 |
| 45 | 3300025893 | Ga0207682_10009231 | Ga0207682_100092312 | 221 |
| 46 | 3300028800 | Ga0265338_10021228 | Ga0265338_1002122810 | 224 |
| 47 | 3300005334 | Ga0068869_100009547 | Ga0068869_1000095477 | 225 |
| 48 | 3300005617 | Ga0068859_100021820 | Ga0068859_1000218202 | 225 |
| 49 | 3300006028 | Ga0070717_10141223 | Ga0070717_101412232 | 225 |
| 50 | 3300006931 | Ga0097620_100021824 | Ga0097620_1000218242 | 225 |
| 51 | 3300025916 | Ga0207663_10242979 | Ga0207663_102429792 | 225 |
| 52 | 3300038443 | Ga0395901_0000225 | Ga0395901_0000225_47358_48092 | 225 |
| 53 | 3300005329 | Ga0070683_100023828 | Ga0070683_1000238283 | 226 |
| 54 | 3300005336 | Ga0070680_100015196 | Ga0070680_1000151964 | 226 |
| 55 | 3300005434 | Ga0070709_10068208 | Ga0070709_100682083 | 226 |
| 56 | 3300005437 | Ga0070710_10004304 | Ga0070710_100043046 | 226 |
| 57 | 3300005439 | Ga0070711_100053143 | Ga0070711_1000531433 | 226 |
| 58 | 3300005535 | Ga0070684_100117049 | Ga0070684_1001170493 | 226 |
| 59 | 3300005539 | Ga0068853_100341419 | Ga0068853_1003414192 | 226 |
| 60 | 3300005547 | Ga0070693_100003633 | Ga0070693_1000036334 | 226 |
| 61 | 3300005577 | Ga0068857_100942842 | Ga0068857_1009428421 | 226 |
| 62 | 3300005578 | Ga0068854_100133504 | Ga0068854_1001335043 | 226 |
| 63 | 3300005614 | Ga0068856_100081363 | Ga0068856_1000813634 | 226 |
| 64 | 3300006175 | Ga0070712_100015199 | Ga0070712_1000151995 | 226 |
| 65 | 3300009093 | Ga0105240_10299790 | Ga0105240_102997903 | 226 |
| 66 | 3300013102 | Ga0157371_10223626 | Ga0157371_102236262 | 226 |
| 67 | 3300025906 | Ga0207699_10035071 | Ga0207699_100350714 | 226 |
| 68 | 3300025913 | Ga0207695_10385409 | Ga0207695_103854091 | 226 |
| 69 | 3300025917 | Ga0207660_10124343 | Ga0207660_101243433 | 226 |
| 70 | 3300025929 | Ga0207664_10005464 | Ga0207664_100054647 | 226 |
| 71 | 3300025949 | Ga0207667_10691039 | Ga0207667_106910391 | 226 |
| 72 | 3300025981 | Ga0207640_10110400 | Ga0207640_101104003 | 226 |
| 73 | 3300026041 | Ga0207639_10236214 | Ga0207639_102362143 | 226 |
| 74 | 3300026078 | Ga0207702_10070400 | Ga0207702_100704003 | 226 |
| 75 | 3300026116 | Ga0207674_10386736 | Ga0207674_103867362 | 226 |
| 76 | 3300049824 | Ga0501045_0080562 | Ga0501045_0080562_561_1298 | 226 |
| 77 | 3300060353 | Ga0501082_0657327 | Ga0501082_0657327_68_805 | 226 |
| 78 | 3300021388 | Ga0213875_10002695 | Ga0213875_100026959 | 228 |
| 79 | 3300037853 | Ga0436364_1026771 | Ga0436364_1026771_4717_5454 | 228 |
| 80 | 3300048929 | Ga0496126_0569822 | Ga0496126_0569822_41_781 | 228 |
| 81 | 3300049574 | Ga0501038_0481291 | Ga0501038_0481291_227_937 | 228 |
| 82 | 3300025924 | Ga0207694_10120857 | Ga0207694_101208573 | 229 |
| 83 | 3300047472 | Ga0495686_0024345 | Ga0495686_0024345_1052_1789 | 229 |
| 84 | 3300048922 | Ga0496119_0002497 | Ga0496119_0002497_15307_16044 | 229 |
| 85 | 3300049587 | Ga0501071_0573494 | Ga0501071_0573494_61_798 | 229 |
| 86 | 3300050511 | nmdc:mga08y16_965277_c1 | nmdc:mga08y16_965277_c1_22_759 | 229 |
| 87 | 3300005344 | Ga0070661_100006288 | Ga0070661_1000062883 | 230 |
| 88 | 3300005366 | Ga0070659_100053819 | Ga0070659_1000538192 | 230 |
| 89 | 3300005539 | Ga0068853_100078999 | Ga0068853_1000789994 | 230 |
| 90 | 3300005578 | Ga0068854_100703289 | Ga0068854_1007032891 | 230 |
| 91 | 3300005616 | Ga0068852_100273793 | Ga0068852_1002737932 | 230 |
| 92 | 3300009093 | Ga0105240_10131409 | Ga0105240_101314092 | 230 |
| 93 | 3300009551 | Ga0105238_10118377 | Ga0105238_101183773 | 230 |
| 94 | 3300010375 | Ga0105239_11154845 | Ga0105239_111548451 | 230 |
| 95 | 3300013104 | Ga0157370_10193886 | Ga0157370_101938862 | 230 |
| 96 | 3300013105 | Ga0157369_10196501 | Ga0157369_101965012 | 230 |
| 97 | 3300035170 | Ga0373943_0239082 | Ga0373943_0239082_161_898 | 230 |
| 98 | 3300035695 | Ga0373927_0036738 | Ga0373927_0036738_2172_2909 | 230 |
| 99 | 3300021388 | Ga0213875_10093515 | Ga0213875_100935152 | 231 |
| 100 | 3300031616 | Ga0307508_10100583 | Ga0307508_101005832 | 231 |
| 101 | 3300037853 | Ga0436364_0382668 | Ga0436364_0382668_1943_2680 | 231 |
| 102 | 3300005614 | Ga0068856_100049571 | Ga0068856_1000495714 | 232 |
| 103 | 3300009098 | Ga0105245_10101542 | Ga0105245_101015422 | 232 |
| 104 | 3300009177 | Ga0105248_10065402 | Ga0105248_100654024 | 232 |
| 105 | 3300009553 | Ga0105249_10820214 | Ga0105249_108202141 | 232 |
| 106 | 3300025903 | Ga0207680_10095618 | Ga0207680_100956183 | 232 |
| 107 | 3300025941 | Ga0207711_10073803 | Ga0207711_100738032 | 232 |
| 108 | 3300025961 | Ga0207712_10332399 | Ga0207712_103323992 | 232 |
| 109 | 3300026078 | Ga0207702_10117617 | Ga0207702_101176172 | 232 |
| 110 | 3300031824 | Ga0307413_10260538 | Ga0307413_102605382 | 232 |
| 111 | 3300031852 | Ga0307410_10106049 | Ga0307410_101060492 | 232 |
| 112 | 3300032002 | Ga0307416_100497318 | Ga0307416_1004973182 | 232 |
| 113 | 3300032005 | Ga0307411_10157678 | Ga0307411_101576782 | 232 |
| 114 | 3300044694 | Ga0466963_0196059 | Ga0466963_0196059_61_783 | 232 |
| 115 | 3300049579 | Ga0501043_0179838 | Ga0501043_0179838_673_1410 | 233 |
| 116 | iso_pu_bacteria | 2511231221 | 2512033511 | 233 |
| 117 | iso_pu_bacteria | 2523231067 | 2523470308 | 233 |
| 118 | iso_pu_bacteria | 2643221547 | 2643756642 | 233 |
| 119 | iso_pu_bacteria | 2643221580 | 2643911245 | 233 |
| 120 | iso_pu_bacteria | 2643221591 | 2643964098 | 233 |
| 121 | iso_pu_bacteria | 2643221598 | 2644001870 | 233 |
| 122 | iso_pu_bacteria | 2643221614 | 2644085262 | 233 |
| 123 | iso_pu_bacteria | 2643221661 | 2644342814 | 233 |
| 124 | iso_pu_bacteria | 2643221666 | 2644366114 | 233 |
| 125 | iso_pu_bacteria | 2643221674 | 2644410990 | 233 |
| 126 | iso_pu_bacteria | 2671180139 | 2671692875 | 233 |
| 127 | iso_pu_bacteria | 2738543031 | 2739350346 | 233 |
| 128 | iso_pu_bacteria | 2821443989 | 2821449361 | 233 |
| 129 | iso_pu_bacteria | 2842333319 | 2842333672 | 233 |
| 130 | iso_pu_bacteria | 2844533157 | 2844533636 | 233 |
| 131 | iso_pu_bacteria | 2883577096 | 2883578858 | 233 |
| 132 | iso_pu_bacteria | 2894772417 | 2894777576 | 233 |
| 133 | iso_pu_bacteria | 2894817345 | 2894819717 | 233 |
| 134 | iso_pu_bacteria | 2897803580 | 2897804328 | 233 |
| 135 | iso_pu_bacteria | 2909399089 | 2909401678 | 233 |
| 136 | iso_pu_bacteria | 2929199973 | 2929201504 | 233 |
| 137 | iso_pu_bacteria | 2932401849 | 2932403861 | 233 |
| 138 | iso_pu_bacteria | 8054002106 | 8054004926 | 233 |
| 139 | iso_pu_bacteria | 8055909800 | 8055915707 | 233 |
| 140 | 3300003316 | rootH1_10164059 | rootH1_101640591 | 234 |
| 141 | 3300003320 | rootH2_10052210 | rootH2_1005221026 | 234 |
| 142 | 3300003322 | rootL2_10218209 | rootL2_102182092 | 234 |
| 143 | 3300003323 | rootH1_10219969 | rootH1_102199691 | 234 |
| 144 | 3300005289 | Ga0065704_10171961 | Ga0065704_101719611 | 234 |
| 145 | 3300005293 | Ga0065715_10166128 | Ga0065715_101661282 | 234 |
| 146 | 3300005327 | Ga0070658_10000059 | Ga0070658_10000059105 | 234 |
| 147 | 3300005328 | Ga0070676_10016919 | Ga0070676_100169192 | 234 |
| 148 | 3300005331 | Ga0070670_100151241 | Ga0070670_1001512412 | 234 |
| 149 | 3300005339 | Ga0070660_100048416 | Ga0070660_1000484161 | 234 |
| 150 | 3300005347 | Ga0070668_100064590 | Ga0070668_1000645902 | 234 |
| 151 | 3300005347 | Ga0070668_100339965 | Ga0070668_1003399652 | 234 |
| 152 | 3300005353 | Ga0070669_100010472 | Ga0070669_1000104723 | 234 |
| 153 | 3300005365 | Ga0070688_100048736 | Ga0070688_1000487362 | 234 |
| 154 | 3300005459 | Ga0068867_100087828 | Ga0068867_1000878282 | 234 |
| 155 | 3300005466 | Ga0070685_10004976 | Ga0070685_100049762 | 234 |
| 156 | 3300005466 | Ga0070685_10047083 | Ga0070685_100470832 | 234 |
| 157 | 3300005543 | Ga0070672_100016229 | Ga0070672_1000162296 | 234 |
| 158 | 3300005549 | Ga0070704_100346552 | Ga0070704_1003465521 | 234 |
| 159 | 3300005563 | Ga0068855_100002770 | Ga0068855_10000277013 | 234 |
| 160 | 3300005564 | Ga0070664_100671954 | Ga0070664_1006719542 | 234 |
| 161 | 3300005578 | Ga0068854_100290918 | Ga0068854_1002909182 | 234 |
| 162 | 3300005617 | Ga0068859_100142510 | Ga0068859_1001425102 | 234 |
| 163 | 3300005617 | Ga0068859_100206335 | Ga0068859_1002063352 | 234 |
| 164 | 3300005719 | Ga0068861_100084612 | Ga0068861_1000846122 | 234 |
| 165 | 3300005840 | Ga0068870_10102381 | Ga0068870_101023812 | 234 |
| 166 | 3300005841 | Ga0068863_100254720 | Ga0068863_1002547203 | 234 |
| 167 | 3300005844 | Ga0068862_100007610 | Ga0068862_1000076107 | 234 |
| 168 | 3300006931 | Ga0097620_100142526 | Ga0097620_1001425262 | 234 |
| 169 | 3300006931 | Ga0097620_100206334 | Ga0097620_1002063342 | 234 |
| 170 | 3300009094 | Ga0111539_10029219 | Ga0111539_100292197 | 234 |
| 171 | 3300009553 | Ga0105249_10352395 | Ga0105249_103523951 | 234 |
| 172 | 3300013297 | Ga0157378_10113810 | Ga0157378_101138102 | 234 |
| 173 | 3300013297 | Ga0157378_10242253 | Ga0157378_102422532 | 234 |
| 174 | 3300013306 | Ga0163162_10037368 | Ga0163162_100373682 | 234 |
| 175 | 3300013308 | Ga0157375_10053720 | Ga0157375_100537202 | 234 |
| 176 | 3300014326 | Ga0157380_10034981 | Ga0157380_100349813 | 234 |
| 177 | 3300014745 | Ga0157377_10024421 | Ga0157377_100244212 | 234 |
| 178 | 3300014745 | Ga0157377_10068405 | Ga0157377_100684051 | 234 |
| 179 | 3300017792 | Ga0163161_10091543 | Ga0163161_100915432 | 234 |
| 180 | 3300017792 | Ga0163161_10207866 | Ga0163161_102078662 | 234 |
| 181 | 3300025907 | Ga0207645_10281570 | Ga0207645_102815702 | 234 |
| 182 | 3300025908 | Ga0207643_10015054 | Ga0207643_100150543 | 234 |
| 183 | 3300025908 | Ga0207643_10152198 | Ga0207643_101521982 | 234 |
| 184 | 3300025909 | Ga0207705_10000195 | Ga0207705_1000019548 | 234 |
| 185 | 3300025909 | Ga0207705_10144164 | Ga0207705_101441642 | 234 |
| 186 | 3300025920 | Ga0207649_10397255 | Ga0207649_103972551 | 234 |
| 187 | 3300025923 | Ga0207681_10306321 | Ga0207681_103063212 | 234 |
| 188 | 3300025925 | Ga0207650_10010512 | Ga0207650_100105123 | 234 |
| 189 | 3300025933 | Ga0207706_10081394 | Ga0207706_100813943 | 234 |
| 190 | 3300025934 | Ga0207686_10150068 | Ga0207686_101500682 | 234 |
| 191 | 3300025936 | Ga0207670_10002994 | Ga0207670_100029945 | 234 |
| 192 | 3300025936 | Ga0207670_10036512 | Ga0207670_100365124 | 234 |
| 193 | 3300025949 | Ga0207667_10005483 | Ga0207667_100054839 | 234 |
| 194 | 3300025960 | Ga0207651_10113471 | Ga0207651_101134712 | 234 |
| 195 | 3300025972 | Ga0207668_10516854 | Ga0207668_105168541 | 234 |
| 196 | 3300026088 | Ga0207641_10481912 | Ga0207641_104819122 | 234 |
| 197 | 3300026089 | Ga0207648_10134622 | Ga0207648_101346222 | 234 |
| 198 | 3300026089 | Ga0207648_10157664 | Ga0207648_101576642 | 234 |
| 199 | 3300026116 | Ga0207674_10049513 | Ga0207674_100495133 | 234 |
| 200 | 3300026118 | Ga0207675_100008841 | Ga0207675_1000088417 | 234 |
| 201 | 3300028380 | Ga0268265_10067990 | Ga0268265_100679902 | 234 |
| 202 | 3300028380 | Ga0268265_10374729 | Ga0268265_103747292 | 234 |
| 203 | 3300028381 | Ga0268264_10754189 | Ga0268264_107541891 | 234 |
| 204 | 3300028577 | Ga0265318_10025807 | Ga0265318_100258073 | 234 |
| 205 | 3300035172 | Ga0373955_0277100 | Ga0373955_0277100_154_891 | 234 |
| 206 | 3300035725 | Ga0373947_0084690 | Ga0373947_0084690_275_1012 | 234 |
| 207 | 3300042876 | Ga0451577_0053495 | Ga0451577_0053495_827_1564 | 234 |
| 208 | 3300044712 | Ga0453684_0005311 | Ga0453684_0005311_21307_22044 | 234 |
| 209 | 3300044712 | Ga0453684_0025337 | Ga0453684_0025337_4614_5351 | 234 |
| 210 | 3300044712 | Ga0453684_0293152 | Ga0453684_0293152_1002_1739 | 234 |
| 211 | 3300045051 | Ga0451576_0526043 | Ga0451576_0526043_274_1011 | 234 |
| 212 | 3300046472 | Ga0495580_0105332 | Ga0495580_0105332_490_1227 | 234 |
| 213 | 3300046476 | Ga0495662_0065385 | Ga0495662_0065385_370_1107 | 234 |
| 214 | 3300046535 | Ga0495586_0149863 | Ga0495586_0149863_235_972 | 234 |
| 215 | 3300046536 | Ga0495587_0191124 | Ga0495587_0191124_111_848 | 234 |
| 216 | 3300046683 | Ga0495658_0036189 | Ga0495658_0036189_1960_2697 | 234 |
| 217 | 3300047321 | Ga0495676_0333307 | Ga0495676_0333307_39_776 | 234 |
| 218 | 3300050508 | nmdc:mga09592_361626_c1 | nmdc:mga09592_361626_c1_482_1231 | 234 |
| 219 | 3300050511 | nmdc:mga08y16_207627_c1 | nmdc:mga08y16_207627_c1_1252_2001 | 234 |
| 220 | 3300053085 | Ga0495619_0418340 | Ga0495619_0418340_105_842 | 234 |
| 221 | 3300005341 | Ga0070691_10052485 | Ga0070691_100524852 | 235 |
| 222 | 3300037418 | Ga0395900_0000128 | Ga0395900_0000128_11513_12379 | 235 |
| 223 | 3300046474 | Ga0495605_0066289 | Ga0495605_0066289_680_1417 | 235 |
| 224 | 3300046513 | Ga0495616_0152338 | Ga0495616_0152338_281_1018 | 235 |
| 225 | 3300046518 | Ga0495631_0120716 | Ga0495631_0120716_65_802 | 235 |
| 226 | 3300049569 | Ga0501032_0001016 | Ga0501032_0001016_9401_10138 | 235 |
| 227 | 3300049572 | Ga0501036_0009704 | Ga0501036_0009704_2908_3645 | 235 |
| 228 | 3300049573 | Ga0501037_0009635 | Ga0501037_0009635_4267_5004 | 235 |
| 229 | 3300049583 | Ga0501067_0000137 | Ga0501067_0000137_7568_8305 | 235 |
| 230 | 3300049584 | Ga0501068_0000436 | Ga0501068_0000436_20083_20820 | 235 |
| 231 | 3300049589 | Ga0501073_0000003 | Ga0501073_0000003_59828_60565 | 235 |
| 232 | 3300049593 | Ga0501077_0000016 | Ga0501077_0000016_39710_40447 | 235 |
| 233 | 3300049742 | Ga0501080_0000777 | Ga0501080_0000777_22338_23075 | 235 |
| 234 | 3300049823 | Ga0501044_0002725 | Ga0501044_0002725_9481_10218 | 235 |
| 235 | 3300053151 | Ga0500604_0009823 | Ga0500604_0009823_583_1320 | 235 |
| 236 | 3300060353 | Ga0501082_0195719 | Ga0501082_0195719_20_757 | 235 |
| 237 | 3300003215 | JGI25153J46596_10005338 | JGI25153J46596_100053381 | 236 |
| 238 | 3300005328 | Ga0070676_10007291 | Ga0070676_100072915 | 236 |
| 239 | 3300005340 | Ga0070689_100021631 | Ga0070689_1000216313 | 236 |
| 240 | 3300005340 | Ga0070689_100187038 | Ga0070689_1001870382 | 236 |
| 241 | 3300005340 | Ga0070689_100310547 | Ga0070689_1003105472 | 236 |
| 242 | 3300005341 | Ga0070691_10333279 | Ga0070691_103332791 | 236 |
| 243 | 3300005353 | Ga0070669_100339713 | Ga0070669_1003397132 | 236 |
| 244 | 3300005354 | Ga0070675_100203670 | Ga0070675_1002036702 | 236 |
| 245 | 3300005365 | Ga0070688_100004472 | Ga0070688_1000044725 | 236 |
| 246 | 3300005365 | Ga0070688_100237137 | Ga0070688_1002371372 | 236 |
| 247 | 3300005438 | Ga0070701_10177097 | Ga0070701_101770972 | 236 |
| 248 | 3300005441 | Ga0070700_100451148 | Ga0070700_1004511482 | 236 |
| 249 | 3300005456 | Ga0070678_100017547 | Ga0070678_1000175472 | 236 |
| 250 | 3300005456 | Ga0070678_100216832 | Ga0070678_1002168322 | 236 |
| 251 | 3300005466 | Ga0070685_10129927 | Ga0070685_101299272 | 236 |
| 252 | 3300005535 | Ga0070684_100266404 | Ga0070684_1002664043 | 236 |
| 253 | 3300005543 | Ga0070672_100195947 | Ga0070672_1001959472 | 236 |
| 254 | 3300005548 | Ga0070665_100378526 | Ga0070665_1003785262 | 236 |
| 255 | 3300005615 | Ga0070702_100429686 | Ga0070702_1004296862 | 236 |
| 256 | 3300005618 | Ga0068864_100041370 | Ga0068864_1000413702 | 236 |
| 257 | 3300005985 | Ga0081539_10005853 | Ga0081539_100058532 | 236 |
| 258 | 3300006048 | Ga0075363_100077948 | Ga0075363_1000779482 | 236 |
| 259 | 3300006051 | Ga0075364_10179402 | Ga0075364_101794022 | 236 |
| 260 | 3300006178 | Ga0075367_10308272 | Ga0075367_103082721 | 236 |
| 261 | 3300006237 | Ga0097621_100397803 | Ga0097621_1003978032 | 236 |
| 262 | 3300006844 | Ga0075428_100181493 | Ga0075428_1001814933 | 236 |
| 263 | 3300006881 | Ga0068865_100211830 | Ga0068865_1002118302 | 236 |
| 264 | 3300009094 | Ga0111539_10019117 | Ga0111539_100191179 | 236 |
| 265 | 3300009094 | Ga0111539_10297775 | Ga0111539_102977752 | 236 |
| 266 | 3300009177 | Ga0105248_10060900 | Ga0105248_100609005 | 236 |
| 267 | 3300009551 | Ga0105238_10295610 | Ga0105238_102956102 | 236 |
| 268 | 3300009551 | Ga0105238_10822266 | Ga0105238_108222661 | 236 |
| 269 | 3300009553 | Ga0105249_10383816 | Ga0105249_103838162 | 236 |
| 270 | 3300013296 | Ga0157374_11057301 | Ga0157374_110573011 | 236 |
| 271 | 3300013297 | Ga0157378_10216303 | Ga0157378_102163032 | 236 |
| 272 | 3300014326 | Ga0157380_10096177 | Ga0157380_100961773 | 236 |
| 273 | 3300014326 | Ga0157380_10154705 | Ga0157380_101547052 | 236 |
| 274 | 3300014968 | Ga0157379_10427938 | Ga0157379_104279382 | 236 |
| 275 | 3300014969 | Ga0157376_10546622 | Ga0157376_105466222 | 236 |
| 276 | 3300025250 | Ga0209026_1010008 | Ga0209026_10100081 | 236 |
| 277 | 3300025254 | Ga0209148_1009797 | Ga0209148_10097972 | 236 |
| 278 | 3300025297 | Ga0209758_1000252 | Ga0209758_100025251 | 236 |
| 279 | 3300025302 | Ga0207426_1026381 | Ga0207426_10263811 | 236 |
| 280 | 3300025899 | Ga0207642_10092372 | Ga0207642_100923722 | 236 |
| 281 | 3300025903 | Ga0207680_10416950 | Ga0207680_104169502 | 236 |
| 282 | 3300025907 | Ga0207645_10009341 | Ga0207645_100093416 | 236 |
| 283 | 3300025912 | Ga0207707_10081952 | Ga0207707_100819523 | 236 |
| 284 | 3300025923 | Ga0207681_10040157 | Ga0207681_100401572 | 236 |
| 285 | 3300025927 | Ga0207687_10182829 | Ga0207687_101828292 | 236 |
| 286 | 3300025936 | Ga0207670_10001178 | Ga0207670_1000117812 | 236 |
| 287 | 3300025936 | Ga0207670_10161876 | Ga0207670_101618763 | 236 |
| 288 | 3300025936 | Ga0207670_10369997 | Ga0207670_103699972 | 236 |
| 289 | 3300025940 | Ga0207691_10079984 | Ga0207691_100799843 | 236 |
| 290 | 3300025941 | Ga0207711_10028623 | Ga0207711_100286233 | 236 |
| 291 | 3300025942 | Ga0207689_10309093 | Ga0207689_103090932 | 236 |
| 292 | 3300025961 | Ga0207712_10248547 | Ga0207712_102485471 | 236 |
| 293 | 3300025972 | Ga0207668_10459451 | Ga0207668_104594511 | 236 |
| 294 | 3300025986 | Ga0207658_10178234 | Ga0207658_101782341 | 236 |
| 295 | 3300026023 | Ga0207677_10436448 | Ga0207677_104364482 | 236 |
| 296 | 3300026023 | Ga0207677_10497113 | Ga0207677_104971131 | 236 |
| 297 | 3300026035 | Ga0207703_10444934 | Ga0207703_104449341 | 236 |
| 298 | 3300026035 | Ga0207703_10495861 | Ga0207703_104958611 | 236 |
| 299 | 3300026067 | Ga0207678_10790741 | Ga0207678_107907411 | 236 |
| 300 | 3300026075 | Ga0207708_10054966 | Ga0207708_100549663 | 236 |
| 301 | 3300026095 | Ga0207676_10385140 | Ga0207676_103851402 | 236 |
| 302 | 3300026118 | Ga0207675_100059146 | Ga0207675_1000591463 | 236 |
| 303 | 3300026121 | Ga0207683_10009099 | Ga0207683_100090999 | 236 |
| 304 | 3300027907 | Ga0207428_10084960 | Ga0207428_100849603 | 236 |
| 305 | 3300028379 | Ga0268266_10331239 | Ga0268266_103312392 | 236 |
| 306 | 3300028381 | Ga0268264_10195286 | Ga0268264_101952862 | 236 |
| 307 | 3300031251 | Ga0265327_10004615 | Ga0265327_100046154 | 236 |
| 308 | 3300031727 | Ga0316576_10107675 | Ga0316576_101076752 | 236 |
| 309 | 3300033180 | Ga0307510_10056928 | Ga0307510_100569283 | 236 |
| 310 | 3300034817 | Ga0373948_0044476 | Ga0373948_0044476_134_868 | 236 |
| 311 | 3300034819 | Ga0373958_0022235 | Ga0373958_0022235_127_861 | 236 |
| 312 | 3300035084 | Ga0373928_0022630 | Ga0373928_0022630_449_1183 | 236 |
| 313 | 3300035084 | Ga0373928_0023704 | Ga0373928_0023704_119_856 | 236 |
| 314 | 3300035088 | Ga0373940_0066669 | Ga0373940_0066669_143_877 | 236 |
| 315 | 3300035089 | Ga0373944_0024197 | Ga0373944_0024197_50_784 | 236 |
| 316 | 3300035090 | Ga0373949_0020589 | Ga0373949_0020589_48_782 | 236 |
| 317 | 3300035091 | Ga0373951_0080872 | Ga0373951_0080872_74_808 | 236 |
| 318 | 3300035112 | Ga0373932_0010736 | Ga0373932_0010736_1069_1803 | 236 |
| 319 | 3300035115 | Ga0373941_0103506 | Ga0373941_0103506_155_889 | 236 |
| 320 | 3300035171 | Ga0373946_0006872 | Ga0373946_0006872_2480_3214 | 236 |
| 321 | 3300035172 | Ga0373955_0171615 | Ga0373955_0171615_319_1053 | 236 |
| 322 | 3300035691 | Ga0373931_0014133 | Ga0373931_0014133_276_1010 | 236 |
| 323 | 3300035692 | Ga0373935_0350407 | Ga0373935_0350407_302_1036 | 236 |
| 324 | 3300035695 | Ga0373927_0245304 | Ga0373927_0245304_34_768 | 236 |
| 325 | 3300035725 | Ga0373947_0090790 | Ga0373947_0090790_13_747 | 236 |
| 326 | 3300036401 | Ga0373937_0173087 | Ga0373937_0173087_586_1320 | 236 |
| 327 | 3300036712 | Ga0316584_0050930 | Ga0316584_0050930_972_1706 | 236 |
| 328 | 3300036712 | Ga0316584_0103663 | Ga0316584_0103663_89_823 | 236 |
| 329 | 3300046462 | Ga0495651_0204340 | Ga0495651_0204340_492_1226 | 236 |
| 330 | 3300046477 | Ga0495664_0275482 | Ga0495664_0275482_246_980 | 236 |
| 331 | 3300046660 | Ga0495625_0370338 | Ga0495625_0370338_66_803 | 236 |
| 332 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_167669_168406 | 236 |
| 333 | 3300047445 | Ga0495677_0046685 | Ga0495677_0046685_89_826 | 236 |
| 334 | 3300048088 | Ga0495602_0087653 | Ga0495602_0087653_285_1019 | 236 |
| 335 | 3300048905 | Ga0496102_0274148 | Ga0496102_0274148_829_1563 | 236 |
| 336 | 3300048908 | Ga0496105_0019423 | Ga0496105_0019423_974_1708 | 236 |
| 337 | 3300048913 | Ga0496110_0030717 | Ga0496110_0030717_3046_3780 | 236 |
| 338 | 3300048913 | Ga0496110_0090979 | Ga0496110_0090979_480_1214 | 236 |
| 339 | 3300048914 | Ga0496111_0076955 | Ga0496111_0076955_1604_2338 | 236 |
| 340 | 3300048915 | Ga0496112_0059344 | Ga0496112_0059344_1027_1761 | 236 |
| 341 | 3300048917 | Ga0496114_0021309 | Ga0496114_0021309_1849_2583 | 236 |
| 342 | 3300048917 | Ga0496114_0383113 | Ga0496114_0383113_99_833 | 236 |
| 343 | 3300049571 | Ga0501034_0009574 | Ga0501034_0009574_2530_3264 | 236 |
| 344 | 3300049583 | Ga0501067_0080972 | Ga0501067_0080972_273_1007 | 236 |
| 345 | 3300049588 | Ga0501072_0013992 | Ga0501072_0013992_3913_4647 | 236 |
| 346 | 3300049590 | Ga0501074_0083490 | Ga0501074_0083490_192_926 | 236 |
| 347 | 3300049742 | Ga0501080_0012166 | Ga0501080_0012166_5524_6258 | 236 |
| 348 | 3300049744 | Ga0501083_0005602 | Ga0501083_0005602_948_1682 | 236 |
| 349 | 3300050490 | nmdc:mga03n38_90280_c1 | nmdc:mga03n38_90280_c1_267_1001 | 236 |
| 350 | 3300050491 | nmdc:mga00v17_41055_c1 | nmdc:mga00v17_41055_c1_1781_2515 | 236 |
| 351 | 3300050493 | nmdc:mga0k408_66682_c1 | nmdc:mga0k408_66682_c1_429_1163 | 236 |
| 352 | 3300050511 | nmdc:mga08y16_170896_c1 | nmdc:mga08y16_170896_c1_776_1510 | 236 |
| 353 | 3300053084 | Ga0495595_0015517 | Ga0495595_0015517_1337_2071 | 236 |
| 354 | 3300053104 | Ga0500556_0099158 | Ga0500556_0099158_68_811 | 236 |
| 355 | 3300053119 | Ga0500595_028795 | Ga0500595_028795_313_1047 | 236 |
| 356 | 3300053125 | Ga0500618_037128 | Ga0500618_037128_297_1040 | 236 |
| 357 | 3300053153 | Ga0500616_0013469 | Ga0500616_0013469_3191_3925 | 236 |
| 358 | 3300054114 | Ga0501084_0021772 | Ga0501084_0021772_500_1234 | 236 |
| 359 | 3300060353 | Ga0501082_0004670 | Ga0501082_0004670_4108_4842 | 236 |
| 360 | 3300003215 | JGI25153J46596_10000054 | JGI25153J46596_10000054131 | 237 |
| 361 | 3300003791 | Ga0055530_10000135 | Ga0055530_1000013543 | 237 |
| 362 | 3300003794 | Ga0055531_10040955 | Ga0055531_100409552 | 237 |
| 363 | 3300003794 | Ga0055531_10042648 | Ga0055531_100426481 | 237 |
| 364 | 3300003911 | JGI25405J52794_10026189 | JGI25405J52794_100261892 | 237 |
| 365 | 3300005262 | Ga0065165_1000563 | Ga0065165_100056322 | 237 |
| 366 | 3300005289 | Ga0065704_10204155 | Ga0065704_102041551 | 237 |
| 367 | 3300005327 | Ga0070658_10008345 | Ga0070658_100083451 | 237 |
| 368 | 3300005330 | Ga0070690_100150919 | Ga0070690_1001509192 | 237 |
| 369 | 3300005331 | Ga0070670_100004475 | Ga0070670_10000447512 | 237 |
| 370 | 3300005335 | Ga0070666_10070550 | Ga0070666_100705502 | 237 |
| 371 | 3300005336 | Ga0070680_100054683 | Ga0070680_1000546834 | 237 |
| 372 | 3300005336 | Ga0070680_100069381 | Ga0070680_1000693812 | 237 |
| 373 | 3300005336 | Ga0070680_100085886 | Ga0070680_1000858863 | 237 |
| 374 | 3300005337 | Ga0070682_100392218 | Ga0070682_1003922181 | 237 |
| 375 | 3300005338 | Ga0068868_100803488 | Ga0068868_1008034881 | 237 |
| 376 | 3300005347 | Ga0070668_100005964 | Ga0070668_1000059645 | 237 |
| 377 | 3300005347 | Ga0070668_100219341 | Ga0070668_1002193411 | 237 |
| 378 | 3300005355 | Ga0070671_100103151 | Ga0070671_1001031513 | 237 |
| 379 | 3300005364 | Ga0070673_100344741 | Ga0070673_1003447412 | 237 |
| 380 | 3300005366 | Ga0070659_100143047 | Ga0070659_1001430472 | 237 |
| 381 | 3300005367 | Ga0070667_100226114 | Ga0070667_1002261142 | 237 |
| 382 | 3300005434 | Ga0070709_10013740 | Ga0070709_100137403 | 237 |
| 383 | 3300005435 | Ga0070714_100000490 | Ga0070714_1000004903 | 237 |
| 384 | 3300005436 | Ga0070713_100000278 | Ga0070713_10000027828 | 237 |
| 385 | 3300005436 | Ga0070713_100092449 | Ga0070713_1000924492 | 237 |
| 386 | 3300005436 | Ga0070713_100461690 | Ga0070713_1004616901 | 237 |
| 387 | 3300005437 | Ga0070710_10003676 | Ga0070710_100036764 | 237 |
| 388 | 3300005439 | Ga0070711_100003976 | Ga0070711_1000039766 | 237 |
| 389 | 3300005456 | Ga0070678_100021018 | Ga0070678_1000210183 | 237 |
| 390 | 3300005458 | Ga0070681_10008082 | Ga0070681_100080822 | 237 |
| 391 | 3300005458 | Ga0070681_10044484 | Ga0070681_100444845 | 237 |
| 392 | 3300005518 | Ga0070699_100187786 | Ga0070699_1001877862 | 237 |
| 393 | 3300005536 | Ga0070697_100283296 | Ga0070697_1002832962 | 237 |
| 394 | 3300005539 | Ga0068853_100005273 | Ga0068853_1000052732 | 237 |
| 395 | 3300005543 | Ga0070672_100153850 | Ga0070672_1001538503 | 237 |
| 396 | 3300005546 | Ga0070696_100069257 | Ga0070696_1000692572 | 237 |
| 397 | 3300005546 | Ga0070696_100469248 | Ga0070696_1004692481 | 237 |
| 398 | 3300005548 | Ga0070665_100047432 | Ga0070665_1000474323 | 237 |
| 399 | 3300005548 | Ga0070665_100318342 | Ga0070665_1003183422 | 237 |
| 400 | 3300005549 | Ga0070704_100370403 | Ga0070704_1003704032 | 237 |
| 401 | 3300005549 | Ga0070704_100446949 | Ga0070704_1004469491 | 237 |
| 402 | 3300005563 | Ga0068855_100079212 | Ga0068855_1000792124 | 237 |
| 403 | 3300005563 | Ga0068855_100101153 | Ga0068855_1001011532 | 237 |
| 404 | 3300005563 | Ga0068855_100276319 | Ga0068855_1002763192 | 237 |
| 405 | 3300005577 | Ga0068857_100106220 | Ga0068857_1001062203 | 237 |
| 406 | 3300005614 | Ga0068856_100246423 | Ga0068856_1002464232 | 237 |
| 407 | 3300005618 | Ga0068864_100000154 | Ga0068864_10000015428 | 237 |
| 408 | 3300005841 | Ga0068863_100000172 | Ga0068863_10000017231 | 237 |
| 409 | 3300005842 | Ga0068858_100000639 | Ga0068858_10000063912 | 237 |
| 410 | 3300005842 | Ga0068858_100166226 | Ga0068858_1001662263 | 237 |
| 411 | 3300005842 | Ga0068858_100595772 | Ga0068858_1005957721 | 237 |
| 412 | 3300005843 | Ga0068860_100000151 | Ga0068860_10000015127 | 237 |
| 413 | 3300005843 | Ga0068860_100008879 | Ga0068860_1000088794 | 237 |
| 414 | 3300005843 | Ga0068860_100754858 | Ga0068860_1007548582 | 237 |
| 415 | 3300005843 | Ga0068860_100902311 | Ga0068860_1009023111 | 237 |
| 416 | 3300005844 | Ga0068862_100014501 | Ga0068862_1000145015 | 237 |
| 417 | 3300005844 | Ga0068862_100263434 | Ga0068862_1002634342 | 237 |
| 418 | 3300005937 | Ga0081455_10000347 | Ga0081455_100003476 | 237 |
| 419 | 3300005937 | Ga0081455_10000477 | Ga0081455_1000047727 | 237 |
| 420 | 3300005937 | Ga0081455_10002412 | Ga0081455_1000241216 | 237 |
| 421 | 3300005937 | Ga0081455_10012372 | Ga0081455_100123726 | 237 |
| 422 | 3300005937 | Ga0081455_10029489 | Ga0081455_100294895 | 237 |
| 423 | 3300005937 | Ga0081455_10046937 | Ga0081455_100469374 | 237 |
| 424 | 3300005937 | Ga0081455_10078322 | Ga0081455_100783223 | 237 |
| 425 | 3300005981 | Ga0081538_10001364 | Ga0081538_100013648 | 237 |
| 426 | 3300005983 | Ga0081540_1000015 | Ga0081540_100001559 | 237 |
| 427 | 3300005983 | Ga0081540_1004841 | Ga0081540_10048417 | 237 |
| 428 | 3300005983 | Ga0081540_1030763 | Ga0081540_10307632 | 237 |
| 429 | 3300006028 | Ga0070717_10000297 | Ga0070717_1000029728 | 237 |
| 430 | 3300006028 | Ga0070717_10124057 | Ga0070717_101240572 | 237 |
| 431 | 3300006028 | Ga0070717_10420344 | Ga0070717_104203442 | 237 |
| 432 | 3300006028 | Ga0070717_10735450 | Ga0070717_107354501 | 237 |
| 433 | 3300006038 | Ga0075365_10030532 | Ga0075365_100305324 | 237 |
| 434 | 3300006038 | Ga0075365_10165338 | Ga0075365_101653382 | 237 |
| 435 | 3300006051 | Ga0075364_10157580 | Ga0075364_101575802 | 237 |
| 436 | 3300006163 | Ga0070715_10005158 | Ga0070715_100051584 | 237 |
| 437 | 3300006175 | Ga0070712_100000896 | Ga0070712_10000089614 | 237 |
| 438 | 3300006175 | Ga0070712_100036096 | Ga0070712_1000360962 | 237 |
| 439 | 3300006178 | Ga0075367_10026095 | Ga0075367_100260953 | 237 |
| 440 | 3300006195 | Ga0075366_10027423 | Ga0075366_100274232 | 237 |
| 441 | 3300006195 | Ga0075366_10220123 | Ga0075366_102201231 | 237 |
| 442 | 3300006353 | Ga0075370_10061817 | Ga0075370_100618173 | 237 |
| 443 | 3300006353 | Ga0075370_10062100 | Ga0075370_100621002 | 237 |
| 444 | 3300006844 | Ga0075428_100000430 | Ga0075428_10000043018 | 237 |
| 445 | 3300006844 | Ga0075428_100214466 | Ga0075428_1002144661 | 237 |
| 446 | 3300006844 | Ga0075428_100382111 | Ga0075428_1003821112 | 237 |
| 447 | 3300006846 | Ga0075430_100128522 | Ga0075430_1001285222 | 237 |
| 448 | 3300006847 | Ga0075431_100000086 | Ga0075431_10000008623 | 237 |
| 449 | 3300006847 | Ga0075431_100019049 | Ga0075431_1000190498 | 237 |
| 450 | 3300006847 | Ga0075431_100123707 | Ga0075431_1001237073 | 237 |
| 451 | 3300006847 | Ga0075431_100360403 | Ga0075431_1003604032 | 237 |
| 452 | 3300006852 | Ga0075433_10029411 | Ga0075433_100294112 | 237 |
| 453 | 3300006852 | Ga0075433_10071279 | Ga0075433_100712792 | 237 |
| 454 | 3300006852 | Ga0075433_10162923 | Ga0075433_101629233 | 237 |
| 455 | 3300006871 | Ga0075434_100018441 | Ga0075434_1000184414 | 237 |
| 456 | 3300006871 | Ga0075434_100288912 | Ga0075434_1002889122 | 237 |
| 457 | 3300006871 | Ga0075434_100788154 | Ga0075434_1007881541 | 237 |
| 458 | 3300006880 | Ga0075429_100082076 | Ga0075429_1000820763 | 237 |
| 459 | 3300006880 | Ga0075429_100326146 | Ga0075429_1003261462 | 237 |
| 460 | 3300007076 | Ga0075435_100032914 | Ga0075435_1000329144 | 237 |
| 461 | 3300007076 | Ga0075435_100213931 | Ga0075435_1002139312 | 237 |
| 462 | 3300007076 | Ga0075435_100634722 | Ga0075435_1006347221 | 237 |
| 463 | 3300007265 | Ga0099794_10000814 | Ga0099794_100008145 | 237 |
| 464 | 3300009093 | Ga0105240_10000094 | Ga0105240_1000009480 | 237 |
| 465 | 3300009093 | Ga0105240_10001341 | Ga0105240_1000134120 | 237 |
| 466 | 3300009093 | Ga0105240_10012709 | Ga0105240_100127097 | 237 |
| 467 | 3300009093 | Ga0105240_10091571 | Ga0105240_100915713 | 237 |
| 468 | 3300009094 | Ga0111539_10001374 | Ga0111539_1000137411 | 237 |
| 469 | 3300009094 | Ga0111539_10054138 | Ga0111539_100541385 | 237 |
| 470 | 3300009094 | Ga0111539_10779185 | Ga0111539_107791851 | 237 |
| 471 | 3300009147 | Ga0114129_10000243 | Ga0114129_1000024347 | 237 |
| 472 | 3300009147 | Ga0114129_10007283 | Ga0114129_1000728315 | 237 |
| 473 | 3300009147 | Ga0114129_10013235 | Ga0114129_100132355 | 237 |
| 474 | 3300009147 | Ga0114129_10035725 | Ga0114129_100357258 | 237 |
| 475 | 3300009147 | Ga0114129_10184579 | Ga0114129_101845793 | 237 |
| 476 | 3300009147 | Ga0114129_10205921 | Ga0114129_102059212 | 237 |
| 477 | 3300009177 | Ga0105248_10024422 | Ga0105248_100244227 | 237 |
| 478 | 3300009545 | Ga0105237_10784813 | Ga0105237_107848132 | 237 |
| 479 | 3300009551 | Ga0105238_10039621 | Ga0105238_100396214 | 237 |
| 480 | 3300009551 | Ga0105238_11027720 | Ga0105238_110277201 | 237 |
| 481 | 3300009553 | Ga0105249_10109094 | Ga0105249_101090942 | 237 |
| 482 | 3300011119 | Ga0105246_10296963 | Ga0105246_102969632 | 237 |
| 483 | 3300013104 | Ga0157370_10011925 | Ga0157370_100119252 | 237 |
| 484 | 3300013105 | Ga0157369_10651347 | Ga0157369_106513472 | 237 |
| 485 | 3300013307 | Ga0157372_10025787 | Ga0157372_100257877 | 237 |
| 486 | 3300014325 | Ga0163163_10019627 | Ga0163163_100196278 | 237 |
| 487 | 3300014325 | Ga0163163_10059375 | Ga0163163_100593752 | 237 |
| 488 | 3300014325 | Ga0163163_10918670 | Ga0163163_109186701 | 237 |
| 489 | 3300014969 | Ga0157376_10257362 | Ga0157376_102573622 | 237 |
| 490 | 3300014969 | Ga0157376_10359570 | Ga0157376_103595702 | 237 |
| 491 | 3300021361 | Ga0213872_10003321 | Ga0213872_1000332110 | 237 |
| 492 | 3300021361 | Ga0213872_10147704 | Ga0213872_101477041 | 237 |
| 493 | 3300021384 | Ga0213876_10000134 | Ga0213876_1000013458 | 237 |
| 494 | 3300021384 | Ga0213876_10004326 | Ga0213876_100043265 | 237 |
| 495 | 3300021384 | Ga0213876_10112654 | Ga0213876_101126542 | 237 |
| 496 | 3300021388 | Ga0213875_10000007 | Ga0213875_10000007338 | 237 |
| 497 | 3300021388 | Ga0213875_10008291 | Ga0213875_100082914 | 237 |
| 498 | 3300021388 | Ga0213875_10086068 | Ga0213875_100860682 | 237 |
| 499 | 3300021441 | Ga0213871_10001032 | Ga0213871_100010324 | 237 |
| 500 | 3300021441 | Ga0213871_10061498 | Ga0213871_100614981 | 237 |
| 501 | 3300025250 | Ga0209026_1001732 | Ga0209026_10017324 | 237 |
| 502 | 3300025297 | Ga0209758_1000119 | Ga0209758_1000119182 | 237 |
| 503 | 3300025297 | Ga0209758_1000682 | Ga0209758_100068238 | 237 |
| 504 | 3300025298 | Ga0209050_1000141 | Ga0209050_1000141142 | 237 |
| 505 | 3300025298 | Ga0209050_1003817 | Ga0209050_10038177 | 237 |
| 506 | 3300025302 | Ga0207426_1050950 | Ga0207426_10509502 | 237 |
| 507 | 3300025302 | Ga0207426_1053149 | Ga0207426_10531492 | 237 |
| 508 | 3300025304 | Ga0209257_1000190 | Ga0209257_100019045 | 237 |
| 509 | 3300025304 | Ga0209257_1000288 | Ga0209257_100028883 | 237 |
| 510 | 3300025304 | Ga0209257_1000562 | Ga0209257_100056244 | 237 |
| 511 | 3300025885 | Ga0207653_10010527 | Ga0207653_100105273 | 237 |
| 512 | 3300025898 | Ga0207692_10001592 | Ga0207692_100015928 | 237 |
| 513 | 3300025905 | Ga0207685_10002629 | Ga0207685_100026294 | 237 |
| 514 | 3300025906 | Ga0207699_10009773 | Ga0207699_100097734 | 237 |
| 515 | 3300025910 | Ga0207684_10022472 | Ga0207684_100224726 | 237 |
| 516 | 3300025912 | Ga0207707_10006763 | Ga0207707_100067632 | 237 |
| 517 | 3300025912 | Ga0207707_10049755 | Ga0207707_100497554 | 237 |
| 518 | 3300025912 | Ga0207707_10760750 | Ga0207707_107607501 | 237 |
| 519 | 3300025913 | Ga0207695_10000419 | Ga0207695_1000041940 | 237 |
| 520 | 3300025913 | Ga0207695_10001861 | Ga0207695_1000186120 | 237 |
| 521 | 3300025913 | Ga0207695_10391725 | Ga0207695_103917252 | 237 |
| 522 | 3300025914 | Ga0207671_10356418 | Ga0207671_103564181 | 237 |
| 523 | 3300025915 | Ga0207693_10005248 | Ga0207693_100052489 | 237 |
| 524 | 3300025915 | Ga0207693_10045878 | Ga0207693_100458783 | 237 |
| 525 | 3300025916 | Ga0207663_10007163 | Ga0207663_100071632 | 237 |
| 526 | 3300025916 | Ga0207663_10471939 | Ga0207663_104719391 | 237 |
| 527 | 3300025917 | Ga0207660_10043058 | Ga0207660_100430584 | 237 |
| 528 | 3300025917 | Ga0207660_10101300 | Ga0207660_101013002 | 237 |
| 529 | 3300025917 | Ga0207660_10185168 | Ga0207660_101851681 | 237 |
| 530 | 3300025919 | Ga0207657_10021183 | Ga0207657_100211837 | 237 |
| 531 | 3300025921 | Ga0207652_10281177 | Ga0207652_102811773 | 237 |
| 532 | 3300025922 | Ga0207646_10438762 | Ga0207646_104387622 | 237 |
| 533 | 3300025923 | Ga0207681_10060574 | Ga0207681_100605742 | 237 |
| 534 | 3300025924 | Ga0207694_10030714 | Ga0207694_100307143 | 237 |
| 535 | 3300025928 | Ga0207700_10000380 | Ga0207700_100003802 | 237 |
| 536 | 3300025928 | Ga0207700_10121010 | Ga0207700_101210102 | 237 |
| 537 | 3300025928 | Ga0207700_10254317 | Ga0207700_102543172 | 237 |
| 538 | 3300025928 | Ga0207700_10679945 | Ga0207700_106799451 | 237 |
| 539 | 3300025929 | Ga0207664_10008858 | Ga0207664_100088587 | 237 |
| 540 | 3300025929 | Ga0207664_10810576 | Ga0207664_108105761 | 237 |
| 541 | 3300025932 | Ga0207690_10379830 | Ga0207690_103798301 | 237 |
| 542 | 3300025939 | Ga0207665_10034393 | Ga0207665_100343934 | 237 |
| 543 | 3300025939 | Ga0207665_10077328 | Ga0207665_100773283 | 237 |
| 544 | 3300025941 | Ga0207711_10021082 | Ga0207711_100210822 | 237 |
| 545 | 3300025942 | Ga0207689_10006787 | Ga0207689_100067878 | 237 |
| 546 | 3300025945 | Ga0207679_10476363 | Ga0207679_104763632 | 237 |
| 547 | 3300025949 | Ga0207667_10146786 | Ga0207667_101467863 | 237 |
| 548 | 3300025949 | Ga0207667_10177908 | Ga0207667_101779082 | 237 |
| 549 | 3300025949 | Ga0207667_10300231 | Ga0207667_103002313 | 237 |
| 550 | 3300025960 | Ga0207651_10004995 | Ga0207651_100049951 | 237 |
| 551 | 3300025960 | Ga0207651_10105642 | Ga0207651_101056423 | 237 |
| 552 | 3300025961 | Ga0207712_10004918 | Ga0207712_100049188 | 237 |
| 553 | 3300025961 | Ga0207712_10172730 | Ga0207712_101727302 | 237 |
| 554 | 3300025972 | Ga0207668_10029854 | Ga0207668_100298542 | 237 |
| 555 | 3300025986 | Ga0207658_10124226 | Ga0207658_101242262 | 237 |
| 556 | 3300026035 | Ga0207703_10000289 | Ga0207703_1000028941 | 237 |
| 557 | 3300026067 | Ga0207678_10464079 | Ga0207678_104640791 | 237 |
| 558 | 3300026078 | Ga0207702_10062359 | Ga0207702_100623594 | 237 |
| 559 | 3300026078 | Ga0207702_10196561 | Ga0207702_101965613 | 237 |
| 560 | 3300026088 | Ga0207641_10000160 | Ga0207641_1000016056 | 237 |
| 561 | 3300026088 | Ga0207641_10200544 | Ga0207641_102005442 | 237 |
| 562 | 3300026088 | Ga0207641_10296121 | Ga0207641_102961213 | 237 |
| 563 | 3300026095 | Ga0207676_10000375 | Ga0207676_1000037516 | 237 |
| 564 | 3300026116 | Ga0207674_10031884 | Ga0207674_100318847 | 237 |
| 565 | 3300026116 | Ga0207674_10121839 | Ga0207674_101218394 | 237 |
| 566 | 3300026116 | Ga0207674_10591405 | Ga0207674_105914051 | 237 |
| 567 | 3300026118 | Ga0207675_100444674 | Ga0207675_1004446742 | 237 |
| 568 | 3300026121 | Ga0207683_10027341 | Ga0207683_100273414 | 237 |
| 569 | 3300027378 | Ga0209981_1000501 | Ga0209981_10005014 | 237 |
| 570 | 3300027907 | Ga0207428_10007141 | Ga0207428_1000714111 | 237 |
| 571 | 3300027907 | Ga0207428_10264931 | Ga0207428_102649312 | 237 |
| 572 | 3300027907 | Ga0207428_10337781 | Ga0207428_103377812 | 237 |
| 573 | 3300028380 | Ga0268265_10006267 | Ga0268265_100062675 | 237 |
| 574 | 3300028380 | Ga0268265_10011714 | Ga0268265_100117142 | 237 |
| 575 | 3300028380 | Ga0268265_10031043 | Ga0268265_100310433 | 237 |
| 576 | 3300028380 | Ga0268265_10224239 | Ga0268265_102242391 | 237 |
| 577 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046353 | 237 |
| 578 | 3300028573 | Ga0265334_10006434 | Ga0265334_100064343 | 237 |
| 579 | 3300028573 | Ga0265334_10068347 | Ga0265334_100683472 | 237 |
| 580 | 3300028786 | Ga0307517_10127623 | Ga0307517_101276232 | 237 |
| 581 | 3300028794 | Ga0307515_10286314 | Ga0307515_102863142 | 237 |
| 582 | 3300028800 | Ga0265338_10020456 | Ga0265338_100204564 | 237 |
| 583 | 3300028800 | Ga0265338_10022862 | Ga0265338_100228623 | 237 |
| 584 | 3300028800 | Ga0265338_10044555 | Ga0265338_100445552 | 237 |
| 585 | 3300028800 | Ga0265338_10143331 | Ga0265338_101433312 | 237 |
| 586 | 3300030521 | Ga0307511_10025571 | Ga0307511_100255713 | 237 |
| 587 | 3300031238 | Ga0265332_10000535 | Ga0265332_1000053516 | 237 |
| 588 | 3300031241 | Ga0265325_10002369 | Ga0265325_100023697 | 237 |
| 589 | 3300031242 | Ga0265329_10033233 | Ga0265329_100332332 | 237 |
| 590 | 3300031247 | Ga0265340_10003508 | Ga0265340_100035084 | 237 |
| 591 | 3300031247 | Ga0265340_10079674 | Ga0265340_100796742 | 237 |
| 592 | 3300031247 | Ga0265340_10167149 | Ga0265340_101671492 | 237 |
| 593 | 3300031249 | Ga0265339_10002291 | Ga0265339_100022915 | 237 |
| 594 | 3300031249 | Ga0265339_10005076 | Ga0265339_100050764 | 237 |
| 595 | 3300031249 | Ga0265339_10005282 | Ga0265339_100052825 | 237 |
| 596 | 3300031250 | Ga0265331_10015628 | Ga0265331_100156281 | 237 |
| 597 | 3300031251 | Ga0265327_10000190 | Ga0265327_1000019034 | 237 |
| 598 | 3300031251 | Ga0265327_10203634 | Ga0265327_102036341 | 237 |
| 599 | 3300031344 | Ga0265316_10013043 | Ga0265316_100130433 | 237 |
| 600 | 3300031456 | Ga0307513_10014691 | Ga0307513_100146918 | 237 |
| 601 | 3300031456 | Ga0307513_10155963 | Ga0307513_101559633 | 237 |
| 602 | 3300031595 | Ga0265313_10000116 | Ga0265313_1000011629 | 237 |
| 603 | 3300031595 | Ga0265313_10000183 | Ga0265313_1000018323 | 237 |
| 604 | 3300031616 | Ga0307508_10060187 | Ga0307508_100601872 | 237 |
| 605 | 3300031711 | Ga0265314_10004504 | Ga0265314_100045045 | 237 |
| 606 | 3300031711 | Ga0265314_10007258 | Ga0265314_100072584 | 237 |
| 607 | 3300031711 | Ga0265314_10024611 | Ga0265314_100246112 | 237 |
| 608 | 3300031711 | Ga0265314_10036586 | Ga0265314_100365864 | 237 |
| 609 | 3300031711 | Ga0265314_10090235 | Ga0265314_100902352 | 237 |
| 610 | 3300031712 | Ga0265342_10000011 | Ga0265342_10000011178 | 237 |
| 611 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004254 | 237 |
| 612 | 3300031730 | Ga0307516_10248986 | Ga0307516_102489862 | 237 |
| 613 | 3300031731 | Ga0307405_10045036 | Ga0307405_100450363 | 237 |
| 614 | 3300031824 | Ga0307413_10137086 | Ga0307413_101370862 | 237 |
| 615 | 3300031824 | Ga0307413_10219368 | Ga0307413_102193681 | 237 |
| 616 | 3300031903 | Ga0307407_10199576 | Ga0307407_101995761 | 237 |
| 617 | 3300031995 | Ga0307409_100229211 | Ga0307409_1002292112 | 237 |
| 618 | 3300032004 | Ga0307414_10091171 | Ga0307414_100911713 | 237 |
| 619 | 3300032004 | Ga0307414_10416830 | Ga0307414_104168302 | 237 |
| 620 | 3300032004 | Ga0307414_10456584 | Ga0307414_104565841 | 237 |
| 621 | 3300032005 | Ga0307411_10131431 | Ga0307411_101314313 | 237 |
| 622 | 3300032005 | Ga0307411_10339649 | Ga0307411_103396492 | 237 |
| 623 | 3300032133 | Ga0316583_10000712 | Ga0316583_100007122 | 237 |
| 624 | 3300032133 | Ga0316583_10046548 | Ga0316583_100465482 | 237 |
| 625 | 3300035111 | Ga0373923_0145113 | Ga0373923_0145113_40_777 | 237 |
| 626 | 3300035116 | Ga0373945_0005510 | Ga0373945_0005510_3236_3973 | 237 |
| 627 | 3300035171 | Ga0373946_0011339 | Ga0373946_0011339_919_1656 | 237 |
| 628 | 3300035691 | Ga0373931_0045000 | Ga0373931_0045000_47_787 | 237 |
| 629 | 3300035691 | Ga0373931_0080049 | Ga0373931_0080049_299_1036 | 237 |
| 630 | 3300035725 | Ga0373947_0044945 | Ga0373947_0044945_1454_2191 | 237 |
| 631 | 3300036401 | Ga0373937_0006315 | Ga0373937_0006315_7260_7997 | 237 |
| 632 | 3300037068 | Ga0373925_0099950 | Ga0373925_0099950_1403_2140 | 237 |
| 633 | 3300037068 | Ga0373925_0105806 | Ga0373925_0105806_1319_2056 | 237 |
| 634 | 3300037068 | Ga0373925_0604110 | Ga0373925_0604110_52_789 | 237 |
| 635 | 3300037312 | Ga0395899_0000070 | Ga0395899_0000070_135143_135880 | 237 |
| 636 | 3300037312 | Ga0395899_0121527 | Ga0395899_0121527_343_1080 | 237 |
| 637 | 3300037418 | Ga0395900_0034389 | Ga0395900_0034389_153_893 | 237 |
| 638 | 3300037418 | Ga0395900_0177445 | Ga0395900_0177445_1170_1907 | 237 |
| 639 | 3300037418 | Ga0395900_0235095 | Ga0395900_0235095_676_1413 | 237 |
| 640 | 3300037466 | Ga0395898_0185201 | Ga0395898_0185201_587_1324 | 237 |
| 641 | 3300037466 | Ga0395898_0675117 | Ga0395898_0675117_132_869 | 237 |
| 642 | 3300037471 | Ga0395905_0038497 | Ga0395905_0038497_230_970 | 237 |
| 643 | 3300037471 | Ga0395905_0417347 | Ga0395905_0417347_193_933 | 237 |
| 644 | 3300037853 | Ga0436364_0013783 | Ga0436364_0013783_13170_13910 | 237 |
| 645 | 3300037853 | Ga0436364_0186560 | Ga0436364_0186560_781_1521 | 237 |
| 646 | 3300037853 | Ga0436364_0955256 | Ga0436364_0955256_5210_5947 | 237 |
| 647 | 3300037853 | Ga0436364_1438211 | Ga0436364_1438211_421_1158 | 237 |
| 648 | 3300038443 | Ga0395901_0001835 | Ga0395901_0001835_15628_16365 | 237 |
| 649 | 3300038443 | Ga0395901_0017625 | Ga0395901_0017625_3118_3855 | 237 |
| 650 | 3300038443 | Ga0395901_0133080 | Ga0395901_0133080_1854_2594 | 237 |
| 651 | 3300039437 | Ga0436365_0029939 | Ga0436365_0029939_139_876 | 237 |
| 652 | 3300039437 | Ga0436365_0316565 | Ga0436365_0316565_358_1095 | 237 |
| 653 | 3300039437 | Ga0436365_0525757 | Ga0436365_0525757_916_1653 | 237 |
| 654 | 3300039437 | Ga0436365_0742782 | Ga0436365_0742782_287_1024 | 237 |
| 655 | 3300039437 | Ga0436365_1136540 | Ga0436365_1136540_28398_29138 | 237 |
| 656 | 3300039437 | Ga0436365_1830840 | Ga0436365_1830840_33768_34508 | 237 |
| 657 | 3300039438 | Ga0436360_0157856 | Ga0436360_0157856_8163_8900 | 237 |
| 658 | 3300039438 | Ga0436360_1273015 | Ga0436360_1273015_271_1008 | 237 |
| 659 | 3300039447 | Ga0436361_0092439 | Ga0436361_0092439_367_1104 | 237 |
| 660 | 3300039447 | Ga0436361_0217171 | Ga0436361_0217171_651_1388 | 237 |
| 661 | 3300039447 | Ga0436361_0235144 | Ga0436361_0235144_1416_2153 | 237 |
| 662 | 3300039447 | Ga0436361_0348195 | Ga0436361_0348195_185_922 | 237 |
| 663 | 3300039447 | Ga0436361_0525734 | Ga0436361_0525734_29087_29827 | 237 |
| 664 | 3300039447 | Ga0436361_0722234 | Ga0436361_0722234_121_858 | 237 |
| 665 | 3300039447 | Ga0436361_0736152 | Ga0436361_0736152_43_780 | 237 |
| 666 | 3300039447 | Ga0436361_0839114 | Ga0436361_0839114_193_930 | 237 |
| 667 | 3300039450 | Ga0436363_0339486 | Ga0436363_0339486_28_768 | 237 |
| 668 | 3300039450 | Ga0436363_0930428 | Ga0436363_0930428_394_1134 | 237 |
| 669 | 3300039450 | Ga0436363_1129020 | Ga0436363_1129020_189_926 | 237 |
| 670 | 3300039450 | Ga0436363_1143576 | Ga0436363_1143576_1704_2441 | 237 |
| 671 | 3300039453 | Ga0436362_0302375 | Ga0436362_0302375_4389_5129 | 237 |
| 672 | 3300039453 | Ga0436362_0694438 | Ga0436362_0694438_664_1401 | 237 |
| 673 | 3300039453 | Ga0436362_0697649 | Ga0436362_0697649_388_1128 | 237 |
| 674 | 3300039453 | Ga0436362_0900943 | Ga0436362_0900943_976_1719 | 237 |
| 675 | 3300039453 | Ga0436362_1201384 | Ga0436362_1201384_220_957 | 237 |
| 676 | 3300041408 | Ga0439453_0017902 | Ga0439453_0017902_361_1098 | 237 |
| 677 | 3300041413 | Ga0439465_0016110 | Ga0439465_0016110_984_1721 | 237 |
| 678 | 3300042004 | Ga0439445_0008563 | Ga0439445_0008563_382_1119 | 237 |
| 679 | 3300042004 | Ga0439445_0016409 | Ga0439445_0016409_225_962 | 237 |
| 680 | 3300042005 | Ga0439448_0096077 | Ga0439448_0096077_28_765 | 237 |
| 681 | 3300044684 | Ga0466966_0013591 | Ga0466966_0013591_2517_3254 | 237 |
| 682 | 3300044684 | Ga0466966_0111882 | Ga0466966_0111882_311_1048 | 237 |
| 683 | 3300044694 | Ga0466963_0095857 | Ga0466963_0095857_182_919 | 237 |
| 684 | 3300044901 | Ga0466960_0173997 | Ga0466960_0173997_210_950 | 237 |
| 685 | 3300045049 | Ga0466959_0002189 | Ga0466959_0002189_3749_4486 | 237 |
| 686 | 3300045049 | Ga0466959_0017658 | Ga0466959_0017658_4052_4789 | 237 |
| 687 | 3300045051 | Ga0451576_0009668 | Ga0451576_0009668_7832_8569 | 237 |
| 688 | 3300046455 | Ga0495603_0129734 | Ga0495603_0129734_507_1244 | 237 |
| 689 | 3300046459 | Ga0495629_0030687 | Ga0495629_0030687_1623_2363 | 237 |
| 690 | 3300046473 | Ga0495582_0032586 | Ga0495582_0032586_208_945 | 237 |
| 691 | 3300046491 | Ga0495584_0006976 | Ga0495584_0006976_2522_3259 | 237 |
| 692 | 3300046491 | Ga0495584_0137124 | Ga0495584_0137124_401_1138 | 237 |
| 693 | 3300046499 | Ga0495594_0089846 | Ga0495594_0089846_749_1486 | 237 |
| 694 | 3300046501 | Ga0495607_0082480 | Ga0495607_0082480_754_1491 | 237 |
| 695 | 3300046506 | Ga0495583_0106877 | Ga0495583_0106877_58_798 | 237 |
| 696 | 3300046507 | Ga0495606_0056869 | Ga0495606_0056869_289_1029 | 237 |
| 697 | 3300046514 | Ga0495618_0083823 | Ga0495618_0083823_306_1043 | 237 |
| 698 | 3300046517 | Ga0495630_0323263 | Ga0495630_0323263_205_942 | 237 |
| 699 | 3300046520 | Ga0495637_0010029 | Ga0495637_0010029_2107_2844 | 237 |
| 700 | 3300046520 | Ga0495637_0124954 | Ga0495637_0124954_161_901 | 237 |
| 701 | 3300046522 | Ga0495643_0036969 | Ga0495643_0036969_566_1306 | 237 |
| 702 | 3300046522 | Ga0495643_0117134 | Ga0495643_0117134_552_1295 | 237 |
| 703 | 3300046526 | Ga0495666_0009590 | Ga0495666_0009590_1457_2194 | 237 |
| 704 | 3300046530 | Ga0495654_0031099 | Ga0495654_0031099_592_1332 | 237 |
| 705 | 3300046531 | Ga0495665_0030883 | Ga0495665_0030883_1169_1906 | 237 |
| 706 | 3300046531 | Ga0495665_0058095 | Ga0495665_0058095_37_774 | 237 |
| 707 | 3300046533 | Ga0495640_0047961 | Ga0495640_0047961_1571_2308 | 237 |
| 708 | 3300046537 | Ga0495598_0000412 | Ga0495598_0000412_4215_4952 | 237 |
| 709 | 3300046538 | Ga0495609_0147653 | Ga0495609_0147653_73_810 | 237 |
| 710 | 3300046539 | Ga0495621_0022276 | Ga0495621_0022276_63_800 | 237 |
| 711 | 3300046542 | Ga0495597_0003340 | Ga0495597_0003340_4488_5228 | 237 |
| 712 | 3300046557 | Ga0495622_0002993 | Ga0495622_0002993_2037_2777 | 237 |
| 713 | 3300046559 | Ga0495667_0085752 | Ga0495667_0085752_979_1716 | 237 |
| 714 | 3300046615 | Ga0495656_0003218 | Ga0495656_0003218_2105_2842 | 237 |
| 715 | 3300046616 | Ga0495668_0033575 | Ga0495668_0033575_849_1589 | 237 |
| 716 | 3300046616 | Ga0495668_0118851 | Ga0495668_0118851_565_1305 | 237 |
| 717 | 3300046642 | Ga0495634_0078900 | Ga0495634_0078900_103_840 | 237 |
| 718 | 3300046664 | Ga0495659_0008319 | Ga0495659_0008319_348_1085 | 237 |
| 719 | 3300046665 | Ga0495661_0180792 | Ga0495661_0180792_206_943 | 237 |
| 720 | 3300046674 | Ga0495588_0045800 | Ga0495588_0045800_954_1691 | 237 |
| 721 | 3300046683 | Ga0495658_0101707 | Ga0495658_0101707_230_967 | 237 |
| 722 | 3300046683 | Ga0495658_0305393 | Ga0495658_0305393_47_784 | 237 |
| 723 | 3300046683 | Ga0495658_0417816 | Ga0495658_0417816_91_828 | 237 |
| 724 | 3300046689 | Ga0495613_0171563 | Ga0495613_0171563_513_1250 | 237 |
| 725 | 3300046689 | Ga0495613_0248288 | Ga0495613_0248288_38_775 | 237 |
| 726 | 3300046690 | Ga0495624_0011870 | Ga0495624_0011870_3912_4649 | 237 |
| 727 | 3300046691 | Ga0495670_0010915 | Ga0495670_0010915_1409_2146 | 237 |
| 728 | 3300046694 | Ga0495649_0060603 | Ga0495649_0060603_788_1525 | 237 |
| 729 | 3300047319 | Ga0495674_0291973 | Ga0495674_0291973_308_1045 | 237 |
| 730 | 3300047319 | Ga0495674_0334792 | Ga0495674_0334792_95_832 | 237 |
| 731 | 3300047320 | Ga0495672_0000739 | Ga0495672_0000739_13735_14472 | 237 |
| 732 | 3300047321 | Ga0495676_0211685 | Ga0495676_0211685_592_1329 | 237 |
| 733 | 3300047471 | Ga0495684_0082641 | Ga0495684_0082641_215_952 | 237 |
| 734 | 3300047673 | Ga0495593_0033310 | Ga0495593_0033310_322_1059 | 237 |
| 735 | 3300047673 | Ga0495593_0072136 | Ga0495593_0072136_721_1461 | 237 |
| 736 | 3300048089 | Ga0495614_0106855 | Ga0495614_0106855_48_785 | 237 |
| 737 | 3300048904 | Ga0496101_0027324 | Ga0496101_0027324_210_950 | 237 |
| 738 | 3300048904 | Ga0496101_0031882 | Ga0496101_0031882_806_1543 | 237 |
| 739 | 3300048904 | Ga0496101_0052513 | Ga0496101_0052513_746_1483 | 237 |
| 740 | 3300048904 | Ga0496101_0633755 | Ga0496101_0633755_81_821 | 237 |
| 741 | 3300048905 | Ga0496102_0055595 | Ga0496102_0055595_677_1417 | 237 |
| 742 | 3300048905 | Ga0496102_0404797 | Ga0496102_0404797_400_1140 | 237 |
| 743 | 3300048906 | Ga0496103_0001539 | Ga0496103_0001539_8668_9405 | 237 |
| 744 | 3300048907 | Ga0496104_0003183 | Ga0496104_0003183_8538_9275 | 237 |
| 745 | 3300048907 | Ga0496104_0006755 | Ga0496104_0006755_3497_4234 | 237 |
| 746 | 3300048907 | Ga0496104_0079346 | Ga0496104_0079346_1535_2272 | 237 |
| 747 | 3300048908 | Ga0496105_0000653 | Ga0496105_0000653_12075_12812 | 237 |
| 748 | 3300048908 | Ga0496105_0003358 | Ga0496105_0003358_152_889 | 237 |
| 749 | 3300048909 | Ga0496106_0004405 | Ga0496106_0004405_5743_6480 | 237 |
| 750 | 3300048909 | Ga0496106_0051764 | Ga0496106_0051764_358_1098 | 237 |
| 751 | 3300048910 | Ga0496107_0021330 | Ga0496107_0021330_1005_1742 | 237 |
| 752 | 3300048911 | Ga0496108_0004848 | Ga0496108_0004848_181_918 | 237 |
| 753 | 3300048912 | Ga0496109_0001027 | Ga0496109_0001027_9743_10480 | 237 |
| 754 | 3300048913 | Ga0496110_0011290 | Ga0496110_0011290_3198_3935 | 237 |
| 755 | 3300048913 | Ga0496110_0018675 | Ga0496110_0018675_2108_2845 | 237 |
| 756 | 3300048914 | Ga0496111_0389404 | Ga0496111_0389404_237_974 | 237 |
| 757 | 3300048915 | Ga0496112_0000804 | Ga0496112_0000804_12893_13630 | 237 |
| 758 | 3300048915 | Ga0496112_0465746 | Ga0496112_0465746_176_913 | 237 |
| 759 | 3300048916 | Ga0496113_0001499 | Ga0496113_0001499_4837_5574 | 237 |
| 760 | 3300048917 | Ga0496114_0030137 | Ga0496114_0030137_3114_3851 | 237 |
| 761 | 3300048917 | Ga0496114_0211420 | Ga0496114_0211420_654_1391 | 237 |
| 762 | 3300048918 | Ga0496115_0004230 | Ga0496115_0004230_642_1379 | 237 |
| 763 | 3300048918 | Ga0496115_0088393 | Ga0496115_0088393_1612_2349 | 237 |
| 764 | 3300048918 | Ga0496115_0263184 | Ga0496115_0263184_17_757 | 237 |
| 765 | 3300048918 | Ga0496115_0407802 | Ga0496115_0407802_269_1009 | 237 |
| 766 | 3300048924 | Ga0496121_0254805 | Ga0496121_0254805_127_864 | 237 |
| 767 | 3300048929 | Ga0496126_0010389 | Ga0496126_0010389_6755_7492 | 237 |
| 768 | 3300048929 | Ga0496126_0278719 | Ga0496126_0278719_450_1190 | 237 |
| 769 | 3300049568 | Ga0501031_0019630 | Ga0501031_0019630_595_1332 | 237 |
| 770 | 3300049568 | Ga0501031_0037957 | Ga0501031_0037957_361_1101 | 237 |
| 771 | 3300049569 | Ga0501032_0006036 | Ga0501032_0006036_6768_7505 | 237 |
| 772 | 3300049569 | Ga0501032_0023092 | Ga0501032_0023092_41_778 | 237 |
| 773 | 3300049569 | Ga0501032_0157399 | Ga0501032_0157399_260_1000 | 237 |
| 774 | 3300049570 | Ga0501033_0005237 | Ga0501033_0005237_5238_5975 | 237 |
| 775 | 3300049570 | Ga0501033_0011204 | Ga0501033_0011204_5466_6206 | 237 |
| 776 | 3300049570 | Ga0501033_0173782 | Ga0501033_0173782_158_895 | 237 |
| 777 | 3300049570 | Ga0501033_0230645 | Ga0501033_0230645_328_1068 | 237 |
| 778 | 3300049571 | Ga0501034_0000244 | Ga0501034_0000244_48596_49333 | 237 |
| 779 | 3300049571 | Ga0501034_0000623 | Ga0501034_0000623_54540_55280 | 237 |
| 780 | 3300049571 | Ga0501034_0006211 | Ga0501034_0006211_248_985 | 237 |
| 781 | 3300049571 | Ga0501034_0015930 | Ga0501034_0015930_369_1106 | 237 |
| 782 | 3300049571 | Ga0501034_0029889 | Ga0501034_0029889_4736_5473 | 237 |
| 783 | 3300049571 | Ga0501034_0030592 | Ga0501034_0030592_1452_2189 | 237 |
| 784 | 3300049571 | Ga0501034_0049229 | Ga0501034_0049229_1746_2483 | 237 |
| 785 | 3300049571 | Ga0501034_0058001 | Ga0501034_0058001_1843_2580 | 237 |
| 786 | 3300049571 | Ga0501034_0085320 | Ga0501034_0085320_663_1400 | 237 |
| 787 | 3300049571 | Ga0501034_0091153 | Ga0501034_0091153_1656_2399 | 237 |
| 788 | 3300049571 | Ga0501034_0136565 | Ga0501034_0136565_1169_1909 | 237 |
| 789 | 3300049571 | Ga0501034_0161820 | Ga0501034_0161820_65_802 | 237 |
| 790 | 3300049571 | Ga0501034_0266304 | Ga0501034_0266304_588_1328 | 237 |
| 791 | 3300049571 | Ga0501034_0455552 | Ga0501034_0455552_378_1115 | 237 |
| 792 | 3300049571 | Ga0501034_0483485 | Ga0501034_0483485_382_1122 | 237 |
| 793 | 3300049571 | Ga0501034_0494303 | Ga0501034_0494303_44_781 | 237 |
| 794 | 3300049571 | Ga0501034_0682207 | Ga0501034_0682207_170_907 | 237 |
| 795 | 3300049571 | Ga0501034_0689621 | Ga0501034_0689621_44_781 | 237 |
| 796 | 3300049572 | Ga0501036_0000402 | Ga0501036_0000402_16832_17572 | 237 |
| 797 | 3300049572 | Ga0501036_0131876 | Ga0501036_0131876_166_903 | 237 |
| 798 | 3300049572 | Ga0501036_0184419 | Ga0501036_0184419_201_938 | 237 |
| 799 | 3300049572 | Ga0501036_0242745 | Ga0501036_0242745_227_964 | 237 |
| 800 | 3300049572 | Ga0501036_0263206 | Ga0501036_0263206_328_1068 | 237 |
| 801 | 3300049572 | Ga0501036_0299640 | Ga0501036_0299640_539_1276 | 237 |
| 802 | 3300049572 | Ga0501036_0348569 | Ga0501036_0348569_451_1188 | 237 |
| 803 | 3300049573 | Ga0501037_0008825 | Ga0501037_0008825_40_777 | 237 |
| 804 | 3300049573 | Ga0501037_0014018 | Ga0501037_0014018_3789_4526 | 237 |
| 805 | 3300049573 | Ga0501037_0072271 | Ga0501037_0072271_368_1105 | 237 |
| 806 | 3300049573 | Ga0501037_0115814 | Ga0501037_0115814_21_761 | 237 |
| 807 | 3300049573 | Ga0501037_0169540 | Ga0501037_0169540_104_844 | 237 |
| 808 | 3300049573 | Ga0501037_0374783 | Ga0501037_0374783_223_960 | 237 |
| 809 | 3300049574 | Ga0501038_0004074 | Ga0501038_0004074_4700_5437 | 237 |
| 810 | 3300049574 | Ga0501038_0012791 | Ga0501038_0012791_3801_4538 | 237 |
| 811 | 3300049574 | Ga0501038_0021786 | Ga0501038_0021786_4697_5434 | 237 |
| 812 | 3300049574 | Ga0501038_0035364 | Ga0501038_0035364_2323_3060 | 237 |
| 813 | 3300049574 | Ga0501038_0100969 | Ga0501038_0100969_247_984 | 237 |
| 814 | 3300049574 | Ga0501038_0151329 | Ga0501038_0151329_284_1021 | 237 |
| 815 | 3300049574 | Ga0501038_0481171 | Ga0501038_0481171_58_795 | 237 |
| 816 | 3300049575 | Ga0501039_0107608 | Ga0501039_0107608_227_964 | 237 |
| 817 | 3300049575 | Ga0501039_0306851 | Ga0501039_0306851_227_964 | 237 |
| 818 | 3300049575 | Ga0501039_0320305 | Ga0501039_0320305_419_1159 | 237 |
| 819 | 3300049576 | Ga0501040_0004593 | Ga0501040_0004593_4141_4878 | 237 |
| 820 | 3300049578 | Ga0501042_0022449 | Ga0501042_0022449_790_1527 | 237 |
| 821 | 3300049578 | Ga0501042_0185854 | Ga0501042_0185854_483_1220 | 237 |
| 822 | 3300049578 | Ga0501042_0198660 | Ga0501042_0198660_326_1066 | 237 |
| 823 | 3300049579 | Ga0501043_0001890 | Ga0501043_0001890_866_1606 | 237 |
| 824 | 3300049579 | Ga0501043_0032700 | Ga0501043_0032700_479_1216 | 237 |
| 825 | 3300049579 | Ga0501043_0076674 | Ga0501043_0076674_1873_2610 | 237 |
| 826 | 3300049579 | Ga0501043_0365493 | Ga0501043_0365493_277_1014 | 237 |
| 827 | 3300049580 | Ga0501046_0035676 | Ga0501046_0035676_1707_2447 | 237 |
| 828 | 3300049580 | Ga0501046_0081176 | Ga0501046_0081176_1221_1958 | 237 |
| 829 | 3300049580 | Ga0501046_0170270 | Ga0501046_0170270_810_1547 | 237 |
| 830 | 3300049580 | Ga0501046_0256573 | Ga0501046_0256573_283_1020 | 237 |
| 831 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_341707_342447 | 237 |
| 832 | 3300049581 | Ga0501047_0006124 | Ga0501047_0006124_6767_7504 | 237 |
| 833 | 3300049581 | Ga0501047_0008824 | Ga0501047_0008824_2644_3381 | 237 |
| 834 | 3300049581 | Ga0501047_0009108 | Ga0501047_0009108_312_1052 | 237 |
| 835 | 3300049581 | Ga0501047_0019030 | Ga0501047_0019030_3139_3876 | 237 |
| 836 | 3300049581 | Ga0501047_0020190 | Ga0501047_0020190_40_777 | 237 |
| 837 | 3300049581 | Ga0501047_0048484 | Ga0501047_0048484_2013_2753 | 237 |
| 838 | 3300049581 | Ga0501047_0121098 | Ga0501047_0121098_381_1118 | 237 |
| 839 | 3300049581 | Ga0501047_0288600 | Ga0501047_0288600_456_1193 | 237 |
| 840 | 3300049581 | Ga0501047_0636817 | Ga0501047_0636817_93_830 | 237 |
| 841 | 3300049582 | Ga0501048_0001467 | Ga0501048_0001467_9225_9965 | 237 |
| 842 | 3300049582 | Ga0501048_0006405 | Ga0501048_0006405_3890_4627 | 237 |
| 843 | 3300049582 | Ga0501048_0031281 | Ga0501048_0031281_2562_3299 | 237 |
| 844 | 3300049583 | Ga0501067_0000637 | Ga0501067_0000637_23_760 | 237 |
| 845 | 3300049583 | Ga0501067_0007532 | Ga0501067_0007532_3618_4355 | 237 |
| 846 | 3300049583 | Ga0501067_0071752 | Ga0501067_0071752_1147_1887 | 237 |
| 847 | 3300049583 | Ga0501067_0095780 | Ga0501067_0095780_896_1633 | 237 |
| 848 | 3300049583 | Ga0501067_0187574 | Ga0501067_0187574_35_775 | 237 |
| 849 | 3300049584 | Ga0501068_0001773 | Ga0501068_0001773_7241_7978 | 237 |
| 850 | 3300049584 | Ga0501068_0004997 | Ga0501068_0004997_1754_2491 | 237 |
| 851 | 3300049584 | Ga0501068_0008618 | Ga0501068_0008618_1678_2415 | 237 |
| 852 | 3300049584 | Ga0501068_0190503 | Ga0501068_0190503_98_835 | 237 |
| 853 | 3300049584 | Ga0501068_0245350 | Ga0501068_0245350_150_887 | 237 |
| 854 | 3300049586 | Ga0501070_0083324 | Ga0501070_0083324_1159_1896 | 237 |
| 855 | 3300049586 | Ga0501070_0126211 | Ga0501070_0126211_464_1201 | 237 |
| 856 | 3300049586 | Ga0501070_0213504 | Ga0501070_0213504_586_1323 | 237 |
| 857 | 3300049586 | Ga0501070_0287230 | Ga0501070_0287230_161_898 | 237 |
| 858 | 3300049586 | Ga0501070_0326225 | Ga0501070_0326225_378_1115 | 237 |
| 859 | 3300049587 | Ga0501071_0050273 | Ga0501071_0050273_397_1134 | 237 |
| 860 | 3300049587 | Ga0501071_0142607 | Ga0501071_0142607_907_1647 | 237 |
| 861 | 3300049588 | Ga0501072_0042845 | Ga0501072_0042845_217_957 | 237 |
| 862 | 3300049588 | Ga0501072_0116565 | Ga0501072_0116565_47_784 | 237 |
| 863 | 3300049588 | Ga0501072_0371741 | Ga0501072_0371741_271_1008 | 237 |
| 864 | 3300049589 | Ga0501073_0000284 | Ga0501073_0000284_1594_2331 | 237 |
| 865 | 3300049589 | Ga0501073_0003399 | Ga0501073_0003399_6261_6998 | 237 |
| 866 | 3300049589 | Ga0501073_0019022 | Ga0501073_0019022_3652_4392 | 237 |
| 867 | 3300049589 | Ga0501073_0047757 | Ga0501073_0047757_1954_2691 | 237 |
| 868 | 3300049589 | Ga0501073_0098835 | Ga0501073_0098835_597_1334 | 237 |
| 869 | 3300049590 | Ga0501074_0015059 | Ga0501074_0015059_4378_5115 | 237 |
| 870 | 3300049590 | Ga0501074_0264219 | Ga0501074_0264219_61_801 | 237 |
| 871 | 3300049590 | Ga0501074_0383166 | Ga0501074_0383166_128_868 | 237 |
| 872 | 3300049591 | Ga0501075_0080363 | Ga0501075_0080363_1676_2413 | 237 |
| 873 | 3300049592 | Ga0501076_0123319 | Ga0501076_0123319_709_1446 | 237 |
| 874 | 3300049592 | Ga0501076_0132604 | Ga0501076_0132604_914_1654 | 237 |
| 875 | 3300049593 | Ga0501077_0046830 | Ga0501077_0046830_800_1537 | 237 |
| 876 | 3300049593 | Ga0501077_0444866 | Ga0501077_0444866_42_779 | 237 |
| 877 | 3300049741 | Ga0501079_0007367 | Ga0501079_0007367_1517_2254 | 237 |
| 878 | 3300049742 | Ga0501080_0000148 | Ga0501080_0000148_9105_9845 | 237 |
| 879 | 3300049742 | Ga0501080_0000954 | Ga0501080_0000954_13107_13844 | 237 |
| 880 | 3300049742 | Ga0501080_0036219 | Ga0501080_0036219_621_1361 | 237 |
| 881 | 3300049742 | Ga0501080_0402339 | Ga0501080_0402339_465_1202 | 237 |
| 882 | 3300049742 | Ga0501080_0405291 | Ga0501080_0405291_305_1042 | 237 |
| 883 | 3300049743 | Ga0501081_0039906 | Ga0501081_0039906_1634_2371 | 237 |
| 884 | 3300049744 | Ga0501083_0001616 | Ga0501083_0001616_7165_7905 | 237 |
| 885 | 3300049744 | Ga0501083_0006643 | Ga0501083_0006643_2972_3709 | 237 |
| 886 | 3300049744 | Ga0501083_0021194 | Ga0501083_0021194_710_1447 | 237 |
| 887 | 3300049744 | Ga0501083_0221209 | Ga0501083_0221209_332_1069 | 237 |
| 888 | 3300049744 | Ga0501083_0270455 | Ga0501083_0270455_240_980 | 237 |
| 889 | 3300049822 | Ga0501035_0000715 | Ga0501035_0000715_21938_22675 | 237 |
| 890 | 3300049822 | Ga0501035_0053381 | Ga0501035_0053381_50_823 | 237 |
| 891 | 3300049822 | Ga0501035_0054708 | Ga0501035_0054708_2365_3102 | 237 |
| 892 | 3300049822 | Ga0501035_0150690 | Ga0501035_0150690_675_1412 | 237 |
| 893 | 3300049822 | Ga0501035_0238619 | Ga0501035_0238619_529_1269 | 237 |
| 894 | 3300049822 | Ga0501035_0337393 | Ga0501035_0337393_456_1196 | 237 |
| 895 | 3300049822 | Ga0501035_0396108 | Ga0501035_0396108_291_1028 | 237 |
| 896 | 3300049823 | Ga0501044_0001007 | Ga0501044_0001007_8304_9044 | 237 |
| 897 | 3300049823 | Ga0501044_0003468 | Ga0501044_0003468_15197_15934 | 237 |
| 898 | 3300049823 | Ga0501044_0045787 | Ga0501044_0045787_1088_1825 | 237 |
| 899 | 3300049823 | Ga0501044_0105507 | Ga0501044_0105507_1547_2284 | 237 |
| 900 | 3300049823 | Ga0501044_0173805 | Ga0501044_0173805_856_1593 | 237 |
| 901 | 3300049823 | Ga0501044_0187458 | Ga0501044_0187458_310_1047 | 237 |
| 902 | 3300049823 | Ga0501044_0269283 | Ga0501044_0269283_562_1299 | 237 |
| 903 | 3300049823 | Ga0501044_0279781 | Ga0501044_0279781_405_1142 | 237 |
| 904 | 3300049823 | Ga0501044_0360262 | Ga0501044_0360262_135_872 | 237 |
| 905 | 3300049823 | Ga0501044_0399893 | Ga0501044_0399893_270_1028 | 237 |
| 906 | 3300049823 | Ga0501044_0573076 | Ga0501044_0573076_21_758 | 237 |
| 907 | 3300049823 | Ga0501044_0788866 | Ga0501044_0788866_10_750 | 237 |
| 908 | 3300049824 | Ga0501045_0002871 | Ga0501045_0002871_2066_2803 | 237 |
| 909 | 3300049824 | Ga0501045_0160963 | Ga0501045_0160963_399_1136 | 237 |
| 910 | 3300050489 | nmdc:mga03683_22577_c1 | nmdc:mga03683_22577_c1_1126_1863 | 237 |
| 911 | 3300050491 | nmdc:mga00v17_188552_c1 | nmdc:mga00v17_188552_c1_543_1280 | 237 |
| 912 | 3300050492 | nmdc:mga0yw44_275362_c1 | nmdc:mga0yw44_275362_c1_218_955 | 237 |
| 913 | 3300050493 | nmdc:mga0k408_11597_c2 | nmdc:mga0k408_11597_c2_1918_2655 | 237 |
| 914 | 3300050494 | nmdc:mga06z11_255298_c1 | nmdc:mga06z11_255298_c1_118_855 | 237 |
| 915 | 3300050494 | nmdc:mga06z11_56709_c1 | nmdc:mga06z11_56709_c1_1136_1873 | 237 |
| 916 | 3300050496 | nmdc:mga07m45_29751_c1 | nmdc:mga07m45_29751_c1_311_1048 | 237 |
| 917 | 3300050507 | nmdc:mga05p37_1364_c1 | nmdc:mga05p37_1364_c1_21639_22376 | 237 |
| 918 | 3300050507 | nmdc:mga05p37_1370_c1 | nmdc:mga05p37_1370_c1_15314_16051 | 237 |
| 919 | 3300050507 | nmdc:mga05p37_415904_c1 | nmdc:mga05p37_415904_c1_76_813 | 237 |
| 920 | 3300050507 | nmdc:mga05p37_43817_c1 | nmdc:mga05p37_43817_c1_219_956 | 237 |
| 921 | 3300050507 | nmdc:mga05p37_59746_c1 | nmdc:mga05p37_59746_c1_2619_3356 | 237 |
| 922 | 3300050507 | nmdc:mga05p37_726882_c1 | nmdc:mga05p37_726882_c1_88_828 | 237 |
| 923 | 3300050508 | nmdc:mga09592_17705_c1 | nmdc:mga09592_17705_c1_2061_2798 | 237 |
| 924 | 3300050508 | nmdc:mga09592_17818_c1 | nmdc:mga09592_17818_c1_145_882 | 237 |
| 925 | 3300050509 | nmdc:mga0qj67_123792_c1 | nmdc:mga0qj67_123792_c1_740_1477 | 237 |
| 926 | 3300050509 | nmdc:mga0qj67_54837_c1 | nmdc:mga0qj67_54837_c1_500_1237 | 237 |
| 927 | 3300050510 | nmdc:mga06r32_151_c1 | nmdc:mga06r32_151_c1_30435_31172 | 237 |
| 928 | 3300050510 | nmdc:mga06r32_23835_c1 | nmdc:mga06r32_23835_c1_236_973 | 237 |
| 929 | 3300050510 | nmdc:mga06r32_50711_c1 | nmdc:mga06r32_50711_c1_1420_2157 | 237 |
| 930 | 3300050511 | nmdc:mga08y16_194666_c1 | nmdc:mga08y16_194666_c1_387_1124 | 237 |
| 931 | 3300050511 | nmdc:mga08y16_86_c1 | nmdc:mga08y16_86_c1_55737_56474 | 237 |
| 932 | 3300050512 | nmdc:mga0n895_127360_c1 | nmdc:mga0n895_127360_c1_203_943 | 237 |
| 933 | 3300050512 | nmdc:mga0n895_160300_c1 | nmdc:mga0n895_160300_c1_927_1664 | 237 |
| 934 | 3300050512 | nmdc:mga0n895_98008_c1 | nmdc:mga0n895_98008_c1_50_787 | 237 |
| 935 | 3300050513 | nmdc:mga0rr50_147851_c1 | nmdc:mga0rr50_147851_c1_147_884 | 237 |
| 936 | 3300050513 | nmdc:mga0rr50_56681_c1 | nmdc:mga0rr50_56681_c1_2176_2916 | 237 |
| 937 | 3300050513 | nmdc:mga0rr50_605984_c1 | nmdc:mga0rr50_605984_c1_113_883 | 237 |
| 938 | 3300050514 | nmdc:mga08x19_4_c2 | nmdc:mga08x19_4_c2_120725_121462 | 237 |
| 939 | 3300050515 | nmdc:mga0a205_101195_c1 | nmdc:mga0a205_101195_c1_1762_2499 | 237 |
| 940 | 3300050515 | nmdc:mga0a205_36209_c1 | nmdc:mga0a205_36209_c1_3348_4088 | 237 |
| 941 | 3300050515 | nmdc:mga0a205_48308_c1 | nmdc:mga0a205_48308_c1_1482_2219 | 237 |
| 942 | 3300050515 | nmdc:mga0a205_597394_c1 | nmdc:mga0a205_597394_c1_25_762 | 237 |
| 943 | 3300050516 | nmdc:mga0sz30_469_c1 | nmdc:mga0sz30_469_c1_646_1383 | 237 |
| 944 | 3300053078 | Ga0495612_0060917 | Ga0495612_0060917_302_1042 | 237 |
| 945 | 3300053080 | Ga0500635_0000080 | Ga0500635_0000080_16130_16870 | 237 |
| 946 | 3300053085 | Ga0495619_0019642 | Ga0495619_0019642_1338_2075 | 237 |
| 947 | 3300053085 | Ga0495619_0089895 | Ga0495619_0089895_189_926 | 237 |
| 948 | 3300053085 | Ga0495619_0103208 | Ga0495619_0103208_504_1241 | 237 |
| 949 | 3300053085 | Ga0495619_0321850 | Ga0495619_0321850_104_898 | 237 |
| 950 | 3300053086 | Ga0500578_0119769 | Ga0500578_0119769_462_1199 | 237 |
| 951 | 3300053086 | Ga0500578_0154959 | Ga0500578_0154959_181_921 | 237 |
| 952 | 3300053087 | Ga0500643_002563 | Ga0500643_002563_5051_5788 | 237 |
| 953 | 3300053087 | Ga0500643_009378 | Ga0500643_009378_2957_3694 | 237 |
| 954 | 3300053087 | Ga0500643_043611 | Ga0500643_043611_312_1049 | 237 |
| 955 | 3300053090 | Ga0500646_0011647 | Ga0500646_0011647_240_977 | 237 |
| 956 | 3300053091 | Ga0500647_0099551 | Ga0500647_0099551_205_945 | 237 |
| 957 | 3300053092 | Ga0500583_0050564 | Ga0500583_0050564_896_1636 | 237 |
| 958 | 3300053093 | Ga0500651_0041785 | Ga0500651_0041785_1112_1849 | 237 |
| 959 | 3300053093 | Ga0500651_0072450 | Ga0500651_0072450_131_868 | 237 |
| 960 | 3300053094 | Ga0500566_0008660 | Ga0500566_0008660_4365_5102 | 237 |
| 961 | 3300053094 | Ga0500566_0128903 | Ga0500566_0128903_116_856 | 237 |
| 962 | 3300053096 | Ga0500641_0000281 | Ga0500641_0000281_17663_18400 | 237 |
| 963 | 3300053096 | Ga0500641_0002911 | Ga0500641_0002911_4677_5417 | 237 |
| 964 | 3300053096 | Ga0500641_0042425 | Ga0500641_0042425_336_1073 | 237 |
| 965 | 3300053099 | Ga0500654_072357 | Ga0500654_072357_481_1218 | 237 |
| 966 | 3300053104 | Ga0500556_0061718 | Ga0500556_0061718_209_946 | 237 |
| 967 | 3300053108 | Ga0500562_083394 | Ga0500562_083394_68_805 | 237 |
| 968 | 3300053109 | Ga0500569_000298 | Ga0500569_000298_1178_1918 | 237 |
| 969 | 3300053119 | Ga0500595_002391 | Ga0500595_002391_4188_4925 | 237 |
| 970 | 3300053121 | Ga0500607_132198 | Ga0500607_132198_414_1154 | 237 |
| 971 | 3300053122 | Ga0500608_001366 | Ga0500608_001366_4967_5707 | 237 |
| 972 | 3300053123 | Ga0500614_007297 | Ga0500614_007297_370_1110 | 237 |
| 973 | 3300053129 | Ga0500628_044927 | Ga0500628_044927_29_766 | 237 |
| 974 | 3300053130 | Ga0500642_0171449 | Ga0500642_0171449_145_882 | 237 |
| 975 | 3300053133 | Ga0500655_031147 | Ga0500655_031147_269_1006 | 237 |
| 976 | 3300053134 | Ga0500658_0008025 | Ga0500658_0008025_1588_2325 | 237 |
| 977 | 3300053134 | Ga0500658_0018884 | Ga0500658_0018884_733_1470 | 237 |
| 978 | 3300053136 | Ga0500559_0152059 | Ga0500559_0152059_242_982 | 237 |
| 979 | 3300053140 | Ga0500573_0185731 | Ga0500573_0185731_324_1064 | 237 |
| 980 | 3300053148 | Ga0500590_008183 | Ga0500590_008183_446_1186 | 237 |
| 981 | 3300053150 | Ga0500603_046359 | Ga0500603_046359_189_929 | 237 |
| 982 | 3300053151 | Ga0500604_0003297 | Ga0500604_0003297_208_945 | 237 |
| 983 | 3300053151 | Ga0500604_0148306 | Ga0500604_0148306_26_763 | 237 |
| 984 | 3300053153 | Ga0500616_0034243 | Ga0500616_0034243_1646_2383 | 237 |
| 985 | 3300053157 | Ga0500624_001445 | Ga0500624_001445_2180_2920 | 237 |
| 986 | 3300053161 | Ga0500634_0000087 | Ga0500634_0000087_16204_16941 | 237 |
| 987 | 3300053162 | Ga0500638_058152 | Ga0500638_058152_198_938 | 237 |
| 988 | 3300053163 | Ga0500639_114379 | Ga0500639_114379_335_1075 | 237 |
| 989 | 3300053177 | Ga0500636_0002254 | Ga0500636_0002254_8801_9541 | 237 |
| 990 | 3300053178 | Ga0500637_0022327 | Ga0500637_0022327_35_775 | 237 |
| 991 | 3300053178 | Ga0500637_0183722 | Ga0500637_0183722_423_1163 | 237 |
| 992 | 3300053725 | Ga0500576_019706 | Ga0500576_019706_2081_2821 | 237 |
| 993 | 3300053729 | Ga0500625_047661 | Ga0500625_047661_1187_1930 | 237 |
| 994 | 3300053731 | Ga0500609_000390 | Ga0500609_000390_3747_4484 | 237 |
| 995 | 3300053735 | Ga0500596_000190 | Ga0500596_000190_2058_2798 | 237 |
| 996 | 3300054114 | Ga0501084_0007012 | Ga0501084_0007012_7117_7854 | 237 |
| 997 | 3300054114 | Ga0501084_0048484 | Ga0501084_0048484_1250_1987 | 237 |
| 998 | 3300054114 | Ga0501084_0075497 | Ga0501084_0075497_1512_2252 | 237 |
| 999 | 3300054114 | Ga0501084_0094788 | Ga0501084_0094788_1702_2442 | 237 |
| 1000 | 3300054114 | Ga0501084_0707123 | Ga0501084_0707123_40_777 | 237 |
| 1001 | 3300059492 | Ga0587073_0031457 | Ga0587073_0031457_301_1038 | 237 |
| 1002 | 3300060353 | Ga0501082_0006711 | Ga0501082_0006711_7073_7810 | 237 |
| 1003 | 3300060353 | Ga0501082_0492114 | Ga0501082_0492114_289_1026 | 237 |
| 1004 | 3300060353 | Ga0501082_0496140 | Ga0501082_0496140_166_903 | 237 |
| 1005 | 3300061734 | Ga0530510_0145921 | Ga0530510_0145921_60_797 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9744 | 1 | 235 |
| 3grp-assembly1.cif.gz_C | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9721 | 1 | 235 |
| 4wjz-assembly1.cif.gz_A | crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(g141a) from vibrio cholerae | 0.9664 | 3 | 235 |
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9653 | 1 | 235 |
| 1i01-assembly2.cif.gz_G | crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli. | 0.9651 | 3 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9721 | 1 | 235 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9632 | 1 | 235 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 79 | 236 | 3.40.50.720 |
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9536 | 4 | 234 | 3.40.50.720 |
| 4lvuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9535 | 3 | 235 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2JN18-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9953 | 1 | 134 |
|
| AF-A0A348W864-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.983 | 1 | 169 |
GO:0016491
|
| AF-A0A7C4A247-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9786 | 1 | 210 |
GO:0016491
|
| AF-A0A849GKC7-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.978 | 1 | 161 |
GO:0016491
|
| AF-A0A7Y2JN18-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9735 | 1 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar