F487982

General Info

Members Datasets Scaffolds Average Seq Length
1005 457 981 243

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10165338|Ga0075365_101653382
Length 288
Sequence MLAIAGPITSVRYDSPDKGGTHNQTAISVLAQRQTSLNEGTRLMFDLTGKTALVTGATGGIGNAIARALHHQGATVAISGTRREVLDQFAGELNERVHVLPCNLAEKDEVEALVPKSEEAMGQLDILVANAGITKDNLLVQLRDEDWDQVVAVNLTATFRLARAALRGMMRRRFGRIIGIASVVGVTGNPGQGNYTATKAGMIGMIKSIAGEYAKRGVTANSIAPGFIATAMTDKLNDKQRDAILARVPAGRLGAGADVAAATVFLASDEAGYVTGQTLHVNGGMAMI

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2643221580 Devosia sp. Root635 Isolate Unclassified
5 2643221591 Devosia sp. Root685 Isolate Unclassified
6 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
7 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
8 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
9 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
10 2643221674 Devosia sp. Root436 Isolate Unclassified
11 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
12 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
13 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
14 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
15 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
16 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
17 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
18 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
19 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
20 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
21 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
22 2932401849 Devosia sp. 2618 Isolate Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
233 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
234 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
275 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
276 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
277 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
330 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
331 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
332 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
378 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
413 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
418 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
419 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
420 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
421 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
424 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
425 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
426 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
427 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
428 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
429 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
430 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
431 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
432 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
433 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
434 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
437 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
438 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
439 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
440 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
441 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
442 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
443 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
444 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
445 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
446 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
447 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
448 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
449 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
450 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
451 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
455 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
456 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
457 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.1
Isolates 2.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0.1
Rhizoplane 3.68
Rhizosphere 80.7
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000054 3300003215 Bacteria 136806
2 JGI25153J46596_10005338 3300003215 Bacteria 6754
3 rootH1_10164059 3300003316 Bacteria 1658
4 rootH2_10052210 3300003320 Bacteria 35441
5 rootL2_10218209 3300003322 Unclassified 2979
6 rootH1_10219969 3300003323 Bacteria 1300
7 Ga0055530_10000135 3300003791 Bacteria 65036
8 Ga0055531_10040955 3300003794 Bacteria 1349
9 Ga0055531_10042648 3300003794 Bacteria 1294
10 JGI25405J52794_10026189 3300003911 Bacteria 1197
11 Ga0065165_1000563 3300005262 Bacteria 55229
12 Ga0065704_10171961 3300005289 Bacteria 1286
13 Ga0065704_10204155 3300005289 Bacteria 1134
14 Ga0065715_10166128 3300005293 Unclassified 1584
15 Ga0070658_10000059 3300005327 Bacteria 112781
16 Ga0070658_10008345 3300005327 Bacteria 8332
17 Ga0070658_10026519 3300005327 Bacteria 4649
18 Ga0070658_10185814 3300005327 Unclassified 1750
19 Ga0070676_10007291 3300005328 Bacteria 5931
20 Ga0070676_10016919 3300005328 Bacteria 4031
21 Ga0070683_100023828 3300005329 Bacteria 5478
22 Ga0070690_100150919 3300005330 Bacteria 1585
23 Ga0070670_100004475 3300005331 Bacteria 11708
24 Ga0070670_100151241 3300005331 Bacteria 2009
25 Ga0070677_10017189 3300005333 Bacteria 2586
26 Ga0068869_100009547 3300005334 Bacteria 6299
27 Ga0070666_10070550 3300005335 Bacteria 2377
28 Ga0070680_100012557 3300005336 Bacteria 6584
29 Ga0070680_100015196 3300005336 Bacteria 6030
30 Ga0070680_100054683 3300005336 Bacteria 3260
31 Ga0070680_100069381 3300005336 Bacteria 2894
32 Ga0070680_100085886 3300005336 Bacteria 2600
33 Ga0070682_100392218 3300005337 Bacteria 1047
34 Ga0068868_100803488 3300005338 Bacteria 849
35 Ga0070660_100048416 3300005339 Bacteria 3265
36 Ga0070689_100021631 3300005340 Bacteria 4791
37 Ga0070689_100187038 3300005340 Bacteria 1685
38 Ga0070689_100310547 3300005340 Bacteria 1314
39 Ga0070691_10052485 3300005341 Bacteria 1949
40 Ga0070691_10333279 3300005341 Bacteria 838
41 Ga0070661_100006288 3300005344 Bacteria 8194
42 Ga0070661_100075453 3300005344 Bacteria 2484
43 Ga0070668_100005964 3300005347 Bacteria 9036
44 Ga0070668_100064590 3300005347 Bacteria 2838
45 Ga0070668_100117910 3300005347 Bacteria 2119
46 Ga0070668_100219341 3300005347 Bacteria 1568
47 Ga0070668_100339965 3300005347 Bacteria 1268
48 Ga0070669_100010472 3300005353 Bacteria 6586
49 Ga0070669_100339713 3300005353 Bacteria 1216
50 Ga0070675_100203670 3300005354 Bacteria 1718
51 Ga0070671_100103151 3300005355 Bacteria 2393
52 Ga0070673_100344741 3300005364 Bacteria 1321
53 Ga0070688_100004472 3300005365 Bacteria 7280
54 Ga0070688_100048736 3300005365 Unclassified 2633
55 Ga0070688_100237137 3300005365 Bacteria 1293
56 Ga0070659_100053819 3300005366 Bacteria 3169
57 Ga0070659_100143047 3300005366 Bacteria 1947
58 Ga0070667_100226114 3300005367 Bacteria 1667
59 Ga0070709_10013740 3300005434 Bacteria 4559
60 Ga0070709_10068208 3300005434 Bacteria 2286
61 Ga0070714_100000490 3300005435 Bacteria 28629
62 Ga0070713_100000278 3300005436 Bacteria 33610
63 Ga0070713_100092449 3300005436 Bacteria 2605
64 Ga0070713_100461690 3300005436 Bacteria 1194
65 Ga0070710_10003676 3300005437 Bacteria 7254
66 Ga0070710_10004304 3300005437 Bacteria 6748
67 Ga0070701_10177097 3300005438 Bacteria 1246
68 Ga0070711_100003976 3300005439 Bacteria 8689
69 Ga0070711_100053143 3300005439 Bacteria 2790
70 Ga0070700_100451148 3300005441 Bacteria 979
71 Ga0070678_100017547 3300005456 Bacteria 4614
72 Ga0070678_100021018 3300005456 Bacteria 4295
73 Ga0070678_100216832 3300005456 Bacteria 1589
74 Ga0070681_10006100 3300005458 Bacteria 11695
75 Ga0070681_10008082 3300005458 Bacteria 10294
76 Ga0070681_10044484 3300005458 Bacteria 4445
77 Ga0068867_100087828 3300005459 Unclassified 2355
78 Ga0070685_10004976 3300005466 Bacteria 6730
79 Ga0070685_10047083 3300005466 Bacteria 2478
80 Ga0070685_10129927 3300005466 Bacteria 1574
81 Ga0070699_100187786 3300005518 Bacteria 1835
82 Ga0070679_100032781 3300005530 Bacteria 5141
83 Ga0070684_100117049 3300005535 Bacteria 2394
84 Ga0070684_100266404 3300005535 Bacteria 1568
85 Ga0070697_100283296 3300005536 Bacteria 1422
86 Ga0068853_100005273 3300005539 Bacteria 10121
87 Ga0068853_100078999 3300005539 Bacteria 2876
88 Ga0068853_100341419 3300005539 Bacteria 1391
89 Ga0070672_100016229 3300005543 Bacteria 5327
90 Ga0070672_100153850 3300005543 Bacteria 1904
91 Ga0070672_100195947 3300005543 Bacteria 1688
92 Ga0070696_100069257 3300005546 Bacteria 2478
93 Ga0070696_100469248 3300005546 Bacteria 996
94 Ga0070693_100003633 3300005547 Bacteria 7208
95 Ga0070665_100047432 3300005548 Bacteria 4312
96 Ga0070665_100318342 3300005548 Bacteria 1560
97 Ga0070665_100378526 3300005548 Bacteria 1423
98 Ga0070704_100346552 3300005549 Bacteria 1252
99 Ga0070704_100370403 3300005549 Bacteria 1214
100 Ga0070704_100446949 3300005549 Bacteria 1112
101 Ga0068855_100000009 3300005563 Bacteria 246035
102 Ga0068855_100000093 3300005563 Bacteria 106968
103 Ga0068855_100002770 3300005563 Bacteria 21581
104 Ga0068855_100079212 3300005563 Bacteria 3811
105 Ga0068855_100101153 3300005563 Bacteria 3318
106 Ga0068855_100214717 3300005563 Bacteria 2160
107 Ga0068855_100276319 3300005563 Bacteria 1867
108 Ga0070664_100671954 3300005564 Bacteria 963
109 Ga0068857_100106220 3300005577 Bacteria 2521
110 Ga0068857_100585764 3300005577 Bacteria 1053
111 Ga0068857_100595835 3300005577 Bacteria 1044
112 Ga0068857_100942842 3300005577 Bacteria 829
113 Ga0068854_100133504 3300005578 Bacteria 1898
114 Ga0068854_100290918 3300005578 Bacteria 1318
115 Ga0068854_100703289 3300005578 Bacteria 872
116 Ga0068856_100014274 3300005614 Bacteria 7681
117 Ga0068856_100049571 3300005614 Bacteria 4138
118 Ga0068856_100081363 3300005614 Bacteria 3213
119 Ga0068856_100246423 3300005614 Bacteria 1802
120 Ga0070702_100429686 3300005615 Bacteria 953
121 Ga0068852_100273793 3300005616 Bacteria 1625
122 Ga0068859_100021820 3300005617 Bacteria 6421
123 Ga0068859_100142510 3300005617 Bacteria 2470
124 Ga0068859_100206335 3300005617 Unclassified 2050
125 Ga0068864_100000154 3300005618 Bacteria 63744
126 Ga0068864_100041370 3300005618 Bacteria 3942
127 Ga0068861_100084612 3300005719 Unclassified 2490
128 Ga0068870_10102381 3300005840 Bacteria 1621
129 Ga0068863_100000172 3300005841 Bacteria 68888
130 Ga0068863_100254720 3300005841 Bacteria 1696
131 Ga0068858_100000639 3300005842 Bacteria 36426
132 Ga0068858_100166226 3300005842 Bacteria 2079
133 Ga0068858_100595772 3300005842 Bacteria 1072
134 Ga0068860_100000151 3300005843 Bacteria 112208
135 Ga0068860_100008879 3300005843 Bacteria 10013
136 Ga0068860_100011656 3300005843 Bacteria 8668
137 Ga0068860_100754858 3300005843 Bacteria 985
138 Ga0068860_100902311 3300005843 Bacteria 900
139 Ga0068862_100007610 3300005844 Bacteria 8974
140 Ga0068862_100014501 3300005844 Bacteria 6541
141 Ga0068862_100057627 3300005844 Bacteria 3332
142 Ga0068862_100263434 3300005844 Bacteria 1574
143 Ga0081455_10000347 3300005937 Bacteria 60756
144 Ga0081455_10000477 3300005937 Bacteria 51914
145 Ga0081455_10002412 3300005937 Bacteria 22295
146 Ga0081455_10012372 3300005937 Bacteria 8515
147 Ga0081455_10029489 3300005937 Bacteria 5002
148 Ga0081455_10046937 3300005937 Bacteria 3744
149 Ga0081455_10078322 3300005937 Bacteria 2716
150 Ga0081538_10001364 3300005981 Bacteria 25135
151 Ga0081540_1000015 3300005983 Bacteria 178704
152 Ga0081540_1004841 3300005983 Bacteria 10144
153 Ga0081540_1030763 3300005983 Bacteria 2967
154 Ga0081539_10005853 3300005985 Bacteria 12191
155 Ga0070717_10000297 3300006028 Bacteria 33338
156 Ga0070717_10124057 3300006028 Bacteria 2215
157 Ga0070717_10141223 3300006028 Bacteria 2077
158 Ga0070717_10420344 3300006028 Bacteria 1202
159 Ga0070717_10735450 3300006028 Bacteria 897
160 Ga0075365_10030532 3300006038 Bacteria 3452
161 Ga0075365_10165338 3300006038 Bacteria 1543
162 Ga0075363_100077948 3300006048 Bacteria 1809
163 Ga0075364_10157580 3300006051 Bacteria 1531
164 Ga0075364_10179402 3300006051 Bacteria 1432
165 Ga0070715_10005158 3300006163 Bacteria 4339
166 Ga0070712_100000896 3300006175 Bacteria 17862
167 Ga0070712_100015199 3300006175 Bacteria 4951
168 Ga0070712_100036096 3300006175 Bacteria 3360
169 Ga0075367_10026095 3300006178 Bacteria 3309
170 Ga0075367_10308272 3300006178 Bacteria 997
171 Ga0075366_10027423 3300006195 Bacteria 3341
172 Ga0075366_10220123 3300006195 Bacteria 1156
173 Ga0097621_100397803 3300006237 Bacteria 1233
174 Ga0075370_10061817 3300006353 Bacteria 2134
175 Ga0075370_10062100 3300006353 Bacteria 2129
176 Ga0068871_100265200 3300006358 Unclassified 1499
177 Ga0075428_100000430 3300006844 Bacteria 41652
178 Ga0075428_100181493 3300006844 Bacteria 2278
179 Ga0075428_100214466 3300006844 Bacteria 2079
180 Ga0075428_100382111 3300006844 Bacteria 1510
181 Ga0075430_100128522 3300006846 Bacteria 2112
182 Ga0075431_100000086 3300006847 Bacteria 56252
183 Ga0075431_100019049 3300006847 Bacteria 6993
184 Ga0075431_100123707 3300006847 Bacteria 2669
185 Ga0075431_100360403 3300006847 Bacteria 1460
186 Ga0075433_10029411 3300006852 Bacteria 4681
187 Ga0075433_10071279 3300006852 Bacteria 3055
188 Ga0075433_10162923 3300006852 Bacteria 1985
189 Ga0075434_100018441 3300006871 Bacteria 6743
190 Ga0075434_100288912 3300006871 Bacteria 1659
191 Ga0075434_100788154 3300006871 Bacteria 967
192 Ga0075429_100082076 3300006880 Bacteria 2810
193 Ga0075429_100326146 3300006880 Bacteria 1344
194 Ga0068865_100211830 3300006881 Bacteria 1510
195 Ga0097620_100021824 3300006931 Bacteria 6421
196 Ga0097620_100142526 3300006931 Bacteria 2470
197 Ga0097620_100206334 3300006931 Unclassified 2050
198 Ga0075435_100032914 3300007076 Bacteria 4097
199 Ga0075435_100213931 3300007076 Bacteria 1636
200 Ga0075435_100634722 3300007076 Bacteria 927
201 Ga0099794_10000814 3300007265 Bacteria 10538
202 Ga0105240_10000094 3300009093 Bacteria 181637
203 Ga0105240_10001341 3300009093 Bacteria 42205
204 Ga0105240_10012709 3300009093 Bacteria 11605
205 Ga0105240_10091571 3300009093 Bacteria 3714
206 Ga0105240_10131409 3300009093 Bacteria 3002
207 Ga0105240_10299790 3300009093 Bacteria 1839
208 Ga0111539_10001374 3300009094 Bacteria 32371
209 Ga0111539_10019117 3300009094 Bacteria 8466
210 Ga0111539_10029219 3300009094 Bacteria 6718
211 Ga0111539_10054138 3300009094 Bacteria 4775
212 Ga0111539_10297775 3300009094 Bacteria 1877
213 Ga0111539_10779185 3300009094 Bacteria 1113
214 Ga0105245_10101542 3300009098 Bacteria 2663
215 Ga0114129_10000243 3300009147 Bacteria 61230
216 Ga0114129_10007283 3300009147 Bacteria 15749
217 Ga0114129_10013235 3300009147 Bacteria 11749
218 Ga0114129_10035725 3300009147 Bacteria 7020
219 Ga0114129_10184579 3300009147 Bacteria 2836
220 Ga0114129_10205921 3300009147 Bacteria 2662
221 Ga0105248_10024422 3300009177 Bacteria 6721
222 Ga0105248_10060900 3300009177 Bacteria 4237
223 Ga0105248_10065402 3300009177 Bacteria 4083
224 Ga0105237_10784813 3300009545 Bacteria 959
225 Ga0105237_10972741 3300009545 Bacteria 856
226 Ga0105238_10039621 3300009551 Bacteria 4778
227 Ga0105238_10118377 3300009551 Bacteria 2629
228 Ga0105238_10295610 3300009551 Bacteria 1603
229 Ga0105238_10822266 3300009551 Bacteria 945
230 Ga0105238_11027720 3300009551 Bacteria 845
231 Ga0105249_10109094 3300009553 Bacteria 2613
232 Ga0105249_10352395 3300009553 Bacteria 1491
233 Ga0105249_10383816 3300009553 Bacteria 1431
234 Ga0105249_10820214 3300009553 Bacteria 995
235 Ga0105239_10243793 3300010375 Bacteria 2017
236 Ga0105239_11154845 3300010375 Bacteria 892
237 Ga0105246_10296963 3300011119 Bacteria 1302
238 Ga0157371_10020758 3300013102 Bacteria 4832
239 Ga0157371_10223626 3300013102 Bacteria 1352
240 Ga0157370_10002875 3300013104 Bacteria 20517
241 Ga0157370_10011925 3300013104 Bacteria 9062
242 Ga0157370_10193886 3300013104 Bacteria 1886
243 Ga0157369_10196501 3300013105 Bacteria 2118
244 Ga0157369_10651347 3300013105 Bacteria 1086
245 Ga0157374_10006020 3300013296 Bacteria 10263
246 Ga0157374_11057301 3300013296 Bacteria 832
247 Ga0157378_10113810 3300013297 Bacteria 2485
248 Ga0157378_10216303 3300013297 Bacteria 1820
249 Ga0157378_10242253 3300013297 Bacteria 1723
250 Ga0163162_10037368 3300013306 Unclassified 4846
251 Ga0163162_10385835 3300013306 Unclassified 1534
252 Ga0157372_10025787 3300013307 Bacteria 6393
253 Ga0157375_10053720 3300013308 Bacteria 3965
254 Ga0157375_11682575 3300013308 Unclassified 751
255 Ga0163163_10019627 3300014325 Bacteria 6349
256 Ga0163163_10059375 3300014325 Bacteria 3783
257 Ga0163163_10918670 3300014325 Bacteria 939
258 Ga0157380_10034981 3300014326 Bacteria 3877
259 Ga0157380_10096177 3300014326 Bacteria 2455
260 Ga0157380_10154705 3300014326 Bacteria 1986
261 Ga0157377_10024421 3300014745 Unclassified 3213
262 Ga0157377_10068405 3300014745 Bacteria 2046
263 Ga0157379_10427938 3300014968 Bacteria 1220
264 Ga0157376_10257362 3300014969 Bacteria 1633
265 Ga0157376_10359570 3300014969 Bacteria 1396
266 Ga0157376_10546622 3300014969 Bacteria 1145
267 Ga0163161_10091543 3300017792 Bacteria 2251
268 Ga0163161_10207866 3300017792 Unclassified 1511
269 Ga0213872_10003321 3300021361 Bacteria 8966
270 Ga0213872_10147704 3300021361 Bacteria 1028
271 Ga0213876_10000134 3300021384 Bacteria 80875
272 Ga0213876_10004326 3300021384 Bacteria 7958
273 Ga0213876_10112654 3300021384 Bacteria 1444
274 Ga0213875_10000007 3300021388 Bacteria 562717
275 Ga0213875_10002695 3300021388 Bacteria 10484
276 Ga0213875_10008291 3300021388 Bacteria 5327
277 Ga0213875_10086068 3300021388 Bacteria 1466
278 Ga0213875_10093515 3300021388 Bacteria 1402
279 Ga0213871_10001032 3300021441 Bacteria 4386
280 Ga0213871_10061498 3300021441 Bacteria 1047
281 Ga0209026_1001732 3300025250 Bacteria 9090
282 Ga0209026_1010008 3300025250 Bacteria 1803
283 Ga0209148_1009797 3300025254 Bacteria 1846
284 Ga0209758_1000119 3300025297 Bacteria 195545
285 Ga0209758_1000252 3300025297 Bacteria 108214
286 Ga0209758_1000682 3300025297 Bacteria 50599
287 Ga0209050_1000141 3300025298 Bacteria 173116
288 Ga0209050_1003817 3300025298 Bacteria 10753
289 Ga0207426_1026381 3300025302 Bacteria 1946
290 Ga0207426_1050950 3300025302 Bacteria 1232
291 Ga0207426_1053149 3300025302 Bacteria 1197
292 Ga0209257_1000190 3300025304 Bacteria 153686
293 Ga0209257_1000288 3300025304 Bacteria 111141
294 Ga0209257_1000562 3300025304 Bacteria 63202
295 Ga0207653_10010527 3300025885 Bacteria 2884
296 Ga0207682_10009231 3300025893 Bacteria 3897
297 Ga0207692_10001592 3300025898 Bacteria 8547
298 Ga0207642_10092372 3300025899 Bacteria 1498
299 Ga0207680_10095618 3300025903 Bacteria 1899
300 Ga0207680_10416950 3300025903 Bacteria 950
301 Ga0207685_10002629 3300025905 Bacteria 4168
302 Ga0207699_10009773 3300025906 Bacteria 4791
303 Ga0207699_10035071 3300025906 Bacteria 2852
304 Ga0207645_10009341 3300025907 Bacteria 6789
305 Ga0207645_10281570 3300025907 Bacteria 1104
306 Ga0207643_10015054 3300025908 Bacteria 4206
307 Ga0207643_10152198 3300025908 Bacteria 1387
308 Ga0207705_10000195 3300025909 Bacteria 61397
309 Ga0207705_10144164 3300025909 Bacteria 1781
310 Ga0207705_10197352 3300025909 Bacteria 1524
311 Ga0207684_10022472 3300025910 Bacteria 5383
312 Ga0207707_10006763 3300025912 Bacteria 10012
313 Ga0207707_10049755 3300025912 Bacteria 3651
314 Ga0207707_10081952 3300025912 Bacteria 2816
315 Ga0207707_10093101 3300025912 Bacteria 2633
316 Ga0207707_10760750 3300025912 Bacteria 809
317 Ga0207695_10000419 3300025913 Bacteria 94504
318 Ga0207695_10001861 3300025913 Bacteria 33054
319 Ga0207695_10385409 3300025913 Bacteria 1287
320 Ga0207695_10391725 3300025913 Bacteria 1274
321 Ga0207671_10356418 3300025914 Bacteria 1160
322 Ga0207693_10005248 3300025915 Bacteria 10840
323 Ga0207693_10045878 3300025915 Bacteria 3433
324 Ga0207663_10007163 3300025916 Bacteria 5767
325 Ga0207663_10242979 3300025916 Bacteria 1321
326 Ga0207663_10471939 3300025916 Bacteria 971
327 Ga0207660_10043058 3300025917 Bacteria 3171
328 Ga0207660_10101300 3300025917 Bacteria 2151
329 Ga0207660_10124343 3300025917 Bacteria 1957
330 Ga0207660_10132914 3300025917 Bacteria 1896
331 Ga0207660_10185168 3300025917 Bacteria 1619
332 Ga0207657_10021183 3300025919 Bacteria 6124
333 Ga0207649_10397255 3300025920 Bacteria 1031
334 Ga0207652_10018761 3300025921 Bacteria 5678
335 Ga0207652_10281177 3300025921 Bacteria 1501
336 Ga0207646_10438762 3300025922 Bacteria 1178
337 Ga0207681_10040157 3300025923 Bacteria 3112
338 Ga0207681_10060574 3300025923 Bacteria 2599
339 Ga0207681_10306321 3300025923 Bacteria 1258
340 Ga0207694_10030714 3300025924 Bacteria 4102
341 Ga0207694_10120857 3300025924 Bacteria 2091
342 Ga0207650_10010512 3300025925 Bacteria 6348
343 Ga0207687_10182829 3300025927 Bacteria 1625
344 Ga0207700_10000380 3300025928 Bacteria 25773
345 Ga0207700_10121010 3300025928 Bacteria 2122
346 Ga0207700_10254317 3300025928 Bacteria 1502
347 Ga0207700_10679945 3300025928 Bacteria 918
348 Ga0207664_10005464 3300025929 Bacteria 8690
349 Ga0207664_10008858 3300025929 Bacteria 7040
350 Ga0207664_10810576 3300025929 Bacteria 842
351 Ga0207690_10379830 3300025932 Bacteria 1122
352 Ga0207706_10081394 3300025933 Bacteria 2845
353 Ga0207686_10150068 3300025934 Bacteria 1622
354 Ga0207670_10001178 3300025936 Bacteria 13805
355 Ga0207670_10002994 3300025936 Bacteria 8920
356 Ga0207670_10036512 3300025936 Bacteria 3196
357 Ga0207670_10161876 3300025936 Bacteria 1671
358 Ga0207670_10369997 3300025936 Bacteria 1139
359 Ga0207665_10034393 3300025939 Bacteria 3362
360 Ga0207665_10077328 3300025939 Bacteria 2284
361 Ga0207691_10079984 3300025940 Bacteria 2941
362 Ga0207691_10105100 3300025940 Bacteria 2515
363 Ga0207711_10021082 3300025941 Bacteria 5442
364 Ga0207711_10028623 3300025941 Bacteria 4691
365 Ga0207711_10073803 3300025941 Bacteria 2966
366 Ga0207689_10006787 3300025942 Bacteria 10075
367 Ga0207689_10309093 3300025942 Bacteria 1311
368 Ga0207679_10476363 3300025945 Bacteria 1111
369 Ga0207667_10000045 3300025949 Bacteria 246053
370 Ga0207667_10000588 3300025949 Bacteria 47296
371 Ga0207667_10005483 3300025949 Bacteria 15466
372 Ga0207667_10146786 3300025949 Bacteria 2428
373 Ga0207667_10177908 3300025949 Bacteria 2185
374 Ga0207667_10300231 3300025949 Bacteria 1641
375 Ga0207667_10304937 3300025949 Bacteria 1627
376 Ga0207667_10691039 3300025949 Bacteria 1023
377 Ga0207651_10004995 3300025960 Bacteria 6762
378 Ga0207651_10105642 3300025960 Bacteria 2101
379 Ga0207651_10113471 3300025960 Bacteria 2039
380 Ga0207712_10004918 3300025961 Bacteria 8449
381 Ga0207712_10172730 3300025961 Bacteria 1691
382 Ga0207712_10248547 3300025961 Bacteria 1436
383 Ga0207712_10332399 3300025961 Bacteria 1257
384 Ga0207668_10029854 3300025972 Bacteria 3578
385 Ga0207668_10459451 3300025972 Bacteria 1088
386 Ga0207668_10516854 3300025972 Bacteria 1029
387 Ga0207640_10110400 3300025981 Bacteria 1948
388 Ga0207658_10124226 3300025986 Bacteria 2063
389 Ga0207658_10178234 3300025986 Bacteria 1757
390 Ga0207677_10436448 3300026023 Bacteria 1119
391 Ga0207677_10497113 3300026023 Bacteria 1054
392 Ga0207703_10000289 3300026035 Bacteria 55525
393 Ga0207703_10444934 3300026035 Bacteria 1209
394 Ga0207703_10495861 3300026035 Bacteria 1146
395 Ga0207639_10236214 3300026041 Bacteria 1587
396 Ga0207678_10464079 3300026067 Bacteria 1102
397 Ga0207678_10790741 3300026067 Bacteria 837
398 Ga0207708_10054966 3300026075 Bacteria 3036
399 Ga0207702_10062359 3300026078 Bacteria 3183
400 Ga0207702_10070400 3300026078 Bacteria 3008
401 Ga0207702_10117617 3300026078 Bacteria 2374
402 Ga0207702_10161501 3300026078 Bacteria 2046
403 Ga0207702_10196561 3300026078 Bacteria 1867
404 Ga0207641_10000160 3300026088 Bacteria 95407
405 Ga0207641_10200544 3300026088 Bacteria 1839
406 Ga0207641_10296121 3300026088 Bacteria 1527
407 Ga0207641_10481912 3300026088 Bacteria 1202
408 Ga0207648_10134622 3300026089 Bacteria 2176
409 Ga0207648_10157664 3300026089 Bacteria 2004
410 Ga0207676_10000375 3300026095 Bacteria 38069
411 Ga0207676_10385140 3300026095 Bacteria 1306
412 Ga0207674_10031884 3300026116 Bacteria 5532
413 Ga0207674_10049513 3300026116 Bacteria 4297
414 Ga0207674_10121839 3300026116 Bacteria 2575
415 Ga0207674_10386736 3300026116 Bacteria 1352
416 Ga0207674_10591405 3300026116 Bacteria 1072
417 Ga0207675_100008841 3300026118 Bacteria 9452
418 Ga0207675_100059146 3300026118 Bacteria 3576
419 Ga0207675_100444674 3300026118 Bacteria 1284
420 Ga0207683_10009099 3300026121 Bacteria 8465
421 Ga0207683_10027341 3300026121 Bacteria 4929
422 Ga0209981_1000501 3300027378 Bacteria 4989
423 Ga0207428_10007141 3300027907 Bacteria 10218
424 Ga0207428_10084960 3300027907 Bacteria 2465
425 Ga0207428_10264931 3300027907 Bacteria 1279
426 Ga0207428_10337781 3300027907 Bacteria 1110
427 Ga0268266_10331239 3300028379 Bacteria 1427
428 Ga0268265_10006267 3300028380 Bacteria 8057
429 Ga0268265_10011714 3300028380 Bacteria 5930
430 Ga0268265_10031043 3300028380 Bacteria 3855
431 Ga0268265_10067990 3300028380 Unclassified 2760
432 Ga0268265_10224239 3300028380 Bacteria 1647
433 Ga0268265_10374729 3300028380 Bacteria 1307
434 Ga0268264_10000046 3300028381 Bacteria 364597
435 Ga0268264_10195286 3300028381 Bacteria 1847
436 Ga0268264_10754189 3300028381 Bacteria 970
437 Ga0265334_10006434 3300028573 Bacteria 5058
438 Ga0265334_10068347 3300028573 Bacteria 1327
439 Ga0265318_10025807 3300028577 Bacteria 2317
440 Ga0307517_10127623 3300028786 Bacteria 1848
441 Ga0307515_10286314 3300028794 Bacteria 1349
442 Ga0265338_10020456 3300028800 Bacteria 6960
443 Ga0265338_10021228 3300028800 Bacteria 6782
444 Ga0265338_10022862 3300028800 Bacteria 6451
445 Ga0265338_10044555 3300028800 Bacteria 4095
446 Ga0265338_10143331 3300028800 Bacteria 1868
447 Ga0307511_10025571 3300030521 Bacteria 5436
448 Ga0265332_10000535 3300031238 Bacteria 25809
449 Ga0265325_10002369 3300031241 Bacteria 12747
450 Ga0265329_10033233 3300031242 Bacteria 1668
451 Ga0265340_10003508 3300031247 Bacteria 8827
452 Ga0265340_10079674 3300031247 Bacteria 1543
453 Ga0265340_10167149 3300031247 Bacteria 997
454 Ga0265339_10002291 3300031249 Bacteria 13811
455 Ga0265339_10005076 3300031249 Bacteria 8843
456 Ga0265339_10005282 3300031249 Bacteria 8613
457 Ga0265331_10015628 3300031250 Bacteria 4003
458 Ga0265327_10000054 3300031251 Bacteria 250337
459 Ga0265327_10000190 3300031251 Bacteria 130086
460 Ga0265327_10004615 3300031251 Bacteria 12107
461 Ga0265327_10071826 3300031251 Bacteria 1730
462 Ga0265327_10203634 3300031251 Bacteria 895
463 Ga0265316_10013043 3300031344 Bacteria 7413
464 Ga0307513_10014691 3300031456 Bacteria 9529
465 Ga0307513_10155963 3300031456 Bacteria 2183
466 Ga0265313_10000116 3300031595 Bacteria 80097
467 Ga0265313_10000183 3300031595 Bacteria 66629
468 Ga0307508_10060187 3300031616 Bacteria 3359
469 Ga0307508_10100583 3300031616 Bacteria 2486
470 Ga0265314_10004504 3300031711 Bacteria 12906
471 Ga0265314_10007258 3300031711 Bacteria 9630
472 Ga0265314_10024611 3300031711 Bacteria 4562
473 Ga0265314_10036586 3300031711 Bacteria 3566
474 Ga0265314_10090235 3300031711 Bacteria 1997
475 Ga0265342_10000011 3300031712 Bacteria 208435
476 Ga0316576_10107675 3300031727 Bacteria 2088
477 Ga0307516_10000004 3300031730 Bacteria 367451
478 Ga0307516_10248986 3300031730 Bacteria 1472
479 Ga0307405_10045036 3300031731 Bacteria 2701
480 Ga0307413_10137086 3300031824 Bacteria 1684
481 Ga0307413_10219368 3300031824 Bacteria 1388
482 Ga0307413_10260538 3300031824 Bacteria 1292
483 Ga0307410_10106049 3300031852 Bacteria 2024
484 Ga0307407_10199576 3300031903 Bacteria 1340
485 Ga0307409_100229211 3300031995 Bacteria 1683
486 Ga0307416_100497318 3300032002 Bacteria 1283
487 Ga0307414_10091171 3300032004 Bacteria 2264
488 Ga0307414_10416830 3300032004 Bacteria 1170
489 Ga0307414_10456584 3300032004 Bacteria 1122
490 Ga0307411_10131431 3300032005 Bacteria 1830
491 Ga0307411_10157678 3300032005 Bacteria 1695
492 Ga0307411_10339649 3300032005 Bacteria 1220
493 Ga0316583_10000712 3300032133 Bacteria 10310
494 Ga0316583_10046548 3300032133 Bacteria 1531
495 Ga0307510_10056928 3300033180 Bacteria 4065
496 Ga0373948_0044476 3300034817 Bacteria 939
497 Ga0373958_0022235 3300034819 Bacteria 1183
498 Ga0373928_0022630 3300035084 Bacteria 1334
499 Ga0373928_0023704 3300035084 Bacteria 1311
500 Ga0373940_0066669 3300035088 Bacteria 1040
501 Ga0373944_0024197 3300035089 Bacteria 1778
502 Ga0373949_0020589 3300035090 Bacteria 1511
503 Ga0373951_0080872 3300035091 Bacteria 841
504 Ga0373923_0145113 3300035111 Bacteria 1075
505 Ga0373932_0010736 3300035112 Bacteria 2223
506 Ga0373941_0103506 3300035115 Bacteria 994
507 Ga0373945_0005510 3300035116 Bacteria 4053
508 Ga0373956_0094151 3300035119 Bacteria 1384
509 Ga0373943_0239082 3300035170 Bacteria 1017
510 Ga0373946_0006872 3300035171 Bacteria 4143
511 Ga0373946_0011339 3300035171 Bacteria 3323
512 Ga0373955_0171615 3300035172 Bacteria 1284
513 Ga0373955_0277100 3300035172 Bacteria 1009
514 Ga0373931_0014133 3300035691 Bacteria 3898
515 Ga0373931_0045000 3300035691 Bacteria 2329
516 Ga0373931_0080049 3300035691 Bacteria 1801
517 Ga0373935_0350407 3300035692 Bacteria 1052
518 Ga0373927_0036738 3300035695 Bacteria 3184
519 Ga0373927_0245304 3300035695 Bacteria 1177
520 Ga0373947_0044945 3300035725 Bacteria 2642
521 Ga0373947_0084690 3300035725 Bacteria 1968
522 Ga0373947_0090790 3300035725 Bacteria 1905
523 Ga0373937_0006315 3300036401 Bacteria 10219
524 Ga0373937_0173087 3300036401 Bacteria 2026
525 Ga0316584_0050930 3300036712 Bacteria 3096
526 Ga0316584_0103663 3300036712 Bacteria 2129
527 Ga0373925_0099950 3300037068 Bacteria 2228
528 Ga0373925_0105806 3300037068 Bacteria 2168
529 Ga0373925_0604110 3300037068 Bacteria 903
530 Ga0395899_0000070 3300037312 Bacteria 189668
531 Ga0395899_0121527 3300037312 Bacteria 1870
532 Ga0395900_0000128 3300037418 Bacteria 127446
533 Ga0395900_0034389 3300037418 Bacteria 5218
534 Ga0395900_0177445 3300037418 Bacteria 2166
535 Ga0395900_0235095 3300037418 Bacteria 1841
536 Ga0395898_0185201 3300037466 Bacteria 1989
537 Ga0395898_0675117 3300037466 Bacteria 975
538 Ga0395905_0038497 3300037471 Bacteria 4488
539 Ga0395905_0417347 3300037471 Bacteria 1238
540 Ga0436364_0013783 3300037853 Bacteria 29941
541 Ga0436364_0186560 3300037853 Bacteria 2805
542 Ga0436364_0382668 3300037853 Bacteria 4228
543 Ga0436364_0955256 3300037853 Bacteria 35556
544 Ga0436364_1026771 3300037853 Bacteria 10513
545 Ga0436364_1438211 3300037853 Bacteria 1326
546 Ga0395901_0000225 3300038443 Bacteria 70878
547 Ga0395901_0001835 3300038443 Bacteria 21949
548 Ga0395901_0017625 3300038443 Bacteria 7292
549 Ga0395901_0133080 3300038443 Bacteria 2613
550 Ga0436365_0029939 3300039437 Bacteria 3270
551 Ga0436365_0316565 3300039437 Bacteria 4011
552 Ga0436365_0525757 3300039437 Bacteria 2335
553 Ga0436365_0742782 3300039437 Bacteria 1270
554 Ga0436365_1136540 3300039437 Bacteria 40433
555 Ga0436365_1830840 3300039437 Bacteria 45078
556 Ga0436360_0157856 3300039438 Bacteria 21123
557 Ga0436360_1273015 3300039438 Bacteria 1851
558 Ga0436361_0092439 3300039447 Bacteria 1517
559 Ga0436361_0217171 3300039447 Bacteria 1775
560 Ga0436361_0235144 3300039447 Bacteria 2839
561 Ga0436361_0348195 3300039447 Bacteria 1485
562 Ga0436361_0525734 3300039447 Bacteria 37715
563 Ga0436361_0722234 3300039447 Bacteria 1205
564 Ga0436361_0736152 3300039447 Bacteria 1222
565 Ga0436361_0839114 3300039447 Bacteria 1258
566 Ga0436363_0339486 3300039450 Bacteria 1456
567 Ga0436363_0930428 3300039450 Bacteria 4099
568 Ga0436363_1129020 3300039450 Bacteria 946
569 Ga0436363_1143576 3300039450 Bacteria 4251
570 Ga0436362_0302375 3300039453 Bacteria 12952
571 Ga0436362_0694438 3300039453 Bacteria 2474
572 Ga0436362_0697649 3300039453 Bacteria 1196
573 Ga0436362_0900943 3300039453 Bacteria 2378
574 Ga0436362_1201384 3300039453 Bacteria 1352
575 Ga0439453_0017902 3300041408 Bacteria 1248
576 Ga0439465_0016110 3300041413 Bacteria 2331
577 Ga0439445_0008563 3300042004 Bacteria 2396
578 Ga0439445_0016409 3300042004 Bacteria 1822
579 Ga0439448_0096077 3300042005 Bacteria 1004
580 Ga0451577_0053495 3300042876 Bacteria 3604
581 Ga0451577_0355087 3300042876 Bacteria 1330
582 Ga0453683_0506275 3300044673 Bacteria 784
583 Ga0466966_0013591 3300044684 Bacteria 5385
584 Ga0466966_0111882 3300044684 Bacteria 1683
585 Ga0466963_0095857 3300044694 Bacteria 2026
586 Ga0466963_0196059 3300044694 Bacteria 1412
587 Ga0453684_0005311 3300044712 Bacteria 25685
588 Ga0453684_0025337 3300044712 Bacteria 8617
589 Ga0453684_0293152 3300044712 Bacteria 1852
590 Ga0466960_0173997 3300044901 Bacteria 1163
591 Ga0466959_0002189 3300045049 Bacteria 12429
592 Ga0466959_0017658 3300045049 Bacteria 5232
593 Ga0451576_0009668 3300045051 Bacteria 11155
594 Ga0451576_0526043 3300045051 Bacteria 1242
595 Ga0495617_151033 3300046452 Bacteria 739
596 Ga0495603_0129734 3300046455 Bacteria 1468
597 Ga0495629_0030687 3300046459 Bacteria 3809
598 Ga0495651_0204340 3300046462 Bacteria 1380
599 Ga0495580_0105332 3300046472 Bacteria 1960
600 Ga0495582_0032586 3300046473 Bacteria 2865
601 Ga0495605_0066289 3300046474 Bacteria 1716
602 Ga0495662_0065385 3300046476 Bacteria 1758
603 Ga0495664_0275482 3300046477 Bacteria 1017
604 Ga0495584_0006976 3300046491 Bacteria 5900
605 Ga0495584_0137124 3300046491 Bacteria 1242
606 Ga0495594_0089846 3300046499 Bacteria 1721
607 Ga0495607_0082480 3300046501 Bacteria 1764
608 Ga0495583_0106877 3300046506 Bacteria 1189
609 Ga0495606_0056869 3300046507 Bacteria 2522
610 Ga0495616_0152338 3300046513 Bacteria 1045
611 Ga0495618_0083823 3300046514 Bacteria 2036
612 Ga0495620_0044994 3300046515 Bacteria 1915
613 Ga0495630_0323263 3300046517 Bacteria 1179
614 Ga0495631_0120716 3300046518 Bacteria 1127
615 Ga0495637_0010029 3300046520 Bacteria 4601
616 Ga0495637_0124954 3300046520 Bacteria 987
617 Ga0495643_0036969 3300046522 Bacteria 2680
618 Ga0495643_0117134 3300046522 Bacteria 1349
619 Ga0495644_0029126 3300046523 Bacteria 2087
620 Ga0495666_0009590 3300046526 Bacteria 4840
621 Ga0495654_0031099 3300046530 Bacteria 2711
622 Ga0495665_0030883 3300046531 Bacteria 2866
623 Ga0495665_0058095 3300046531 Bacteria 2043
624 Ga0495640_0047961 3300046533 Bacteria 2954
625 Ga0495586_0149863 3300046535 Bacteria 1312
626 Ga0495587_0191124 3300046536 Bacteria 1159
627 Ga0495598_0000412 3300046537 Bacteria 7686
628 Ga0495609_0147653 3300046538 Bacteria 1001
629 Ga0495621_0022276 3300046539 Bacteria 2098
630 Ga0495597_0003340 3300046542 Bacteria 9456
631 Ga0495622_0002993 3300046557 Bacteria 8021
632 Ga0495667_0085752 3300046559 Bacteria 2044
633 Ga0495656_0003218 3300046615 Bacteria 5508
634 Ga0495668_0033575 3300046616 Bacteria 2882
635 Ga0495668_0118851 3300046616 Bacteria 1445
636 Ga0495634_0078900 3300046642 Bacteria 2157
637 Ga0495625_0370338 3300046660 Bacteria 901
638 Ga0495659_0008319 3300046664 Bacteria 3303
639 Ga0495661_0180792 3300046665 Bacteria 1118
640 Ga0495588_0045800 3300046674 Bacteria 2243
641 Ga0495657_0257678 3300046675 Bacteria 1049
642 Ga0495658_0036189 3300046683 Unclassified 2722
643 Ga0495658_0101707 3300046683 Bacteria 1716
644 Ga0495658_0305393 3300046683 Bacteria 1007
645 Ga0495658_0417816 3300046683 Bacteria 855
646 Ga0495669_0000001 3300046684 Bacteria 291866
647 Ga0495613_0171563 3300046689 Bacteria 1539
648 Ga0495613_0248288 3300046689 Bacteria 1242
649 Ga0495624_0011870 3300046690 Bacteria 5974
650 Ga0495670_0010915 3300046691 Bacteria 4464
651 Ga0495649_0060603 3300046694 Bacteria 2036
652 Ga0495674_0291973 3300047319 Bacteria 1333
653 Ga0495674_0334792 3300047319 Bacteria 1231
654 Ga0495672_0000739 3300047320 Bacteria 35757
655 Ga0495676_0211685 3300047321 Bacteria 1341
656 Ga0495676_0333307 3300047321 Unclassified 1017
657 Ga0495677_0046685 3300047445 Bacteria 1589
658 Ga0495685_024034 3300047447 Bacteria 2098
659 Ga0495684_0082641 3300047471 Bacteria 2436
660 Ga0495686_0002708 3300047472 Bacteria 16223
661 Ga0495686_0024345 3300047472 Bacteria 3980
662 Ga0495593_0033310 3300047673 Bacteria 2806
663 Ga0495593_0072136 3300047673 Bacteria 1793
664 Ga0495602_0087653 3300048088 Bacteria 2594
665 Ga0495614_0106855 3300048089 Bacteria 1227
666 Ga0496101_0027324 3300048904 Bacteria 3975
667 Ga0496101_0031882 3300048904 Bacteria 3707
668 Ga0496101_0052513 3300048904 Bacteria 2939
669 Ga0496101_0633755 3300048904 Bacteria 845
670 Ga0496102_0055595 3300048905 Bacteria 3609
671 Ga0496102_0274148 3300048905 Bacteria 1590
672 Ga0496102_0404797 3300048905 Bacteria 1283
673 Ga0496103_0001539 3300048906 Bacteria 15366
674 Ga0496104_0003183 3300048907 Bacteria 14111
675 Ga0496104_0006755 3300048907 Bacteria 10105
676 Ga0496104_0079346 3300048907 Bacteria 3129
677 Ga0496105_0000653 3300048908 Bacteria 23216
678 Ga0496105_0003358 3300048908 Bacteria 11834
679 Ga0496105_0019423 3300048908 Bacteria 5480
680 Ga0496106_0004405 3300048909 Bacteria 10438
681 Ga0496106_0051764 3300048909 Bacteria 3097
682 Ga0496107_0021330 3300048910 Bacteria 4578
683 Ga0496108_0004848 3300048911 Bacteria 10859
684 Ga0496109_0001027 3300048912 Bacteria 23090
685 Ga0496110_0011290 3300048913 Bacteria 7303
686 Ga0496110_0018675 3300048913 Bacteria 5818
687 Ga0496110_0030717 3300048913 Bacteria 4632
688 Ga0496110_0090979 3300048913 Bacteria 2729
689 Ga0496111_0076955 3300048914 Bacteria 2432
690 Ga0496111_0389404 3300048914 Bacteria 1030
691 Ga0496112_0000804 3300048915 Bacteria 22118
692 Ga0496112_0059344 3300048915 Bacteria 3769
693 Ga0496112_0465746 3300048915 Bacteria 1201
694 Ga0496113_0001499 3300048916 Bacteria 13066
695 Ga0496114_0021309 3300048917 Bacteria 5271
696 Ga0496114_0030137 3300048917 Bacteria 4463
697 Ga0496114_0211420 3300048917 Bacteria 1701
698 Ga0496114_0383113 3300048917 Bacteria 1245
699 Ga0496115_0004230 3300048918 Bacteria 10380
700 Ga0496115_0088393 3300048918 Bacteria 2530
701 Ga0496115_0263184 3300048918 Bacteria 1418
702 Ga0496115_0407802 3300048918 Bacteria 1102
703 Ga0496119_0002497 3300048922 Bacteria 20107
704 Ga0496121_0254805 3300048924 Bacteria 1215
705 Ga0496126_0010389 3300048929 Bacteria 9766
706 Ga0496126_0278719 3300048929 Bacteria 1385
707 Ga0496126_0569822 3300048929 Bacteria 896
708 Ga0501031_0019630 3300049568 Bacteria 4402
709 Ga0501031_0037957 3300049568 Bacteria 3144
710 Ga0501032_0001016 3300049569 Bacteria 22671
711 Ga0501032_0006036 3300049569 Bacteria 8938
712 Ga0501032_0023092 3300049569 Bacteria 4305
713 Ga0501032_0157399 3300049569 Bacteria 1492
714 Ga0501033_0005237 3300049570 Bacteria 10295
715 Ga0501033_0011204 3300049570 Bacteria 6868
716 Ga0501033_0173782 3300049570 Bacteria 1547
717 Ga0501033_0230645 3300049570 Bacteria 1315
718 Ga0501034_0000244 3300049571 Bacteria 100222
719 Ga0501034_0000623 3300049571 Bacteria 55353
720 Ga0501034_0006211 3300049571 Bacteria 12862
721 Ga0501034_0009574 3300049571 Bacteria 10139
722 Ga0501034_0015930 3300049571 Bacteria 7715
723 Ga0501034_0029889 3300049571 Bacteria 5538
724 Ga0501034_0030592 3300049571 Bacteria 5472
725 Ga0501034_0049229 3300049571 Bacteria 4252
726 Ga0501034_0058001 3300049571 Bacteria 3892
727 Ga0501034_0085320 3300049571 Bacteria 3159
728 Ga0501034_0091153 3300049571 Bacteria 3046
729 Ga0501034_0136565 3300049571 Bacteria 2433
730 Ga0501034_0161820 3300049571 Bacteria 2209
731 Ga0501034_0266304 3300049571 Bacteria 1655
732 Ga0501034_0455552 3300049571 Bacteria 1197
733 Ga0501034_0483485 3300049571 Bacteria 1153
734 Ga0501034_0494303 3300049571 Bacteria 1137
735 Ga0501034_0682207 3300049571 Bacteria 927
736 Ga0501034_0689621 3300049571 Bacteria 920
737 Ga0501036_0000402 3300049572 Bacteria 30483
738 Ga0501036_0009704 3300049572 Bacteria 7923
739 Ga0501036_0131876 3300049572 Bacteria 2109
740 Ga0501036_0184419 3300049572 Bacteria 1756
741 Ga0501036_0242745 3300049572 Bacteria 1510
742 Ga0501036_0263206 3300049572 Bacteria 1444
743 Ga0501036_0299640 3300049572 Bacteria 1345
744 Ga0501036_0348569 3300049572 Bacteria 1236
745 Ga0501037_0008825 3300049573 Bacteria 7386
746 Ga0501037_0009635 3300049573 Bacteria 7087
747 Ga0501037_0014018 3300049573 Bacteria 5905
748 Ga0501037_0072271 3300049573 Bacteria 2509
749 Ga0501037_0115814 3300049573 Bacteria 1929
750 Ga0501037_0169540 3300049573 Bacteria 1552
751 Ga0501037_0374783 3300049573 Bacteria 979
752 Ga0501038_0004074 3300049574 Bacteria 13588
753 Ga0501038_0012791 3300049574 Bacteria 7663
754 Ga0501038_0021786 3300049574 Bacteria 5750
755 Ga0501038_0035364 3300049574 Bacteria 4386
756 Ga0501038_0100969 3300049574 Bacteria 2402
757 Ga0501038_0151329 3300049574 Bacteria 1891
758 Ga0501038_0481171 3300049574 Bacteria 951
759 Ga0501038_0481291 3300049574 Bacteria 951
760 Ga0501039_0107608 3300049575 Bacteria 2178
761 Ga0501039_0306851 3300049575 Bacteria 1247
762 Ga0501039_0320305 3300049575 Bacteria 1219
763 Ga0501040_0004593 3300049576 Bacteria 8960
764 Ga0501042_0022449 3300049578 Bacteria 4407
765 Ga0501042_0185854 3300049578 Bacteria 1499
766 Ga0501042_0198660 3300049578 Bacteria 1446
767 Ga0501043_0001890 3300049579 Bacteria 17946
768 Ga0501043_0032700 3300049579 Bacteria 4090
769 Ga0501043_0076674 3300049579 Bacteria 2626
770 Ga0501043_0179838 3300049579 Bacteria 1648
771 Ga0501043_0365493 3300049579 Bacteria 1094
772 Ga0501046_0035676 3300049580 Bacteria 4007
773 Ga0501046_0081176 3300049580 Bacteria 2504
774 Ga0501046_0170270 3300049580 Bacteria 1635
775 Ga0501046_0256573 3300049580 Bacteria 1285
776 Ga0501047_0000010 3300049581 Bacteria 429357
777 Ga0501047_0006124 3300049581 Bacteria 11304
778 Ga0501047_0008824 3300049581 Bacteria 9512
779 Ga0501047_0009108 3300049581 Bacteria 9375
780 Ga0501047_0019030 3300049581 Bacteria 6587
781 Ga0501047_0020190 3300049581 Bacteria 6397
782 Ga0501047_0048484 3300049581 Bacteria 4102
783 Ga0501047_0121098 3300049581 Bacteria 2499
784 Ga0501047_0288600 3300049581 Bacteria 1484
785 Ga0501047_0636817 3300049581 Bacteria 886
786 Ga0501048_0001467 3300049582 Bacteria 17883
787 Ga0501048_0006405 3300049582 Bacteria 8948
788 Ga0501048_0031281 3300049582 Bacteria 3850
789 Ga0501067_0000137 3300049583 Bacteria 40123
790 Ga0501067_0000637 3300049583 Bacteria 18857
791 Ga0501067_0007532 3300049583 Bacteria 6050
792 Ga0501067_0071752 3300049583 Bacteria 1918
793 Ga0501067_0080972 3300049583 Bacteria 1800
794 Ga0501067_0095780 3300049583 Bacteria 1648
795 Ga0501067_0187574 3300049583 Bacteria 1151
796 Ga0501068_0000436 3300049584 Bacteria 21206
797 Ga0501068_0001773 3300049584 Bacteria 11475
798 Ga0501068_0004997 3300049584 Bacteria 7221
799 Ga0501068_0008618 3300049584 Bacteria 5682
800 Ga0501068_0190503 3300049584 Bacteria 1299
801 Ga0501068_0245350 3300049584 Bacteria 1140
802 Ga0501070_0083324 3300049586 Bacteria 2647
803 Ga0501070_0126211 3300049586 Bacteria 2115
804 Ga0501070_0213504 3300049586 Bacteria 1583
805 Ga0501070_0287230 3300049586 Bacteria 1341
806 Ga0501070_0326225 3300049586 Bacteria 1248
807 Ga0501071_0050273 3300049587 Bacteria 3003
808 Ga0501071_0142607 3300049587 Bacteria 1784
809 Ga0501071_0573494 3300049587 Bacteria 867
810 Ga0501072_0013992 3300049588 Bacteria 6149
811 Ga0501072_0042845 3300049588 Bacteria 3556
812 Ga0501072_0116565 3300049588 Bacteria 2127
813 Ga0501072_0371741 3300049588 Bacteria 1135
814 Ga0501073_0000003 3300049589 Bacteria 294975
815 Ga0501073_0000284 3300049589 Bacteria 33459
816 Ga0501073_0003399 3300049589 Bacteria 11970
817 Ga0501073_0019022 3300049589 Bacteria 4963
818 Ga0501073_0047757 3300049589 Bacteria 3007
819 Ga0501073_0098835 3300049589 Bacteria 2026
820 Ga0501074_0015059 3300049590 Bacteria 5626
821 Ga0501074_0083490 3300049590 Bacteria 2290
822 Ga0501074_0264219 3300049590 Bacteria 1223
823 Ga0501074_0383166 3300049590 Bacteria 997
824 Ga0501075_0080363 3300049591 Bacteria 2468
825 Ga0501076_0123319 3300049592 Bacteria 2098
826 Ga0501076_0132604 3300049592 Bacteria 2021
827 Ga0501077_0000016 3300049593 Bacteria 88500
828 Ga0501077_0046830 3300049593 Bacteria 2747
829 Ga0501077_0444866 3300049593 Bacteria 830
830 Ga0501079_0007367 3300049741 Bacteria 8321
831 Ga0501080_0000148 3300049742 Bacteria 50074
832 Ga0501080_0000777 3300049742 Bacteria 25921
833 Ga0501080_0000954 3300049742 Bacteria 23683
834 Ga0501080_0012166 3300049742 Bacteria 7885
835 Ga0501080_0036219 3300049742 Bacteria 4606
836 Ga0501080_0402339 3300049742 Bacteria 1231
837 Ga0501080_0405291 3300049742 Bacteria 1226
838 Ga0501081_0039906 3300049743 Bacteria 3214
839 Ga0501083_0001616 3300049744 Bacteria 15406
840 Ga0501083_0005602 3300049744 Bacteria 8890
841 Ga0501083_0006643 3300049744 Bacteria 8204
842 Ga0501083_0021194 3300049744 Bacteria 4517
843 Ga0501083_0221209 3300049744 Bacteria 1233
844 Ga0501083_0270455 3300049744 Bacteria 1106
845 Ga0501035_0000715 3300049822 Bacteria 35903
846 Ga0501035_0053381 3300049822 Bacteria 3615
847 Ga0501035_0054708 3300049822 Bacteria 3565
848 Ga0501035_0150690 3300049822 Bacteria 2018
849 Ga0501035_0238619 3300049822 Bacteria 1547
850 Ga0501035_0337393 3300049822 Bacteria 1263
851 Ga0501035_0396108 3300049822 Bacteria 1149
852 Ga0501044_0001007 3300049823 Bacteria 33907
853 Ga0501044_0002725 3300049823 Bacteria 20097
854 Ga0501044_0003468 3300049823 Bacteria 17770
855 Ga0501044_0045787 3300049823 Bacteria 4531
856 Ga0501044_0105507 3300049823 Bacteria 2830
857 Ga0501044_0173805 3300049823 Bacteria 2124
858 Ga0501044_0187458 3300049823 Bacteria 2032
859 Ga0501044_0269283 3300049823 Bacteria 1639
860 Ga0501044_0279781 3300049823 Bacteria 1602
861 Ga0501044_0360262 3300049823 Bacteria 1372
862 Ga0501044_0399893 3300049823 Bacteria 1286
863 Ga0501044_0573076 3300049823 Bacteria 1024
864 Ga0501044_0788866 3300049823 Bacteria 830
865 Ga0501045_0002871 3300049824 Bacteria 11773
866 Ga0501045_0080562 3300049824 Bacteria 2401
867 Ga0501045_0160963 3300049824 Bacteria 1671
868 nmdc:mga03683_22577_c1 3300050489 Bacteria 2441
869 nmdc:mga03n38_90280_c1 3300050490 Bacteria 1457
870 nmdc:mga00v17_188552_c1 3300050491 Bacteria 1331
871 nmdc:mga00v17_41055_c1 3300050491 Bacteria 2777
872 nmdc:mga0yw44_275362_c1 3300050492 Bacteria 1124
873 nmdc:mga0k408_11597_c2 3300050493 Bacteria 3488
874 nmdc:mga0k408_66682_c1 3300050493 Bacteria 2097
875 nmdc:mga06z11_255298_c1 3300050494 Bacteria 1033
876 nmdc:mga06z11_56709_c1 3300050494 Bacteria 2027
877 nmdc:mga07m45_29751_c1 3300050496 Bacteria 3023
878 nmdc:mga05p37_1364_c1 3300050507 Bacteria 28406
879 nmdc:mga05p37_1370_c1 3300050507 Bacteria 28331
880 nmdc:mga05p37_415904_c1 3300050507 Bacteria 1566
881 nmdc:mga05p37_43817_c1 3300050507 Bacteria 5505
882 nmdc:mga05p37_59746_c1 3300050507 Bacteria 4694
883 nmdc:mga05p37_726882_c1 3300050507 Bacteria 1098
884 nmdc:mga09592_17705_c1 3300050508 Bacteria 5839
885 nmdc:mga09592_17818_c1 3300050508 Bacteria 5819
886 nmdc:mga09592_361626_c1 3300050508 Bacteria 1256
887 nmdc:mga0qj67_123792_c1 3300050509 Bacteria 2092
888 nmdc:mga0qj67_54837_c1 3300050509 Bacteria 3156
889 nmdc:mga06r32_151_c1 3300050510 Bacteria 52848
890 nmdc:mga06r32_23835_c1 3300050510 Bacteria 5670
891 nmdc:mga06r32_50711_c1 3300050510 Bacteria 3969
892 nmdc:mga08y16_170896_c1 3300050511 Bacteria 2258
893 nmdc:mga08y16_194666_c1 3300050511 Bacteria 2102
894 nmdc:mga08y16_207627_c1 3300050511 Bacteria 2029
895 nmdc:mga08y16_86_c1 3300050511 Bacteria 78136
896 nmdc:mga08y16_965277_c1 3300050511 Bacteria 834
897 nmdc:mga0n895_127360_c1 3300050512 Bacteria 2570
898 nmdc:mga0n895_160300_c1 3300050512 Bacteria 2281
899 nmdc:mga0n895_98008_c1 3300050512 Bacteria 2938
900 nmdc:mga0rr50_147851_c1 3300050513 Bacteria 1896
901 nmdc:mga0rr50_56681_c1 3300050513 Bacteria 2928
902 nmdc:mga0rr50_605984_c1 3300050513 Bacteria 934
903 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
904 nmdc:mga0a205_101195_c1 3300050515 Bacteria 2780
905 nmdc:mga0a205_36209_c1 3300050515 Bacteria 4741
906 nmdc:mga0a205_48308_c1 3300050515 Bacteria 4107
907 nmdc:mga0a205_597394_c1 3300050515 Bacteria 957
908 nmdc:mga0sz30_469_c1 3300050516 Bacteria 15301
909 Ga0495612_0060917 3300053078 Bacteria 1563
910 Ga0500635_0000080 3300053080 Bacteria 63214
911 Ga0495595_0015517 3300053084 Bacteria 3250
912 Ga0495619_0019642 3300053085 Bacteria 4297
913 Ga0495619_0089895 3300053085 Bacteria 2078
914 Ga0495619_0103208 3300053085 Bacteria 1942
915 Ga0495619_0321850 3300053085 Bacteria 1070
916 Ga0495619_0418340 3300053085 Bacteria 925
917 Ga0500578_0119769 3300053086 Bacteria 1655
918 Ga0500578_0154959 3300053086 Bacteria 1425
919 Ga0500643_002563 3300053087 Bacteria 9261
920 Ga0500643_009378 3300053087 Bacteria 3744
921 Ga0500643_043611 3300053087 Bacteria 1307
922 Ga0500646_0011647 3300053090 Bacteria 2263
923 Ga0500647_0099551 3300053091 Bacteria 1388
924 Ga0500583_0050564 3300053092 Bacteria 1928
925 Ga0500651_0041785 3300053093 Bacteria 2890
926 Ga0500651_0072450 3300053093 Bacteria 2142
927 Ga0500566_0008660 3300053094 Bacteria 6017
928 Ga0500566_0128903 3300053094 Bacteria 1356
929 Ga0500641_0000281 3300053096 Bacteria 19016
930 Ga0500641_0002911 3300053096 Bacteria 6073
931 Ga0500641_0042425 3300053096 Bacteria 1843
932 Ga0500654_072357 3300053099 Bacteria 1670
933 Ga0500556_0061718 3300053104 Bacteria 1382
934 Ga0500556_0099158 3300053104 Bacteria 1120
935 Ga0500562_083394 3300053108 Bacteria 866
936 Ga0500569_000298 3300053109 Bacteria 7944
937 Ga0500595_002391 3300053119 Bacteria 9372
938 Ga0500595_028795 3300053119 Bacteria 1891
939 Ga0500607_132198 3300053121 Bacteria 1188
940 Ga0500608_001366 3300053122 Bacteria 8732
941 Ga0500614_007297 3300053123 Bacteria 2328
942 Ga0500618_037128 3300053125 Bacteria 1127
943 Ga0500628_044927 3300053129 Bacteria 1025
944 Ga0500642_0171449 3300053130 Bacteria 1016
945 Ga0500655_031147 3300053133 Bacteria 1028
946 Ga0500658_0008025 3300053134 Bacteria 3902
947 Ga0500658_0018884 3300053134 Bacteria 2590
948 Ga0500559_0152059 3300053136 Bacteria 1087
949 Ga0500573_0185731 3300053140 Bacteria 1114
950 Ga0500590_008183 3300053148 Bacteria 5207
951 Ga0500603_046359 3300053150 Bacteria 1176
952 Ga0500604_0003297 3300053151 Bacteria 4346
953 Ga0500604_0009823 3300053151 Bacteria 2551
954 Ga0500604_0148306 3300053151 Bacteria 795
955 Ga0500616_0013469 3300053153 Bacteria 4746
956 Ga0500616_0034243 3300053153 Bacteria 2767
957 Ga0500624_001445 3300053157 Bacteria 3852
958 Ga0500634_0000087 3300053161 Bacteria 35438
959 Ga0500638_058152 3300053162 Bacteria 1862
960 Ga0500639_114379 3300053163 Bacteria 1307
961 Ga0500636_0002254 3300053177 Bacteria 10696
962 Ga0500637_0022327 3300053178 Bacteria 3446
963 Ga0500637_0183722 3300053178 Bacteria 1197
964 Ga0500576_019706 3300053725 Bacteria 3076
965 Ga0500625_047661 3300053729 Bacteria 1992
966 Ga0500609_000390 3300053731 Bacteria 6488
967 Ga0500596_000190 3300053735 Bacteria 10041
968 Ga0501084_0007012 3300054114 Bacteria 9288
969 Ga0501084_0021772 3300054114 Bacteria 5346
970 Ga0501084_0048484 3300054114 Bacteria 3556
971 Ga0501084_0075497 3300054114 Bacteria 2824
972 Ga0501084_0094788 3300054114 Bacteria 2506
973 Ga0501084_0707123 3300054114 Bacteria 850
974 Ga0587073_0031457 3300059492 Bacteria 1099
975 Ga0501082_0004670 3300060353 Bacteria 11950
976 Ga0501082_0006711 3300060353 Bacteria 9955
977 Ga0501082_0195719 3300060353 Bacteria 1759
978 Ga0501082_0492114 3300060353 Bacteria 1072
979 Ga0501082_0496140 3300060353 Bacteria 1067
980 Ga0501082_0657327 3300060353 Bacteria 917
981 Ga0530510_0145921 3300061734 Bacteria 1745

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100012557 Ga0070680_1000125574 191
2 3300005344 Ga0070661_100075453 Ga0070661_1000754531 191
3 3300005458 Ga0070681_10006100 Ga0070681_100061009 191
4 3300005530 Ga0070679_100032781 Ga0070679_1000327812 191
5 3300005577 Ga0068857_100595835 Ga0068857_1005958352 191
6 3300025912 Ga0207707_10093101 Ga0207707_100931012 191
7 3300025917 Ga0207660_10132914 Ga0207660_101329142 191
8 3300025921 Ga0207652_10018761 Ga0207652_100187612 191
9 3300046452 Ga0495617_151033 Ga0495617_151033_100_714 194
10 3300005327 Ga0070658_10026519 Ga0070658_100265194 197
11 3300005563 Ga0068855_100214717 Ga0068855_1002147172 197
12 3300025949 Ga0207667_10304937 Ga0207667_103049372 197
13 3300005563 Ga0068855_100000009 Ga0068855_100000009136 198
14 3300005563 Ga0068855_100000093 Ga0068855_10000009321 198
15 3300025949 Ga0207667_10000045 Ga0207667_1000004599 198
16 3300025949 Ga0207667_10000588 Ga0207667_1000058816 198
17 3300046523 Ga0495644_0029126 Ga0495644_0029126_222_959 198
18 3300047447 Ga0495685_024034 Ga0495685_024034_898_1635 198
19 3300042876 Ga0451577_0355087 Ga0451577_0355087_238_870 199
20 3300005347 Ga0070668_100117910 Ga0070668_1001179102 200
21 3300044673 Ga0453683_0506275 Ga0453683_0506275_41_676 200
22 3300031251 Ga0265327_10000054 Ga0265327_1000005464 203
23 3300047472 Ga0495686_0002708 Ga0495686_0002708_12449_13192 203
24 3300005333 Ga0070677_10017189 Ga0070677_100171893 204
25 3300025940 Ga0207691_10105100 Ga0207691_101051003 204
26 3300046515 Ga0495620_0044994 Ga0495620_0044994_1257_1901 205
27 3300005577 Ga0068857_100585764 Ga0068857_1005857641 207
28 3300009545 Ga0105237_10972741 Ga0105237_109727411 207
29 3300010375 Ga0105239_10243793 Ga0105239_102437933 207
30 3300013102 Ga0157371_10020758 Ga0157371_100207583 207
31 3300005614 Ga0068856_100014274 Ga0068856_1000142748 209
32 3300026078 Ga0207702_10161501 Ga0207702_101615012 209
33 3300005844 Ga0068862_100057627 Ga0068862_1000576273 211
34 3300013104 Ga0157370_10002875 Ga0157370_100028756 211
35 3300013296 Ga0157374_10006020 Ga0157374_100060202 211
36 3300013306 Ga0163162_10385835 Ga0163162_103858352 211
37 3300013308 Ga0157375_11682575 Ga0157375_116825751 211
38 3300031251 Ga0265327_10071826 Ga0265327_100718262 212
39 3300005327 Ga0070658_10185814 Ga0070658_101858142 213
40 3300025909 Ga0207705_10197352 Ga0207705_101973522 213
41 3300035119 Ga0373956_0094151 Ga0373956_0094151_588_1262 213
42 3300005843 Ga0068860_100011656 Ga0068860_1000116563 215
43 3300006358 Ga0068871_100265200 Ga0068871_1002652002 215
44 3300046675 Ga0495657_0257678 Ga0495657_0257678_10_693 216
45 3300025893 Ga0207682_10009231 Ga0207682_100092312 221
46 3300028800 Ga0265338_10021228 Ga0265338_1002122810 224
47 3300005334 Ga0068869_100009547 Ga0068869_1000095477 225
48 3300005617 Ga0068859_100021820 Ga0068859_1000218202 225
49 3300006028 Ga0070717_10141223 Ga0070717_101412232 225
50 3300006931 Ga0097620_100021824 Ga0097620_1000218242 225
51 3300025916 Ga0207663_10242979 Ga0207663_102429792 225
52 3300038443 Ga0395901_0000225 Ga0395901_0000225_47358_48092 225
53 3300005329 Ga0070683_100023828 Ga0070683_1000238283 226
54 3300005336 Ga0070680_100015196 Ga0070680_1000151964 226
55 3300005434 Ga0070709_10068208 Ga0070709_100682083 226
56 3300005437 Ga0070710_10004304 Ga0070710_100043046 226
57 3300005439 Ga0070711_100053143 Ga0070711_1000531433 226
58 3300005535 Ga0070684_100117049 Ga0070684_1001170493 226
59 3300005539 Ga0068853_100341419 Ga0068853_1003414192 226
60 3300005547 Ga0070693_100003633 Ga0070693_1000036334 226
61 3300005577 Ga0068857_100942842 Ga0068857_1009428421 226
62 3300005578 Ga0068854_100133504 Ga0068854_1001335043 226
63 3300005614 Ga0068856_100081363 Ga0068856_1000813634 226
64 3300006175 Ga0070712_100015199 Ga0070712_1000151995 226
65 3300009093 Ga0105240_10299790 Ga0105240_102997903 226
66 3300013102 Ga0157371_10223626 Ga0157371_102236262 226
67 3300025906 Ga0207699_10035071 Ga0207699_100350714 226
68 3300025913 Ga0207695_10385409 Ga0207695_103854091 226
69 3300025917 Ga0207660_10124343 Ga0207660_101243433 226
70 3300025929 Ga0207664_10005464 Ga0207664_100054647 226
71 3300025949 Ga0207667_10691039 Ga0207667_106910391 226
72 3300025981 Ga0207640_10110400 Ga0207640_101104003 226
73 3300026041 Ga0207639_10236214 Ga0207639_102362143 226
74 3300026078 Ga0207702_10070400 Ga0207702_100704003 226
75 3300026116 Ga0207674_10386736 Ga0207674_103867362 226
76 3300049824 Ga0501045_0080562 Ga0501045_0080562_561_1298 226
77 3300060353 Ga0501082_0657327 Ga0501082_0657327_68_805 226
78 3300021388 Ga0213875_10002695 Ga0213875_100026959 228
79 3300037853 Ga0436364_1026771 Ga0436364_1026771_4717_5454 228
80 3300048929 Ga0496126_0569822 Ga0496126_0569822_41_781 228
81 3300049574 Ga0501038_0481291 Ga0501038_0481291_227_937 228
82 3300025924 Ga0207694_10120857 Ga0207694_101208573 229
83 3300047472 Ga0495686_0024345 Ga0495686_0024345_1052_1789 229
84 3300048922 Ga0496119_0002497 Ga0496119_0002497_15307_16044 229
85 3300049587 Ga0501071_0573494 Ga0501071_0573494_61_798 229
86 3300050511 nmdc:mga08y16_965277_c1 nmdc:mga08y16_965277_c1_22_759 229
87 3300005344 Ga0070661_100006288 Ga0070661_1000062883 230
88 3300005366 Ga0070659_100053819 Ga0070659_1000538192 230
89 3300005539 Ga0068853_100078999 Ga0068853_1000789994 230
90 3300005578 Ga0068854_100703289 Ga0068854_1007032891 230
91 3300005616 Ga0068852_100273793 Ga0068852_1002737932 230
92 3300009093 Ga0105240_10131409 Ga0105240_101314092 230
93 3300009551 Ga0105238_10118377 Ga0105238_101183773 230
94 3300010375 Ga0105239_11154845 Ga0105239_111548451 230
95 3300013104 Ga0157370_10193886 Ga0157370_101938862 230
96 3300013105 Ga0157369_10196501 Ga0157369_101965012 230
97 3300035170 Ga0373943_0239082 Ga0373943_0239082_161_898 230
98 3300035695 Ga0373927_0036738 Ga0373927_0036738_2172_2909 230
99 3300021388 Ga0213875_10093515 Ga0213875_100935152 231
100 3300031616 Ga0307508_10100583 Ga0307508_101005832 231
101 3300037853 Ga0436364_0382668 Ga0436364_0382668_1943_2680 231
102 3300005614 Ga0068856_100049571 Ga0068856_1000495714 232
103 3300009098 Ga0105245_10101542 Ga0105245_101015422 232
104 3300009177 Ga0105248_10065402 Ga0105248_100654024 232
105 3300009553 Ga0105249_10820214 Ga0105249_108202141 232
106 3300025903 Ga0207680_10095618 Ga0207680_100956183 232
107 3300025941 Ga0207711_10073803 Ga0207711_100738032 232
108 3300025961 Ga0207712_10332399 Ga0207712_103323992 232
109 3300026078 Ga0207702_10117617 Ga0207702_101176172 232
110 3300031824 Ga0307413_10260538 Ga0307413_102605382 232
111 3300031852 Ga0307410_10106049 Ga0307410_101060492 232
112 3300032002 Ga0307416_100497318 Ga0307416_1004973182 232
113 3300032005 Ga0307411_10157678 Ga0307411_101576782 232
114 3300044694 Ga0466963_0196059 Ga0466963_0196059_61_783 232
115 3300049579 Ga0501043_0179838 Ga0501043_0179838_673_1410 233
116 iso_pu_bacteria 2511231221 2512033511 233
117 iso_pu_bacteria 2523231067 2523470308 233
118 iso_pu_bacteria 2643221547 2643756642 233
119 iso_pu_bacteria 2643221580 2643911245 233
120 iso_pu_bacteria 2643221591 2643964098 233
121 iso_pu_bacteria 2643221598 2644001870 233
122 iso_pu_bacteria 2643221614 2644085262 233
123 iso_pu_bacteria 2643221661 2644342814 233
124 iso_pu_bacteria 2643221666 2644366114 233
125 iso_pu_bacteria 2643221674 2644410990 233
126 iso_pu_bacteria 2671180139 2671692875 233
127 iso_pu_bacteria 2738543031 2739350346 233
128 iso_pu_bacteria 2821443989 2821449361 233
129 iso_pu_bacteria 2842333319 2842333672 233
130 iso_pu_bacteria 2844533157 2844533636 233
131 iso_pu_bacteria 2883577096 2883578858 233
132 iso_pu_bacteria 2894772417 2894777576 233
133 iso_pu_bacteria 2894817345 2894819717 233
134 iso_pu_bacteria 2897803580 2897804328 233
135 iso_pu_bacteria 2909399089 2909401678 233
136 iso_pu_bacteria 2929199973 2929201504 233
137 iso_pu_bacteria 2932401849 2932403861 233
138 iso_pu_bacteria 8054002106 8054004926 233
139 iso_pu_bacteria 8055909800 8055915707 233
140 3300003316 rootH1_10164059 rootH1_101640591 234
141 3300003320 rootH2_10052210 rootH2_1005221026 234
142 3300003322 rootL2_10218209 rootL2_102182092 234
143 3300003323 rootH1_10219969 rootH1_102199691 234
144 3300005289 Ga0065704_10171961 Ga0065704_101719611 234
145 3300005293 Ga0065715_10166128 Ga0065715_101661282 234
146 3300005327 Ga0070658_10000059 Ga0070658_10000059105 234
147 3300005328 Ga0070676_10016919 Ga0070676_100169192 234
148 3300005331 Ga0070670_100151241 Ga0070670_1001512412 234
149 3300005339 Ga0070660_100048416 Ga0070660_1000484161 234
150 3300005347 Ga0070668_100064590 Ga0070668_1000645902 234
151 3300005347 Ga0070668_100339965 Ga0070668_1003399652 234
152 3300005353 Ga0070669_100010472 Ga0070669_1000104723 234
153 3300005365 Ga0070688_100048736 Ga0070688_1000487362 234
154 3300005459 Ga0068867_100087828 Ga0068867_1000878282 234
155 3300005466 Ga0070685_10004976 Ga0070685_100049762 234
156 3300005466 Ga0070685_10047083 Ga0070685_100470832 234
157 3300005543 Ga0070672_100016229 Ga0070672_1000162296 234
158 3300005549 Ga0070704_100346552 Ga0070704_1003465521 234
159 3300005563 Ga0068855_100002770 Ga0068855_10000277013 234
160 3300005564 Ga0070664_100671954 Ga0070664_1006719542 234
161 3300005578 Ga0068854_100290918 Ga0068854_1002909182 234
162 3300005617 Ga0068859_100142510 Ga0068859_1001425102 234
163 3300005617 Ga0068859_100206335 Ga0068859_1002063352 234
164 3300005719 Ga0068861_100084612 Ga0068861_1000846122 234
165 3300005840 Ga0068870_10102381 Ga0068870_101023812 234
166 3300005841 Ga0068863_100254720 Ga0068863_1002547203 234
167 3300005844 Ga0068862_100007610 Ga0068862_1000076107 234
168 3300006931 Ga0097620_100142526 Ga0097620_1001425262 234
169 3300006931 Ga0097620_100206334 Ga0097620_1002063342 234
170 3300009094 Ga0111539_10029219 Ga0111539_100292197 234
171 3300009553 Ga0105249_10352395 Ga0105249_103523951 234
172 3300013297 Ga0157378_10113810 Ga0157378_101138102 234
173 3300013297 Ga0157378_10242253 Ga0157378_102422532 234
174 3300013306 Ga0163162_10037368 Ga0163162_100373682 234
175 3300013308 Ga0157375_10053720 Ga0157375_100537202 234
176 3300014326 Ga0157380_10034981 Ga0157380_100349813 234
177 3300014745 Ga0157377_10024421 Ga0157377_100244212 234
178 3300014745 Ga0157377_10068405 Ga0157377_100684051 234
179 3300017792 Ga0163161_10091543 Ga0163161_100915432 234
180 3300017792 Ga0163161_10207866 Ga0163161_102078662 234
181 3300025907 Ga0207645_10281570 Ga0207645_102815702 234
182 3300025908 Ga0207643_10015054 Ga0207643_100150543 234
183 3300025908 Ga0207643_10152198 Ga0207643_101521982 234
184 3300025909 Ga0207705_10000195 Ga0207705_1000019548 234
185 3300025909 Ga0207705_10144164 Ga0207705_101441642 234
186 3300025920 Ga0207649_10397255 Ga0207649_103972551 234
187 3300025923 Ga0207681_10306321 Ga0207681_103063212 234
188 3300025925 Ga0207650_10010512 Ga0207650_100105123 234
189 3300025933 Ga0207706_10081394 Ga0207706_100813943 234
190 3300025934 Ga0207686_10150068 Ga0207686_101500682 234
191 3300025936 Ga0207670_10002994 Ga0207670_100029945 234
192 3300025936 Ga0207670_10036512 Ga0207670_100365124 234
193 3300025949 Ga0207667_10005483 Ga0207667_100054839 234
194 3300025960 Ga0207651_10113471 Ga0207651_101134712 234
195 3300025972 Ga0207668_10516854 Ga0207668_105168541 234
196 3300026088 Ga0207641_10481912 Ga0207641_104819122 234
197 3300026089 Ga0207648_10134622 Ga0207648_101346222 234
198 3300026089 Ga0207648_10157664 Ga0207648_101576642 234
199 3300026116 Ga0207674_10049513 Ga0207674_100495133 234
200 3300026118 Ga0207675_100008841 Ga0207675_1000088417 234
201 3300028380 Ga0268265_10067990 Ga0268265_100679902 234
202 3300028380 Ga0268265_10374729 Ga0268265_103747292 234
203 3300028381 Ga0268264_10754189 Ga0268264_107541891 234
204 3300028577 Ga0265318_10025807 Ga0265318_100258073 234
205 3300035172 Ga0373955_0277100 Ga0373955_0277100_154_891 234
206 3300035725 Ga0373947_0084690 Ga0373947_0084690_275_1012 234
207 3300042876 Ga0451577_0053495 Ga0451577_0053495_827_1564 234
208 3300044712 Ga0453684_0005311 Ga0453684_0005311_21307_22044 234
209 3300044712 Ga0453684_0025337 Ga0453684_0025337_4614_5351 234
210 3300044712 Ga0453684_0293152 Ga0453684_0293152_1002_1739 234
211 3300045051 Ga0451576_0526043 Ga0451576_0526043_274_1011 234
212 3300046472 Ga0495580_0105332 Ga0495580_0105332_490_1227 234
213 3300046476 Ga0495662_0065385 Ga0495662_0065385_370_1107 234
214 3300046535 Ga0495586_0149863 Ga0495586_0149863_235_972 234
215 3300046536 Ga0495587_0191124 Ga0495587_0191124_111_848 234
216 3300046683 Ga0495658_0036189 Ga0495658_0036189_1960_2697 234
217 3300047321 Ga0495676_0333307 Ga0495676_0333307_39_776 234
218 3300050508 nmdc:mga09592_361626_c1 nmdc:mga09592_361626_c1_482_1231 234
219 3300050511 nmdc:mga08y16_207627_c1 nmdc:mga08y16_207627_c1_1252_2001 234
220 3300053085 Ga0495619_0418340 Ga0495619_0418340_105_842 234
221 3300005341 Ga0070691_10052485 Ga0070691_100524852 235
222 3300037418 Ga0395900_0000128 Ga0395900_0000128_11513_12379 235
223 3300046474 Ga0495605_0066289 Ga0495605_0066289_680_1417 235
224 3300046513 Ga0495616_0152338 Ga0495616_0152338_281_1018 235
225 3300046518 Ga0495631_0120716 Ga0495631_0120716_65_802 235
226 3300049569 Ga0501032_0001016 Ga0501032_0001016_9401_10138 235
227 3300049572 Ga0501036_0009704 Ga0501036_0009704_2908_3645 235
228 3300049573 Ga0501037_0009635 Ga0501037_0009635_4267_5004 235
229 3300049583 Ga0501067_0000137 Ga0501067_0000137_7568_8305 235
230 3300049584 Ga0501068_0000436 Ga0501068_0000436_20083_20820 235
231 3300049589 Ga0501073_0000003 Ga0501073_0000003_59828_60565 235
232 3300049593 Ga0501077_0000016 Ga0501077_0000016_39710_40447 235
233 3300049742 Ga0501080_0000777 Ga0501080_0000777_22338_23075 235
234 3300049823 Ga0501044_0002725 Ga0501044_0002725_9481_10218 235
235 3300053151 Ga0500604_0009823 Ga0500604_0009823_583_1320 235
236 3300060353 Ga0501082_0195719 Ga0501082_0195719_20_757 235
237 3300003215 JGI25153J46596_10005338 JGI25153J46596_100053381 236
238 3300005328 Ga0070676_10007291 Ga0070676_100072915 236
239 3300005340 Ga0070689_100021631 Ga0070689_1000216313 236
240 3300005340 Ga0070689_100187038 Ga0070689_1001870382 236
241 3300005340 Ga0070689_100310547 Ga0070689_1003105472 236
242 3300005341 Ga0070691_10333279 Ga0070691_103332791 236
243 3300005353 Ga0070669_100339713 Ga0070669_1003397132 236
244 3300005354 Ga0070675_100203670 Ga0070675_1002036702 236
245 3300005365 Ga0070688_100004472 Ga0070688_1000044725 236
246 3300005365 Ga0070688_100237137 Ga0070688_1002371372 236
247 3300005438 Ga0070701_10177097 Ga0070701_101770972 236
248 3300005441 Ga0070700_100451148 Ga0070700_1004511482 236
249 3300005456 Ga0070678_100017547 Ga0070678_1000175472 236
250 3300005456 Ga0070678_100216832 Ga0070678_1002168322 236
251 3300005466 Ga0070685_10129927 Ga0070685_101299272 236
252 3300005535 Ga0070684_100266404 Ga0070684_1002664043 236
253 3300005543 Ga0070672_100195947 Ga0070672_1001959472 236
254 3300005548 Ga0070665_100378526 Ga0070665_1003785262 236
255 3300005615 Ga0070702_100429686 Ga0070702_1004296862 236
256 3300005618 Ga0068864_100041370 Ga0068864_1000413702 236
257 3300005985 Ga0081539_10005853 Ga0081539_100058532 236
258 3300006048 Ga0075363_100077948 Ga0075363_1000779482 236
259 3300006051 Ga0075364_10179402 Ga0075364_101794022 236
260 3300006178 Ga0075367_10308272 Ga0075367_103082721 236
261 3300006237 Ga0097621_100397803 Ga0097621_1003978032 236
262 3300006844 Ga0075428_100181493 Ga0075428_1001814933 236
263 3300006881 Ga0068865_100211830 Ga0068865_1002118302 236
264 3300009094 Ga0111539_10019117 Ga0111539_100191179 236
265 3300009094 Ga0111539_10297775 Ga0111539_102977752 236
266 3300009177 Ga0105248_10060900 Ga0105248_100609005 236
267 3300009551 Ga0105238_10295610 Ga0105238_102956102 236
268 3300009551 Ga0105238_10822266 Ga0105238_108222661 236
269 3300009553 Ga0105249_10383816 Ga0105249_103838162 236
270 3300013296 Ga0157374_11057301 Ga0157374_110573011 236
271 3300013297 Ga0157378_10216303 Ga0157378_102163032 236
272 3300014326 Ga0157380_10096177 Ga0157380_100961773 236
273 3300014326 Ga0157380_10154705 Ga0157380_101547052 236
274 3300014968 Ga0157379_10427938 Ga0157379_104279382 236
275 3300014969 Ga0157376_10546622 Ga0157376_105466222 236
276 3300025250 Ga0209026_1010008 Ga0209026_10100081 236
277 3300025254 Ga0209148_1009797 Ga0209148_10097972 236
278 3300025297 Ga0209758_1000252 Ga0209758_100025251 236
279 3300025302 Ga0207426_1026381 Ga0207426_10263811 236
280 3300025899 Ga0207642_10092372 Ga0207642_100923722 236
281 3300025903 Ga0207680_10416950 Ga0207680_104169502 236
282 3300025907 Ga0207645_10009341 Ga0207645_100093416 236
283 3300025912 Ga0207707_10081952 Ga0207707_100819523 236
284 3300025923 Ga0207681_10040157 Ga0207681_100401572 236
285 3300025927 Ga0207687_10182829 Ga0207687_101828292 236
286 3300025936 Ga0207670_10001178 Ga0207670_1000117812 236
287 3300025936 Ga0207670_10161876 Ga0207670_101618763 236
288 3300025936 Ga0207670_10369997 Ga0207670_103699972 236
289 3300025940 Ga0207691_10079984 Ga0207691_100799843 236
290 3300025941 Ga0207711_10028623 Ga0207711_100286233 236
291 3300025942 Ga0207689_10309093 Ga0207689_103090932 236
292 3300025961 Ga0207712_10248547 Ga0207712_102485471 236
293 3300025972 Ga0207668_10459451 Ga0207668_104594511 236
294 3300025986 Ga0207658_10178234 Ga0207658_101782341 236
295 3300026023 Ga0207677_10436448 Ga0207677_104364482 236
296 3300026023 Ga0207677_10497113 Ga0207677_104971131 236
297 3300026035 Ga0207703_10444934 Ga0207703_104449341 236
298 3300026035 Ga0207703_10495861 Ga0207703_104958611 236
299 3300026067 Ga0207678_10790741 Ga0207678_107907411 236
300 3300026075 Ga0207708_10054966 Ga0207708_100549663 236
301 3300026095 Ga0207676_10385140 Ga0207676_103851402 236
302 3300026118 Ga0207675_100059146 Ga0207675_1000591463 236
303 3300026121 Ga0207683_10009099 Ga0207683_100090999 236
304 3300027907 Ga0207428_10084960 Ga0207428_100849603 236
305 3300028379 Ga0268266_10331239 Ga0268266_103312392 236
306 3300028381 Ga0268264_10195286 Ga0268264_101952862 236
307 3300031251 Ga0265327_10004615 Ga0265327_100046154 236
308 3300031727 Ga0316576_10107675 Ga0316576_101076752 236
309 3300033180 Ga0307510_10056928 Ga0307510_100569283 236
310 3300034817 Ga0373948_0044476 Ga0373948_0044476_134_868 236
311 3300034819 Ga0373958_0022235 Ga0373958_0022235_127_861 236
312 3300035084 Ga0373928_0022630 Ga0373928_0022630_449_1183 236
313 3300035084 Ga0373928_0023704 Ga0373928_0023704_119_856 236
314 3300035088 Ga0373940_0066669 Ga0373940_0066669_143_877 236
315 3300035089 Ga0373944_0024197 Ga0373944_0024197_50_784 236
316 3300035090 Ga0373949_0020589 Ga0373949_0020589_48_782 236
317 3300035091 Ga0373951_0080872 Ga0373951_0080872_74_808 236
318 3300035112 Ga0373932_0010736 Ga0373932_0010736_1069_1803 236
319 3300035115 Ga0373941_0103506 Ga0373941_0103506_155_889 236
320 3300035171 Ga0373946_0006872 Ga0373946_0006872_2480_3214 236
321 3300035172 Ga0373955_0171615 Ga0373955_0171615_319_1053 236
322 3300035691 Ga0373931_0014133 Ga0373931_0014133_276_1010 236
323 3300035692 Ga0373935_0350407 Ga0373935_0350407_302_1036 236
324 3300035695 Ga0373927_0245304 Ga0373927_0245304_34_768 236
325 3300035725 Ga0373947_0090790 Ga0373947_0090790_13_747 236
326 3300036401 Ga0373937_0173087 Ga0373937_0173087_586_1320 236
327 3300036712 Ga0316584_0050930 Ga0316584_0050930_972_1706 236
328 3300036712 Ga0316584_0103663 Ga0316584_0103663_89_823 236
329 3300046462 Ga0495651_0204340 Ga0495651_0204340_492_1226 236
330 3300046477 Ga0495664_0275482 Ga0495664_0275482_246_980 236
331 3300046660 Ga0495625_0370338 Ga0495625_0370338_66_803 236
332 3300046684 Ga0495669_0000001 Ga0495669_0000001_167669_168406 236
333 3300047445 Ga0495677_0046685 Ga0495677_0046685_89_826 236
334 3300048088 Ga0495602_0087653 Ga0495602_0087653_285_1019 236
335 3300048905 Ga0496102_0274148 Ga0496102_0274148_829_1563 236
336 3300048908 Ga0496105_0019423 Ga0496105_0019423_974_1708 236
337 3300048913 Ga0496110_0030717 Ga0496110_0030717_3046_3780 236
338 3300048913 Ga0496110_0090979 Ga0496110_0090979_480_1214 236
339 3300048914 Ga0496111_0076955 Ga0496111_0076955_1604_2338 236
340 3300048915 Ga0496112_0059344 Ga0496112_0059344_1027_1761 236
341 3300048917 Ga0496114_0021309 Ga0496114_0021309_1849_2583 236
342 3300048917 Ga0496114_0383113 Ga0496114_0383113_99_833 236
343 3300049571 Ga0501034_0009574 Ga0501034_0009574_2530_3264 236
344 3300049583 Ga0501067_0080972 Ga0501067_0080972_273_1007 236
345 3300049588 Ga0501072_0013992 Ga0501072_0013992_3913_4647 236
346 3300049590 Ga0501074_0083490 Ga0501074_0083490_192_926 236
347 3300049742 Ga0501080_0012166 Ga0501080_0012166_5524_6258 236
348 3300049744 Ga0501083_0005602 Ga0501083_0005602_948_1682 236
349 3300050490 nmdc:mga03n38_90280_c1 nmdc:mga03n38_90280_c1_267_1001 236
350 3300050491 nmdc:mga00v17_41055_c1 nmdc:mga00v17_41055_c1_1781_2515 236
351 3300050493 nmdc:mga0k408_66682_c1 nmdc:mga0k408_66682_c1_429_1163 236
352 3300050511 nmdc:mga08y16_170896_c1 nmdc:mga08y16_170896_c1_776_1510 236
353 3300053084 Ga0495595_0015517 Ga0495595_0015517_1337_2071 236
354 3300053104 Ga0500556_0099158 Ga0500556_0099158_68_811 236
355 3300053119 Ga0500595_028795 Ga0500595_028795_313_1047 236
356 3300053125 Ga0500618_037128 Ga0500618_037128_297_1040 236
357 3300053153 Ga0500616_0013469 Ga0500616_0013469_3191_3925 236
358 3300054114 Ga0501084_0021772 Ga0501084_0021772_500_1234 236
359 3300060353 Ga0501082_0004670 Ga0501082_0004670_4108_4842 236
360 3300003215 JGI25153J46596_10000054 JGI25153J46596_10000054131 237
361 3300003791 Ga0055530_10000135 Ga0055530_1000013543 237
362 3300003794 Ga0055531_10040955 Ga0055531_100409552 237
363 3300003794 Ga0055531_10042648 Ga0055531_100426481 237
364 3300003911 JGI25405J52794_10026189 JGI25405J52794_100261892 237
365 3300005262 Ga0065165_1000563 Ga0065165_100056322 237
366 3300005289 Ga0065704_10204155 Ga0065704_102041551 237
367 3300005327 Ga0070658_10008345 Ga0070658_100083451 237
368 3300005330 Ga0070690_100150919 Ga0070690_1001509192 237
369 3300005331 Ga0070670_100004475 Ga0070670_10000447512 237
370 3300005335 Ga0070666_10070550 Ga0070666_100705502 237
371 3300005336 Ga0070680_100054683 Ga0070680_1000546834 237
372 3300005336 Ga0070680_100069381 Ga0070680_1000693812 237
373 3300005336 Ga0070680_100085886 Ga0070680_1000858863 237
374 3300005337 Ga0070682_100392218 Ga0070682_1003922181 237
375 3300005338 Ga0068868_100803488 Ga0068868_1008034881 237
376 3300005347 Ga0070668_100005964 Ga0070668_1000059645 237
377 3300005347 Ga0070668_100219341 Ga0070668_1002193411 237
378 3300005355 Ga0070671_100103151 Ga0070671_1001031513 237
379 3300005364 Ga0070673_100344741 Ga0070673_1003447412 237
380 3300005366 Ga0070659_100143047 Ga0070659_1001430472 237
381 3300005367 Ga0070667_100226114 Ga0070667_1002261142 237
382 3300005434 Ga0070709_10013740 Ga0070709_100137403 237
383 3300005435 Ga0070714_100000490 Ga0070714_1000004903 237
384 3300005436 Ga0070713_100000278 Ga0070713_10000027828 237
385 3300005436 Ga0070713_100092449 Ga0070713_1000924492 237
386 3300005436 Ga0070713_100461690 Ga0070713_1004616901 237
387 3300005437 Ga0070710_10003676 Ga0070710_100036764 237
388 3300005439 Ga0070711_100003976 Ga0070711_1000039766 237
389 3300005456 Ga0070678_100021018 Ga0070678_1000210183 237
390 3300005458 Ga0070681_10008082 Ga0070681_100080822 237
391 3300005458 Ga0070681_10044484 Ga0070681_100444845 237
392 3300005518 Ga0070699_100187786 Ga0070699_1001877862 237
393 3300005536 Ga0070697_100283296 Ga0070697_1002832962 237
394 3300005539 Ga0068853_100005273 Ga0068853_1000052732 237
395 3300005543 Ga0070672_100153850 Ga0070672_1001538503 237
396 3300005546 Ga0070696_100069257 Ga0070696_1000692572 237
397 3300005546 Ga0070696_100469248 Ga0070696_1004692481 237
398 3300005548 Ga0070665_100047432 Ga0070665_1000474323 237
399 3300005548 Ga0070665_100318342 Ga0070665_1003183422 237
400 3300005549 Ga0070704_100370403 Ga0070704_1003704032 237
401 3300005549 Ga0070704_100446949 Ga0070704_1004469491 237
402 3300005563 Ga0068855_100079212 Ga0068855_1000792124 237
403 3300005563 Ga0068855_100101153 Ga0068855_1001011532 237
404 3300005563 Ga0068855_100276319 Ga0068855_1002763192 237
405 3300005577 Ga0068857_100106220 Ga0068857_1001062203 237
406 3300005614 Ga0068856_100246423 Ga0068856_1002464232 237
407 3300005618 Ga0068864_100000154 Ga0068864_10000015428 237
408 3300005841 Ga0068863_100000172 Ga0068863_10000017231 237
409 3300005842 Ga0068858_100000639 Ga0068858_10000063912 237
410 3300005842 Ga0068858_100166226 Ga0068858_1001662263 237
411 3300005842 Ga0068858_100595772 Ga0068858_1005957721 237
412 3300005843 Ga0068860_100000151 Ga0068860_10000015127 237
413 3300005843 Ga0068860_100008879 Ga0068860_1000088794 237
414 3300005843 Ga0068860_100754858 Ga0068860_1007548582 237
415 3300005843 Ga0068860_100902311 Ga0068860_1009023111 237
416 3300005844 Ga0068862_100014501 Ga0068862_1000145015 237
417 3300005844 Ga0068862_100263434 Ga0068862_1002634342 237
418 3300005937 Ga0081455_10000347 Ga0081455_100003476 237
419 3300005937 Ga0081455_10000477 Ga0081455_1000047727 237
420 3300005937 Ga0081455_10002412 Ga0081455_1000241216 237
421 3300005937 Ga0081455_10012372 Ga0081455_100123726 237
422 3300005937 Ga0081455_10029489 Ga0081455_100294895 237
423 3300005937 Ga0081455_10046937 Ga0081455_100469374 237
424 3300005937 Ga0081455_10078322 Ga0081455_100783223 237
425 3300005981 Ga0081538_10001364 Ga0081538_100013648 237
426 3300005983 Ga0081540_1000015 Ga0081540_100001559 237
427 3300005983 Ga0081540_1004841 Ga0081540_10048417 237
428 3300005983 Ga0081540_1030763 Ga0081540_10307632 237
429 3300006028 Ga0070717_10000297 Ga0070717_1000029728 237
430 3300006028 Ga0070717_10124057 Ga0070717_101240572 237
431 3300006028 Ga0070717_10420344 Ga0070717_104203442 237
432 3300006028 Ga0070717_10735450 Ga0070717_107354501 237
433 3300006038 Ga0075365_10030532 Ga0075365_100305324 237
434 3300006038 Ga0075365_10165338 Ga0075365_101653382 237
435 3300006051 Ga0075364_10157580 Ga0075364_101575802 237
436 3300006163 Ga0070715_10005158 Ga0070715_100051584 237
437 3300006175 Ga0070712_100000896 Ga0070712_10000089614 237
438 3300006175 Ga0070712_100036096 Ga0070712_1000360962 237
439 3300006178 Ga0075367_10026095 Ga0075367_100260953 237
440 3300006195 Ga0075366_10027423 Ga0075366_100274232 237
441 3300006195 Ga0075366_10220123 Ga0075366_102201231 237
442 3300006353 Ga0075370_10061817 Ga0075370_100618173 237
443 3300006353 Ga0075370_10062100 Ga0075370_100621002 237
444 3300006844 Ga0075428_100000430 Ga0075428_10000043018 237
445 3300006844 Ga0075428_100214466 Ga0075428_1002144661 237
446 3300006844 Ga0075428_100382111 Ga0075428_1003821112 237
447 3300006846 Ga0075430_100128522 Ga0075430_1001285222 237
448 3300006847 Ga0075431_100000086 Ga0075431_10000008623 237
449 3300006847 Ga0075431_100019049 Ga0075431_1000190498 237
450 3300006847 Ga0075431_100123707 Ga0075431_1001237073 237
451 3300006847 Ga0075431_100360403 Ga0075431_1003604032 237
452 3300006852 Ga0075433_10029411 Ga0075433_100294112 237
453 3300006852 Ga0075433_10071279 Ga0075433_100712792 237
454 3300006852 Ga0075433_10162923 Ga0075433_101629233 237
455 3300006871 Ga0075434_100018441 Ga0075434_1000184414 237
456 3300006871 Ga0075434_100288912 Ga0075434_1002889122 237
457 3300006871 Ga0075434_100788154 Ga0075434_1007881541 237
458 3300006880 Ga0075429_100082076 Ga0075429_1000820763 237
459 3300006880 Ga0075429_100326146 Ga0075429_1003261462 237
460 3300007076 Ga0075435_100032914 Ga0075435_1000329144 237
461 3300007076 Ga0075435_100213931 Ga0075435_1002139312 237
462 3300007076 Ga0075435_100634722 Ga0075435_1006347221 237
463 3300007265 Ga0099794_10000814 Ga0099794_100008145 237
464 3300009093 Ga0105240_10000094 Ga0105240_1000009480 237
465 3300009093 Ga0105240_10001341 Ga0105240_1000134120 237
466 3300009093 Ga0105240_10012709 Ga0105240_100127097 237
467 3300009093 Ga0105240_10091571 Ga0105240_100915713 237
468 3300009094 Ga0111539_10001374 Ga0111539_1000137411 237
469 3300009094 Ga0111539_10054138 Ga0111539_100541385 237
470 3300009094 Ga0111539_10779185 Ga0111539_107791851 237
471 3300009147 Ga0114129_10000243 Ga0114129_1000024347 237
472 3300009147 Ga0114129_10007283 Ga0114129_1000728315 237
473 3300009147 Ga0114129_10013235 Ga0114129_100132355 237
474 3300009147 Ga0114129_10035725 Ga0114129_100357258 237
475 3300009147 Ga0114129_10184579 Ga0114129_101845793 237
476 3300009147 Ga0114129_10205921 Ga0114129_102059212 237
477 3300009177 Ga0105248_10024422 Ga0105248_100244227 237
478 3300009545 Ga0105237_10784813 Ga0105237_107848132 237
479 3300009551 Ga0105238_10039621 Ga0105238_100396214 237
480 3300009551 Ga0105238_11027720 Ga0105238_110277201 237
481 3300009553 Ga0105249_10109094 Ga0105249_101090942 237
482 3300011119 Ga0105246_10296963 Ga0105246_102969632 237
483 3300013104 Ga0157370_10011925 Ga0157370_100119252 237
484 3300013105 Ga0157369_10651347 Ga0157369_106513472 237
485 3300013307 Ga0157372_10025787 Ga0157372_100257877 237
486 3300014325 Ga0163163_10019627 Ga0163163_100196278 237
487 3300014325 Ga0163163_10059375 Ga0163163_100593752 237
488 3300014325 Ga0163163_10918670 Ga0163163_109186701 237
489 3300014969 Ga0157376_10257362 Ga0157376_102573622 237
490 3300014969 Ga0157376_10359570 Ga0157376_103595702 237
491 3300021361 Ga0213872_10003321 Ga0213872_1000332110 237
492 3300021361 Ga0213872_10147704 Ga0213872_101477041 237
493 3300021384 Ga0213876_10000134 Ga0213876_1000013458 237
494 3300021384 Ga0213876_10004326 Ga0213876_100043265 237
495 3300021384 Ga0213876_10112654 Ga0213876_101126542 237
496 3300021388 Ga0213875_10000007 Ga0213875_10000007338 237
497 3300021388 Ga0213875_10008291 Ga0213875_100082914 237
498 3300021388 Ga0213875_10086068 Ga0213875_100860682 237
499 3300021441 Ga0213871_10001032 Ga0213871_100010324 237
500 3300021441 Ga0213871_10061498 Ga0213871_100614981 237
501 3300025250 Ga0209026_1001732 Ga0209026_10017324 237
502 3300025297 Ga0209758_1000119 Ga0209758_1000119182 237
503 3300025297 Ga0209758_1000682 Ga0209758_100068238 237
504 3300025298 Ga0209050_1000141 Ga0209050_1000141142 237
505 3300025298 Ga0209050_1003817 Ga0209050_10038177 237
506 3300025302 Ga0207426_1050950 Ga0207426_10509502 237
507 3300025302 Ga0207426_1053149 Ga0207426_10531492 237
508 3300025304 Ga0209257_1000190 Ga0209257_100019045 237
509 3300025304 Ga0209257_1000288 Ga0209257_100028883 237
510 3300025304 Ga0209257_1000562 Ga0209257_100056244 237
511 3300025885 Ga0207653_10010527 Ga0207653_100105273 237
512 3300025898 Ga0207692_10001592 Ga0207692_100015928 237
513 3300025905 Ga0207685_10002629 Ga0207685_100026294 237
514 3300025906 Ga0207699_10009773 Ga0207699_100097734 237
515 3300025910 Ga0207684_10022472 Ga0207684_100224726 237
516 3300025912 Ga0207707_10006763 Ga0207707_100067632 237
517 3300025912 Ga0207707_10049755 Ga0207707_100497554 237
518 3300025912 Ga0207707_10760750 Ga0207707_107607501 237
519 3300025913 Ga0207695_10000419 Ga0207695_1000041940 237
520 3300025913 Ga0207695_10001861 Ga0207695_1000186120 237
521 3300025913 Ga0207695_10391725 Ga0207695_103917252 237
522 3300025914 Ga0207671_10356418 Ga0207671_103564181 237
523 3300025915 Ga0207693_10005248 Ga0207693_100052489 237
524 3300025915 Ga0207693_10045878 Ga0207693_100458783 237
525 3300025916 Ga0207663_10007163 Ga0207663_100071632 237
526 3300025916 Ga0207663_10471939 Ga0207663_104719391 237
527 3300025917 Ga0207660_10043058 Ga0207660_100430584 237
528 3300025917 Ga0207660_10101300 Ga0207660_101013002 237
529 3300025917 Ga0207660_10185168 Ga0207660_101851681 237
530 3300025919 Ga0207657_10021183 Ga0207657_100211837 237
531 3300025921 Ga0207652_10281177 Ga0207652_102811773 237
532 3300025922 Ga0207646_10438762 Ga0207646_104387622 237
533 3300025923 Ga0207681_10060574 Ga0207681_100605742 237
534 3300025924 Ga0207694_10030714 Ga0207694_100307143 237
535 3300025928 Ga0207700_10000380 Ga0207700_100003802 237
536 3300025928 Ga0207700_10121010 Ga0207700_101210102 237
537 3300025928 Ga0207700_10254317 Ga0207700_102543172 237
538 3300025928 Ga0207700_10679945 Ga0207700_106799451 237
539 3300025929 Ga0207664_10008858 Ga0207664_100088587 237
540 3300025929 Ga0207664_10810576 Ga0207664_108105761 237
541 3300025932 Ga0207690_10379830 Ga0207690_103798301 237
542 3300025939 Ga0207665_10034393 Ga0207665_100343934 237
543 3300025939 Ga0207665_10077328 Ga0207665_100773283 237
544 3300025941 Ga0207711_10021082 Ga0207711_100210822 237
545 3300025942 Ga0207689_10006787 Ga0207689_100067878 237
546 3300025945 Ga0207679_10476363 Ga0207679_104763632 237
547 3300025949 Ga0207667_10146786 Ga0207667_101467863 237
548 3300025949 Ga0207667_10177908 Ga0207667_101779082 237
549 3300025949 Ga0207667_10300231 Ga0207667_103002313 237
550 3300025960 Ga0207651_10004995 Ga0207651_100049951 237
551 3300025960 Ga0207651_10105642 Ga0207651_101056423 237
552 3300025961 Ga0207712_10004918 Ga0207712_100049188 237
553 3300025961 Ga0207712_10172730 Ga0207712_101727302 237
554 3300025972 Ga0207668_10029854 Ga0207668_100298542 237
555 3300025986 Ga0207658_10124226 Ga0207658_101242262 237
556 3300026035 Ga0207703_10000289 Ga0207703_1000028941 237
557 3300026067 Ga0207678_10464079 Ga0207678_104640791 237
558 3300026078 Ga0207702_10062359 Ga0207702_100623594 237
559 3300026078 Ga0207702_10196561 Ga0207702_101965613 237
560 3300026088 Ga0207641_10000160 Ga0207641_1000016056 237
561 3300026088 Ga0207641_10200544 Ga0207641_102005442 237
562 3300026088 Ga0207641_10296121 Ga0207641_102961213 237
563 3300026095 Ga0207676_10000375 Ga0207676_1000037516 237
564 3300026116 Ga0207674_10031884 Ga0207674_100318847 237
565 3300026116 Ga0207674_10121839 Ga0207674_101218394 237
566 3300026116 Ga0207674_10591405 Ga0207674_105914051 237
567 3300026118 Ga0207675_100444674 Ga0207675_1004446742 237
568 3300026121 Ga0207683_10027341 Ga0207683_100273414 237
569 3300027378 Ga0209981_1000501 Ga0209981_10005014 237
570 3300027907 Ga0207428_10007141 Ga0207428_1000714111 237
571 3300027907 Ga0207428_10264931 Ga0207428_102649312 237
572 3300027907 Ga0207428_10337781 Ga0207428_103377812 237
573 3300028380 Ga0268265_10006267 Ga0268265_100062675 237
574 3300028380 Ga0268265_10011714 Ga0268265_100117142 237
575 3300028380 Ga0268265_10031043 Ga0268265_100310433 237
576 3300028380 Ga0268265_10224239 Ga0268265_102242391 237
577 3300028381 Ga0268264_10000046 Ga0268264_10000046353 237
578 3300028573 Ga0265334_10006434 Ga0265334_100064343 237
579 3300028573 Ga0265334_10068347 Ga0265334_100683472 237
580 3300028786 Ga0307517_10127623 Ga0307517_101276232 237
581 3300028794 Ga0307515_10286314 Ga0307515_102863142 237
582 3300028800 Ga0265338_10020456 Ga0265338_100204564 237
583 3300028800 Ga0265338_10022862 Ga0265338_100228623 237
584 3300028800 Ga0265338_10044555 Ga0265338_100445552 237
585 3300028800 Ga0265338_10143331 Ga0265338_101433312 237
586 3300030521 Ga0307511_10025571 Ga0307511_100255713 237
587 3300031238 Ga0265332_10000535 Ga0265332_1000053516 237
588 3300031241 Ga0265325_10002369 Ga0265325_100023697 237
589 3300031242 Ga0265329_10033233 Ga0265329_100332332 237
590 3300031247 Ga0265340_10003508 Ga0265340_100035084 237
591 3300031247 Ga0265340_10079674 Ga0265340_100796742 237
592 3300031247 Ga0265340_10167149 Ga0265340_101671492 237
593 3300031249 Ga0265339_10002291 Ga0265339_100022915 237
594 3300031249 Ga0265339_10005076 Ga0265339_100050764 237
595 3300031249 Ga0265339_10005282 Ga0265339_100052825 237
596 3300031250 Ga0265331_10015628 Ga0265331_100156281 237
597 3300031251 Ga0265327_10000190 Ga0265327_1000019034 237
598 3300031251 Ga0265327_10203634 Ga0265327_102036341 237
599 3300031344 Ga0265316_10013043 Ga0265316_100130433 237
600 3300031456 Ga0307513_10014691 Ga0307513_100146918 237
601 3300031456 Ga0307513_10155963 Ga0307513_101559633 237
602 3300031595 Ga0265313_10000116 Ga0265313_1000011629 237
603 3300031595 Ga0265313_10000183 Ga0265313_1000018323 237
604 3300031616 Ga0307508_10060187 Ga0307508_100601872 237
605 3300031711 Ga0265314_10004504 Ga0265314_100045045 237
606 3300031711 Ga0265314_10007258 Ga0265314_100072584 237
607 3300031711 Ga0265314_10024611 Ga0265314_100246112 237
608 3300031711 Ga0265314_10036586 Ga0265314_100365864 237
609 3300031711 Ga0265314_10090235 Ga0265314_100902352 237
610 3300031712 Ga0265342_10000011 Ga0265342_10000011178 237
611 3300031730 Ga0307516_10000004 Ga0307516_10000004254 237
612 3300031730 Ga0307516_10248986 Ga0307516_102489862 237
613 3300031731 Ga0307405_10045036 Ga0307405_100450363 237
614 3300031824 Ga0307413_10137086 Ga0307413_101370862 237
615 3300031824 Ga0307413_10219368 Ga0307413_102193681 237
616 3300031903 Ga0307407_10199576 Ga0307407_101995761 237
617 3300031995 Ga0307409_100229211 Ga0307409_1002292112 237
618 3300032004 Ga0307414_10091171 Ga0307414_100911713 237
619 3300032004 Ga0307414_10416830 Ga0307414_104168302 237
620 3300032004 Ga0307414_10456584 Ga0307414_104565841 237
621 3300032005 Ga0307411_10131431 Ga0307411_101314313 237
622 3300032005 Ga0307411_10339649 Ga0307411_103396492 237
623 3300032133 Ga0316583_10000712 Ga0316583_100007122 237
624 3300032133 Ga0316583_10046548 Ga0316583_100465482 237
625 3300035111 Ga0373923_0145113 Ga0373923_0145113_40_777 237
626 3300035116 Ga0373945_0005510 Ga0373945_0005510_3236_3973 237
627 3300035171 Ga0373946_0011339 Ga0373946_0011339_919_1656 237
628 3300035691 Ga0373931_0045000 Ga0373931_0045000_47_787 237
629 3300035691 Ga0373931_0080049 Ga0373931_0080049_299_1036 237
630 3300035725 Ga0373947_0044945 Ga0373947_0044945_1454_2191 237
631 3300036401 Ga0373937_0006315 Ga0373937_0006315_7260_7997 237
632 3300037068 Ga0373925_0099950 Ga0373925_0099950_1403_2140 237
633 3300037068 Ga0373925_0105806 Ga0373925_0105806_1319_2056 237
634 3300037068 Ga0373925_0604110 Ga0373925_0604110_52_789 237
635 3300037312 Ga0395899_0000070 Ga0395899_0000070_135143_135880 237
636 3300037312 Ga0395899_0121527 Ga0395899_0121527_343_1080 237
637 3300037418 Ga0395900_0034389 Ga0395900_0034389_153_893 237
638 3300037418 Ga0395900_0177445 Ga0395900_0177445_1170_1907 237
639 3300037418 Ga0395900_0235095 Ga0395900_0235095_676_1413 237
640 3300037466 Ga0395898_0185201 Ga0395898_0185201_587_1324 237
641 3300037466 Ga0395898_0675117 Ga0395898_0675117_132_869 237
642 3300037471 Ga0395905_0038497 Ga0395905_0038497_230_970 237
643 3300037471 Ga0395905_0417347 Ga0395905_0417347_193_933 237
644 3300037853 Ga0436364_0013783 Ga0436364_0013783_13170_13910 237
645 3300037853 Ga0436364_0186560 Ga0436364_0186560_781_1521 237
646 3300037853 Ga0436364_0955256 Ga0436364_0955256_5210_5947 237
647 3300037853 Ga0436364_1438211 Ga0436364_1438211_421_1158 237
648 3300038443 Ga0395901_0001835 Ga0395901_0001835_15628_16365 237
649 3300038443 Ga0395901_0017625 Ga0395901_0017625_3118_3855 237
650 3300038443 Ga0395901_0133080 Ga0395901_0133080_1854_2594 237
651 3300039437 Ga0436365_0029939 Ga0436365_0029939_139_876 237
652 3300039437 Ga0436365_0316565 Ga0436365_0316565_358_1095 237
653 3300039437 Ga0436365_0525757 Ga0436365_0525757_916_1653 237
654 3300039437 Ga0436365_0742782 Ga0436365_0742782_287_1024 237
655 3300039437 Ga0436365_1136540 Ga0436365_1136540_28398_29138 237
656 3300039437 Ga0436365_1830840 Ga0436365_1830840_33768_34508 237
657 3300039438 Ga0436360_0157856 Ga0436360_0157856_8163_8900 237
658 3300039438 Ga0436360_1273015 Ga0436360_1273015_271_1008 237
659 3300039447 Ga0436361_0092439 Ga0436361_0092439_367_1104 237
660 3300039447 Ga0436361_0217171 Ga0436361_0217171_651_1388 237
661 3300039447 Ga0436361_0235144 Ga0436361_0235144_1416_2153 237
662 3300039447 Ga0436361_0348195 Ga0436361_0348195_185_922 237
663 3300039447 Ga0436361_0525734 Ga0436361_0525734_29087_29827 237
664 3300039447 Ga0436361_0722234 Ga0436361_0722234_121_858 237
665 3300039447 Ga0436361_0736152 Ga0436361_0736152_43_780 237
666 3300039447 Ga0436361_0839114 Ga0436361_0839114_193_930 237
667 3300039450 Ga0436363_0339486 Ga0436363_0339486_28_768 237
668 3300039450 Ga0436363_0930428 Ga0436363_0930428_394_1134 237
669 3300039450 Ga0436363_1129020 Ga0436363_1129020_189_926 237
670 3300039450 Ga0436363_1143576 Ga0436363_1143576_1704_2441 237
671 3300039453 Ga0436362_0302375 Ga0436362_0302375_4389_5129 237
672 3300039453 Ga0436362_0694438 Ga0436362_0694438_664_1401 237
673 3300039453 Ga0436362_0697649 Ga0436362_0697649_388_1128 237
674 3300039453 Ga0436362_0900943 Ga0436362_0900943_976_1719 237
675 3300039453 Ga0436362_1201384 Ga0436362_1201384_220_957 237
676 3300041408 Ga0439453_0017902 Ga0439453_0017902_361_1098 237
677 3300041413 Ga0439465_0016110 Ga0439465_0016110_984_1721 237
678 3300042004 Ga0439445_0008563 Ga0439445_0008563_382_1119 237
679 3300042004 Ga0439445_0016409 Ga0439445_0016409_225_962 237
680 3300042005 Ga0439448_0096077 Ga0439448_0096077_28_765 237
681 3300044684 Ga0466966_0013591 Ga0466966_0013591_2517_3254 237
682 3300044684 Ga0466966_0111882 Ga0466966_0111882_311_1048 237
683 3300044694 Ga0466963_0095857 Ga0466963_0095857_182_919 237
684 3300044901 Ga0466960_0173997 Ga0466960_0173997_210_950 237
685 3300045049 Ga0466959_0002189 Ga0466959_0002189_3749_4486 237
686 3300045049 Ga0466959_0017658 Ga0466959_0017658_4052_4789 237
687 3300045051 Ga0451576_0009668 Ga0451576_0009668_7832_8569 237
688 3300046455 Ga0495603_0129734 Ga0495603_0129734_507_1244 237
689 3300046459 Ga0495629_0030687 Ga0495629_0030687_1623_2363 237
690 3300046473 Ga0495582_0032586 Ga0495582_0032586_208_945 237
691 3300046491 Ga0495584_0006976 Ga0495584_0006976_2522_3259 237
692 3300046491 Ga0495584_0137124 Ga0495584_0137124_401_1138 237
693 3300046499 Ga0495594_0089846 Ga0495594_0089846_749_1486 237
694 3300046501 Ga0495607_0082480 Ga0495607_0082480_754_1491 237
695 3300046506 Ga0495583_0106877 Ga0495583_0106877_58_798 237
696 3300046507 Ga0495606_0056869 Ga0495606_0056869_289_1029 237
697 3300046514 Ga0495618_0083823 Ga0495618_0083823_306_1043 237
698 3300046517 Ga0495630_0323263 Ga0495630_0323263_205_942 237
699 3300046520 Ga0495637_0010029 Ga0495637_0010029_2107_2844 237
700 3300046520 Ga0495637_0124954 Ga0495637_0124954_161_901 237
701 3300046522 Ga0495643_0036969 Ga0495643_0036969_566_1306 237
702 3300046522 Ga0495643_0117134 Ga0495643_0117134_552_1295 237
703 3300046526 Ga0495666_0009590 Ga0495666_0009590_1457_2194 237
704 3300046530 Ga0495654_0031099 Ga0495654_0031099_592_1332 237
705 3300046531 Ga0495665_0030883 Ga0495665_0030883_1169_1906 237
706 3300046531 Ga0495665_0058095 Ga0495665_0058095_37_774 237
707 3300046533 Ga0495640_0047961 Ga0495640_0047961_1571_2308 237
708 3300046537 Ga0495598_0000412 Ga0495598_0000412_4215_4952 237
709 3300046538 Ga0495609_0147653 Ga0495609_0147653_73_810 237
710 3300046539 Ga0495621_0022276 Ga0495621_0022276_63_800 237
711 3300046542 Ga0495597_0003340 Ga0495597_0003340_4488_5228 237
712 3300046557 Ga0495622_0002993 Ga0495622_0002993_2037_2777 237
713 3300046559 Ga0495667_0085752 Ga0495667_0085752_979_1716 237
714 3300046615 Ga0495656_0003218 Ga0495656_0003218_2105_2842 237
715 3300046616 Ga0495668_0033575 Ga0495668_0033575_849_1589 237
716 3300046616 Ga0495668_0118851 Ga0495668_0118851_565_1305 237
717 3300046642 Ga0495634_0078900 Ga0495634_0078900_103_840 237
718 3300046664 Ga0495659_0008319 Ga0495659_0008319_348_1085 237
719 3300046665 Ga0495661_0180792 Ga0495661_0180792_206_943 237
720 3300046674 Ga0495588_0045800 Ga0495588_0045800_954_1691 237
721 3300046683 Ga0495658_0101707 Ga0495658_0101707_230_967 237
722 3300046683 Ga0495658_0305393 Ga0495658_0305393_47_784 237
723 3300046683 Ga0495658_0417816 Ga0495658_0417816_91_828 237
724 3300046689 Ga0495613_0171563 Ga0495613_0171563_513_1250 237
725 3300046689 Ga0495613_0248288 Ga0495613_0248288_38_775 237
726 3300046690 Ga0495624_0011870 Ga0495624_0011870_3912_4649 237
727 3300046691 Ga0495670_0010915 Ga0495670_0010915_1409_2146 237
728 3300046694 Ga0495649_0060603 Ga0495649_0060603_788_1525 237
729 3300047319 Ga0495674_0291973 Ga0495674_0291973_308_1045 237
730 3300047319 Ga0495674_0334792 Ga0495674_0334792_95_832 237
731 3300047320 Ga0495672_0000739 Ga0495672_0000739_13735_14472 237
732 3300047321 Ga0495676_0211685 Ga0495676_0211685_592_1329 237
733 3300047471 Ga0495684_0082641 Ga0495684_0082641_215_952 237
734 3300047673 Ga0495593_0033310 Ga0495593_0033310_322_1059 237
735 3300047673 Ga0495593_0072136 Ga0495593_0072136_721_1461 237
736 3300048089 Ga0495614_0106855 Ga0495614_0106855_48_785 237
737 3300048904 Ga0496101_0027324 Ga0496101_0027324_210_950 237
738 3300048904 Ga0496101_0031882 Ga0496101_0031882_806_1543 237
739 3300048904 Ga0496101_0052513 Ga0496101_0052513_746_1483 237
740 3300048904 Ga0496101_0633755 Ga0496101_0633755_81_821 237
741 3300048905 Ga0496102_0055595 Ga0496102_0055595_677_1417 237
742 3300048905 Ga0496102_0404797 Ga0496102_0404797_400_1140 237
743 3300048906 Ga0496103_0001539 Ga0496103_0001539_8668_9405 237
744 3300048907 Ga0496104_0003183 Ga0496104_0003183_8538_9275 237
745 3300048907 Ga0496104_0006755 Ga0496104_0006755_3497_4234 237
746 3300048907 Ga0496104_0079346 Ga0496104_0079346_1535_2272 237
747 3300048908 Ga0496105_0000653 Ga0496105_0000653_12075_12812 237
748 3300048908 Ga0496105_0003358 Ga0496105_0003358_152_889 237
749 3300048909 Ga0496106_0004405 Ga0496106_0004405_5743_6480 237
750 3300048909 Ga0496106_0051764 Ga0496106_0051764_358_1098 237
751 3300048910 Ga0496107_0021330 Ga0496107_0021330_1005_1742 237
752 3300048911 Ga0496108_0004848 Ga0496108_0004848_181_918 237
753 3300048912 Ga0496109_0001027 Ga0496109_0001027_9743_10480 237
754 3300048913 Ga0496110_0011290 Ga0496110_0011290_3198_3935 237
755 3300048913 Ga0496110_0018675 Ga0496110_0018675_2108_2845 237
756 3300048914 Ga0496111_0389404 Ga0496111_0389404_237_974 237
757 3300048915 Ga0496112_0000804 Ga0496112_0000804_12893_13630 237
758 3300048915 Ga0496112_0465746 Ga0496112_0465746_176_913 237
759 3300048916 Ga0496113_0001499 Ga0496113_0001499_4837_5574 237
760 3300048917 Ga0496114_0030137 Ga0496114_0030137_3114_3851 237
761 3300048917 Ga0496114_0211420 Ga0496114_0211420_654_1391 237
762 3300048918 Ga0496115_0004230 Ga0496115_0004230_642_1379 237
763 3300048918 Ga0496115_0088393 Ga0496115_0088393_1612_2349 237
764 3300048918 Ga0496115_0263184 Ga0496115_0263184_17_757 237
765 3300048918 Ga0496115_0407802 Ga0496115_0407802_269_1009 237
766 3300048924 Ga0496121_0254805 Ga0496121_0254805_127_864 237
767 3300048929 Ga0496126_0010389 Ga0496126_0010389_6755_7492 237
768 3300048929 Ga0496126_0278719 Ga0496126_0278719_450_1190 237
769 3300049568 Ga0501031_0019630 Ga0501031_0019630_595_1332 237
770 3300049568 Ga0501031_0037957 Ga0501031_0037957_361_1101 237
771 3300049569 Ga0501032_0006036 Ga0501032_0006036_6768_7505 237
772 3300049569 Ga0501032_0023092 Ga0501032_0023092_41_778 237
773 3300049569 Ga0501032_0157399 Ga0501032_0157399_260_1000 237
774 3300049570 Ga0501033_0005237 Ga0501033_0005237_5238_5975 237
775 3300049570 Ga0501033_0011204 Ga0501033_0011204_5466_6206 237
776 3300049570 Ga0501033_0173782 Ga0501033_0173782_158_895 237
777 3300049570 Ga0501033_0230645 Ga0501033_0230645_328_1068 237
778 3300049571 Ga0501034_0000244 Ga0501034_0000244_48596_49333 237
779 3300049571 Ga0501034_0000623 Ga0501034_0000623_54540_55280 237
780 3300049571 Ga0501034_0006211 Ga0501034_0006211_248_985 237
781 3300049571 Ga0501034_0015930 Ga0501034_0015930_369_1106 237
782 3300049571 Ga0501034_0029889 Ga0501034_0029889_4736_5473 237
783 3300049571 Ga0501034_0030592 Ga0501034_0030592_1452_2189 237
784 3300049571 Ga0501034_0049229 Ga0501034_0049229_1746_2483 237
785 3300049571 Ga0501034_0058001 Ga0501034_0058001_1843_2580 237
786 3300049571 Ga0501034_0085320 Ga0501034_0085320_663_1400 237
787 3300049571 Ga0501034_0091153 Ga0501034_0091153_1656_2399 237
788 3300049571 Ga0501034_0136565 Ga0501034_0136565_1169_1909 237
789 3300049571 Ga0501034_0161820 Ga0501034_0161820_65_802 237
790 3300049571 Ga0501034_0266304 Ga0501034_0266304_588_1328 237
791 3300049571 Ga0501034_0455552 Ga0501034_0455552_378_1115 237
792 3300049571 Ga0501034_0483485 Ga0501034_0483485_382_1122 237
793 3300049571 Ga0501034_0494303 Ga0501034_0494303_44_781 237
794 3300049571 Ga0501034_0682207 Ga0501034_0682207_170_907 237
795 3300049571 Ga0501034_0689621 Ga0501034_0689621_44_781 237
796 3300049572 Ga0501036_0000402 Ga0501036_0000402_16832_17572 237
797 3300049572 Ga0501036_0131876 Ga0501036_0131876_166_903 237
798 3300049572 Ga0501036_0184419 Ga0501036_0184419_201_938 237
799 3300049572 Ga0501036_0242745 Ga0501036_0242745_227_964 237
800 3300049572 Ga0501036_0263206 Ga0501036_0263206_328_1068 237
801 3300049572 Ga0501036_0299640 Ga0501036_0299640_539_1276 237
802 3300049572 Ga0501036_0348569 Ga0501036_0348569_451_1188 237
803 3300049573 Ga0501037_0008825 Ga0501037_0008825_40_777 237
804 3300049573 Ga0501037_0014018 Ga0501037_0014018_3789_4526 237
805 3300049573 Ga0501037_0072271 Ga0501037_0072271_368_1105 237
806 3300049573 Ga0501037_0115814 Ga0501037_0115814_21_761 237
807 3300049573 Ga0501037_0169540 Ga0501037_0169540_104_844 237
808 3300049573 Ga0501037_0374783 Ga0501037_0374783_223_960 237
809 3300049574 Ga0501038_0004074 Ga0501038_0004074_4700_5437 237
810 3300049574 Ga0501038_0012791 Ga0501038_0012791_3801_4538 237
811 3300049574 Ga0501038_0021786 Ga0501038_0021786_4697_5434 237
812 3300049574 Ga0501038_0035364 Ga0501038_0035364_2323_3060 237
813 3300049574 Ga0501038_0100969 Ga0501038_0100969_247_984 237
814 3300049574 Ga0501038_0151329 Ga0501038_0151329_284_1021 237
815 3300049574 Ga0501038_0481171 Ga0501038_0481171_58_795 237
816 3300049575 Ga0501039_0107608 Ga0501039_0107608_227_964 237
817 3300049575 Ga0501039_0306851 Ga0501039_0306851_227_964 237
818 3300049575 Ga0501039_0320305 Ga0501039_0320305_419_1159 237
819 3300049576 Ga0501040_0004593 Ga0501040_0004593_4141_4878 237
820 3300049578 Ga0501042_0022449 Ga0501042_0022449_790_1527 237
821 3300049578 Ga0501042_0185854 Ga0501042_0185854_483_1220 237
822 3300049578 Ga0501042_0198660 Ga0501042_0198660_326_1066 237
823 3300049579 Ga0501043_0001890 Ga0501043_0001890_866_1606 237
824 3300049579 Ga0501043_0032700 Ga0501043_0032700_479_1216 237
825 3300049579 Ga0501043_0076674 Ga0501043_0076674_1873_2610 237
826 3300049579 Ga0501043_0365493 Ga0501043_0365493_277_1014 237
827 3300049580 Ga0501046_0035676 Ga0501046_0035676_1707_2447 237
828 3300049580 Ga0501046_0081176 Ga0501046_0081176_1221_1958 237
829 3300049580 Ga0501046_0170270 Ga0501046_0170270_810_1547 237
830 3300049580 Ga0501046_0256573 Ga0501046_0256573_283_1020 237
831 3300049581 Ga0501047_0000010 Ga0501047_0000010_341707_342447 237
832 3300049581 Ga0501047_0006124 Ga0501047_0006124_6767_7504 237
833 3300049581 Ga0501047_0008824 Ga0501047_0008824_2644_3381 237
834 3300049581 Ga0501047_0009108 Ga0501047_0009108_312_1052 237
835 3300049581 Ga0501047_0019030 Ga0501047_0019030_3139_3876 237
836 3300049581 Ga0501047_0020190 Ga0501047_0020190_40_777 237
837 3300049581 Ga0501047_0048484 Ga0501047_0048484_2013_2753 237
838 3300049581 Ga0501047_0121098 Ga0501047_0121098_381_1118 237
839 3300049581 Ga0501047_0288600 Ga0501047_0288600_456_1193 237
840 3300049581 Ga0501047_0636817 Ga0501047_0636817_93_830 237
841 3300049582 Ga0501048_0001467 Ga0501048_0001467_9225_9965 237
842 3300049582 Ga0501048_0006405 Ga0501048_0006405_3890_4627 237
843 3300049582 Ga0501048_0031281 Ga0501048_0031281_2562_3299 237
844 3300049583 Ga0501067_0000637 Ga0501067_0000637_23_760 237
845 3300049583 Ga0501067_0007532 Ga0501067_0007532_3618_4355 237
846 3300049583 Ga0501067_0071752 Ga0501067_0071752_1147_1887 237
847 3300049583 Ga0501067_0095780 Ga0501067_0095780_896_1633 237
848 3300049583 Ga0501067_0187574 Ga0501067_0187574_35_775 237
849 3300049584 Ga0501068_0001773 Ga0501068_0001773_7241_7978 237
850 3300049584 Ga0501068_0004997 Ga0501068_0004997_1754_2491 237
851 3300049584 Ga0501068_0008618 Ga0501068_0008618_1678_2415 237
852 3300049584 Ga0501068_0190503 Ga0501068_0190503_98_835 237
853 3300049584 Ga0501068_0245350 Ga0501068_0245350_150_887 237
854 3300049586 Ga0501070_0083324 Ga0501070_0083324_1159_1896 237
855 3300049586 Ga0501070_0126211 Ga0501070_0126211_464_1201 237
856 3300049586 Ga0501070_0213504 Ga0501070_0213504_586_1323 237
857 3300049586 Ga0501070_0287230 Ga0501070_0287230_161_898 237
858 3300049586 Ga0501070_0326225 Ga0501070_0326225_378_1115 237
859 3300049587 Ga0501071_0050273 Ga0501071_0050273_397_1134 237
860 3300049587 Ga0501071_0142607 Ga0501071_0142607_907_1647 237
861 3300049588 Ga0501072_0042845 Ga0501072_0042845_217_957 237
862 3300049588 Ga0501072_0116565 Ga0501072_0116565_47_784 237
863 3300049588 Ga0501072_0371741 Ga0501072_0371741_271_1008 237
864 3300049589 Ga0501073_0000284 Ga0501073_0000284_1594_2331 237
865 3300049589 Ga0501073_0003399 Ga0501073_0003399_6261_6998 237
866 3300049589 Ga0501073_0019022 Ga0501073_0019022_3652_4392 237
867 3300049589 Ga0501073_0047757 Ga0501073_0047757_1954_2691 237
868 3300049589 Ga0501073_0098835 Ga0501073_0098835_597_1334 237
869 3300049590 Ga0501074_0015059 Ga0501074_0015059_4378_5115 237
870 3300049590 Ga0501074_0264219 Ga0501074_0264219_61_801 237
871 3300049590 Ga0501074_0383166 Ga0501074_0383166_128_868 237
872 3300049591 Ga0501075_0080363 Ga0501075_0080363_1676_2413 237
873 3300049592 Ga0501076_0123319 Ga0501076_0123319_709_1446 237
874 3300049592 Ga0501076_0132604 Ga0501076_0132604_914_1654 237
875 3300049593 Ga0501077_0046830 Ga0501077_0046830_800_1537 237
876 3300049593 Ga0501077_0444866 Ga0501077_0444866_42_779 237
877 3300049741 Ga0501079_0007367 Ga0501079_0007367_1517_2254 237
878 3300049742 Ga0501080_0000148 Ga0501080_0000148_9105_9845 237
879 3300049742 Ga0501080_0000954 Ga0501080_0000954_13107_13844 237
880 3300049742 Ga0501080_0036219 Ga0501080_0036219_621_1361 237
881 3300049742 Ga0501080_0402339 Ga0501080_0402339_465_1202 237
882 3300049742 Ga0501080_0405291 Ga0501080_0405291_305_1042 237
883 3300049743 Ga0501081_0039906 Ga0501081_0039906_1634_2371 237
884 3300049744 Ga0501083_0001616 Ga0501083_0001616_7165_7905 237
885 3300049744 Ga0501083_0006643 Ga0501083_0006643_2972_3709 237
886 3300049744 Ga0501083_0021194 Ga0501083_0021194_710_1447 237
887 3300049744 Ga0501083_0221209 Ga0501083_0221209_332_1069 237
888 3300049744 Ga0501083_0270455 Ga0501083_0270455_240_980 237
889 3300049822 Ga0501035_0000715 Ga0501035_0000715_21938_22675 237
890 3300049822 Ga0501035_0053381 Ga0501035_0053381_50_823 237
891 3300049822 Ga0501035_0054708 Ga0501035_0054708_2365_3102 237
892 3300049822 Ga0501035_0150690 Ga0501035_0150690_675_1412 237
893 3300049822 Ga0501035_0238619 Ga0501035_0238619_529_1269 237
894 3300049822 Ga0501035_0337393 Ga0501035_0337393_456_1196 237
895 3300049822 Ga0501035_0396108 Ga0501035_0396108_291_1028 237
896 3300049823 Ga0501044_0001007 Ga0501044_0001007_8304_9044 237
897 3300049823 Ga0501044_0003468 Ga0501044_0003468_15197_15934 237
898 3300049823 Ga0501044_0045787 Ga0501044_0045787_1088_1825 237
899 3300049823 Ga0501044_0105507 Ga0501044_0105507_1547_2284 237
900 3300049823 Ga0501044_0173805 Ga0501044_0173805_856_1593 237
901 3300049823 Ga0501044_0187458 Ga0501044_0187458_310_1047 237
902 3300049823 Ga0501044_0269283 Ga0501044_0269283_562_1299 237
903 3300049823 Ga0501044_0279781 Ga0501044_0279781_405_1142 237
904 3300049823 Ga0501044_0360262 Ga0501044_0360262_135_872 237
905 3300049823 Ga0501044_0399893 Ga0501044_0399893_270_1028 237
906 3300049823 Ga0501044_0573076 Ga0501044_0573076_21_758 237
907 3300049823 Ga0501044_0788866 Ga0501044_0788866_10_750 237
908 3300049824 Ga0501045_0002871 Ga0501045_0002871_2066_2803 237
909 3300049824 Ga0501045_0160963 Ga0501045_0160963_399_1136 237
910 3300050489 nmdc:mga03683_22577_c1 nmdc:mga03683_22577_c1_1126_1863 237
911 3300050491 nmdc:mga00v17_188552_c1 nmdc:mga00v17_188552_c1_543_1280 237
912 3300050492 nmdc:mga0yw44_275362_c1 nmdc:mga0yw44_275362_c1_218_955 237
913 3300050493 nmdc:mga0k408_11597_c2 nmdc:mga0k408_11597_c2_1918_2655 237
914 3300050494 nmdc:mga06z11_255298_c1 nmdc:mga06z11_255298_c1_118_855 237
915 3300050494 nmdc:mga06z11_56709_c1 nmdc:mga06z11_56709_c1_1136_1873 237
916 3300050496 nmdc:mga07m45_29751_c1 nmdc:mga07m45_29751_c1_311_1048 237
917 3300050507 nmdc:mga05p37_1364_c1 nmdc:mga05p37_1364_c1_21639_22376 237
918 3300050507 nmdc:mga05p37_1370_c1 nmdc:mga05p37_1370_c1_15314_16051 237
919 3300050507 nmdc:mga05p37_415904_c1 nmdc:mga05p37_415904_c1_76_813 237
920 3300050507 nmdc:mga05p37_43817_c1 nmdc:mga05p37_43817_c1_219_956 237
921 3300050507 nmdc:mga05p37_59746_c1 nmdc:mga05p37_59746_c1_2619_3356 237
922 3300050507 nmdc:mga05p37_726882_c1 nmdc:mga05p37_726882_c1_88_828 237
923 3300050508 nmdc:mga09592_17705_c1 nmdc:mga09592_17705_c1_2061_2798 237
924 3300050508 nmdc:mga09592_17818_c1 nmdc:mga09592_17818_c1_145_882 237
925 3300050509 nmdc:mga0qj67_123792_c1 nmdc:mga0qj67_123792_c1_740_1477 237
926 3300050509 nmdc:mga0qj67_54837_c1 nmdc:mga0qj67_54837_c1_500_1237 237
927 3300050510 nmdc:mga06r32_151_c1 nmdc:mga06r32_151_c1_30435_31172 237
928 3300050510 nmdc:mga06r32_23835_c1 nmdc:mga06r32_23835_c1_236_973 237
929 3300050510 nmdc:mga06r32_50711_c1 nmdc:mga06r32_50711_c1_1420_2157 237
930 3300050511 nmdc:mga08y16_194666_c1 nmdc:mga08y16_194666_c1_387_1124 237
931 3300050511 nmdc:mga08y16_86_c1 nmdc:mga08y16_86_c1_55737_56474 237
932 3300050512 nmdc:mga0n895_127360_c1 nmdc:mga0n895_127360_c1_203_943 237
933 3300050512 nmdc:mga0n895_160300_c1 nmdc:mga0n895_160300_c1_927_1664 237
934 3300050512 nmdc:mga0n895_98008_c1 nmdc:mga0n895_98008_c1_50_787 237
935 3300050513 nmdc:mga0rr50_147851_c1 nmdc:mga0rr50_147851_c1_147_884 237
936 3300050513 nmdc:mga0rr50_56681_c1 nmdc:mga0rr50_56681_c1_2176_2916 237
937 3300050513 nmdc:mga0rr50_605984_c1 nmdc:mga0rr50_605984_c1_113_883 237
938 3300050514 nmdc:mga08x19_4_c2 nmdc:mga08x19_4_c2_120725_121462 237
939 3300050515 nmdc:mga0a205_101195_c1 nmdc:mga0a205_101195_c1_1762_2499 237
940 3300050515 nmdc:mga0a205_36209_c1 nmdc:mga0a205_36209_c1_3348_4088 237
941 3300050515 nmdc:mga0a205_48308_c1 nmdc:mga0a205_48308_c1_1482_2219 237
942 3300050515 nmdc:mga0a205_597394_c1 nmdc:mga0a205_597394_c1_25_762 237
943 3300050516 nmdc:mga0sz30_469_c1 nmdc:mga0sz30_469_c1_646_1383 237
944 3300053078 Ga0495612_0060917 Ga0495612_0060917_302_1042 237
945 3300053080 Ga0500635_0000080 Ga0500635_0000080_16130_16870 237
946 3300053085 Ga0495619_0019642 Ga0495619_0019642_1338_2075 237
947 3300053085 Ga0495619_0089895 Ga0495619_0089895_189_926 237
948 3300053085 Ga0495619_0103208 Ga0495619_0103208_504_1241 237
949 3300053085 Ga0495619_0321850 Ga0495619_0321850_104_898 237
950 3300053086 Ga0500578_0119769 Ga0500578_0119769_462_1199 237
951 3300053086 Ga0500578_0154959 Ga0500578_0154959_181_921 237
952 3300053087 Ga0500643_002563 Ga0500643_002563_5051_5788 237
953 3300053087 Ga0500643_009378 Ga0500643_009378_2957_3694 237
954 3300053087 Ga0500643_043611 Ga0500643_043611_312_1049 237
955 3300053090 Ga0500646_0011647 Ga0500646_0011647_240_977 237
956 3300053091 Ga0500647_0099551 Ga0500647_0099551_205_945 237
957 3300053092 Ga0500583_0050564 Ga0500583_0050564_896_1636 237
958 3300053093 Ga0500651_0041785 Ga0500651_0041785_1112_1849 237
959 3300053093 Ga0500651_0072450 Ga0500651_0072450_131_868 237
960 3300053094 Ga0500566_0008660 Ga0500566_0008660_4365_5102 237
961 3300053094 Ga0500566_0128903 Ga0500566_0128903_116_856 237
962 3300053096 Ga0500641_0000281 Ga0500641_0000281_17663_18400 237
963 3300053096 Ga0500641_0002911 Ga0500641_0002911_4677_5417 237
964 3300053096 Ga0500641_0042425 Ga0500641_0042425_336_1073 237
965 3300053099 Ga0500654_072357 Ga0500654_072357_481_1218 237
966 3300053104 Ga0500556_0061718 Ga0500556_0061718_209_946 237
967 3300053108 Ga0500562_083394 Ga0500562_083394_68_805 237
968 3300053109 Ga0500569_000298 Ga0500569_000298_1178_1918 237
969 3300053119 Ga0500595_002391 Ga0500595_002391_4188_4925 237
970 3300053121 Ga0500607_132198 Ga0500607_132198_414_1154 237
971 3300053122 Ga0500608_001366 Ga0500608_001366_4967_5707 237
972 3300053123 Ga0500614_007297 Ga0500614_007297_370_1110 237
973 3300053129 Ga0500628_044927 Ga0500628_044927_29_766 237
974 3300053130 Ga0500642_0171449 Ga0500642_0171449_145_882 237
975 3300053133 Ga0500655_031147 Ga0500655_031147_269_1006 237
976 3300053134 Ga0500658_0008025 Ga0500658_0008025_1588_2325 237
977 3300053134 Ga0500658_0018884 Ga0500658_0018884_733_1470 237
978 3300053136 Ga0500559_0152059 Ga0500559_0152059_242_982 237
979 3300053140 Ga0500573_0185731 Ga0500573_0185731_324_1064 237
980 3300053148 Ga0500590_008183 Ga0500590_008183_446_1186 237
981 3300053150 Ga0500603_046359 Ga0500603_046359_189_929 237
982 3300053151 Ga0500604_0003297 Ga0500604_0003297_208_945 237
983 3300053151 Ga0500604_0148306 Ga0500604_0148306_26_763 237
984 3300053153 Ga0500616_0034243 Ga0500616_0034243_1646_2383 237
985 3300053157 Ga0500624_001445 Ga0500624_001445_2180_2920 237
986 3300053161 Ga0500634_0000087 Ga0500634_0000087_16204_16941 237
987 3300053162 Ga0500638_058152 Ga0500638_058152_198_938 237
988 3300053163 Ga0500639_114379 Ga0500639_114379_335_1075 237
989 3300053177 Ga0500636_0002254 Ga0500636_0002254_8801_9541 237
990 3300053178 Ga0500637_0022327 Ga0500637_0022327_35_775 237
991 3300053178 Ga0500637_0183722 Ga0500637_0183722_423_1163 237
992 3300053725 Ga0500576_019706 Ga0500576_019706_2081_2821 237
993 3300053729 Ga0500625_047661 Ga0500625_047661_1187_1930 237
994 3300053731 Ga0500609_000390 Ga0500609_000390_3747_4484 237
995 3300053735 Ga0500596_000190 Ga0500596_000190_2058_2798 237
996 3300054114 Ga0501084_0007012 Ga0501084_0007012_7117_7854 237
997 3300054114 Ga0501084_0048484 Ga0501084_0048484_1250_1987 237
998 3300054114 Ga0501084_0075497 Ga0501084_0075497_1512_2252 237
999 3300054114 Ga0501084_0094788 Ga0501084_0094788_1702_2442 237
1000 3300054114 Ga0501084_0707123 Ga0501084_0707123_40_777 237
1001 3300059492 Ga0587073_0031457 Ga0587073_0031457_301_1038 237
1002 3300060353 Ga0501082_0006711 Ga0501082_0006711_7073_7810 237
1003 3300060353 Ga0501082_0492114 Ga0501082_0492114_289_1026 237
1004 3300060353 Ga0501082_0496140 Ga0501082_0496140_166_903 237
1005 3300061734 Ga0530510_0145921 Ga0530510_0145921_60_797 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

50

241

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

56

286

0.97

PF08659

KR

KR domain

50

230

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

52

219

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9744 1 235
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9721 1 235
4wjz-assembly1.cif.gz_A crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(g141a) from vibrio cholerae 0.9664 3 235
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9653 1 235
1i01-assembly2.cif.gz_G crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli. 0.9651 3 234
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9721 1 235 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 1 235 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 79 236 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9536 4 234 3.40.50.720
4lvuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 3 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y2JN18-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9953 1 134
AF-A0A348W864-F1-model_v4 Beta-ketoacyl-ACP reductase 0.983 1 169 GO:0016491
AF-A0A7C4A247-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9786 1 210 GO:0016491
AF-A0A849GKC7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.978 1 161 GO:0016491
AF-A0A7Y2JN18-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9735 1 134

Feature Viewer

pLDDT pTM Quality
93.31 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map