F487933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1003 | 373 | 2006 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10401260|Ga0207693_104012602 |
| Length | 245 |
| Sequence | MLAPECWNAGHAAQVVRISMPVSFGTADTSTRTSQRCALSGVTVSEDGIVTGNTYDKYGSSNPLVRRLMTGFEAALEELFVQADPRSLLDVGCGEGVLVHRWAQRLGEKRVVGIDLEEQSIQAGWSRRRAPNLEYRTMQAEDLPFAANEFDLASAIEVLEHVPDPERTLAEMVRCAERHLLVSVPREPLWRVLNVARGAYLTQLGNTPGHCNHWSRGSFLRLLSRYGEVVAVRSPFPWTMLLVRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 233 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 237 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 238 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 239 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 370 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 373 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0 |
| Rhizoplane | 8.97 |
| Rhizosphere | 85.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207693_10401260 | 3300025915 | Bacteria | 1072 |
| 2 | JGI25406J46586_10002122 | 3300003203 | Bacteria | 9361 |
| 3 | JGI25407J50210_10000151 | 3300003373 | Bacteria | 10819 |
| 4 | JGI25407J50210_10049560 | 3300003373 | Bacteria | 1066 |
| 5 | Ga0032354_1118388 | 3300003693 | Bacteria | 989 |
| 6 | Ga0070676_10112936 | 3300005328 | Bacteria | 1694 |
| 7 | Ga0070676_10151319 | 3300005328 | Bacteria | 1485 |
| 8 | Ga0070683_100002001 | 3300005329 | Bacteria | 15985 |
| 9 | Ga0070683_100007956 | 3300005329 | Bacteria | 8993 |
| 10 | Ga0070683_100012678 | 3300005329 | Bacteria | 7330 |
| 11 | Ga0070683_100972508 | 3300005329 | Bacteria | 815 |
| 12 | Ga0070683_101430351 | 3300005329 | Bacteria | 664 |
| 13 | Ga0070690_100095155 | 3300005330 | Bacteria | 1966 |
| 14 | Ga0068869_100393778 | 3300005334 | Bacteria | 1138 |
| 15 | Ga0068869_100610154 | 3300005334 | Bacteria | 923 |
| 16 | Ga0070680_100000851 | 3300005336 | Bacteria | 21636 |
| 17 | Ga0070680_100516143 | 3300005336 | Bacteria | 1023 |
| 18 | Ga0070680_100595485 | 3300005336 | Bacteria | 949 |
| 19 | Ga0070680_100596715 | 3300005336 | Bacteria | 948 |
| 20 | Ga0070682_100018192 | 3300005337 | Bacteria | 4104 |
| 21 | Ga0070682_100025807 | 3300005337 | Bacteria | 3510 |
| 22 | Ga0070682_100127380 | 3300005337 | Bacteria | 1718 |
| 23 | Ga0068868_100112271 | 3300005338 | Bacteria | 2215 |
| 24 | Ga0070660_100028182 | 3300005339 | Bacteria | 4200 |
| 25 | Ga0070660_100043921 | 3300005339 | Bacteria | 3416 |
| 26 | Ga0070660_100224887 | 3300005339 | Bacteria | 1526 |
| 27 | Ga0070689_100002784 | 3300005340 | Bacteria | 11477 |
| 28 | Ga0070691_10004880 | 3300005341 | Bacteria | 6105 |
| 29 | Ga0070687_100009144 | 3300005343 | Bacteria | 4232 |
| 30 | Ga0070687_100029066 | 3300005343 | Bacteria | 2687 |
| 31 | Ga0070661_100521921 | 3300005344 | Bacteria | 953 |
| 32 | Ga0070692_10194529 | 3300005345 | Bacteria | 1184 |
| 33 | Ga0070668_100232706 | 3300005347 | Bacteria | 1524 |
| 34 | Ga0070668_100267605 | 3300005347 | Bacteria | 1423 |
| 35 | Ga0070669_100003124 | 3300005353 | Bacteria | 11913 |
| 36 | Ga0070669_100104149 | 3300005353 | Bacteria | 2145 |
| 37 | Ga0070669_100422332 | 3300005353 | Bacteria | 1094 |
| 38 | Ga0070671_100677403 | 3300005355 | Bacteria | 894 |
| 39 | Ga0070674_100890362 | 3300005356 | Bacteria | 775 |
| 40 | Ga0070673_100137131 | 3300005364 | Bacteria | 2061 |
| 41 | Ga0070688_100002559 | 3300005365 | Bacteria | 9210 |
| 42 | Ga0070688_100177278 | 3300005365 | Bacteria | 1475 |
| 43 | Ga0070688_100617367 | 3300005365 | Bacteria | 832 |
| 44 | Ga0070659_100000013 | 3300005366 | Bacteria | 178795 |
| 45 | Ga0070659_100010365 | 3300005366 | Bacteria | 6853 |
| 46 | Ga0070659_100021366 | 3300005366 | Bacteria | 4929 |
| 47 | Ga0070659_100360331 | 3300005366 | Bacteria | 1221 |
| 48 | Ga0070659_100586786 | 3300005366 | Bacteria | 957 |
| 49 | Ga0070659_100723535 | 3300005366 | Bacteria | 862 |
| 50 | Ga0070714_100000137 | 3300005435 | Bacteria | 58260 |
| 51 | Ga0070714_100072239 | 3300005435 | Bacteria | 2986 |
| 52 | Ga0070714_100128989 | 3300005435 | Bacteria | 2258 |
| 53 | Ga0070714_100136958 | 3300005435 | Bacteria | 2194 |
| 54 | Ga0070714_100837189 | 3300005435 | Bacteria | 892 |
| 55 | Ga0070714_100856098 | 3300005435 | Bacteria | 882 |
| 56 | Ga0070714_100881031 | 3300005435 | Bacteria | 869 |
| 57 | Ga0070710_10213322 | 3300005437 | Bacteria | 1225 |
| 58 | Ga0070710_10273707 | 3300005437 | Bacteria | 1093 |
| 59 | Ga0070710_10446337 | 3300005437 | Bacteria | 876 |
| 60 | Ga0070711_100037334 | 3300005439 | Bacteria | 3260 |
| 61 | Ga0070711_100322455 | 3300005439 | Unclassified | 1235 |
| 62 | Ga0070711_100325180 | 3300005439 | Bacteria | 1230 |
| 63 | Ga0070711_100352487 | 3300005439 | Bacteria | 1184 |
| 64 | Ga0070705_100013157 | 3300005440 | Bacteria | 4225 |
| 65 | Ga0070705_100025016 | 3300005440 | Bacteria | 3231 |
| 66 | Ga0070705_100171828 | 3300005440 | Bacteria | 1459 |
| 67 | Ga0070700_100000792 | 3300005441 | Bacteria | 15526 |
| 68 | Ga0070700_100013095 | 3300005441 | Bacteria | 4652 |
| 69 | Ga0070700_100124187 | 3300005441 | Bacteria | 1734 |
| 70 | Ga0070700_100272835 | 3300005441 | Bacteria | 1223 |
| 71 | Ga0070694_100193959 | 3300005444 | Bacteria | 1510 |
| 72 | Ga0070694_100714127 | 3300005444 | Bacteria | 816 |
| 73 | Ga0070708_100120700 | 3300005445 | Bacteria | 2418 |
| 74 | Ga0070663_100215961 | 3300005455 | Bacteria | 1504 |
| 75 | Ga0070678_100051898 | 3300005456 | Bacteria | 2975 |
| 76 | Ga0070678_100863755 | 3300005456 | Bacteria | 825 |
| 77 | Ga0070662_100007538 | 3300005457 | Bacteria | 7061 |
| 78 | Ga0070662_100010410 | 3300005457 | Bacteria | 6099 |
| 79 | Ga0070681_10064485 | 3300005458 | Bacteria | 3633 |
| 80 | Ga0070681_10658765 | 3300005458 | Bacteria | 962 |
| 81 | Ga0068867_100282973 | 3300005459 | Bacteria | 1360 |
| 82 | Ga0070685_10001526 | 3300005466 | Bacteria | 12215 |
| 83 | Ga0070685_10089096 | 3300005466 | Bacteria | 1865 |
| 84 | Ga0070685_10495244 | 3300005466 | Bacteria | 864 |
| 85 | Ga0070707_100889174 | 3300005468 | Bacteria | 855 |
| 86 | Ga0070679_100004554 | 3300005530 | Bacteria | 12798 |
| 87 | Ga0070684_100001264 | 3300005535 | Bacteria | 18112 |
| 88 | Ga0070684_100020205 | 3300005535 | Bacteria | 5525 |
| 89 | Ga0070684_100043861 | 3300005535 | Bacteria | 3864 |
| 90 | Ga0070684_100104754 | 3300005535 | Bacteria | 2531 |
| 91 | Ga0070684_100375527 | 3300005535 | Bacteria | 1309 |
| 92 | Ga0070684_100398481 | 3300005535 | Bacteria | 1269 |
| 93 | Ga0070684_100759346 | 3300005535 | Bacteria | 905 |
| 94 | Ga0068853_100323258 | 3300005539 | Bacteria | 1431 |
| 95 | Ga0068853_100363453 | 3300005539 | Bacteria | 1349 |
| 96 | Ga0068853_100418065 | 3300005539 | Bacteria | 1257 |
| 97 | Ga0070672_100216420 | 3300005543 | Bacteria | 1606 |
| 98 | Ga0070672_100441499 | 3300005543 | Bacteria | 1120 |
| 99 | Ga0070672_100457573 | 3300005543 | Bacteria | 1100 |
| 100 | Ga0070686_100019676 | 3300005544 | Bacteria | 3982 |
| 101 | Ga0070686_100164352 | 3300005544 | Bacteria | 1565 |
| 102 | Ga0070686_100652882 | 3300005544 | Bacteria | 834 |
| 103 | Ga0070695_100076010 | 3300005545 | Bacteria | 2211 |
| 104 | Ga0070695_100254136 | 3300005545 | Bacteria | 1281 |
| 105 | Ga0070696_100077094 | 3300005546 | Bacteria | 2355 |
| 106 | Ga0070693_100142654 | 3300005547 | Bacteria | 1509 |
| 107 | Ga0070693_100344137 | 3300005547 | Bacteria | 1019 |
| 108 | Ga0070693_100413439 | 3300005547 | Bacteria | 938 |
| 109 | Ga0070665_100014863 | 3300005548 | Bacteria | 7814 |
| 110 | Ga0070665_100184015 | 3300005548 | Bacteria | 2090 |
| 111 | Ga0070665_100226679 | 3300005548 | Bacteria | 1869 |
| 112 | Ga0070665_100494127 | 3300005548 | Bacteria | 1235 |
| 113 | Ga0070704_100050641 | 3300005549 | Bacteria | 2920 |
| 114 | Ga0070704_100050690 | 3300005549 | Bacteria | 2919 |
| 115 | Ga0070704_100212121 | 3300005549 | Bacteria | 1570 |
| 116 | Ga0068855_100115379 | 3300005563 | Bacteria | 3079 |
| 117 | Ga0070664_100107671 | 3300005564 | Bacteria | 2430 |
| 118 | Ga0068857_100248237 | 3300005577 | Bacteria | 1631 |
| 119 | Ga0068857_100422112 | 3300005577 | Bacteria | 1244 |
| 120 | Ga0068854_100046665 | 3300005578 | Bacteria | 3085 |
| 121 | Ga0068854_100058889 | 3300005578 | Bacteria | 2774 |
| 122 | Ga0068854_100121737 | 3300005578 | Bacteria | 1982 |
| 123 | Ga0068854_100510594 | 3300005578 | Bacteria | 1014 |
| 124 | Ga0068856_100040052 | 3300005614 | Bacteria | 4601 |
| 125 | Ga0068856_100043324 | 3300005614 | Bacteria | 4428 |
| 126 | Ga0068856_100085307 | 3300005614 | Bacteria | 3137 |
| 127 | Ga0068856_100669109 | 3300005614 | Bacteria | 1059 |
| 128 | Ga0070702_100054426 | 3300005615 | Bacteria | 2302 |
| 129 | Ga0070702_100194478 | 3300005615 | Bacteria | 1337 |
| 130 | Ga0070702_100420823 | 3300005615 | Bacteria | 961 |
| 131 | Ga0070702_100694034 | 3300005615 | Bacteria | 775 |
| 132 | Ga0068852_100007442 | 3300005616 | Bacteria | 7993 |
| 133 | Ga0068852_100052208 | 3300005616 | Bacteria | 3513 |
| 134 | Ga0068859_100129192 | 3300005617 | Bacteria | 2597 |
| 135 | Ga0068859_100702907 | 3300005617 | Bacteria | 1102 |
| 136 | Ga0068859_101419288 | 3300005617 | Bacteria | 766 |
| 137 | Ga0068864_100040881 | 3300005618 | Bacteria | 3965 |
| 138 | Ga0068864_100055854 | 3300005618 | Bacteria | 3410 |
| 139 | Ga0068866_10029323 | 3300005718 | Bacteria | 2631 |
| 140 | Ga0068866_10147443 | 3300005718 | Bacteria | 1359 |
| 141 | Ga0068861_100097351 | 3300005719 | Bacteria | 2334 |
| 142 | Ga0068870_10130798 | 3300005840 | Bacteria | 1457 |
| 143 | Ga0068863_100302744 | 3300005841 | Bacteria | 1551 |
| 144 | Ga0068858_100058261 | 3300005842 | Bacteria | 3571 |
| 145 | Ga0068860_100052109 | 3300005843 | Bacteria | 3892 |
| 146 | Ga0068862_100053510 | 3300005844 | Bacteria | 3456 |
| 147 | Ga0068862_100183903 | 3300005844 | Bacteria | 1877 |
| 148 | Ga0081455_10009871 | 3300005937 | Bacteria | 9769 |
| 149 | Ga0081455_10032988 | 3300005937 | Bacteria | 4658 |
| 150 | Ga0081455_10118826 | 3300005937 | Bacteria | 2086 |
| 151 | Ga0081455_10428800 | 3300005937 | Unclassified | 909 |
| 152 | Ga0081538_10000035 | 3300005981 | Bacteria | 120009 |
| 153 | Ga0081538_10000686 | 3300005981 | Bacteria | 37157 |
| 154 | Ga0081538_10000796 | 3300005981 | Bacteria | 34251 |
| 155 | Ga0081538_10001347 | 3300005981 | Bacteria | 25269 |
| 156 | Ga0081538_10001532 | 3300005981 | Bacteria | 23721 |
| 157 | Ga0081538_10001548 | 3300005981 | Bacteria | 23571 |
| 158 | Ga0081538_10004774 | 3300005981 | Bacteria | 12390 |
| 159 | Ga0081538_10005388 | 3300005981 | Bacteria | 11498 |
| 160 | Ga0081538_10005793 | 3300005981 | Bacteria | 11020 |
| 161 | Ga0081538_10007624 | 3300005981 | Bacteria | 9331 |
| 162 | Ga0081538_10008204 | 3300005981 | Bacteria | 8908 |
| 163 | Ga0081538_10031118 | 3300005981 | Bacteria | 3608 |
| 164 | Ga0081538_10040376 | 3300005981 | Bacteria | 2978 |
| 165 | Ga0081538_10160483 | 3300005981 | Bacteria | 1000 |
| 166 | Ga0081540_1001836 | 3300005983 | Bacteria | 17805 |
| 167 | Ga0081540_1050127 | 3300005983 | Bacteria | 2076 |
| 168 | Ga0081539_10011937 | 3300005985 | Bacteria | 6777 |
| 169 | Ga0081539_10016115 | 3300005985 | Bacteria | 5368 |
| 170 | Ga0081539_10039589 | 3300005985 | Bacteria | 2778 |
| 171 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 172 | Ga0075432_10006699 | 3300006058 | Bacteria | 3924 |
| 173 | Ga0070716_100037990 | 3300006173 | Bacteria | 2663 |
| 174 | Ga0070716_100383595 | 3300006173 | Bacteria | 1005 |
| 175 | Ga0070712_100000002 | 3300006175 | Bacteria | 288475 |
| 176 | Ga0070712_100002104 | 3300006175 | Bacteria | 12239 |
| 177 | Ga0070712_100050081 | 3300006175 | Bacteria | 2904 |
| 178 | Ga0070712_100070633 | 3300006175 | Bacteria | 2495 |
| 179 | Ga0070712_100132205 | 3300006175 | Bacteria | 1892 |
| 180 | Ga0075428_100134027 | 3300006844 | Bacteria | 2694 |
| 181 | Ga0075428_100657319 | 3300006844 | Bacteria | 1118 |
| 182 | Ga0075430_100059932 | 3300006846 | Bacteria | 3199 |
| 183 | Ga0075430_100149263 | 3300006846 | Bacteria | 1947 |
| 184 | Ga0075430_100196294 | 3300006846 | Bacteria | 1677 |
| 185 | Ga0075430_100381036 | 3300006846 | Bacteria | 1164 |
| 186 | Ga0075430_100395457 | 3300006846 | Unclassified | 1141 |
| 187 | Ga0075431_100005739 | 3300006847 | Bacteria | 12274 |
| 188 | Ga0075431_100013418 | 3300006847 | Bacteria | 8277 |
| 189 | Ga0075431_100201213 | 3300006847 | Bacteria | 2038 |
| 190 | Ga0075431_100859971 | 3300006847 | Bacteria | 878 |
| 191 | Ga0075433_10058988 | 3300006852 | Bacteria | 3357 |
| 192 | Ga0075433_10077257 | 3300006852 | Bacteria | 2933 |
| 193 | Ga0075434_100062110 | 3300006871 | Bacteria | 3718 |
| 194 | Ga0075434_100278268 | 3300006871 | Bacteria | 1693 |
| 195 | Ga0075429_100000985 | 3300006880 | Bacteria | 22642 |
| 196 | Ga0075429_100002391 | 3300006880 | Bacteria | 15812 |
| 197 | Ga0068865_100074038 | 3300006881 | Bacteria | 2424 |
| 198 | Ga0068865_100094599 | 3300006881 | Bacteria | 2175 |
| 199 | Ga0068865_100100696 | 3300006881 | Bacteria | 2115 |
| 200 | Ga0075436_100028836 | 3300006914 | Bacteria | 3818 |
| 201 | Ga0075436_100380180 | 3300006914 | Bacteria | 1021 |
| 202 | Ga0097620_100129191 | 3300006931 | Bacteria | 2597 |
| 203 | Ga0097620_100702912 | 3300006931 | Bacteria | 1102 |
| 204 | Ga0097620_101419336 | 3300006931 | Bacteria | 766 |
| 205 | Ga0075435_100035221 | 3300007076 | Bacteria | 3972 |
| 206 | Ga0075435_100041218 | 3300007076 | Bacteria | 3690 |
| 207 | Ga0105244_10182490 | 3300009036 | Bacteria | 995 |
| 208 | Ga0105240_10008779 | 3300009093 | Bacteria | 14400 |
| 209 | Ga0105240_10035619 | 3300009093 | Bacteria | 6412 |
| 210 | Ga0105240_10096003 | 3300009093 | Bacteria | 3614 |
| 211 | Ga0105240_10787541 | 3300009093 | Bacteria | 1031 |
| 212 | Ga0111539_10010097 | 3300009094 | Bacteria | 11901 |
| 213 | Ga0111539_10026586 | 3300009094 | Bacteria | 7075 |
| 214 | Ga0111539_10044601 | 3300009094 | Bacteria | 5312 |
| 215 | Ga0111539_10199389 | 3300009094 | Bacteria | 2334 |
| 216 | Ga0111539_10373480 | 3300009094 | Bacteria | 1660 |
| 217 | Ga0111539_10925690 | 3300009094 | Bacteria | 1014 |
| 218 | Ga0111539_11595920 | 3300009094 | Bacteria | 757 |
| 219 | Ga0105245_10034568 | 3300009098 | Bacteria | 4484 |
| 220 | Ga0105245_10104866 | 3300009098 | Bacteria | 2621 |
| 221 | Ga0105245_10114050 | 3300009098 | Bacteria | 2517 |
| 222 | Ga0105245_10133846 | 3300009098 | Bacteria | 2327 |
| 223 | Ga0105245_10219831 | 3300009098 | Bacteria | 1832 |
| 224 | Ga0105245_10730930 | 3300009098 | Bacteria | 1025 |
| 225 | Ga0105247_10395986 | 3300009101 | Bacteria | 983 |
| 226 | Ga0105247_10494798 | 3300009101 | Bacteria | 890 |
| 227 | Ga0114129_10001284 | 3300009147 | Bacteria | 33454 |
| 228 | Ga0114129_10001769 | 3300009147 | Bacteria | 29451 |
| 229 | Ga0114129_10003100 | 3300009147 | Bacteria | 23306 |
| 230 | Ga0114129_10230528 | 3300009147 | Bacteria | 2494 |
| 231 | Ga0114129_10487610 | 3300009147 | Bacteria | 1612 |
| 232 | Ga0114129_10621528 | 3300009147 | Bacteria | 1397 |
| 233 | Ga0114129_10747040 | 3300009147 | Bacteria | 1253 |
| 234 | Ga0114129_11004487 | 3300009147 | Bacteria | 1050 |
| 235 | Ga0114129_11216264 | 3300009147 | Bacteria | 938 |
| 236 | Ga0105243_10060590 | 3300009148 | Bacteria | 3023 |
| 237 | Ga0105243_10377065 | 3300009148 | Bacteria | 1311 |
| 238 | Ga0105243_10755492 | 3300009148 | Bacteria | 954 |
| 239 | Ga0105242_10375432 | 3300009176 | Bacteria | 1320 |
| 240 | Ga0105242_10571650 | 3300009176 | Bacteria | 1087 |
| 241 | Ga0105248_10061918 | 3300009177 | Bacteria | 4202 |
| 242 | Ga0105248_10209520 | 3300009177 | Bacteria | 2196 |
| 243 | Ga0105248_11252989 | 3300009177 | Bacteria | 839 |
| 244 | Ga0105237_10035405 | 3300009545 | Bacteria | 5052 |
| 245 | Ga0105237_10053629 | 3300009545 | Bacteria | 4044 |
| 246 | Ga0105238_10021716 | 3300009551 | Bacteria | 6538 |
| 247 | Ga0105238_10175540 | 3300009551 | Bacteria | 2119 |
| 248 | Ga0105238_10516644 | 3300009551 | Bacteria | 1197 |
| 249 | Ga0105238_10755716 | 3300009551 | Bacteria | 986 |
| 250 | Ga0105238_10974594 | 3300009551 | Bacteria | 868 |
| 251 | Ga0105249_10002555 | 3300009553 | Bacteria | 15760 |
| 252 | Ga0105249_10056642 | 3300009553 | Bacteria | 3588 |
| 253 | Ga0105249_10207693 | 3300009553 | Bacteria | 1920 |
| 254 | Ga0105239_10033164 | 3300010375 | Bacteria | 5671 |
| 255 | Ga0105239_10234369 | 3300010375 | Bacteria | 2060 |
| 256 | Ga0105246_10029838 | 3300011119 | Bacteria | 3596 |
| 257 | Ga0105246_10071124 | 3300011119 | Bacteria | 2449 |
| 258 | Ga0105246_10560780 | 3300011119 | Bacteria | 980 |
| 259 | Ga0105246_10574043 | 3300011119 | Bacteria | 970 |
| 260 | Ga0157371_10169662 | 3300013102 | Bacteria | 1559 |
| 261 | Ga0157371_10753285 | 3300013102 | Bacteria | 731 |
| 262 | Ga0157370_10017809 | 3300013104 | Bacteria | 7158 |
| 263 | Ga0157369_10064451 | 3300013105 | Bacteria | 3946 |
| 264 | Ga0157369_10511781 | 3300013105 | Bacteria | 1242 |
| 265 | Ga0157369_10586396 | 3300013105 | Bacteria | 1151 |
| 266 | Ga0157369_10643227 | 3300013105 | Bacteria | 1094 |
| 267 | Ga0157369_10703292 | 3300013105 | Bacteria | 1041 |
| 268 | Ga0157369_10826717 | 3300013105 | Unclassified | 951 |
| 269 | Ga0157374_10202317 | 3300013296 | Bacteria | 1945 |
| 270 | Ga0157378_10198259 | 3300013297 | Bacteria | 1897 |
| 271 | Ga0157378_11237601 | 3300013297 | Bacteria | 787 |
| 272 | Ga0163162_10097679 | 3300013306 | Bacteria | 3025 |
| 273 | Ga0163162_10574634 | 3300013306 | Bacteria | 1254 |
| 274 | Ga0163162_11246488 | 3300013306 | Bacteria | 844 |
| 275 | Ga0157372_10021302 | 3300013307 | Bacteria | 7002 |
| 276 | Ga0157372_10059317 | 3300013307 | Bacteria | 4279 |
| 277 | Ga0157372_10415797 | 3300013307 | Bacteria | 1567 |
| 278 | Ga0157375_10150681 | 3300013308 | Bacteria | 2461 |
| 279 | Ga0157375_10716828 | 3300013308 | Bacteria | 1153 |
| 280 | Ga0163163_10058837 | 3300014325 | Bacteria | 3800 |
| 281 | Ga0163163_10079759 | 3300014325 | Bacteria | 3272 |
| 282 | Ga0163163_10312329 | 3300014325 | Bacteria | 1625 |
| 283 | Ga0157380_10559719 | 3300014326 | Bacteria | 1123 |
| 284 | Ga0157380_10604876 | 3300014326 | Bacteria | 1085 |
| 285 | Ga0157380_11321260 | 3300014326 | Bacteria | 769 |
| 286 | Ga0157380_11614859 | 3300014326 | Bacteria | 704 |
| 287 | Ga0157377_10022125 | 3300014745 | Bacteria | 3353 |
| 288 | Ga0157377_10054145 | 3300014745 | Bacteria | 2271 |
| 289 | Ga0157377_10123277 | 3300014745 | Bacteria | 1573 |
| 290 | Ga0157379_10002756 | 3300014968 | Bacteria | 14821 |
| 291 | Ga0157379_10595734 | 3300014968 | Bacteria | 1031 |
| 292 | Ga0157379_10787677 | 3300014968 | Bacteria | 897 |
| 293 | Ga0157379_10875928 | 3300014968 | Bacteria | 851 |
| 294 | Ga0157376_10076419 | 3300014969 | Bacteria | 2861 |
| 295 | Ga0157376_10459838 | 3300014969 | Bacteria | 1243 |
| 296 | Ga0163161_10224113 | 3300017792 | Bacteria | 1457 |
| 297 | Ga0163161_10865138 | 3300017792 | Bacteria | 764 |
| 298 | Ga0206354_10874749 | 3300020081 | Bacteria | 3444 |
| 299 | Ga0206353_10577359 | 3300020082 | Bacteria | 2379 |
| 300 | Ga0206353_11238906 | 3300020082 | Bacteria | 1205 |
| 301 | Ga0206353_11619556 | 3300020082 | Bacteria | 4512 |
| 302 | Ga0213873_10022720 | 3300021358 | Bacteria | 1488 |
| 303 | Ga0213873_10059852 | 3300021358 | Bacteria | 1028 |
| 304 | Ga0213874_10000286 | 3300021377 | Bacteria | 9904 |
| 305 | Ga0213874_10117757 | 3300021377 | Bacteria | 899 |
| 306 | Ga0213876_10004599 | 3300021384 | Bacteria | 7697 |
| 307 | Ga0213876_10013573 | 3300021384 | Bacteria | 4321 |
| 308 | Ga0213876_10047594 | 3300021384 | Bacteria | 2267 |
| 309 | Ga0213876_10067549 | 3300021384 | Bacteria | 1888 |
| 310 | Ga0213876_10111661 | 3300021384 | Bacteria | 1451 |
| 311 | Ga0213876_10229595 | 3300021384 | Bacteria | 986 |
| 312 | Ga0213875_10004930 | 3300021388 | Bacteria | 7247 |
| 313 | Ga0213875_10035984 | 3300021388 | Bacteria | 2335 |
| 314 | Ga0213875_10071666 | 3300021388 | Bacteria | 1618 |
| 315 | Ga0224712_10192507 | 3300022467 | Bacteria | 924 |
| 316 | Ga0207426_1022128 | 3300025302 | Bacteria | 2188 |
| 317 | Ga0207692_10119972 | 3300025898 | Bacteria | 1471 |
| 318 | Ga0207642_10043969 | 3300025899 | Bacteria | 1974 |
| 319 | Ga0207688_10000837 | 3300025901 | Bacteria | 15455 |
| 320 | Ga0207688_10041232 | 3300025901 | Bacteria | 2567 |
| 321 | Ga0207688_10050595 | 3300025901 | Bacteria | 2326 |
| 322 | Ga0207688_10093730 | 3300025901 | Bacteria | 1727 |
| 323 | Ga0207688_10133445 | 3300025901 | Bacteria | 1456 |
| 324 | Ga0207647_10070974 | 3300025904 | Bacteria | 2102 |
| 325 | Ga0207647_10231714 | 3300025904 | Bacteria | 1062 |
| 326 | Ga0207699_10153629 | 3300025906 | Bacteria | 1525 |
| 327 | Ga0207699_10246426 | 3300025906 | Bacteria | 1230 |
| 328 | Ga0207645_10038506 | 3300025907 | Bacteria | 3066 |
| 329 | Ga0207645_10126985 | 3300025907 | Bacteria | 1658 |
| 330 | Ga0207643_10016080 | 3300025908 | Bacteria | 4077 |
| 331 | Ga0207643_10252762 | 3300025908 | Bacteria | 1086 |
| 332 | Ga0207705_10050012 | 3300025909 | Bacteria | 3008 |
| 333 | Ga0207705_10211615 | 3300025909 | Bacteria | 1470 |
| 334 | Ga0207705_10446500 | 3300025909 | Bacteria | 1002 |
| 335 | Ga0207707_10034137 | 3300025912 | Bacteria | 4451 |
| 336 | Ga0207695_10015973 | 3300025913 | Bacteria | 8812 |
| 337 | Ga0207695_10066993 | 3300025913 | Bacteria | 3685 |
| 338 | Ga0207671_10009131 | 3300025914 | Bacteria | 8324 |
| 339 | Ga0207671_10046530 | 3300025914 | Bacteria | 3210 |
| 340 | Ga0207671_10870426 | 3300025914 | Bacteria | 713 |
| 341 | Ga0207693_10000327 | 3300025915 | Bacteria | 43947 |
| 342 | Ga0207693_10001761 | 3300025915 | Bacteria | 18999 |
| 343 | Ga0207693_10033646 | 3300025915 | Bacteria | 4044 |
| 344 | Ga0207693_10061828 | 3300025915 | Bacteria | 2933 |
| 345 | Ga0207663_10041395 | 3300025916 | Bacteria | 2808 |
| 346 | Ga0207663_10150608 | 3300025916 | Bacteria | 1632 |
| 347 | Ga0207663_10163911 | 3300025916 | Bacteria | 1572 |
| 348 | Ga0207663_10304040 | 3300025916 | Bacteria | 1193 |
| 349 | Ga0207663_10375746 | 3300025916 | Bacteria | 1082 |
| 350 | Ga0207660_10020293 | 3300025917 | Bacteria | 4456 |
| 351 | Ga0207660_10550249 | 3300025917 | Bacteria | 939 |
| 352 | Ga0207662_10001100 | 3300025918 | Bacteria | 12711 |
| 353 | Ga0207662_10013749 | 3300025918 | Bacteria | 4530 |
| 354 | Ga0207662_10025441 | 3300025918 | Bacteria | 3409 |
| 355 | Ga0207657_10020543 | 3300025919 | Bacteria | 6238 |
| 356 | Ga0207657_10074175 | 3300025919 | Bacteria | 2874 |
| 357 | Ga0207657_10112322 | 3300025919 | Bacteria | 2249 |
| 358 | Ga0207657_10128028 | 3300025919 | Bacteria | 2084 |
| 359 | Ga0207657_10256728 | 3300025919 | Bacteria | 1392 |
| 360 | Ga0207649_10430963 | 3300025920 | Bacteria | 992 |
| 361 | Ga0207649_10601593 | 3300025920 | Bacteria | 846 |
| 362 | Ga0207652_10021757 | 3300025921 | Bacteria | 5296 |
| 363 | Ga0207652_10047855 | 3300025921 | Bacteria | 3653 |
| 364 | Ga0207652_10510486 | 3300025921 | Bacteria | 1082 |
| 365 | Ga0207646_10193065 | 3300025922 | Bacteria | 1839 |
| 366 | Ga0207646_10750932 | 3300025922 | Bacteria | 871 |
| 367 | Ga0207681_10007778 | 3300025923 | Bacteria | 6565 |
| 368 | Ga0207681_11155720 | 3300025923 | Bacteria | 650 |
| 369 | Ga0207694_10521321 | 3300025924 | Bacteria | 996 |
| 370 | Ga0207694_10521941 | 3300025924 | Bacteria | 995 |
| 371 | Ga0207694_10590113 | 3300025924 | Bacteria | 934 |
| 372 | Ga0207694_10647867 | 3300025924 | Bacteria | 890 |
| 373 | Ga0207694_10697589 | 3300025924 | Bacteria | 856 |
| 374 | Ga0207650_10100909 | 3300025925 | Bacteria | 2221 |
| 375 | Ga0207650_10244685 | 3300025925 | Bacteria | 1450 |
| 376 | Ga0207650_10245645 | 3300025925 | Bacteria | 1447 |
| 377 | Ga0207659_10822650 | 3300025926 | Bacteria | 798 |
| 378 | Ga0207687_10041432 | 3300025927 | Bacteria | 3162 |
| 379 | Ga0207687_10148521 | 3300025927 | Bacteria | 1786 |
| 380 | Ga0207687_10747644 | 3300025927 | Bacteria | 832 |
| 381 | Ga0207700_10226856 | 3300025928 | Bacteria | 1586 |
| 382 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 383 | Ga0207664_10001425 | 3300025929 | Bacteria | 15730 |
| 384 | Ga0207664_10164876 | 3300025929 | Bacteria | 1892 |
| 385 | Ga0207664_10201664 | 3300025929 | Bacteria | 1718 |
| 386 | Ga0207664_10277769 | 3300025929 | Bacteria | 1469 |
| 387 | Ga0207664_10803374 | 3300025929 | Bacteria | 846 |
| 388 | Ga0207644_10084495 | 3300025931 | Bacteria | 2353 |
| 389 | Ga0207644_10482599 | 3300025931 | Bacteria | 1021 |
| 390 | Ga0207690_10000017 | 3300025932 | Bacteria | 243513 |
| 391 | Ga0207690_10038862 | 3300025932 | Bacteria | 3101 |
| 392 | Ga0207690_10165618 | 3300025932 | Bacteria | 1652 |
| 393 | Ga0207690_10248156 | 3300025932 | Bacteria | 1374 |
| 394 | Ga0207690_10479682 | 3300025932 | Bacteria | 1003 |
| 395 | Ga0207690_10618717 | 3300025932 | Bacteria | 885 |
| 396 | Ga0207706_10003447 | 3300025933 | Bacteria | 15103 |
| 397 | Ga0207706_10049514 | 3300025933 | Bacteria | 3713 |
| 398 | Ga0207706_10221945 | 3300025933 | Bacteria | 1655 |
| 399 | Ga0207706_10281907 | 3300025933 | Bacteria | 1449 |
| 400 | Ga0207706_10348693 | 3300025933 | Bacteria | 1287 |
| 401 | Ga0207706_10450961 | 3300025933 | Bacteria | 1113 |
| 402 | Ga0207706_10470414 | 3300025933 | Bacteria | 1086 |
| 403 | Ga0207706_10773316 | 3300025933 | Bacteria | 817 |
| 404 | Ga0207686_10559656 | 3300025934 | Bacteria | 895 |
| 405 | Ga0207709_10546181 | 3300025935 | Bacteria | 911 |
| 406 | Ga0207670_10001431 | 3300025936 | Bacteria | 12529 |
| 407 | Ga0207670_10663229 | 3300025936 | Bacteria | 861 |
| 408 | Ga0207669_10307807 | 3300025937 | Bacteria | 1207 |
| 409 | Ga0207669_10850834 | 3300025937 | Bacteria | 759 |
| 410 | Ga0207704_10016449 | 3300025938 | Bacteria | 3802 |
| 411 | Ga0207704_10023564 | 3300025938 | Bacteria | 3320 |
| 412 | Ga0207704_10096881 | 3300025938 | Bacteria | 1955 |
| 413 | Ga0207665_10089389 | 3300025939 | Bacteria | 2133 |
| 414 | Ga0207665_10482230 | 3300025939 | Bacteria | 956 |
| 415 | Ga0207691_10080475 | 3300025940 | Bacteria | 2930 |
| 416 | Ga0207691_10266972 | 3300025940 | Bacteria | 1474 |
| 417 | Ga0207691_10516962 | 3300025940 | Bacteria | 1013 |
| 418 | Ga0207689_10024464 | 3300025942 | Bacteria | 5067 |
| 419 | Ga0207689_10198982 | 3300025942 | Bacteria | 1654 |
| 420 | Ga0207689_10505934 | 3300025942 | Bacteria | 1012 |
| 421 | Ga0207661_10004877 | 3300025944 | Bacteria | 9402 |
| 422 | Ga0207661_10016432 | 3300025944 | Bacteria | 5460 |
| 423 | Ga0207661_10247771 | 3300025944 | Bacteria | 1583 |
| 424 | Ga0207661_10310088 | 3300025944 | Bacteria | 1416 |
| 425 | Ga0207661_10716484 | 3300025944 | Bacteria | 921 |
| 426 | Ga0207679_10030048 | 3300025945 | Bacteria | 3791 |
| 427 | Ga0207679_10156559 | 3300025945 | Bacteria | 1861 |
| 428 | Ga0207679_10183666 | 3300025945 | Bacteria | 1732 |
| 429 | Ga0207679_10254981 | 3300025945 | Bacteria | 1493 |
| 430 | Ga0207651_10208866 | 3300025960 | Bacteria | 1570 |
| 431 | Ga0207712_10007095 | 3300025961 | Bacteria | 7066 |
| 432 | Ga0207712_10247160 | 3300025961 | Bacteria | 1440 |
| 433 | Ga0207668_10255500 | 3300025972 | Bacteria | 1425 |
| 434 | Ga0207668_10352312 | 3300025972 | Bacteria | 1231 |
| 435 | Ga0207640_10048962 | 3300025981 | Bacteria | 2734 |
| 436 | Ga0207640_10070838 | 3300025981 | Bacteria | 2346 |
| 437 | Ga0207640_10102341 | 3300025981 | Bacteria | 2011 |
| 438 | Ga0207640_10259162 | 3300025981 | Bacteria | 1354 |
| 439 | Ga0207640_10969990 | 3300025981 | Bacteria | 746 |
| 440 | Ga0207658_10260126 | 3300025986 | Bacteria | 1479 |
| 441 | Ga0207677_10076623 | 3300026023 | Bacteria | 2381 |
| 442 | Ga0207677_10224438 | 3300026023 | Bacteria | 1509 |
| 443 | Ga0207677_10260083 | 3300026023 | Bacteria | 1414 |
| 444 | Ga0207677_10871580 | 3300026023 | Bacteria | 810 |
| 445 | Ga0207703_10109837 | 3300026035 | Bacteria | 2351 |
| 446 | Ga0207703_10180667 | 3300026035 | Bacteria | 1862 |
| 447 | Ga0207639_10106837 | 3300026041 | Bacteria | 2273 |
| 448 | Ga0207639_10370946 | 3300026041 | Bacteria | 1283 |
| 449 | Ga0207678_10327800 | 3300026067 | Bacteria | 1318 |
| 450 | Ga0207678_10541442 | 3300026067 | Bacteria | 1018 |
| 451 | Ga0207708_10000262 | 3300026075 | Bacteria | 41463 |
| 452 | Ga0207708_10005500 | 3300026075 | Bacteria | 9353 |
| 453 | Ga0207708_10027883 | 3300026075 | Bacteria | 4275 |
| 454 | Ga0207708_10222675 | 3300026075 | Bacteria | 1512 |
| 455 | Ga0207702_10149712 | 3300026078 | Bacteria | 2122 |
| 456 | Ga0207702_10270174 | 3300026078 | Bacteria | 1603 |
| 457 | Ga0207702_10691092 | 3300026078 | Bacteria | 1005 |
| 458 | Ga0207641_10251107 | 3300026088 | Bacteria | 1652 |
| 459 | Ga0207641_10625725 | 3300026088 | Bacteria | 1056 |
| 460 | Ga0207648_10300311 | 3300026089 | Bacteria | 1440 |
| 461 | Ga0207676_10057173 | 3300026095 | Bacteria | 3071 |
| 462 | Ga0207676_10108096 | 3300026095 | Bacteria | 2321 |
| 463 | Ga0207676_10148488 | 3300026095 | Bacteria | 2016 |
| 464 | Ga0207674_10031818 | 3300026116 | Bacteria | 5537 |
| 465 | Ga0207674_10114818 | 3300026116 | Bacteria | 2664 |
| 466 | Ga0207675_100003369 | 3300026118 | Bacteria | 15620 |
| 467 | Ga0207675_100052101 | 3300026118 | Bacteria | 3819 |
| 468 | Ga0207675_100134023 | 3300026118 | Bacteria | 2349 |
| 469 | Ga0207683_10007689 | 3300026121 | Bacteria | 9229 |
| 470 | Ga0207683_10030528 | 3300026121 | Bacteria | 4670 |
| 471 | Ga0207683_10299851 | 3300026121 | Bacteria | 1470 |
| 472 | Ga0207683_10800871 | 3300026121 | Bacteria | 875 |
| 473 | Ga0207698_10009395 | 3300026142 | Bacteria | 6235 |
| 474 | Ga0207698_10307308 | 3300026142 | Bacteria | 1479 |
| 475 | Ga0207698_10908976 | 3300026142 | Unclassified | 888 |
| 476 | Ga0207698_11451743 | 3300026142 | Bacteria | 701 |
| 477 | Ga0207428_10026260 | 3300027907 | Bacteria | 4862 |
| 478 | Ga0207428_10027185 | 3300027907 | Bacteria | 4765 |
| 479 | Ga0207428_10138551 | 3300027907 | Bacteria | 1859 |
| 480 | Ga0207428_10165116 | 3300027907 | Bacteria | 1679 |
| 481 | Ga0268266_10024720 | 3300028379 | Bacteria | 5111 |
| 482 | Ga0268266_10129471 | 3300028379 | Bacteria | 2256 |
| 483 | Ga0268266_10131349 | 3300028379 | Bacteria | 2240 |
| 484 | Ga0268266_10455455 | 3300028379 | Bacteria | 1217 |
| 485 | Ga0268265_10321432 | 3300028380 | Bacteria | 1402 |
| 486 | Ga0268265_10399338 | 3300028380 | Bacteria | 1270 |
| 487 | Ga0268264_10087651 | 3300028381 | Bacteria | 2677 |
| 488 | Ga0265337_1002297 | 3300028556 | Bacteria | 8876 |
| 489 | Ga0265326_10000045 | 3300028558 | Bacteria | 79810 |
| 490 | Ga0265326_10000318 | 3300028558 | Bacteria | 20961 |
| 491 | Ga0265326_10048311 | 3300028558 | Bacteria | 1207 |
| 492 | Ga0265319_1000436 | 3300028563 | Bacteria | 29984 |
| 493 | Ga0265319_1003909 | 3300028563 | Bacteria | 7579 |
| 494 | Ga0265319_1004825 | 3300028563 | Bacteria | 6603 |
| 495 | Ga0265334_10000012 | 3300028573 | Bacteria | 174358 |
| 496 | Ga0265318_10001193 | 3300028577 | Bacteria | 15929 |
| 497 | Ga0265318_10021316 | 3300028577 | Bacteria | 2602 |
| 498 | Ga0265336_10000002 | 3300028666 | Bacteria | 830172 |
| 499 | Ga0265336_10007601 | 3300028666 | Bacteria | 3849 |
| 500 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 501 | Ga0265338_10019260 | 3300028800 | Bacteria | 7257 |
| 502 | Ga0265338_10021887 | 3300028800 | Bacteria | 6644 |
| 503 | Ga0265324_10005748 | 3300029957 | Bacteria | 5286 |
| 504 | Ga0265324_10021734 | 3300029957 | Bacteria | 2298 |
| 505 | Ga0265320_10026441 | 3300031240 | Bacteria | 3037 |
| 506 | Ga0265325_10267863 | 3300031241 | Bacteria | 769 |
| 507 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 508 | Ga0265339_10142321 | 3300031249 | Bacteria | 1219 |
| 509 | Ga0265327_10013895 | 3300031251 | Bacteria | 5312 |
| 510 | Ga0265327_10025123 | 3300031251 | Bacteria | 3481 |
| 511 | Ga0307408_100380562 | 3300031548 | Bacteria | 1206 |
| 512 | Ga0265314_10094109 | 3300031711 | Bacteria | 1943 |
| 513 | Ga0307405_10026830 | 3300031731 | Bacteria | 3330 |
| 514 | Ga0307405_10072812 | 3300031731 | Bacteria | 2216 |
| 515 | Ga0307405_10141587 | 3300031731 | Bacteria | 1678 |
| 516 | Ga0307405_10207810 | 3300031731 | Bacteria | 1427 |
| 517 | Ga0307405_10219743 | 3300031731 | Bacteria | 1393 |
| 518 | Ga0307405_10259523 | 3300031731 | Bacteria | 1297 |
| 519 | Ga0307405_10333099 | 3300031731 | Bacteria | 1164 |
| 520 | Ga0307413_10004520 | 3300031824 | Bacteria | 6064 |
| 521 | Ga0307413_10010533 | 3300031824 | Bacteria | 4492 |
| 522 | Ga0307413_10027796 | 3300031824 | Bacteria | 3141 |
| 523 | Ga0307413_10143709 | 3300031824 | Bacteria | 1652 |
| 524 | Ga0307413_10151179 | 3300031824 | Bacteria | 1618 |
| 525 | Ga0307413_10363631 | 3300031824 | Bacteria | 1121 |
| 526 | Ga0307413_11163864 | 3300031824 | Bacteria | 669 |
| 527 | Ga0307410_10049059 | 3300031852 | Bacteria | 2832 |
| 528 | Ga0307410_10118831 | 3300031852 | Bacteria | 1924 |
| 529 | Ga0307410_10316507 | 3300031852 | Bacteria | 1237 |
| 530 | Ga0307410_10317852 | 3300031852 | Bacteria | 1234 |
| 531 | Ga0307410_10318103 | 3300031852 | Bacteria | 1234 |
| 532 | Ga0307410_10440393 | 3300031852 | Bacteria | 1061 |
| 533 | Ga0307410_10906964 | 3300031852 | Bacteria | 755 |
| 534 | Ga0307406_10034062 | 3300031901 | Bacteria | 3122 |
| 535 | Ga0307406_10050479 | 3300031901 | Bacteria | 2638 |
| 536 | Ga0307406_10061900 | 3300031901 | Bacteria | 2419 |
| 537 | Ga0307406_10112368 | 3300031901 | Bacteria | 1878 |
| 538 | Ga0307406_10379542 | 3300031901 | Bacteria | 1114 |
| 539 | Ga0307407_10311196 | 3300031903 | Bacteria | 1102 |
| 540 | Ga0307412_10079012 | 3300031911 | Bacteria | 2268 |
| 541 | Ga0307409_100013677 | 3300031995 | Bacteria | 5239 |
| 542 | Ga0307409_100023003 | 3300031995 | Bacteria | 4308 |
| 543 | Ga0307409_100187342 | 3300031995 | Bacteria | 1838 |
| 544 | Ga0307409_100266172 | 3300031995 | Bacteria | 1576 |
| 545 | Ga0307416_100018458 | 3300032002 | Bacteria | 4913 |
| 546 | Ga0307416_100064797 | 3300032002 | Bacteria | 2999 |
| 547 | Ga0307416_100097547 | 3300032002 | Bacteria | 2546 |
| 548 | Ga0307416_100185191 | 3300032002 | Bacteria | 1956 |
| 549 | Ga0307416_100238743 | 3300032002 | Bacteria | 1759 |
| 550 | Ga0307416_100523160 | 3300032002 | Bacteria | 1255 |
| 551 | Ga0307416_100638896 | 3300032002 | Bacteria | 1148 |
| 552 | Ga0307416_100808139 | 3300032002 | Bacteria | 1034 |
| 553 | Ga0307416_102029861 | 3300032002 | Bacteria | 677 |
| 554 | Ga0307414_10097145 | 3300032004 | Bacteria | 2206 |
| 555 | Ga0307414_11121964 | 3300032004 | Bacteria | 727 |
| 556 | Ga0307411_10159356 | 3300032005 | Bacteria | 1688 |
| 557 | Ga0307411_10553866 | 3300032005 | Bacteria | 981 |
| 558 | Ga0307411_11132417 | 3300032005 | Bacteria | 707 |
| 559 | Ga0307415_100010575 | 3300032126 | Bacteria | 5232 |
| 560 | Ga0307415_100026117 | 3300032126 | Bacteria | 3678 |
| 561 | Ga0307415_100060247 | 3300032126 | Bacteria | 2622 |
| 562 | Ga0307415_100114074 | 3300032126 | Bacteria | 2011 |
| 563 | Ga0307415_100336831 | 3300032126 | Bacteria | 1264 |
| 564 | Ga0307415_100896240 | 3300032126 | Bacteria | 817 |
| 565 | Ga0373959_0016079 | 3300034820 | Bacteria | 1382 |
| 566 | Ga0373951_0012443 | 3300035091 | Bacteria | 1914 |
| 567 | Ga0373952_0019941 | 3300035092 | Bacteria | 1400 |
| 568 | Ga0373952_0096180 | 3300035092 | Bacteria | 776 |
| 569 | Ga0373941_0096849 | 3300035115 | Bacteria | 1021 |
| 570 | Ga0373956_0079572 | 3300035119 | Bacteria | 1503 |
| 571 | Ga0373960_0012423 | 3300035121 | Bacteria | 2116 |
| 572 | Ga0373961_0040457 | 3300035241 | Bacteria | 1344 |
| 573 | Ga0373962_0087386 | 3300035242 | Bacteria | 955 |
| 574 | Ga0373931_0096747 | 3300035691 | Bacteria | 1654 |
| 575 | Ga0373935_0076789 | 3300035692 | Bacteria | 2164 |
| 576 | Ga0373935_0203315 | 3300035692 | Bacteria | 1370 |
| 577 | Ga0373927_0317593 | 3300035695 | Bacteria | 1026 |
| 578 | Ga0373933_0235400 | 3300035724 | Bacteria | 1177 |
| 579 | Ga0373947_0053373 | 3300035725 | Bacteria | 2437 |
| 580 | Ga0373947_0302442 | 3300035725 | Unclassified | 1067 |
| 581 | Ga0373937_0044127 | 3300036401 | Bacteria | 4071 |
| 582 | Ga0395899_0216165 | 3300037312 | Bacteria | 1330 |
| 583 | Ga0395900_0011709 | 3300037418 | Bacteria | 8970 |
| 584 | Ga0395900_0183470 | 3300037418 | Bacteria | 2125 |
| 585 | Ga0395900_0236479 | 3300037418 | Bacteria | 1835 |
| 586 | Ga0395900_0266985 | 3300037418 | Bacteria | 1707 |
| 587 | Ga0395900_0310615 | 3300037418 | Bacteria | 1560 |
| 588 | Ga0395900_0439479 | 3300037418 | Bacteria | 1262 |
| 589 | Ga0395900_0469611 | 3300037418 | Bacteria | 1212 |
| 590 | Ga0395898_0001837 | 3300037466 | Bacteria | 27315 |
| 591 | Ga0395898_0076700 | 3300037466 | Bacteria | 3227 |
| 592 | Ga0395898_0202792 | 3300037466 | Bacteria | 1893 |
| 593 | Ga0395898_0283508 | 3300037466 | Bacteria | 1580 |
| 594 | Ga0395898_1003262 | 3300037466 | Bacteria | 771 |
| 595 | Ga0395905_0147523 | 3300037471 | Bacteria | 2213 |
| 596 | Ga0395905_0166886 | 3300037471 | Bacteria | 2069 |
| 597 | Ga0436364_0148076 | 3300037853 | Bacteria | 19229 |
| 598 | Ga0436364_0392358 | 3300037853 | Bacteria | 3119 |
| 599 | Ga0436364_0532729 | 3300037853 | Bacteria | 13483 |
| 600 | Ga0436364_0920964 | 3300037853 | Bacteria | 26280 |
| 601 | Ga0436364_1153395 | 3300037853 | Bacteria | 12147 |
| 602 | Ga0436364_1222548 | 3300037853 | Bacteria | 1178 |
| 603 | Ga0395901_0001743 | 3300038443 | Bacteria | 22473 |
| 604 | Ga0395901_0002278 | 3300038443 | Bacteria | 19572 |
| 605 | Ga0395901_0162427 | 3300038443 | Bacteria | 2346 |
| 606 | Ga0395901_0194520 | 3300038443 | Bacteria | 2127 |
| 607 | Ga0395901_0207341 | 3300038443 | Bacteria | 2053 |
| 608 | Ga0395901_0256552 | 3300038443 | Bacteria | 1821 |
| 609 | Ga0395901_0275782 | 3300038443 | Bacteria | 1748 |
| 610 | Ga0395901_0291272 | 3300038443 | Bacteria | 1694 |
| 611 | Ga0395901_0335132 | 3300038443 | Bacteria | 1563 |
| 612 | Ga0395901_0453581 | 3300038443 | Bacteria | 1311 |
| 613 | Ga0395901_0667039 | 3300038443 | Bacteria | 1041 |
| 614 | Ga0395901_1669620 | 3300038443 | Bacteria | 589 |
| 615 | Ga0242420_040006 | 3300038996 | Bacteria | 894 |
| 616 | Ga0436365_0125894 | 3300039437 | Bacteria | 4696 |
| 617 | Ga0436365_0523152 | 3300039437 | Bacteria | 5454 |
| 618 | Ga0436365_0671457 | 3300039437 | Bacteria | 6739 |
| 619 | Ga0436365_1090611 | 3300039437 | Bacteria | 2761 |
| 620 | Ga0436365_1154285 | 3300039437 | Bacteria | 1033 |
| 621 | Ga0436365_1439885 | 3300039437 | Bacteria | 10548 |
| 622 | Ga0436365_1464727 | 3300039437 | Bacteria | 1002 |
| 623 | Ga0436365_1552732 | 3300039437 | Bacteria | 3731 |
| 624 | Ga0436363_0018181 | 3300039450 | Bacteria | 1345 |
| 625 | Ga0436363_0261314 | 3300039450 | Bacteria | 2286 |
| 626 | Ga0436363_0795197 | 3300039450 | Bacteria | 2574 |
| 627 | Ga0436363_0805533 | 3300039450 | Bacteria | 51825 |
| 628 | Ga0436363_0843894 | 3300039450 | Bacteria | 4187 |
| 629 | Ga0436363_0975892 | 3300039450 | Bacteria | 912 |
| 630 | Ga0436363_1000235 | 3300039450 | Bacteria | 994 |
| 631 | Ga0436363_1213228 | 3300039450 | Bacteria | 5607 |
| 632 | Ga0436363_1221643 | 3300039450 | Bacteria | 10051 |
| 633 | Ga0436362_0440536 | 3300039453 | Bacteria | 3120 |
| 634 | Ga0436362_0867877 | 3300039453 | Bacteria | 3516 |
| 635 | Ga0436362_1247145 | 3300039453 | Bacteria | 2267 |
| 636 | Ga0451791_1011400 | 3300041451 | Bacteria | 1616 |
| 637 | Ga0451793_0211409 | 3300041452 | Bacteria | 1000 |
| 638 | Ga0451800_1516251 | 3300041459 | Bacteria | 812 |
| 639 | Ga0451833_0229410 | 3300041491 | Bacteria | 1664 |
| 640 | Ga0451833_0413282 | 3300041491 | Bacteria | 802 |
| 641 | Ga0451841_0806707 | 3300041498 | Bacteria | 663 |
| 642 | Ga0451853_1393261 | 3300041512 | Bacteria | 864 |
| 643 | Ga0451853_4054958 | 3300041512 | Bacteria | 1248 |
| 644 | Ga0451853_4093827 | 3300041512 | Bacteria | 653 |
| 645 | Ga0439448_0078661 | 3300042005 | Bacteria | 1105 |
| 646 | Ga0439463_005263 | 3300042016 | Bacteria | 3217 |
| 647 | Ga0439435_0045895 | 3300042436 | Bacteria | 1237 |
| 648 | Ga0439464_0021209 | 3300042439 | Bacteria | 1783 |
| 649 | Ga0439464_0035830 | 3300042439 | Bacteria | 1403 |
| 650 | Ga0439460_0024744 | 3300042461 | Bacteria | 1666 |
| 651 | Ga0439460_0033182 | 3300042461 | Bacteria | 1482 |
| 652 | Ga0439460_0078378 | 3300042461 | Bacteria | 1034 |
| 653 | Ga0451577_1028974 | 3300042876 | Bacteria | 739 |
| 654 | Ga0466965_0053109 | 3300044683 | Bacteria | 2014 |
| 655 | Ga0466966_0075669 | 3300044684 | Bacteria | 2103 |
| 656 | Ga0466966_0094865 | 3300044684 | Bacteria | 1849 |
| 657 | Ga0466966_0200103 | 3300044684 | Bacteria | 1209 |
| 658 | Ga0466966_0211740 | 3300044684 | Bacteria | 1171 |
| 659 | Ga0466961_0008051 | 3300044693 | Bacteria | 6717 |
| 660 | Ga0466961_0011517 | 3300044693 | Bacteria | 5655 |
| 661 | Ga0466961_0061055 | 3300044693 | Bacteria | 2396 |
| 662 | Ga0466961_0115876 | 3300044693 | Bacteria | 1684 |
| 663 | Ga0466961_0130650 | 3300044693 | Bacteria | 1574 |
| 664 | Ga0466963_0006665 | 3300044694 | Bacteria | 6859 |
| 665 | Ga0466963_0025905 | 3300044694 | Bacteria | 3745 |
| 666 | Ga0466963_0042730 | 3300044694 | Bacteria | 2977 |
| 667 | Ga0466963_0094702 | 3300044694 | Bacteria | 2037 |
| 668 | Ga0466963_0127903 | 3300044694 | Bacteria | 1752 |
| 669 | Ga0466963_0173938 | 3300044694 | Bacteria | 1502 |
| 670 | Ga0466963_0187951 | 3300044694 | Bacteria | 1443 |
| 671 | Ga0466963_0565867 | 3300044694 | Bacteria | 803 |
| 672 | Ga0466964_0055144 | 3300044706 | Bacteria | 1641 |
| 673 | Ga0466971_0003603 | 3300044719 | Bacteria | 6617 |
| 674 | Ga0466971_0050648 | 3300044719 | Bacteria | 1869 |
| 675 | Ga0466971_0064442 | 3300044719 | Bacteria | 1659 |
| 676 | Ga0466971_0104027 | 3300044719 | Bacteria | 1306 |
| 677 | Ga0466968_0003379 | 3300044735 | Bacteria | 5900 |
| 678 | Ga0466968_0011998 | 3300044735 | Bacteria | 3385 |
| 679 | Ga0466968_0049842 | 3300044735 | Bacteria | 1785 |
| 680 | Ga0466970_0078128 | 3300044765 | Bacteria | 1785 |
| 681 | Ga0466970_0508059 | 3300044765 | Bacteria | 694 |
| 682 | Ga0466957_0010507 | 3300044842 | Bacteria | 5320 |
| 683 | Ga0466957_0132010 | 3300044842 | Bacteria | 1601 |
| 684 | Ga0466960_0000600 | 3300044901 | Bacteria | 12466 |
| 685 | Ga0466960_0023758 | 3300044901 | Bacteria | 2756 |
| 686 | Ga0466960_0028031 | 3300044901 | Bacteria | 2575 |
| 687 | Ga0466960_0085178 | 3300044901 | Bacteria | 1600 |
| 688 | Ga0466960_0091219 | 3300044901 | Bacteria | 1553 |
| 689 | Ga0466960_0107756 | 3300044901 | Bacteria | 1443 |
| 690 | Ga0466960_0210111 | 3300044901 | Bacteria | 1067 |
| 691 | Ga0466960_0219298 | 3300044901 | Bacteria | 1046 |
| 692 | Ga0466960_0279214 | 3300044901 | Bacteria | 936 |
| 693 | Ga0466960_0302468 | 3300044901 | Bacteria | 902 |
| 694 | Ga0466959_0033097 | 3300045049 | Bacteria | 3825 |
| 695 | Ga0466959_0047851 | 3300045049 | Bacteria | 3145 |
| 696 | Ga0466959_0065882 | 3300045049 | Bacteria | 2628 |
| 697 | Ga0466959_0068803 | 3300045049 | Bacteria | 2565 |
| 698 | Ga0466959_0070338 | 3300045049 | Bacteria | 2535 |
| 699 | Ga0466959_0137356 | 3300045049 | Bacteria | 1730 |
| 700 | Ga0466959_0175208 | 3300045049 | Bacteria | 1503 |
| 701 | Ga0466959_0252942 | 3300045049 | Bacteria | 1215 |
| 702 | Ga0466959_0316381 | 3300045049 | Bacteria | 1067 |
| 703 | Ga0466959_0462430 | 3300045049 | Bacteria | 860 |
| 704 | Ga0466959_0498644 | 3300045049 | Bacteria | 823 |
| 705 | Ga0466958_0062833 | 3300045836 | Bacteria | 2264 |
| 706 | Ga0466958_0083730 | 3300045836 | Bacteria | 1966 |
| 707 | Ga0466967_0022058 | 3300045976 | Bacteria | 5187 |
| 708 | Ga0466967_0037629 | 3300045976 | Bacteria | 4142 |
| 709 | Ga0466967_0045020 | 3300045976 | Bacteria | 3832 |
| 710 | Ga0466967_0049481 | 3300045976 | Bacteria | 3675 |
| 711 | Ga0466967_0086368 | 3300045976 | Bacteria | 2842 |
| 712 | Ga0466967_0180494 | 3300045976 | Bacteria | 1991 |
| 713 | Ga0466967_0218280 | 3300045976 | Bacteria | 1811 |
| 714 | Ga0466967_0312791 | 3300045976 | Bacteria | 1513 |
| 715 | Ga0466967_0323244 | 3300045976 | Bacteria | 1488 |
| 716 | Ga0466967_0493990 | 3300045976 | Bacteria | 1200 |
| 717 | Ga0466967_0724450 | 3300045976 | Bacteria | 986 |
| 718 | Ga0466967_0748596 | 3300045976 | Bacteria | 969 |
| 719 | Ga0466967_1027138 | 3300045976 | Bacteria | 821 |
| 720 | Ga0466967_1032254 | 3300045976 | Bacteria | 819 |
| 721 | Ga0495592_0246459 | 3300046454 | Bacteria | 1183 |
| 722 | Ga0495603_0035624 | 3300046455 | Bacteria | 2989 |
| 723 | Ga0495603_0054537 | 3300046455 | Bacteria | 2369 |
| 724 | Ga0495603_0382302 | 3300046455 | Bacteria | 807 |
| 725 | Ga0495590_0061614 | 3300046457 | Bacteria | 1314 |
| 726 | Ga0495590_0167564 | 3300046457 | Bacteria | 800 |
| 727 | Ga0495629_0107117 | 3300046459 | Bacteria | 1950 |
| 728 | Ga0495638_0049636 | 3300046460 | Bacteria | 2623 |
| 729 | Ga0495641_0003534 | 3300046461 | Bacteria | 11613 |
| 730 | Ga0495641_0064637 | 3300046461 | Bacteria | 1648 |
| 731 | Ga0495641_0102718 | 3300046461 | Bacteria | 1275 |
| 732 | Ga0495651_0014077 | 3300046462 | Bacteria | 6187 |
| 733 | Ga0495651_0071479 | 3300046462 | Bacteria | 2638 |
| 734 | Ga0495653_0015690 | 3300046463 | Bacteria | 6175 |
| 735 | Ga0495653_0055338 | 3300046463 | Bacteria | 3028 |
| 736 | Ga0495650_0000079 | 3300046471 | Bacteria | 244549 |
| 737 | Ga0495605_0046239 | 3300046474 | Bacteria | 2141 |
| 738 | Ga0495639_0203026 | 3300046475 | Bacteria | 971 |
| 739 | Ga0495662_0224173 | 3300046476 | Bacteria | 927 |
| 740 | Ga0495664_0000025 | 3300046477 | Bacteria | 120941 |
| 741 | Ga0495584_0022720 | 3300046491 | Bacteria | 3182 |
| 742 | Ga0495584_0304163 | 3300046491 | Bacteria | 810 |
| 743 | Ga0495584_0309599 | 3300046491 | Bacteria | 802 |
| 744 | Ga0495596_0037476 | 3300046500 | Bacteria | 1917 |
| 745 | Ga0495608_0089812 | 3300046511 | Bacteria | 1988 |
| 746 | Ga0495608_0587915 | 3300046511 | Bacteria | 669 |
| 747 | Ga0495618_0000805 | 3300046514 | Bacteria | 21850 |
| 748 | Ga0495620_0120013 | 3300046515 | Bacteria | 1037 |
| 749 | Ga0495620_0209513 | 3300046515 | Bacteria | 748 |
| 750 | Ga0495628_0064520 | 3300046516 | Bacteria | 2867 |
| 751 | Ga0495630_0000440 | 3300046517 | Bacteria | 31661 |
| 752 | Ga0495630_0049204 | 3300046517 | Bacteria | 3155 |
| 753 | Ga0495637_0062609 | 3300046520 | Bacteria | 1522 |
| 754 | Ga0495644_0016911 | 3300046523 | Bacteria | 2791 |
| 755 | Ga0495652_0053756 | 3300046529 | Bacteria | 3432 |
| 756 | Ga0495652_0069827 | 3300046529 | Bacteria | 2939 |
| 757 | Ga0495654_0108490 | 3300046530 | Bacteria | 1269 |
| 758 | Ga0495665_0263292 | 3300046531 | Unclassified | 886 |
| 759 | Ga0495640_0025372 | 3300046533 | Bacteria | 4301 |
| 760 | Ga0495586_0126969 | 3300046535 | Bacteria | 1427 |
| 761 | Ga0495609_0050520 | 3300046538 | Bacteria | 1854 |
| 762 | Ga0495621_0152128 | 3300046539 | Bacteria | 911 |
| 763 | Ga0495645_0000021 | 3300046543 | Bacteria | 137604 |
| 764 | Ga0495645_0000463 | 3300046543 | Bacteria | 28033 |
| 765 | Ga0495645_0073056 | 3300046543 | Bacteria | 2471 |
| 766 | Ga0495633_0140162 | 3300046558 | Bacteria | 1118 |
| 767 | Ga0495667_0037600 | 3300046559 | Bacteria | 3225 |
| 768 | Ga0495667_0094196 | 3300046559 | Bacteria | 1939 |
| 769 | Ga0495668_0091876 | 3300046616 | Bacteria | 1663 |
| 770 | Ga0495635_0019238 | 3300046663 | Bacteria | 4763 |
| 771 | Ga0495635_0076737 | 3300046663 | Bacteria | 2290 |
| 772 | Ga0495661_0000258 | 3300046665 | Bacteria | 60916 |
| 773 | Ga0495657_0000017 | 3300046675 | Bacteria | 174558 |
| 774 | Ga0495657_0075356 | 3300046675 | Bacteria | 2193 |
| 775 | Ga0495599_0193891 | 3300046678 | Bacteria | 1249 |
| 776 | Ga0495647_0273284 | 3300046681 | Bacteria | 757 |
| 777 | Ga0495658_0216027 | 3300046683 | Bacteria | 1199 |
| 778 | Ga0495624_0425685 | 3300046690 | Bacteria | 796 |
| 779 | Ga0495671_0179734 | 3300046692 | Bacteria | 1028 |
| 780 | Ga0495589_0047541 | 3300046794 | Bacteria | 2126 |
| 781 | Ga0495589_0221203 | 3300046794 | Bacteria | 889 |
| 782 | Ga0495600_0023393 | 3300046809 | Bacteria | 3975 |
| 783 | Ga0495674_0078959 | 3300047319 | Bacteria | 2827 |
| 784 | Ga0495674_0197182 | 3300047319 | Bacteria | 1671 |
| 785 | Ga0495672_0017846 | 3300047320 | Bacteria | 4734 |
| 786 | Ga0495672_0028111 | 3300047320 | Bacteria | 3564 |
| 787 | Ga0495676_0061260 | 3300047321 | Bacteria | 2944 |
| 788 | Ga0495676_0154232 | 3300047321 | Bacteria | 1631 |
| 789 | Ga0495676_0366632 | 3300047321 | Bacteria | 961 |
| 790 | Ga0495676_0594452 | 3300047321 | Bacteria | 721 |
| 791 | Ga0495680_0429398 | 3300047322 | Bacteria | 907 |
| 792 | Ga0495683_0076549 | 3300047323 | Bacteria | 1637 |
| 793 | Ga0495679_067935 | 3300047446 | Bacteria | 1032 |
| 794 | Ga0495673_0065251 | 3300047469 | Bacteria | 1546 |
| 795 | Ga0495684_0001866 | 3300047471 | Bacteria | 16862 |
| 796 | Ga0495684_0015331 | 3300047471 | Bacteria | 5900 |
| 797 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 798 | Ga0495686_0097471 | 3300047472 | Bacteria | 1777 |
| 799 | Ga0495602_0311595 | 3300048088 | Bacteria | 1148 |
| 800 | Ga0496100_0002656 | 3300048903 | Bacteria | 9115 |
| 801 | Ga0496100_0020501 | 3300048903 | Bacteria | 3964 |
| 802 | Ga0496100_0194782 | 3300048903 | Bacteria | 1473 |
| 803 | Ga0496100_0220106 | 3300048903 | Bacteria | 1393 |
| 804 | Ga0496100_0613447 | 3300048903 | Bacteria | 846 |
| 805 | Ga0496100_0706158 | 3300048903 | Bacteria | 787 |
| 806 | Ga0496101_0001383 | 3300048904 | Bacteria | 14539 |
| 807 | Ga0496101_0012856 | 3300048904 | Bacteria | 5599 |
| 808 | Ga0496101_0121007 | 3300048904 | Bacteria | 1979 |
| 809 | Ga0496101_0149016 | 3300048904 | Bacteria | 1788 |
| 810 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 811 | Ga0496102_0022044 | 3300048905 | Bacteria | 5641 |
| 812 | Ga0496102_0102611 | 3300048905 | Bacteria | 2659 |
| 813 | Ga0496102_0166084 | 3300048905 | Bacteria | 2077 |
| 814 | Ga0496102_0546519 | 3300048905 | Bacteria | 1081 |
| 815 | Ga0496102_0759069 | 3300048905 | Bacteria | 893 |
| 816 | Ga0496103_0000047 | 3300048906 | Bacteria | 161130 |
| 817 | Ga0496103_0181448 | 3300048906 | Bacteria | 1353 |
| 818 | Ga0496104_0000037 | 3300048907 | Bacteria | 178518 |
| 819 | Ga0496104_0002837 | 3300048907 | Bacteria | 14958 |
| 820 | Ga0496104_0015555 | 3300048907 | Bacteria | 6893 |
| 821 | Ga0496104_0021881 | 3300048907 | Bacteria | 5873 |
| 822 | Ga0496104_0079261 | 3300048907 | Bacteria | 3130 |
| 823 | Ga0496104_0102937 | 3300048907 | Bacteria | 2735 |
| 824 | Ga0496104_0289120 | 3300048907 | Bacteria | 1551 |
| 825 | Ga0496104_0677205 | 3300048907 | Bacteria | 940 |
| 826 | Ga0496104_1118554 | 3300048907 | Bacteria | 691 |
| 827 | Ga0496105_0005677 | 3300048908 | Bacteria | 9495 |
| 828 | Ga0496105_0054369 | 3300048908 | Bacteria | 3305 |
| 829 | Ga0496105_0155915 | 3300048908 | Bacteria | 1875 |
| 830 | Ga0496105_0259311 | 3300048908 | Bacteria | 1406 |
| 831 | Ga0496106_0019719 | 3300048909 | Bacteria | 5001 |
| 832 | Ga0496106_0252683 | 3300048909 | Bacteria | 1410 |
| 833 | Ga0496107_0016861 | 3300048910 | Bacteria | 5134 |
| 834 | Ga0496108_0001183 | 3300048911 | Bacteria | 20367 |
| 835 | Ga0496108_0003122 | 3300048911 | Bacteria | 13314 |
| 836 | Ga0496108_0027856 | 3300048911 | Bacteria | 4671 |
| 837 | Ga0496108_0078360 | 3300048911 | Bacteria | 2797 |
| 838 | Ga0496108_0096157 | 3300048911 | Bacteria | 2522 |
| 839 | Ga0496109_0000470 | 3300048912 | Bacteria | 34274 |
| 840 | Ga0496109_0003253 | 3300048912 | Bacteria | 13541 |
| 841 | Ga0496109_0017148 | 3300048912 | Bacteria | 6340 |
| 842 | Ga0496109_0039264 | 3300048912 | Bacteria | 4284 |
| 843 | Ga0496109_0043951 | 3300048912 | Bacteria | 4051 |
| 844 | Ga0496109_0139042 | 3300048912 | Bacteria | 2270 |
| 845 | Ga0496109_0397310 | 3300048912 | Bacteria | 1302 |
| 846 | Ga0496109_0683899 | 3300048912 | Bacteria | 963 |
| 847 | Ga0496110_0001297 | 3300048913 | Bacteria | 17951 |
| 848 | Ga0496110_0003735 | 3300048913 | Bacteria | 11729 |
| 849 | Ga0496110_0091188 | 3300048913 | Bacteria | 2726 |
| 850 | Ga0496110_0501833 | 3300048913 | Bacteria | 1105 |
| 851 | Ga0496110_0558904 | 3300048913 | Bacteria | 1040 |
| 852 | Ga0496110_0573049 | 3300048913 | Bacteria | 1025 |
| 853 | Ga0496111_0000296 | 3300048914 | Bacteria | 24338 |
| 854 | Ga0496111_0061408 | 3300048914 | Bacteria | 2724 |
| 855 | Ga0496111_0091083 | 3300048914 | Bacteria | 2234 |
| 856 | Ga0496111_0201697 | 3300048914 | Bacteria | 1478 |
| 857 | Ga0496111_0216293 | 3300048914 | Bacteria | 1423 |
| 858 | Ga0496111_0527222 | 3300048914 | Bacteria | 868 |
| 859 | Ga0496112_0005877 | 3300048915 | Bacteria | 10690 |
| 860 | Ga0496112_0010188 | 3300048915 | Bacteria | 8517 |
| 861 | Ga0496112_0011629 | 3300048915 | Bacteria | 8050 |
| 862 | Ga0496112_0020012 | 3300048915 | Bacteria | 6336 |
| 863 | Ga0496112_0050095 | 3300048915 | Bacteria | 4094 |
| 864 | Ga0496112_0055639 | 3300048915 | Bacteria | 3891 |
| 865 | Ga0496112_0063356 | 3300048915 | Bacteria | 3647 |
| 866 | Ga0496112_0122167 | 3300048915 | Bacteria | 2575 |
| 867 | Ga0496112_0138345 | 3300048915 | Bacteria | 2405 |
| 868 | Ga0496112_0187946 | 3300048915 | Bacteria | 2029 |
| 869 | Ga0496112_0316884 | 3300048915 | Bacteria | 1504 |
| 870 | Ga0496112_0366996 | 3300048915 | Bacteria | 1381 |
| 871 | Ga0496112_0517919 | 3300048915 | Bacteria | 1127 |
| 872 | Ga0496113_0016207 | 3300048916 | Bacteria | 5144 |
| 873 | Ga0496113_0033633 | 3300048916 | Bacteria | 3735 |
| 874 | Ga0496113_0042890 | 3300048916 | Bacteria | 3344 |
| 875 | Ga0496113_0076321 | 3300048916 | Bacteria | 2560 |
| 876 | Ga0496113_0122983 | 3300048916 | Bacteria | 2030 |
| 877 | Ga0496113_0195175 | 3300048916 | Bacteria | 1608 |
| 878 | Ga0496113_0267488 | 3300048916 | Bacteria | 1366 |
| 879 | Ga0496114_0117253 | 3300048917 | Bacteria | 2287 |
| 880 | Ga0496114_0289928 | 3300048917 | Bacteria | 1444 |
| 881 | Ga0496114_0362135 | 3300048917 | Bacteria | 1283 |
| 882 | Ga0496114_0540896 | 3300048917 | Bacteria | 1030 |
| 883 | Ga0496115_0000012 | 3300048918 | Bacteria | 215509 |
| 884 | Ga0496115_0000017 | 3300048918 | Bacteria | 185702 |
| 885 | Ga0496115_0033295 | 3300048918 | Bacteria | 4068 |
| 886 | Ga0496115_0326107 | 3300048918 | Bacteria | 1255 |
| 887 | Ga0496119_0051933 | 3300048922 | Bacteria | 2515 |
| 888 | Ga0496119_0067296 | 3300048922 | Bacteria | 2113 |
| 889 | Ga0496121_0003947 | 3300048924 | Bacteria | 20501 |
| 890 | Ga0496121_0037020 | 3300048924 | Bacteria | 4339 |
| 891 | Ga0496121_0141976 | 3300048924 | Bacteria | 1780 |
| 892 | Ga0496126_0352660 | 3300048929 | Bacteria | 1203 |
| 893 | Ga0501031_0005231 | 3300049568 | Bacteria | 8458 |
| 894 | Ga0501031_0057901 | 3300049568 | Bacteria | 2525 |
| 895 | Ga0501031_0124663 | 3300049568 | Bacteria | 1683 |
| 896 | Ga0501032_0007337 | 3300049569 | Bacteria | 8059 |
| 897 | Ga0501033_0604698 | 3300049570 | Bacteria | 752 |
| 898 | Ga0501034_0012754 | 3300049571 | Bacteria | 8668 |
| 899 | Ga0501034_0598463 | 3300049571 | Bacteria | 1008 |
| 900 | Ga0501036_0073293 | 3300049572 | Bacteria | 2895 |
| 901 | Ga0501036_0398008 | 3300049572 | Bacteria | 1149 |
| 902 | Ga0501036_0623948 | 3300049572 | Bacteria | 893 |
| 903 | Ga0501038_0065576 | 3300049574 | Bacteria | 3093 |
| 904 | Ga0501038_0091418 | 3300049574 | Bacteria | 2550 |
| 905 | Ga0501038_0231558 | 3300049574 | Bacteria | 1470 |
| 906 | Ga0501038_0392324 | 3300049574 | Bacteria | 1075 |
| 907 | Ga0501039_0039406 | 3300049575 | Bacteria | 3649 |
| 908 | Ga0501039_0095126 | 3300049575 | Bacteria | 2322 |
| 909 | Ga0501039_0103646 | 3300049575 | Bacteria | 2221 |
| 910 | Ga0501039_0263135 | 3300049575 | Bacteria | 1356 |
| 911 | Ga0501040_0062632 | 3300049576 | Bacteria | 2559 |
| 912 | Ga0501040_0223062 | 3300049576 | Bacteria | 1341 |
| 913 | Ga0501040_0578066 | 3300049576 | Bacteria | 811 |
| 914 | Ga0501040_0837161 | 3300049576 | Bacteria | 666 |
| 915 | Ga0501041_0086673 | 3300049577 | Bacteria | 1932 |
| 916 | Ga0501041_0096832 | 3300049577 | Bacteria | 1824 |
| 917 | Ga0501041_0190892 | 3300049577 | Bacteria | 1283 |
| 918 | Ga0501042_0018820 | 3300049578 | Bacteria | 4786 |
| 919 | Ga0501042_0020332 | 3300049578 | Bacteria | 4620 |
| 920 | Ga0501043_0270571 | 3300049579 | Bacteria | 1304 |
| 921 | Ga0501046_0010844 | 3300049580 | Bacteria | 7811 |
| 922 | Ga0501046_0088952 | 3300049580 | Bacteria | 2378 |
| 923 | Ga0501046_0494155 | 3300049580 | Bacteria | 877 |
| 924 | Ga0501047_0166259 | 3300049581 | Bacteria | 2076 |
| 925 | Ga0501048_0012934 | 3300049582 | Bacteria | 6200 |
| 926 | Ga0501048_0031263 | 3300049582 | Bacteria | 3851 |
| 927 | Ga0501048_0105780 | 3300049582 | Bacteria | 1986 |
| 928 | Ga0501048_0232088 | 3300049582 | Bacteria | 1309 |
| 929 | Ga0501067_0296230 | 3300049583 | Bacteria | 901 |
| 930 | Ga0501069_0031547 | 3300049585 | Bacteria | 2915 |
| 931 | Ga0501069_0366053 | 3300049585 | Bacteria | 851 |
| 932 | Ga0501070_0017941 | 3300049586 | Bacteria | 5941 |
| 933 | Ga0501071_0004942 | 3300049587 | Bacteria | 8514 |
| 934 | Ga0501072_0043293 | 3300049588 | Bacteria | 3538 |
| 935 | Ga0501072_0113911 | 3300049588 | Bacteria | 2153 |
| 936 | Ga0501072_0121636 | 3300049588 | Bacteria | 2080 |
| 937 | Ga0501074_0079824 | 3300049590 | Bacteria | 2348 |
| 938 | Ga0501074_0455728 | 3300049590 | Bacteria | 907 |
| 939 | Ga0501075_0098521 | 3300049591 | Bacteria | 2219 |
| 940 | Ga0501075_0134025 | 3300049591 | Bacteria | 1887 |
| 941 | Ga0501075_0394747 | 3300049591 | Bacteria | 1055 |
| 942 | Ga0501076_0167092 | 3300049592 | Bacteria | 1793 |
| 943 | Ga0501076_0318991 | 3300049592 | Bacteria | 1275 |
| 944 | Ga0501079_0122079 | 3300049741 | Bacteria | 2026 |
| 945 | Ga0501079_0154328 | 3300049741 | Bacteria | 1790 |
| 946 | Ga0501079_0187195 | 3300049741 | Bacteria | 1616 |
| 947 | Ga0501080_0009103 | 3300049742 | Bacteria | 9038 |
| 948 | Ga0501080_0141807 | 3300049742 | Bacteria | 2221 |
| 949 | Ga0501081_0169096 | 3300049743 | Bacteria | 1578 |
| 950 | Ga0501081_1178535 | 3300049743 | Bacteria | 580 |
| 951 | Ga0501083_0022425 | 3300049744 | Bacteria | 4383 |
| 952 | Ga0501083_0602733 | 3300049744 | Bacteria | 715 |
| 953 | Ga0501035_0006314 | 3300049822 | Bacteria | 11141 |
| 954 | Ga0501035_0232697 | 3300049822 | Bacteria | 1570 |
| 955 | Ga0501044_0174738 | 3300049823 | Bacteria | 2117 |
| 956 | Ga0501044_0188380 | 3300049823 | Bacteria | 2027 |
| 957 | Ga0501045_0008928 | 3300049824 | Bacteria | 7000 |
| 958 | Ga0501045_0066897 | 3300049824 | Bacteria | 2638 |
| 959 | Ga0501045_0225639 | 3300049824 | Bacteria | 1394 |
| 960 | Ga0501045_0556390 | 3300049824 | Bacteria | 851 |
| 961 | nmdc:mga05p37_193978_c1 | 3300050507 | Bacteria | 2464 |
| 962 | nmdc:mga05p37_340798_c1 | 3300050507 | Bacteria | 1768 |
| 963 | nmdc:mga05p37_6405_c1 | 3300050507 | Bacteria | 13872 |
| 964 | nmdc:mga05p37_8057_c1 | 3300050507 | Bacteria | 12446 |
| 965 | nmdc:mga09592_187_c1 | 3300050508 | Bacteria | 44377 |
| 966 | nmdc:mga0qj67_18777_c1 | 3300050509 | Bacteria | 5272 |
| 967 | nmdc:mga0qj67_335841_c1 | 3300050509 | Bacteria | 1222 |
| 968 | nmdc:mga06r32_267227_c1 | 3300050510 | Bacteria | 1698 |
| 969 | nmdc:mga06r32_56294_c1 | 3300050510 | Bacteria | 3775 |
| 970 | nmdc:mga06r32_92209_c1 | 3300050510 | Bacteria | 2961 |
| 971 | nmdc:mga08y16_143639_c1 | 3300050511 | Bacteria | 2481 |
| 972 | nmdc:mga08y16_171849_c1 | 3300050511 | Bacteria | 2251 |
| 973 | nmdc:mga08y16_21022_c1 | 3300050511 | Bacteria | 6890 |
| 974 | nmdc:mga08y16_258703_c1 | 3300050511 | Bacteria | 1798 |
| 975 | nmdc:mga08y16_270164_c1 | 3300050511 | Bacteria | 1755 |
| 976 | nmdc:mga08y16_271308_c1 | 3300050511 | Bacteria | 1751 |
| 977 | nmdc:mga0n895_113044_c1 | 3300050512 | Bacteria | 2733 |
| 978 | nmdc:mga0n895_201636_c1 | 3300050512 | Bacteria | 2020 |
| 979 | nmdc:mga0n895_360723_c1 | 3300050512 | Bacteria | 1471 |
| 980 | nmdc:mga0rr50_28677_c1 | 3300050513 | Bacteria | 3916 |
| 981 | nmdc:mga08x19_207399_c1 | 3300050514 | Bacteria | 1345 |
| 982 | Ga0495601_0029276 | 3300053077 | Bacteria | 3415 |
| 983 | Ga0495601_0214147 | 3300053077 | Bacteria | 1258 |
| 984 | Ga0495612_0000214 | 3300053078 | Bacteria | 24528 |
| 985 | Ga0495612_0086378 | 3300053078 | Bacteria | 1323 |
| 986 | Ga0495595_0061549 | 3300053084 | Bacteria | 1758 |
| 987 | Ga0495619_0091957 | 3300053085 | Bacteria | 2054 |
| 988 | Ga0495619_0192492 | 3300053085 | Bacteria | 1412 |
| 989 | Ga0500556_0000279 | 3300053104 | Bacteria | 40113 |
| 990 | Ga0500616_0002461 | 3300053153 | Bacteria | 15362 |
| 991 | Ga0500616_0020563 | 3300053153 | Bacteria | 3706 |
| 992 | Ga0500616_0119917 | 3300053153 | Bacteria | 1258 |
| 993 | Ga0500599_002809 | 3300053736 | Bacteria | 2106 |
| 994 | Ga0501084_0141239 | 3300054114 | Bacteria | 2028 |
| 995 | Ga0501084_0806204 | 3300054114 | Bacteria | 791 |
| 996 | Ga0501084_0871862 | 3300054114 | Bacteria | 757 |
| 997 | Ga0501082_0126003 | 3300060353 | Bacteria | 2221 |
| 998 | Ga0501082_0136114 | 3300060353 | Bacteria | 2131 |
| 999 | Ga0501082_0363457 | 3300060353 | Bacteria | 1262 |
| 1000 | Ga0466962_0029129 | 3300061719 | Bacteria | 2642 |
| 1001 | Ga0530510_0020459 | 3300061734 | Bacteria | 4705 |
| 1002 | Ga0530510_0217327 | 3300061734 | Bacteria | 1420 |
| 1003 | Ga0530510_0500083 | 3300061734 | Bacteria | 921 |
| 1004 | Ga0207693_10401260 | |||
| 1005 | JGI25406J46586_10002122 | |||
| 1006 | JGI25407J50210_10000151 | |||
| 1007 | JGI25407J50210_10049560 | |||
| 1008 | Ga0032354_1118388 | |||
| 1009 | Ga0070676_10112936 | |||
| 1010 | Ga0070676_10151319 | |||
| 1011 | Ga0070683_100002001 | |||
| 1012 | Ga0070683_100007956 | |||
| 1013 | Ga0070683_100012678 | |||
| 1014 | Ga0070683_100972508 | |||
| 1015 | Ga0070683_101430351 | |||
| 1016 | Ga0070690_100095155 | |||
| 1017 | Ga0068869_100393778 | |||
| 1018 | Ga0068869_100610154 | |||
| 1019 | Ga0070680_100000851 | |||
| 1020 | Ga0070680_100516143 | |||
| 1021 | Ga0070680_100595485 | |||
| 1022 | Ga0070680_100596715 | |||
| 1023 | Ga0070682_100018192 | |||
| 1024 | Ga0070682_100025807 | |||
| 1025 | Ga0070682_100127380 | |||
| 1026 | Ga0068868_100112271 | |||
| 1027 | Ga0070660_100028182 | |||
| 1028 | Ga0070660_100043921 | |||
| 1029 | Ga0070660_100224887 | |||
| 1030 | Ga0070689_100002784 | |||
| 1031 | Ga0070691_10004880 | |||
| 1032 | Ga0070687_100009144 | |||
| 1033 | Ga0070687_100029066 | |||
| 1034 | Ga0070661_100521921 | |||
| 1035 | Ga0070692_10194529 | |||
| 1036 | Ga0070668_100232706 | |||
| 1037 | Ga0070668_100267605 | |||
| 1038 | Ga0070669_100003124 | |||
| 1039 | Ga0070669_100104149 | |||
| 1040 | Ga0070669_100422332 | |||
| 1041 | Ga0070671_100677403 | |||
| 1042 | Ga0070674_100890362 | |||
| 1043 | Ga0070673_100137131 | |||
| 1044 | Ga0070688_100002559 | |||
| 1045 | Ga0070688_100177278 | |||
| 1046 | Ga0070688_100617367 | |||
| 1047 | Ga0070659_100000013 | |||
| 1048 | Ga0070659_100010365 | |||
| 1049 | Ga0070659_100021366 | |||
| 1050 | Ga0070659_100360331 | |||
| 1051 | Ga0070659_100586786 | |||
| 1052 | Ga0070659_100723535 | |||
| 1053 | Ga0070714_100000137 | |||
| 1054 | Ga0070714_100072239 | |||
| 1055 | Ga0070714_100128989 | |||
| 1056 | Ga0070714_100136958 | |||
| 1057 | Ga0070714_100837189 | |||
| 1058 | Ga0070714_100856098 | |||
| 1059 | Ga0070714_100881031 | |||
| 1060 | Ga0070710_10213322 | |||
| 1061 | Ga0070710_10273707 | |||
| 1062 | Ga0070710_10446337 | |||
| 1063 | Ga0070711_100037334 | |||
| 1064 | Ga0070711_100322455 | |||
| 1065 | Ga0070711_100325180 | |||
| 1066 | Ga0070711_100352487 | |||
| 1067 | Ga0070705_100013157 | |||
| 1068 | Ga0070705_100025016 | |||
| 1069 | Ga0070705_100171828 | |||
| 1070 | Ga0070700_100000792 | |||
| 1071 | Ga0070700_100013095 | |||
| 1072 | Ga0070700_100124187 | |||
| 1073 | Ga0070700_100272835 | |||
| 1074 | Ga0070694_100193959 | |||
| 1075 | Ga0070694_100714127 | |||
| 1076 | Ga0070708_100120700 | |||
| 1077 | Ga0070663_100215961 | |||
| 1078 | Ga0070678_100051898 | |||
| 1079 | Ga0070678_100863755 | |||
| 1080 | Ga0070662_100007538 | |||
| 1081 | Ga0070662_100010410 | |||
| 1082 | Ga0070681_10064485 | |||
| 1083 | Ga0070681_10658765 | |||
| 1084 | Ga0068867_100282973 | |||
| 1085 | Ga0070685_10001526 | |||
| 1086 | Ga0070685_10089096 | |||
| 1087 | Ga0070685_10495244 | |||
| 1088 | Ga0070707_100889174 | |||
| 1089 | Ga0070679_100004554 | |||
| 1090 | Ga0070684_100001264 | |||
| 1091 | Ga0070684_100020205 | |||
| 1092 | Ga0070684_100043861 | |||
| 1093 | Ga0070684_100104754 | |||
| 1094 | Ga0070684_100375527 | |||
| 1095 | Ga0070684_100398481 | |||
| 1096 | Ga0070684_100759346 | |||
| 1097 | Ga0068853_100323258 | |||
| 1098 | Ga0068853_100363453 | |||
| 1099 | Ga0068853_100418065 | |||
| 1100 | Ga0070672_100216420 | |||
| 1101 | Ga0070672_100441499 | |||
| 1102 | Ga0070672_100457573 | |||
| 1103 | Ga0070686_100019676 | |||
| 1104 | Ga0070686_100164352 | |||
| 1105 | Ga0070686_100652882 | |||
| 1106 | Ga0070695_100076010 | |||
| 1107 | Ga0070695_100254136 | |||
| 1108 | Ga0070696_100077094 | |||
| 1109 | Ga0070693_100142654 | |||
| 1110 | Ga0070693_100344137 | |||
| 1111 | Ga0070693_100413439 | |||
| 1112 | Ga0070665_100014863 | |||
| 1113 | Ga0070665_100184015 | |||
| 1114 | Ga0070665_100226679 | |||
| 1115 | Ga0070665_100494127 | |||
| 1116 | Ga0070704_100050641 | |||
| 1117 | Ga0070704_100050690 | |||
| 1118 | Ga0070704_100212121 | |||
| 1119 | Ga0068855_100115379 | |||
| 1120 | Ga0070664_100107671 | |||
| 1121 | Ga0068857_100248237 | |||
| 1122 | Ga0068857_100422112 | |||
| 1123 | Ga0068854_100046665 | |||
| 1124 | Ga0068854_100058889 | |||
| 1125 | Ga0068854_100121737 | |||
| 1126 | Ga0068854_100510594 | |||
| 1127 | Ga0068856_100040052 | |||
| 1128 | Ga0068856_100043324 | |||
| 1129 | Ga0068856_100085307 | |||
| 1130 | Ga0068856_100669109 | |||
| 1131 | Ga0070702_100054426 | |||
| 1132 | Ga0070702_100194478 | |||
| 1133 | Ga0070702_100420823 | |||
| 1134 | Ga0070702_100694034 | |||
| 1135 | Ga0068852_100007442 | |||
| 1136 | Ga0068852_100052208 | |||
| 1137 | Ga0068859_100129192 | |||
| 1138 | Ga0068859_100702907 | |||
| 1139 | Ga0068859_101419288 | |||
| 1140 | Ga0068864_100040881 | |||
| 1141 | Ga0068864_100055854 | |||
| 1142 | Ga0068866_10029323 | |||
| 1143 | Ga0068866_10147443 | |||
| 1144 | Ga0068861_100097351 | |||
| 1145 | Ga0068870_10130798 | |||
| 1146 | Ga0068863_100302744 | |||
| 1147 | Ga0068858_100058261 | |||
| 1148 | Ga0068860_100052109 | |||
| 1149 | Ga0068862_100053510 | |||
| 1150 | Ga0068862_100183903 | |||
| 1151 | Ga0081455_10009871 | |||
| 1152 | Ga0081455_10032988 | |||
| 1153 | Ga0081455_10118826 | |||
| 1154 | Ga0081455_10428800 | |||
| 1155 | Ga0081538_10000035 | |||
| 1156 | Ga0081538_10000686 | |||
| 1157 | Ga0081538_10000796 | |||
| 1158 | Ga0081538_10001347 | |||
| 1159 | Ga0081538_10001532 | |||
| 1160 | Ga0081538_10001548 | |||
| 1161 | Ga0081538_10004774 | |||
| 1162 | Ga0081538_10005388 | |||
| 1163 | Ga0081538_10005793 | |||
| 1164 | Ga0081538_10007624 | |||
| 1165 | Ga0081538_10008204 | |||
| 1166 | Ga0081538_10031118 | |||
| 1167 | Ga0081538_10040376 | |||
| 1168 | Ga0081538_10160483 | |||
| 1169 | Ga0081540_1001836 | |||
| 1170 | Ga0081540_1050127 | |||
| 1171 | Ga0081539_10011937 | |||
| 1172 | Ga0081539_10016115 | |||
| 1173 | Ga0081539_10039589 | |||
| 1174 | Ga0070717_10000004 | |||
| 1175 | Ga0075432_10006699 | |||
| 1176 | Ga0070716_100037990 | |||
| 1177 | Ga0070716_100383595 | |||
| 1178 | Ga0070712_100000002 | |||
| 1179 | Ga0070712_100002104 | |||
| 1180 | Ga0070712_100050081 | |||
| 1181 | Ga0070712_100070633 | |||
| 1182 | Ga0070712_100132205 | |||
| 1183 | Ga0075428_100134027 | |||
| 1184 | Ga0075428_100657319 | |||
| 1185 | Ga0075430_100059932 | |||
| 1186 | Ga0075430_100149263 | |||
| 1187 | Ga0075430_100196294 | |||
| 1188 | Ga0075430_100381036 | |||
| 1189 | Ga0075430_100395457 | |||
| 1190 | Ga0075431_100005739 | |||
| 1191 | Ga0075431_100013418 | |||
| 1192 | Ga0075431_100201213 | |||
| 1193 | Ga0075431_100859971 | |||
| 1194 | Ga0075433_10058988 | |||
| 1195 | Ga0075433_10077257 | |||
| 1196 | Ga0075434_100062110 | |||
| 1197 | Ga0075434_100278268 | |||
| 1198 | Ga0075429_100000985 | |||
| 1199 | Ga0075429_100002391 | |||
| 1200 | Ga0068865_100074038 | |||
| 1201 | Ga0068865_100094599 | |||
| 1202 | Ga0068865_100100696 | |||
| 1203 | Ga0075436_100028836 | |||
| 1204 | Ga0075436_100380180 | |||
| 1205 | Ga0097620_100129191 | |||
| 1206 | Ga0097620_100702912 | |||
| 1207 | Ga0097620_101419336 | |||
| 1208 | Ga0075435_100035221 | |||
| 1209 | Ga0075435_100041218 | |||
| 1210 | Ga0105244_10182490 | |||
| 1211 | Ga0105240_10008779 | |||
| 1212 | Ga0105240_10035619 | |||
| 1213 | Ga0105240_10096003 | |||
| 1214 | Ga0105240_10787541 | |||
| 1215 | Ga0111539_10010097 | |||
| 1216 | Ga0111539_10026586 | |||
| 1217 | Ga0111539_10044601 | |||
| 1218 | Ga0111539_10199389 | |||
| 1219 | Ga0111539_10373480 | |||
| 1220 | Ga0111539_10925690 | |||
| 1221 | Ga0111539_11595920 | |||
| 1222 | Ga0105245_10034568 | |||
| 1223 | Ga0105245_10104866 | |||
| 1224 | Ga0105245_10114050 | |||
| 1225 | Ga0105245_10133846 | |||
| 1226 | Ga0105245_10219831 | |||
| 1227 | Ga0105245_10730930 | |||
| 1228 | Ga0105247_10395986 | |||
| 1229 | Ga0105247_10494798 | |||
| 1230 | Ga0114129_10001284 | |||
| 1231 | Ga0114129_10001769 | |||
| 1232 | Ga0114129_10003100 | |||
| 1233 | Ga0114129_10230528 | |||
| 1234 | Ga0114129_10487610 | |||
| 1235 | Ga0114129_10621528 | |||
| 1236 | Ga0114129_10747040 | |||
| 1237 | Ga0114129_11004487 | |||
| 1238 | Ga0114129_11216264 | |||
| 1239 | Ga0105243_10060590 | |||
| 1240 | Ga0105243_10377065 | |||
| 1241 | Ga0105243_10755492 | |||
| 1242 | Ga0105242_10375432 | |||
| 1243 | Ga0105242_10571650 | |||
| 1244 | Ga0105248_10061918 | |||
| 1245 | Ga0105248_10209520 | |||
| 1246 | Ga0105248_11252989 | |||
| 1247 | Ga0105237_10035405 | |||
| 1248 | Ga0105237_10053629 | |||
| 1249 | Ga0105238_10021716 | |||
| 1250 | Ga0105238_10175540 | |||
| 1251 | Ga0105238_10516644 | |||
| 1252 | Ga0105238_10755716 | |||
| 1253 | Ga0105238_10974594 | |||
| 1254 | Ga0105249_10002555 | |||
| 1255 | Ga0105249_10056642 | |||
| 1256 | Ga0105249_10207693 | |||
| 1257 | Ga0105239_10033164 | |||
| 1258 | Ga0105239_10234369 | |||
| 1259 | Ga0105246_10029838 | |||
| 1260 | Ga0105246_10071124 | |||
| 1261 | Ga0105246_10560780 | |||
| 1262 | Ga0105246_10574043 | |||
| 1263 | Ga0157371_10169662 | |||
| 1264 | Ga0157371_10753285 | |||
| 1265 | Ga0157370_10017809 | |||
| 1266 | Ga0157369_10064451 | |||
| 1267 | Ga0157369_10511781 | |||
| 1268 | Ga0157369_10586396 | |||
| 1269 | Ga0157369_10643227 | |||
| 1270 | Ga0157369_10703292 | |||
| 1271 | Ga0157369_10826717 | |||
| 1272 | Ga0157374_10202317 | |||
| 1273 | Ga0157378_10198259 | |||
| 1274 | Ga0157378_11237601 | |||
| 1275 | Ga0163162_10097679 | |||
| 1276 | Ga0163162_10574634 | |||
| 1277 | Ga0163162_11246488 | |||
| 1278 | Ga0157372_10021302 | |||
| 1279 | Ga0157372_10059317 | |||
| 1280 | Ga0157372_10415797 | |||
| 1281 | Ga0157375_10150681 | |||
| 1282 | Ga0157375_10716828 | |||
| 1283 | Ga0163163_10058837 | |||
| 1284 | Ga0163163_10079759 | |||
| 1285 | Ga0163163_10312329 | |||
| 1286 | Ga0157380_10559719 | |||
| 1287 | Ga0157380_10604876 | |||
| 1288 | Ga0157380_11321260 | |||
| 1289 | Ga0157380_11614859 | |||
| 1290 | Ga0157377_10022125 | |||
| 1291 | Ga0157377_10054145 | |||
| 1292 | Ga0157377_10123277 | |||
| 1293 | Ga0157379_10002756 | |||
| 1294 | Ga0157379_10595734 | |||
| 1295 | Ga0157379_10787677 | |||
| 1296 | Ga0157379_10875928 | |||
| 1297 | Ga0157376_10076419 | |||
| 1298 | Ga0157376_10459838 | |||
| 1299 | Ga0163161_10224113 | |||
| 1300 | Ga0163161_10865138 | |||
| 1301 | Ga0206354_10874749 | |||
| 1302 | Ga0206353_10577359 | |||
| 1303 | Ga0206353_11238906 | |||
| 1304 | Ga0206353_11619556 | |||
| 1305 | Ga0213873_10022720 | |||
| 1306 | Ga0213873_10059852 | |||
| 1307 | Ga0213874_10000286 | |||
| 1308 | Ga0213874_10117757 | |||
| 1309 | Ga0213876_10004599 | |||
| 1310 | Ga0213876_10013573 | |||
| 1311 | Ga0213876_10047594 | |||
| 1312 | Ga0213876_10067549 | |||
| 1313 | Ga0213876_10111661 | |||
| 1314 | Ga0213876_10229595 | |||
| 1315 | Ga0213875_10004930 | |||
| 1316 | Ga0213875_10035984 | |||
| 1317 | Ga0213875_10071666 | |||
| 1318 | Ga0224712_10192507 | |||
| 1319 | Ga0207426_1022128 | |||
| 1320 | Ga0207692_10119972 | |||
| 1321 | Ga0207642_10043969 | |||
| 1322 | Ga0207688_10000837 | |||
| 1323 | Ga0207688_10041232 | |||
| 1324 | Ga0207688_10050595 | |||
| 1325 | Ga0207688_10093730 | |||
| 1326 | Ga0207688_10133445 | |||
| 1327 | Ga0207647_10070974 | |||
| 1328 | Ga0207647_10231714 | |||
| 1329 | Ga0207699_10153629 | |||
| 1330 | Ga0207699_10246426 | |||
| 1331 | Ga0207645_10038506 | |||
| 1332 | Ga0207645_10126985 | |||
| 1333 | Ga0207643_10016080 | |||
| 1334 | Ga0207643_10252762 | |||
| 1335 | Ga0207705_10050012 | |||
| 1336 | Ga0207705_10211615 | |||
| 1337 | Ga0207705_10446500 | |||
| 1338 | Ga0207707_10034137 | |||
| 1339 | Ga0207695_10015973 | |||
| 1340 | Ga0207695_10066993 | |||
| 1341 | Ga0207671_10009131 | |||
| 1342 | Ga0207671_10046530 | |||
| 1343 | Ga0207671_10870426 | |||
| 1344 | Ga0207693_10000327 | |||
| 1345 | Ga0207693_10001761 | |||
| 1346 | Ga0207693_10033646 | |||
| 1347 | Ga0207693_10061828 | |||
| 1348 | Ga0207663_10041395 | |||
| 1349 | Ga0207663_10150608 | |||
| 1350 | Ga0207663_10163911 | |||
| 1351 | Ga0207663_10304040 | |||
| 1352 | Ga0207663_10375746 | |||
| 1353 | Ga0207660_10020293 | |||
| 1354 | Ga0207660_10550249 | |||
| 1355 | Ga0207662_10001100 | |||
| 1356 | Ga0207662_10013749 | |||
| 1357 | Ga0207662_10025441 | |||
| 1358 | Ga0207657_10020543 | |||
| 1359 | Ga0207657_10074175 | |||
| 1360 | Ga0207657_10112322 | |||
| 1361 | Ga0207657_10128028 | |||
| 1362 | Ga0207657_10256728 | |||
| 1363 | Ga0207649_10430963 | |||
| 1364 | Ga0207649_10601593 | |||
| 1365 | Ga0207652_10021757 | |||
| 1366 | Ga0207652_10047855 | |||
| 1367 | Ga0207652_10510486 | |||
| 1368 | Ga0207646_10193065 | |||
| 1369 | Ga0207646_10750932 | |||
| 1370 | Ga0207681_10007778 | |||
| 1371 | Ga0207681_11155720 | |||
| 1372 | Ga0207694_10521321 | |||
| 1373 | Ga0207694_10521941 | |||
| 1374 | Ga0207694_10590113 | |||
| 1375 | Ga0207694_10647867 | |||
| 1376 | Ga0207694_10697589 | |||
| 1377 | Ga0207650_10100909 | |||
| 1378 | Ga0207650_10244685 | |||
| 1379 | Ga0207650_10245645 | |||
| 1380 | Ga0207659_10822650 | |||
| 1381 | Ga0207687_10041432 | |||
| 1382 | Ga0207687_10148521 | |||
| 1383 | Ga0207687_10747644 | |||
| 1384 | Ga0207700_10226856 | |||
| 1385 | Ga0207664_10000006 | |||
| 1386 | Ga0207664_10001425 | |||
| 1387 | Ga0207664_10164876 | |||
| 1388 | Ga0207664_10201664 | |||
| 1389 | Ga0207664_10277769 | |||
| 1390 | Ga0207664_10803374 | |||
| 1391 | Ga0207644_10084495 | |||
| 1392 | Ga0207644_10482599 | |||
| 1393 | Ga0207690_10000017 | |||
| 1394 | Ga0207690_10038862 | |||
| 1395 | Ga0207690_10165618 | |||
| 1396 | Ga0207690_10248156 | |||
| 1397 | Ga0207690_10479682 | |||
| 1398 | Ga0207690_10618717 | |||
| 1399 | Ga0207706_10003447 | |||
| 1400 | Ga0207706_10049514 | |||
| 1401 | Ga0207706_10221945 | |||
| 1402 | Ga0207706_10281907 | |||
| 1403 | Ga0207706_10348693 | |||
| 1404 | Ga0207706_10450961 | |||
| 1405 | Ga0207706_10470414 | |||
| 1406 | Ga0207706_10773316 | |||
| 1407 | Ga0207686_10559656 | |||
| 1408 | Ga0207709_10546181 | |||
| 1409 | Ga0207670_10001431 | |||
| 1410 | Ga0207670_10663229 | |||
| 1411 | Ga0207669_10307807 | |||
| 1412 | Ga0207669_10850834 | |||
| 1413 | Ga0207704_10016449 | |||
| 1414 | Ga0207704_10023564 | |||
| 1415 | Ga0207704_10096881 | |||
| 1416 | Ga0207665_10089389 | |||
| 1417 | Ga0207665_10482230 | |||
| 1418 | Ga0207691_10080475 | |||
| 1419 | Ga0207691_10266972 | |||
| 1420 | Ga0207691_10516962 | |||
| 1421 | Ga0207689_10024464 | |||
| 1422 | Ga0207689_10198982 | |||
| 1423 | Ga0207689_10505934 | |||
| 1424 | Ga0207661_10004877 | |||
| 1425 | Ga0207661_10016432 | |||
| 1426 | Ga0207661_10247771 | |||
| 1427 | Ga0207661_10310088 | |||
| 1428 | Ga0207661_10716484 | |||
| 1429 | Ga0207679_10030048 | |||
| 1430 | Ga0207679_10156559 | |||
| 1431 | Ga0207679_10183666 | |||
| 1432 | Ga0207679_10254981 | |||
| 1433 | Ga0207651_10208866 | |||
| 1434 | Ga0207712_10007095 | |||
| 1435 | Ga0207712_10247160 | |||
| 1436 | Ga0207668_10255500 | |||
| 1437 | Ga0207668_10352312 | |||
| 1438 | Ga0207640_10048962 | |||
| 1439 | Ga0207640_10070838 | |||
| 1440 | Ga0207640_10102341 | |||
| 1441 | Ga0207640_10259162 | |||
| 1442 | Ga0207640_10969990 | |||
| 1443 | Ga0207658_10260126 | |||
| 1444 | Ga0207677_10076623 | |||
| 1445 | Ga0207677_10224438 | |||
| 1446 | Ga0207677_10260083 | |||
| 1447 | Ga0207677_10871580 | |||
| 1448 | Ga0207703_10109837 | |||
| 1449 | Ga0207703_10180667 | |||
| 1450 | Ga0207639_10106837 | |||
| 1451 | Ga0207639_10370946 | |||
| 1452 | Ga0207678_10327800 | |||
| 1453 | Ga0207678_10541442 | |||
| 1454 | Ga0207708_10000262 | |||
| 1455 | Ga0207708_10005500 | |||
| 1456 | Ga0207708_10027883 | |||
| 1457 | Ga0207708_10222675 | |||
| 1458 | Ga0207702_10149712 | |||
| 1459 | Ga0207702_10270174 | |||
| 1460 | Ga0207702_10691092 | |||
| 1461 | Ga0207641_10251107 | |||
| 1462 | Ga0207641_10625725 | |||
| 1463 | Ga0207648_10300311 | |||
| 1464 | Ga0207676_10057173 | |||
| 1465 | Ga0207676_10108096 | |||
| 1466 | Ga0207676_10148488 | |||
| 1467 | Ga0207674_10031818 | |||
| 1468 | Ga0207674_10114818 | |||
| 1469 | Ga0207675_100003369 | |||
| 1470 | Ga0207675_100052101 | |||
| 1471 | Ga0207675_100134023 | |||
| 1472 | Ga0207683_10007689 | |||
| 1473 | Ga0207683_10030528 | |||
| 1474 | Ga0207683_10299851 | |||
| 1475 | Ga0207683_10800871 | |||
| 1476 | Ga0207698_10009395 | |||
| 1477 | Ga0207698_10307308 | |||
| 1478 | Ga0207698_10908976 | |||
| 1479 | Ga0207698_11451743 | |||
| 1480 | Ga0207428_10026260 | |||
| 1481 | Ga0207428_10027185 | |||
| 1482 | Ga0207428_10138551 | |||
| 1483 | Ga0207428_10165116 | |||
| 1484 | Ga0268266_10024720 | |||
| 1485 | Ga0268266_10129471 | |||
| 1486 | Ga0268266_10131349 | |||
| 1487 | Ga0268266_10455455 | |||
| 1488 | Ga0268265_10321432 | |||
| 1489 | Ga0268265_10399338 | |||
| 1490 | Ga0268264_10087651 | |||
| 1491 | Ga0265337_1002297 | |||
| 1492 | Ga0265326_10000045 | |||
| 1493 | Ga0265326_10000318 | |||
| 1494 | Ga0265326_10048311 | |||
| 1495 | Ga0265319_1000436 | |||
| 1496 | Ga0265319_1003909 | |||
| 1497 | Ga0265319_1004825 | |||
| 1498 | Ga0265334_10000012 | |||
| 1499 | Ga0265318_10001193 | |||
| 1500 | Ga0265318_10021316 | |||
| 1501 | Ga0265336_10000002 | |||
| 1502 | Ga0265336_10007601 | |||
| 1503 | Ga0265338_10000001 | |||
| 1504 | Ga0265338_10019260 | |||
| 1505 | Ga0265338_10021887 | |||
| 1506 | Ga0265324_10005748 | |||
| 1507 | Ga0265324_10021734 | |||
| 1508 | Ga0265320_10026441 | |||
| 1509 | Ga0265325_10267863 | |||
| 1510 | Ga0265340_10000001 | |||
| 1511 | Ga0265339_10142321 | |||
| 1512 | Ga0265327_10013895 | |||
| 1513 | Ga0265327_10025123 | |||
| 1514 | Ga0307408_100380562 | |||
| 1515 | Ga0265314_10094109 | |||
| 1516 | Ga0307405_10026830 | |||
| 1517 | Ga0307405_10072812 | |||
| 1518 | Ga0307405_10141587 | |||
| 1519 | Ga0307405_10207810 | |||
| 1520 | Ga0307405_10219743 | |||
| 1521 | Ga0307405_10259523 | |||
| 1522 | Ga0307405_10333099 | |||
| 1523 | Ga0307413_10004520 | |||
| 1524 | Ga0307413_10010533 | |||
| 1525 | Ga0307413_10027796 | |||
| 1526 | Ga0307413_10143709 | |||
| 1527 | Ga0307413_10151179 | |||
| 1528 | Ga0307413_10363631 | |||
| 1529 | Ga0307413_11163864 | |||
| 1530 | Ga0307410_10049059 | |||
| 1531 | Ga0307410_10118831 | |||
| 1532 | Ga0307410_10316507 | |||
| 1533 | Ga0307410_10317852 | |||
| 1534 | Ga0307410_10318103 | |||
| 1535 | Ga0307410_10440393 | |||
| 1536 | Ga0307410_10906964 | |||
| 1537 | Ga0307406_10034062 | |||
| 1538 | Ga0307406_10050479 | |||
| 1539 | Ga0307406_10061900 | |||
| 1540 | Ga0307406_10112368 | |||
| 1541 | Ga0307406_10379542 | |||
| 1542 | Ga0307407_10311196 | |||
| 1543 | Ga0307412_10079012 | |||
| 1544 | Ga0307409_100013677 | |||
| 1545 | Ga0307409_100023003 | |||
| 1546 | Ga0307409_100187342 | |||
| 1547 | Ga0307409_100266172 | |||
| 1548 | Ga0307416_100018458 | |||
| 1549 | Ga0307416_100064797 | |||
| 1550 | Ga0307416_100097547 | |||
| 1551 | Ga0307416_100185191 | |||
| 1552 | Ga0307416_100238743 | |||
| 1553 | Ga0307416_100523160 | |||
| 1554 | Ga0307416_100638896 | |||
| 1555 | Ga0307416_100808139 | |||
| 1556 | Ga0307416_102029861 | |||
| 1557 | Ga0307414_10097145 | |||
| 1558 | Ga0307414_11121964 | |||
| 1559 | Ga0307411_10159356 | |||
| 1560 | Ga0307411_10553866 | |||
| 1561 | Ga0307411_11132417 | |||
| 1562 | Ga0307415_100010575 | |||
| 1563 | Ga0307415_100026117 | |||
| 1564 | Ga0307415_100060247 | |||
| 1565 | Ga0307415_100114074 | |||
| 1566 | Ga0307415_100336831 | |||
| 1567 | Ga0307415_100896240 | |||
| 1568 | Ga0373959_0016079 | |||
| 1569 | Ga0373951_0012443 | |||
| 1570 | Ga0373952_0019941 | |||
| 1571 | Ga0373952_0096180 | |||
| 1572 | Ga0373941_0096849 | |||
| 1573 | Ga0373956_0079572 | |||
| 1574 | Ga0373960_0012423 | |||
| 1575 | Ga0373961_0040457 | |||
| 1576 | Ga0373962_0087386 | |||
| 1577 | Ga0373931_0096747 | |||
| 1578 | Ga0373935_0076789 | |||
| 1579 | Ga0373935_0203315 | |||
| 1580 | Ga0373927_0317593 | |||
| 1581 | Ga0373933_0235400 | |||
| 1582 | Ga0373947_0053373 | |||
| 1583 | Ga0373947_0302442 | |||
| 1584 | Ga0373937_0044127 | |||
| 1585 | Ga0395899_0216165 | |||
| 1586 | Ga0395900_0011709 | |||
| 1587 | Ga0395900_0183470 | |||
| 1588 | Ga0395900_0236479 | |||
| 1589 | Ga0395900_0266985 | |||
| 1590 | Ga0395900_0310615 | |||
| 1591 | Ga0395900_0439479 | |||
| 1592 | Ga0395900_0469611 | |||
| 1593 | Ga0395898_0001837 | |||
| 1594 | Ga0395898_0076700 | |||
| 1595 | Ga0395898_0202792 | |||
| 1596 | Ga0395898_0283508 | |||
| 1597 | Ga0395898_1003262 | |||
| 1598 | Ga0395905_0147523 | |||
| 1599 | Ga0395905_0166886 | |||
| 1600 | Ga0436364_0148076 | |||
| 1601 | Ga0436364_0392358 | |||
| 1602 | Ga0436364_0532729 | |||
| 1603 | Ga0436364_0920964 | |||
| 1604 | Ga0436364_1153395 | |||
| 1605 | Ga0436364_1222548 | |||
| 1606 | Ga0395901_0001743 | |||
| 1607 | Ga0395901_0002278 | |||
| 1608 | Ga0395901_0162427 | |||
| 1609 | Ga0395901_0194520 | |||
| 1610 | Ga0395901_0207341 | |||
| 1611 | Ga0395901_0256552 | |||
| 1612 | Ga0395901_0275782 | |||
| 1613 | Ga0395901_0291272 | |||
| 1614 | Ga0395901_0335132 | |||
| 1615 | Ga0395901_0453581 | |||
| 1616 | Ga0395901_0667039 | |||
| 1617 | Ga0395901_1669620 | |||
| 1618 | Ga0242420_040006 | |||
| 1619 | Ga0436365_0125894 | |||
| 1620 | Ga0436365_0523152 | |||
| 1621 | Ga0436365_0671457 | |||
| 1622 | Ga0436365_1090611 | |||
| 1623 | Ga0436365_1154285 | |||
| 1624 | Ga0436365_1439885 | |||
| 1625 | Ga0436365_1464727 | |||
| 1626 | Ga0436365_1552732 | |||
| 1627 | Ga0436363_0018181 | |||
| 1628 | Ga0436363_0261314 | |||
| 1629 | Ga0436363_0795197 | |||
| 1630 | Ga0436363_0805533 | |||
| 1631 | Ga0436363_0843894 | |||
| 1632 | Ga0436363_0975892 | |||
| 1633 | Ga0436363_1000235 | |||
| 1634 | Ga0436363_1213228 | |||
| 1635 | Ga0436363_1221643 | |||
| 1636 | Ga0436362_0440536 | |||
| 1637 | Ga0436362_0867877 | |||
| 1638 | Ga0436362_1247145 | |||
| 1639 | Ga0451791_1011400 | |||
| 1640 | Ga0451793_0211409 | |||
| 1641 | Ga0451800_1516251 | |||
| 1642 | Ga0451833_0229410 | |||
| 1643 | Ga0451833_0413282 | |||
| 1644 | Ga0451841_0806707 | |||
| 1645 | Ga0451853_1393261 | |||
| 1646 | Ga0451853_4054958 | |||
| 1647 | Ga0451853_4093827 | |||
| 1648 | Ga0439448_0078661 | |||
| 1649 | Ga0439463_005263 | |||
| 1650 | Ga0439435_0045895 | |||
| 1651 | Ga0439464_0021209 | |||
| 1652 | Ga0439464_0035830 | |||
| 1653 | Ga0439460_0024744 | |||
| 1654 | Ga0439460_0033182 | |||
| 1655 | Ga0439460_0078378 | |||
| 1656 | Ga0451577_1028974 | |||
| 1657 | Ga0466965_0053109 | |||
| 1658 | Ga0466966_0075669 | |||
| 1659 | Ga0466966_0094865 | |||
| 1660 | Ga0466966_0200103 | |||
| 1661 | Ga0466966_0211740 | |||
| 1662 | Ga0466961_0008051 | |||
| 1663 | Ga0466961_0011517 | |||
| 1664 | Ga0466961_0061055 | |||
| 1665 | Ga0466961_0115876 | |||
| 1666 | Ga0466961_0130650 | |||
| 1667 | Ga0466963_0006665 | |||
| 1668 | Ga0466963_0025905 | |||
| 1669 | Ga0466963_0042730 | |||
| 1670 | Ga0466963_0094702 | |||
| 1671 | Ga0466963_0127903 | |||
| 1672 | Ga0466963_0173938 | |||
| 1673 | Ga0466963_0187951 | |||
| 1674 | Ga0466963_0565867 | |||
| 1675 | Ga0466964_0055144 | |||
| 1676 | Ga0466971_0003603 | |||
| 1677 | Ga0466971_0050648 | |||
| 1678 | Ga0466971_0064442 | |||
| 1679 | Ga0466971_0104027 | |||
| 1680 | Ga0466968_0003379 | |||
| 1681 | Ga0466968_0011998 | |||
| 1682 | Ga0466968_0049842 | |||
| 1683 | Ga0466970_0078128 | |||
| 1684 | Ga0466970_0508059 | |||
| 1685 | Ga0466957_0010507 | |||
| 1686 | Ga0466957_0132010 | |||
| 1687 | Ga0466960_0000600 | |||
| 1688 | Ga0466960_0023758 | |||
| 1689 | Ga0466960_0028031 | |||
| 1690 | Ga0466960_0085178 | |||
| 1691 | Ga0466960_0091219 | |||
| 1692 | Ga0466960_0107756 | |||
| 1693 | Ga0466960_0210111 | |||
| 1694 | Ga0466960_0219298 | |||
| 1695 | Ga0466960_0279214 | |||
| 1696 | Ga0466960_0302468 | |||
| 1697 | Ga0466959_0033097 | |||
| 1698 | Ga0466959_0047851 | |||
| 1699 | Ga0466959_0065882 | |||
| 1700 | Ga0466959_0068803 | |||
| 1701 | Ga0466959_0070338 | |||
| 1702 | Ga0466959_0137356 | |||
| 1703 | Ga0466959_0175208 | |||
| 1704 | Ga0466959_0252942 | |||
| 1705 | Ga0466959_0316381 | |||
| 1706 | Ga0466959_0462430 | |||
| 1707 | Ga0466959_0498644 | |||
| 1708 | Ga0466958_0062833 | |||
| 1709 | Ga0466958_0083730 | |||
| 1710 | Ga0466967_0022058 | |||
| 1711 | Ga0466967_0037629 | |||
| 1712 | Ga0466967_0045020 | |||
| 1713 | Ga0466967_0049481 | |||
| 1714 | Ga0466967_0086368 | |||
| 1715 | Ga0466967_0180494 | |||
| 1716 | Ga0466967_0218280 | |||
| 1717 | Ga0466967_0312791 | |||
| 1718 | Ga0466967_0323244 | |||
| 1719 | Ga0466967_0493990 | |||
| 1720 | Ga0466967_0724450 | |||
| 1721 | Ga0466967_0748596 | |||
| 1722 | Ga0466967_1027138 | |||
| 1723 | Ga0466967_1032254 | |||
| 1724 | Ga0495592_0246459 | |||
| 1725 | Ga0495603_0035624 | |||
| 1726 | Ga0495603_0054537 | |||
| 1727 | Ga0495603_0382302 | |||
| 1728 | Ga0495590_0061614 | |||
| 1729 | Ga0495590_0167564 | |||
| 1730 | Ga0495629_0107117 | |||
| 1731 | Ga0495638_0049636 | |||
| 1732 | Ga0495641_0003534 | |||
| 1733 | Ga0495641_0064637 | |||
| 1734 | Ga0495641_0102718 | |||
| 1735 | Ga0495651_0014077 | |||
| 1736 | Ga0495651_0071479 | |||
| 1737 | Ga0495653_0015690 | |||
| 1738 | Ga0495653_0055338 | |||
| 1739 | Ga0495650_0000079 | |||
| 1740 | Ga0495605_0046239 | |||
| 1741 | Ga0495639_0203026 | |||
| 1742 | Ga0495662_0224173 | |||
| 1743 | Ga0495664_0000025 | |||
| 1744 | Ga0495584_0022720 | |||
| 1745 | Ga0495584_0304163 | |||
| 1746 | Ga0495584_0309599 | |||
| 1747 | Ga0495596_0037476 | |||
| 1748 | Ga0495608_0089812 | |||
| 1749 | Ga0495608_0587915 | |||
| 1750 | Ga0495618_0000805 | |||
| 1751 | Ga0495620_0120013 | |||
| 1752 | Ga0495620_0209513 | |||
| 1753 | Ga0495628_0064520 | |||
| 1754 | Ga0495630_0000440 | |||
| 1755 | Ga0495630_0049204 | |||
| 1756 | Ga0495637_0062609 | |||
| 1757 | Ga0495644_0016911 | |||
| 1758 | Ga0495652_0053756 | |||
| 1759 | Ga0495652_0069827 | |||
| 1760 | Ga0495654_0108490 | |||
| 1761 | Ga0495665_0263292 | |||
| 1762 | Ga0495640_0025372 | |||
| 1763 | Ga0495586_0126969 | |||
| 1764 | Ga0495609_0050520 | |||
| 1765 | Ga0495621_0152128 | |||
| 1766 | Ga0495645_0000021 | |||
| 1767 | Ga0495645_0000463 | |||
| 1768 | Ga0495645_0073056 | |||
| 1769 | Ga0495633_0140162 | |||
| 1770 | Ga0495667_0037600 | |||
| 1771 | Ga0495667_0094196 | |||
| 1772 | Ga0495668_0091876 | |||
| 1773 | Ga0495635_0019238 | |||
| 1774 | Ga0495635_0076737 | |||
| 1775 | Ga0495661_0000258 | |||
| 1776 | Ga0495657_0000017 | |||
| 1777 | Ga0495657_0075356 | |||
| 1778 | Ga0495599_0193891 | |||
| 1779 | Ga0495647_0273284 | |||
| 1780 | Ga0495658_0216027 | |||
| 1781 | Ga0495624_0425685 | |||
| 1782 | Ga0495671_0179734 | |||
| 1783 | Ga0495589_0047541 | |||
| 1784 | Ga0495589_0221203 | |||
| 1785 | Ga0495600_0023393 | |||
| 1786 | Ga0495674_0078959 | |||
| 1787 | Ga0495674_0197182 | |||
| 1788 | Ga0495672_0017846 | |||
| 1789 | Ga0495672_0028111 | |||
| 1790 | Ga0495676_0061260 | |||
| 1791 | Ga0495676_0154232 | |||
| 1792 | Ga0495676_0366632 | |||
| 1793 | Ga0495676_0594452 | |||
| 1794 | Ga0495680_0429398 | |||
| 1795 | Ga0495683_0076549 | |||
| 1796 | Ga0495679_067935 | |||
| 1797 | Ga0495673_0065251 | |||
| 1798 | Ga0495684_0001866 | |||
| 1799 | Ga0495684_0015331 | |||
| 1800 | Ga0495686_0000020 | |||
| 1801 | Ga0495686_0097471 | |||
| 1802 | Ga0495602_0311595 | |||
| 1803 | Ga0496100_0002656 | |||
| 1804 | Ga0496100_0020501 | |||
| 1805 | Ga0496100_0194782 | |||
| 1806 | Ga0496100_0220106 | |||
| 1807 | Ga0496100_0613447 | |||
| 1808 | Ga0496100_0706158 | |||
| 1809 | Ga0496101_0001383 | |||
| 1810 | Ga0496101_0012856 | |||
| 1811 | Ga0496101_0121007 | |||
| 1812 | Ga0496101_0149016 | |||
| 1813 | Ga0496102_0000002 | |||
| 1814 | Ga0496102_0022044 | |||
| 1815 | Ga0496102_0102611 | |||
| 1816 | Ga0496102_0166084 | |||
| 1817 | Ga0496102_0546519 | |||
| 1818 | Ga0496102_0759069 | |||
| 1819 | Ga0496103_0000047 | |||
| 1820 | Ga0496103_0181448 | |||
| 1821 | Ga0496104_0000037 | |||
| 1822 | Ga0496104_0002837 | |||
| 1823 | Ga0496104_0015555 | |||
| 1824 | Ga0496104_0021881 | |||
| 1825 | Ga0496104_0079261 | |||
| 1826 | Ga0496104_0102937 | |||
| 1827 | Ga0496104_0289120 | |||
| 1828 | Ga0496104_0677205 | |||
| 1829 | Ga0496104_1118554 | |||
| 1830 | Ga0496105_0005677 | |||
| 1831 | Ga0496105_0054369 | |||
| 1832 | Ga0496105_0155915 | |||
| 1833 | Ga0496105_0259311 | |||
| 1834 | Ga0496106_0019719 | |||
| 1835 | Ga0496106_0252683 | |||
| 1836 | Ga0496107_0016861 | |||
| 1837 | Ga0496108_0001183 | |||
| 1838 | Ga0496108_0003122 | |||
| 1839 | Ga0496108_0027856 | |||
| 1840 | Ga0496108_0078360 | |||
| 1841 | Ga0496108_0096157 | |||
| 1842 | Ga0496109_0000470 | |||
| 1843 | Ga0496109_0003253 | |||
| 1844 | Ga0496109_0017148 | |||
| 1845 | Ga0496109_0039264 | |||
| 1846 | Ga0496109_0043951 | |||
| 1847 | Ga0496109_0139042 | |||
| 1848 | Ga0496109_0397310 | |||
| 1849 | Ga0496109_0683899 | |||
| 1850 | Ga0496110_0001297 | |||
| 1851 | Ga0496110_0003735 | |||
| 1852 | Ga0496110_0091188 | |||
| 1853 | Ga0496110_0501833 | |||
| 1854 | Ga0496110_0558904 | |||
| 1855 | Ga0496110_0573049 | |||
| 1856 | Ga0496111_0000296 | |||
| 1857 | Ga0496111_0061408 | |||
| 1858 | Ga0496111_0091083 | |||
| 1859 | Ga0496111_0201697 | |||
| 1860 | Ga0496111_0216293 | |||
| 1861 | Ga0496111_0527222 | |||
| 1862 | Ga0496112_0005877 | |||
| 1863 | Ga0496112_0010188 | |||
| 1864 | Ga0496112_0011629 | |||
| 1865 | Ga0496112_0020012 | |||
| 1866 | Ga0496112_0050095 | |||
| 1867 | Ga0496112_0055639 | |||
| 1868 | Ga0496112_0063356 | |||
| 1869 | Ga0496112_0122167 | |||
| 1870 | Ga0496112_0138345 | |||
| 1871 | Ga0496112_0187946 | |||
| 1872 | Ga0496112_0316884 | |||
| 1873 | Ga0496112_0366996 | |||
| 1874 | Ga0496112_0517919 | |||
| 1875 | Ga0496113_0016207 | |||
| 1876 | Ga0496113_0033633 | |||
| 1877 | Ga0496113_0042890 | |||
| 1878 | Ga0496113_0076321 | |||
| 1879 | Ga0496113_0122983 | |||
| 1880 | Ga0496113_0195175 | |||
| 1881 | Ga0496113_0267488 | |||
| 1882 | Ga0496114_0117253 | |||
| 1883 | Ga0496114_0289928 | |||
| 1884 | Ga0496114_0362135 | |||
| 1885 | Ga0496114_0540896 | |||
| 1886 | Ga0496115_0000012 | |||
| 1887 | Ga0496115_0000017 | |||
| 1888 | Ga0496115_0033295 | |||
| 1889 | Ga0496115_0326107 | |||
| 1890 | Ga0496119_0051933 | |||
| 1891 | Ga0496119_0067296 | |||
| 1892 | Ga0496121_0003947 | |||
| 1893 | Ga0496121_0037020 | |||
| 1894 | Ga0496121_0141976 | |||
| 1895 | Ga0496126_0352660 | |||
| 1896 | Ga0501031_0005231 | |||
| 1897 | Ga0501031_0057901 | |||
| 1898 | Ga0501031_0124663 | |||
| 1899 | Ga0501032_0007337 | |||
| 1900 | Ga0501033_0604698 | |||
| 1901 | Ga0501034_0012754 | |||
| 1902 | Ga0501034_0598463 | |||
| 1903 | Ga0501036_0073293 | |||
| 1904 | Ga0501036_0398008 | |||
| 1905 | Ga0501036_0623948 | |||
| 1906 | Ga0501038_0065576 | |||
| 1907 | Ga0501038_0091418 | |||
| 1908 | Ga0501038_0231558 | |||
| 1909 | Ga0501038_0392324 | |||
| 1910 | Ga0501039_0039406 | |||
| 1911 | Ga0501039_0095126 | |||
| 1912 | Ga0501039_0103646 | |||
| 1913 | Ga0501039_0263135 | |||
| 1914 | Ga0501040_0062632 | |||
| 1915 | Ga0501040_0223062 | |||
| 1916 | Ga0501040_0578066 | |||
| 1917 | Ga0501040_0837161 | |||
| 1918 | Ga0501041_0086673 | |||
| 1919 | Ga0501041_0096832 | |||
| 1920 | Ga0501041_0190892 | |||
| 1921 | Ga0501042_0018820 | |||
| 1922 | Ga0501042_0020332 | |||
| 1923 | Ga0501043_0270571 | |||
| 1924 | Ga0501046_0010844 | |||
| 1925 | Ga0501046_0088952 | |||
| 1926 | Ga0501046_0494155 | |||
| 1927 | Ga0501047_0166259 | |||
| 1928 | Ga0501048_0012934 | |||
| 1929 | Ga0501048_0031263 | |||
| 1930 | Ga0501048_0105780 | |||
| 1931 | Ga0501048_0232088 | |||
| 1932 | Ga0501067_0296230 | |||
| 1933 | Ga0501069_0031547 | |||
| 1934 | Ga0501069_0366053 | |||
| 1935 | Ga0501070_0017941 | |||
| 1936 | Ga0501071_0004942 | |||
| 1937 | Ga0501072_0043293 | |||
| 1938 | Ga0501072_0113911 | |||
| 1939 | Ga0501072_0121636 | |||
| 1940 | Ga0501074_0079824 | |||
| 1941 | Ga0501074_0455728 | |||
| 1942 | Ga0501075_0098521 | |||
| 1943 | Ga0501075_0134025 | |||
| 1944 | Ga0501075_0394747 | |||
| 1945 | Ga0501076_0167092 | |||
| 1946 | Ga0501076_0318991 | |||
| 1947 | Ga0501079_0122079 | |||
| 1948 | Ga0501079_0154328 | |||
| 1949 | Ga0501079_0187195 | |||
| 1950 | Ga0501080_0009103 | |||
| 1951 | Ga0501080_0141807 | |||
| 1952 | Ga0501081_0169096 | |||
| 1953 | Ga0501081_1178535 | |||
| 1954 | Ga0501083_0022425 | |||
| 1955 | Ga0501083_0602733 | |||
| 1956 | Ga0501035_0006314 | |||
| 1957 | Ga0501035_0232697 | |||
| 1958 | Ga0501044_0174738 | |||
| 1959 | Ga0501044_0188380 | |||
| 1960 | Ga0501045_0008928 | |||
| 1961 | Ga0501045_0066897 | |||
| 1962 | Ga0501045_0225639 | |||
| 1963 | Ga0501045_0556390 | |||
| 1964 | nmdc:mga05p37_193978_c1 | |||
| 1965 | nmdc:mga05p37_340798_c1 | |||
| 1966 | nmdc:mga05p37_6405_c1 | |||
| 1967 | nmdc:mga05p37_8057_c1 | |||
| 1968 | nmdc:mga09592_187_c1 | |||
| 1969 | nmdc:mga0qj67_18777_c1 | |||
| 1970 | nmdc:mga0qj67_335841_c1 | |||
| 1971 | nmdc:mga06r32_267227_c1 | |||
| 1972 | nmdc:mga06r32_56294_c1 | |||
| 1973 | nmdc:mga06r32_92209_c1 | |||
| 1974 | nmdc:mga08y16_143639_c1 | |||
| 1975 | nmdc:mga08y16_171849_c1 | |||
| 1976 | nmdc:mga08y16_21022_c1 | |||
| 1977 | nmdc:mga08y16_258703_c1 | |||
| 1978 | nmdc:mga08y16_270164_c1 | |||
| 1979 | nmdc:mga08y16_271308_c1 | |||
| 1980 | nmdc:mga0n895_113044_c1 | |||
| 1981 | nmdc:mga0n895_201636_c1 | |||
| 1982 | nmdc:mga0n895_360723_c1 | |||
| 1983 | nmdc:mga0rr50_28677_c1 | |||
| 1984 | nmdc:mga08x19_207399_c1 | |||
| 1985 | Ga0495601_0029276 | |||
| 1986 | Ga0495601_0214147 | |||
| 1987 | Ga0495612_0000214 | |||
| 1988 | Ga0495612_0086378 | |||
| 1989 | Ga0495595_0061549 | |||
| 1990 | Ga0495619_0091957 | |||
| 1991 | Ga0495619_0192492 | |||
| 1992 | Ga0500556_0000279 | |||
| 1993 | Ga0500616_0002461 | |||
| 1994 | Ga0500616_0020563 | |||
| 1995 | Ga0500616_0119917 | |||
| 1996 | Ga0500599_002809 | |||
| 1997 | Ga0501084_0141239 | |||
| 1998 | Ga0501084_0806204 | |||
| 1999 | Ga0501084_0871862 | |||
| 2000 | Ga0501082_0126003 | |||
| 2001 | Ga0501082_0136114 | |||
| 2002 | Ga0501082_0363457 | |||
| 2003 | Ga0466962_0029129 | |||
| 2004 | Ga0530510_0020459 | |||
| 2005 | Ga0530510_0217327 | |||
| 2006 | Ga0530510_0500083 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f5z-assembly1.cif.gz_A | complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase | 0.8211 | 49 | 210 |
| 3px2-assembly1.cif.gz_D | structure of tylm1 from streptomyces fradiae h123n mutant in complex with sah and dtdp-quip3n | 0.8126 | 37 | 150 |
| 3l8d-assembly1.cif.gz_A-2 | crystal structure of methyltransferase from bacillus thuringiensis | 0.812 | 49 | 207 |
| 6f5z-assembly1.cif.gz_B | complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase | 0.8075 | 49 | 210 |
| 5kpg-assembly1.cif.gz_B | pavine n-methyltransferase in complex with s-adenosylhomocysteine ph 7 | 0.8042 | 38 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8Q1A0_7_169_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.883 | 50 | 139 | 3.40.50.150 |
| af_O01594_147_310_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8804 | 49 | 139 | 3.40.50.150 |
| af_Q9P3E7_8_144_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8614 | 49 | 150 | 3.40.50.150 |
| af_Q9VBJ3_147_316_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8575 | 49 | 139 | 3.40.50.150 |
| af_Q80WQ4_26_187_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8496 | 49 | 146 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A242N260-F1-model_v4 | SAM-dependent methyltransferase | 0.9719 | 111 | 210 |
GO:0008168
GO:0032259 |
| AF-A0A7K0A947-F1-model_v4 | Methyltransferase domain-containing protein | 0.9704 | 61 | 207 |
GO:0008757
GO:0032259 |
| AF-A0A4S0MVU9-F1-model_v4 | Methyltransferase type 11 | 0.9622 | 110 | 210 |
GO:0008757
GO:0032259 |
| AF-A0A7K3ZGB8-F1-model_v4 | deleted | 0.9537 | 107 | 206 |
|
| AF-A0A7K0A947-F1-model_v4 | Methyltransferase domain-containing protein | 0.951 | 61 | 207 |
GO:0008757
GO:0032259 |