F487886

General Info

Members Datasets Scaffolds Average Seq Length
1001 344 999 338

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10011237|Ga0070681_100112374
Length 397
Sequence MLLRQAGRGSFQVKFEAPNGVQRGRKRTRLVILTYSRLIRLFTIRESPPLNTPDKSPSLTYRDAGVDIDAGDALVENIKPFAKKTLRPEVLAGIGGFGAMCNIPAKYREPVLVSGTDGVGTKLKLAFELGFHDTIGIDLVAMSVNDILTQGAEPLFFLDYYACGKLDVATATAVVKGIAAGCEQAGCALIGGETAEMPGMYPPGEYDLAGFAVGVVEKSKIIDGSTIAAGDAVLGMASSGAHSNGYSLIRRIIGTRRDDLAADFGGRTLGQALLEPTRIYVKSVLQLIEKIPVKGLAHITGGGLVENVPRILSEGLAARLERASWPQPPLYAWLQRQGKVDDDEMLRVFNCGIGMVAIVAEQHADAAARLLRAAGETVWRIGSVQTRAAAEAQTTVA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
217 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
243 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
344 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 1.7
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10022481 3300003203 Bacteria 2511
2 JGI25405J52794_10004864 3300003911 Bacteria 2407
3 Ga0065712_10000192 3300005290 Bacteria 34231
4 Ga0065715_10000385 3300005293 Bacteria 24803
5 Ga0065707_10000602 3300005295 Bacteria 17078
6 Ga0065707_10014078 3300005295 Bacteria 1875
7 Ga0065707_10095781 3300005295 Bacteria 3338
8 Ga0070658_10188952 3300005327 Bacteria 1736
9 Ga0070676_10013414 3300005328 Bacteria 4491
10 Ga0070676_10042161 3300005328 Bacteria 2648
11 Ga0070683_100003976 3300005329 Bacteria 12106
12 Ga0070683_100064417 3300005329 Bacteria 3412
13 Ga0070690_100000182 3300005330 Bacteria 32371
14 Ga0070690_100005120 3300005330 Bacteria 7342
15 Ga0070690_100023712 3300005330 Bacteria 3767
16 Ga0070690_100089090 3300005330 Bacteria 2029
17 Ga0070690_100145933 3300005330 Bacteria 1610
18 Ga0070670_100010770 3300005331 Bacteria 7812
19 Ga0070670_100025655 3300005331 Bacteria 5070
20 Ga0070677_10001307 3300005333 Bacteria 7969
21 Ga0068869_100000785 3300005334 Bacteria 18102
22 Ga0068869_100009966 3300005334 Bacteria 6176
23 Ga0068869_100135380 3300005334 Bacteria 1897
24 Ga0070666_10129335 3300005335 Bacteria 1754
25 Ga0070680_100001823 3300005336 Bacteria 15647
26 Ga0070680_100021809 3300005336 Bacteria 5094
27 Ga0070680_100285061 3300005336 Bacteria 1400
28 Ga0070682_100013004 3300005337 Bacteria 4779
29 Ga0070682_100013879 3300005337 Bacteria 4645
30 Ga0068868_100000782 3300005338 Bacteria 21532
31 Ga0068868_100049644 3300005338 Bacteria 3293
32 Ga0070660_100015860 3300005339 Bacteria 5454
33 Ga0070689_100000521 3300005340 Bacteria 22753
34 Ga0070689_100082369 3300005340 Bacteria 2527
35 Ga0070689_100188759 3300005340 Bacteria 1677
36 Ga0070689_100231833 3300005340 Bacteria 1518
37 Ga0070691_10002091 3300005341 Bacteria 8828
38 Ga0070691_10012037 3300005341 Bacteria 3962
39 Ga0070691_10016272 3300005341 Bacteria 3416
40 Ga0070687_100000050 3300005343 Bacteria 37797
41 Ga0070687_100008251 3300005343 Bacteria 4400
42 Ga0070661_100005648 3300005344 Bacteria 8619
43 Ga0070661_100053601 3300005344 Bacteria 2953
44 Ga0070661_100085142 3300005344 Bacteria 2335
45 Ga0070692_10003200 3300005345 Bacteria 6586
46 Ga0070692_10015262 3300005345 Bacteria 3630
47 Ga0070668_100028302 3300005347 Bacteria 4254
48 Ga0070668_100028483 3300005347 Bacteria 4240
49 Ga0070668_100060433 3300005347 Bacteria 2934
50 Ga0070668_100124210 3300005347 Bacteria 2066
51 Ga0070668_100288519 3300005347 Bacteria 1373
52 Ga0070669_100009604 3300005353 Bacteria 6888
53 Ga0070669_100055174 3300005353 Bacteria 2911
54 Ga0070669_100063106 3300005353 Bacteria 2726
55 Ga0070675_100000071 3300005354 Bacteria 59417
56 Ga0070675_100067178 3300005354 Bacteria 2966
57 Ga0070671_100008154 3300005355 Bacteria 8385
58 Ga0070671_100008298 3300005355 Bacteria 8312
59 Ga0070671_100017520 3300005355 Bacteria 5804
60 Ga0070671_100035876 3300005355 Bacteria 4110
61 Ga0070671_100139576 3300005355 Bacteria 2045
62 Ga0070671_100304393 3300005355 Bacteria 1357
63 Ga0070674_100023890 3300005356 Bacteria 3963
64 Ga0070673_100027794 3300005364 Bacteria 4197
65 Ga0070673_100121157 3300005364 Bacteria 2182
66 Ga0070688_100002481 3300005365 Bacteria 9334
67 Ga0070659_100001017 3300005366 Bacteria 20562
68 Ga0070659_100021088 3300005366 Bacteria 4956
69 Ga0070659_100073065 3300005366 Bacteria 2730
70 Ga0070659_100203622 3300005366 Bacteria 1630
71 Ga0070667_100066127 3300005367 Bacteria 3071
72 Ga0070667_100336853 3300005367 Bacteria 1364
73 Ga0070713_100040710 3300005436 Bacteria 3779
74 Ga0070701_10000918 3300005438 Bacteria 10655
75 Ga0070701_10015244 3300005438 Bacteria 3544
76 Ga0070701_10016039 3300005438 Bacteria 3474
77 Ga0070711_100082894 3300005439 Bacteria 2290
78 Ga0070705_100000752 3300005440 Bacteria 18382
79 Ga0070700_100010913 3300005441 Bacteria 5024
80 Ga0070700_100094000 3300005441 Bacteria 1962
81 Ga0070694_100000128 3300005444 Bacteria 37863
82 Ga0070694_100029825 3300005444 Bacteria 3563
83 Ga0070694_100044666 3300005444 Bacteria 2966
84 Ga0070694_100097120 3300005444 Bacteria 2078
85 Ga0070694_100120168 3300005444 Bacteria 1884
86 Ga0070694_100134597 3300005444 Bacteria 1789
87 Ga0070678_100036062 3300005456 Bacteria 3458
88 Ga0070678_100075992 3300005456 Bacteria 2529
89 Ga0070662_100004111 3300005457 Bacteria 9145
90 Ga0070662_100013160 3300005457 Bacteria 5499
91 Ga0070662_100035144 3300005457 Bacteria 3537
92 Ga0070662_100084726 3300005457 Bacteria 2368
93 Ga0070662_100245291 3300005457 Bacteria 1438
94 Ga0070662_100253442 3300005457 Bacteria 1416
95 Ga0070662_100318850 3300005457 Bacteria 1267
96 Ga0070681_10011237 3300005458 Bacteria 8856
97 Ga0070681_10024123 3300005458 Bacteria 6123
98 Ga0070681_10025978 3300005458 Bacteria 5888
99 Ga0070681_10042940 3300005458 Bacteria 4530
100 Ga0070681_10119883 3300005458 Bacteria 2566
101 Ga0068867_100000411 3300005459 Bacteria 28681
102 Ga0068867_100000511 3300005459 Bacteria 25862
103 Ga0068867_100023044 3300005459 Bacteria 4455
104 Ga0068867_100048586 3300005459 Bacteria 3122
105 Ga0070685_10004184 3300005466 Bacteria 7279
106 Ga0070706_100000049 3300005467 Bacteria 141287
107 Ga0070706_100072507 3300005467 Bacteria 3187
108 Ga0070707_100005499 3300005468 Bacteria 11845
109 Ga0070707_100050967 3300005468 Bacteria 3968
110 Ga0070698_100045644 3300005471 Bacteria 4484
111 Ga0070698_100286410 3300005471 Bacteria 1579
112 Ga0070679_100002560 3300005530 Bacteria 16500
113 Ga0070679_100026411 3300005530 Bacteria 5704
114 Ga0070679_100049543 3300005530 Bacteria 4183
115 Ga0070679_100290556 3300005530 Bacteria 1586
116 Ga0070684_100028247 3300005535 Bacteria 4744
117 Ga0070684_100202092 3300005535 Bacteria 1810
118 Ga0070697_100003863 3300005536 Bacteria 11510
119 Ga0070697_100083742 3300005536 Bacteria 2630
120 Ga0070697_100100623 3300005536 Bacteria 2401
121 Ga0068853_100005087 3300005539 Bacteria 10262
122 Ga0070672_100018571 3300005543 Bacteria 5031
123 Ga0070672_100022344 3300005543 Bacteria 4645
124 Ga0070672_100093259 3300005543 Bacteria 2432
125 Ga0070672_100114944 3300005543 Bacteria 2197
126 Ga0070672_100206875 3300005543 Bacteria 1642
127 Ga0070686_100000107 3300005544 Bacteria 57801
128 Ga0070686_100013191 3300005544 Bacteria 4723
129 Ga0070686_100020266 3300005544 Bacteria 3931
130 Ga0070686_100049402 3300005544 Bacteria 2669
131 Ga0070686_100188780 3300005544 Bacteria 1470
132 Ga0070695_100000172 3300005545 Bacteria 30962
133 Ga0070695_100000952 3300005545 Bacteria 15714
134 Ga0070695_100123361 3300005545 Bacteria 1776
135 Ga0070695_100165033 3300005545 Bacteria 1558
136 Ga0070696_100003396 3300005546 Bacteria 10625
137 Ga0070696_100012727 3300005546 Bacteria 5650
138 Ga0070693_100000078 3300005547 Bacteria 40457
139 Ga0070665_100008476 3300005548 Bacteria 10402
140 Ga0070665_100040250 3300005548 Bacteria 4698
141 Ga0070665_100230064 3300005548 Bacteria 1854
142 Ga0070665_100234755 3300005548 Bacteria 1834
143 Ga0070704_100000256 3300005549 Bacteria 23053
144 Ga0070704_100020456 3300005549 Bacteria 4268
145 Ga0070704_100060738 3300005549 Bacteria 2701
146 Ga0070704_100200682 3300005549 Bacteria 1610
147 Ga0068855_100004148 3300005563 Bacteria 17675
148 Ga0068855_100045835 3300005563 Bacteria 5170
149 Ga0068855_100333597 3300005563 Bacteria 1674
150 Ga0068855_100441711 3300005563 Bacteria 1421
151 Ga0070664_100003033 3300005564 Bacteria 13581
152 Ga0070664_100017510 3300005564 Bacteria 5886
153 Ga0070664_100021130 3300005564 Bacteria 5362
154 Ga0070664_100021164 3300005564 Bacteria 5357
155 Ga0070664_100084795 3300005564 Bacteria 2735
156 Ga0070664_100183961 3300005564 Bacteria 1859
157 Ga0068857_100009677 3300005577 Bacteria 8373
158 Ga0068857_100026226 3300005577 Bacteria 5135
159 Ga0068854_100139316 3300005578 Bacteria 1860
160 Ga0068856_100004397 3300005614 Bacteria 14044
161 Ga0068856_100005065 3300005614 Bacteria 13041
162 Ga0068856_100027421 3300005614 Bacteria 5558
163 Ga0068856_100046734 3300005614 Bacteria 4263
164 Ga0068856_100052324 3300005614 Bacteria 4026
165 Ga0068856_100069726 3300005614 Bacteria 3476
166 Ga0068856_100184111 3300005614 Bacteria 2102
167 Ga0070702_100000048 3300005615 Bacteria 33172
168 Ga0068852_100002993 3300005616 Bacteria 11740
169 Ga0068852_100025692 3300005616 Bacteria 4776
170 Ga0068852_100130983 3300005616 Bacteria 2309
171 Ga0068859_100000873 3300005617 Bacteria 30722
172 Ga0068859_100049097 3300005617 Bacteria 4238
173 Ga0068859_100390752 3300005617 Bacteria 1487
174 Ga0068864_100031635 3300005618 Bacteria 4491
175 Ga0068864_100108838 3300005618 Bacteria 2466
176 Ga0068864_100150357 3300005618 Bacteria 2109
177 Ga0068864_100292689 3300005618 Bacteria 1522
178 Ga0068866_10022435 3300005718 Bacteria 2921
179 Ga0068861_100000373 3300005719 Bacteria 25769
180 Ga0068861_100005597 3300005719 Bacteria 8516
181 Ga0068861_100006204 3300005719 Bacteria 8134
182 Ga0068861_100085033 3300005719 Bacteria 2484
183 Ga0068861_100286089 3300005719 Bacteria 1422
184 Ga0068851_10003974 3300005834 Bacteria 6624
185 Ga0068851_10008679 3300005834 Bacteria 4707
186 Ga0068851_10097611 3300005834 Bacteria 1555
187 Ga0068870_10051460 3300005840 Bacteria 2180
188 Ga0068863_100061998 3300005841 Bacteria 3536
189 Ga0068863_100182880 3300005841 Bacteria 2012
190 Ga0068863_100223213 3300005841 Bacteria 1816
191 Ga0068858_100000324 3300005842 Bacteria 50505
192 Ga0068858_100008217 3300005842 Bacteria 10034
193 Ga0068858_100019089 3300005842 Bacteria 6412
194 Ga0068858_100027824 3300005842 Bacteria 5252
195 Ga0068858_100062343 3300005842 Bacteria 3447
196 Ga0068858_100135647 3300005842 Bacteria 2309
197 Ga0068860_100000687 3300005843 Bacteria 39010
198 Ga0068860_100120401 3300005843 Bacteria 2513
199 Ga0068862_100000430 3300005844 Bacteria 45618
200 Ga0068862_100016928 3300005844 Bacteria 6068
201 Ga0068862_100018871 3300005844 Bacteria 5747
202 Ga0068862_100101554 3300005844 Bacteria 2516
203 Ga0068862_100166029 3300005844 Bacteria 1973
204 Ga0068862_100194977 3300005844 Bacteria 1824
205 Ga0081455_10000235 3300005937 Bacteria 71796
206 Ga0081455_10081050 3300005937 Bacteria 2659
207 Ga0081538_10005747 3300005981 Bacteria 11081
208 Ga0081539_10000188 3300005985 Bacteria 143987
209 Ga0081539_10017313 3300005985 Bacteria 5068
210 Ga0070712_100133078 3300006175 Bacteria 1887
211 Ga0097621_100000180 3300006237 Bacteria 40011
212 Ga0097621_100032120 3300006237 Bacteria 4171
213 Ga0068871_100006394 3300006358 Bacteria 8330
214 Ga0068871_100007928 3300006358 Bacteria 7614
215 Ga0075428_100002149 3300006844 Bacteria 21295
216 Ga0075428_100006527 3300006844 Bacteria 12971
217 Ga0075428_100007657 3300006844 Bacteria 11973
218 Ga0075428_100042960 3300006844 Bacteria 4970
219 Ga0075428_100073629 3300006844 Bacteria 3731
220 Ga0075428_100090114 3300006844 Bacteria 3345
221 Ga0075428_100149383 3300006844 Bacteria 2538
222 Ga0075428_100413172 3300006844 Bacteria 1446
223 Ga0075430_100006463 3300006846 Bacteria 9874
224 Ga0075430_100012241 3300006846 Bacteria 7300
225 Ga0075430_100031706 3300006846 Bacteria 4485
226 Ga0075430_100035077 3300006846 Bacteria 4258
227 Ga0075430_100114549 3300006846 Bacteria 2247
228 Ga0075431_100010159 3300006847 Bacteria 9463
229 Ga0075431_100025953 3300006847 Bacteria 6006
230 Ga0075431_100031001 3300006847 Bacteria 5507
231 Ga0075431_100047368 3300006847 Bacteria 4432
232 Ga0075431_100056793 3300006847 Bacteria 4037
233 Ga0075431_100146359 3300006847 Bacteria 2435
234 Ga0075433_10002531 3300006852 Bacteria 13913
235 Ga0075433_10007284 3300006852 Bacteria 8770
236 Ga0075433_10069699 3300006852 Bacteria 3089
237 Ga0075433_10156071 3300006852 Bacteria 2030
238 Ga0075433_10279580 3300006852 Bacteria 1479
239 Ga0075433_10377353 3300006852 Bacteria 1252
240 Ga0075434_100000204 3300006871 Bacteria 40084
241 Ga0075434_100008705 3300006871 Bacteria 9444
242 Ga0075434_100009247 3300006871 Bacteria 9182
243 Ga0075434_100140254 3300006871 Bacteria 2437
244 Ga0075429_100000208 3300006880 Bacteria 39267
245 Ga0075429_100006909 3300006880 Bacteria 9859
246 Ga0075429_100027878 3300006880 Bacteria 4903
247 Ga0075429_100032477 3300006880 Bacteria 4537
248 Ga0075429_100036912 3300006880 Bacteria 4253
249 Ga0068865_100000148 3300006881 Bacteria 37832
250 Ga0068865_100023180 3300006881 Bacteria 4061
251 Ga0068865_100189197 3300006881 Bacteria 1590
252 Ga0075436_100000090 3300006914 Bacteria 52278
253 Ga0075436_100000422 3300006914 Bacteria 27110
254 Ga0075436_100002022 3300006914 Bacteria 13988
255 Ga0075436_100013290 3300006914 Bacteria 5639
256 Ga0075436_100014350 3300006914 Bacteria 5425
257 Ga0097620_100000874 3300006931 Bacteria 30722
258 Ga0097620_100025304 3300006931 Bacteria 5954
259 Ga0097620_100049098 3300006931 Bacteria 4238
260 Ga0097620_100390762 3300006931 Bacteria 1487
261 Ga0075435_100002321 3300007076 Bacteria 12584
262 Ga0075435_100015103 3300007076 Bacteria 5796
263 Ga0075435_100035388 3300007076 Bacteria 3963
264 Ga0099794_10000009 3300007265 Bacteria 92040
265 Ga0099794_10002614 3300007265 Bacteria 6695
266 Ga0099795_10022451 3300007788 Bacteria 2083
267 Ga0105240_10070494 3300009093 Bacteria 4324
268 Ga0111539_10002337 3300009094 Bacteria 25250
269 Ga0111539_10044518 3300009094 Bacteria 5317
270 Ga0111539_10054521 3300009094 Bacteria 4756
271 Ga0111539_10066933 3300009094 Bacteria 4243
272 Ga0111539_10095513 3300009094 Bacteria 3492
273 Ga0111539_10101073 3300009094 Bacteria 3385
274 Ga0111539_10102152 3300009094 Bacteria 3365
275 Ga0111539_10104229 3300009094 Unclassified 3328
276 Ga0111539_10278054 3300009094 Bacteria 1948
277 Ga0111539_10281188 3300009094 Bacteria 1936
278 Ga0105245_10000429 3300009098 Bacteria 39127
279 Ga0105245_10075495 3300009098 Bacteria 3069
280 Ga0114129_10000140 3300009147 Bacteria 75593
281 Ga0114129_10004111 3300009147 Bacteria 20570
282 Ga0114129_10012098 3300009147 Bacteria 12285
283 Ga0114129_10013997 3300009147 Bacteria 11428
284 Ga0114129_10025255 3300009147 Bacteria 8418
285 Ga0114129_10031678 3300009147 Bacteria 7475
286 Ga0114129_10063467 3300009147 Bacteria 5158
287 Ga0114129_10146982 3300009147 Bacteria 3228
288 Ga0114129_10159021 3300009147 Bacteria 3088
289 Ga0114129_10300936 3300009147 Bacteria 2138
290 Ga0105243_10010939 3300009148 Bacteria 6863
291 Ga0105243_10053140 3300009148 Bacteria 3212
292 Ga0105243_10077088 3300009148 Bacteria 2710
293 Ga0105243_10262958 3300009148 Bacteria 1546
294 Ga0105241_10016620 3300009174 Bacteria 5400
295 Ga0105241_10150284 3300009174 Bacteria 1905
296 Ga0105242_10002750 3300009176 Bacteria 13769
297 Ga0105242_10139885 3300009176 Bacteria 2099
298 Ga0105242_10364229 3300009176 Bacteria 1339
299 Ga0105248_10008760 3300009177 Bacteria 11109
300 Ga0105248_10028581 3300009177 Bacteria 6213
301 Ga0105248_10082693 3300009177 Bacteria 3612
302 Ga0105248_10174301 3300009177 Bacteria 2424
303 Ga0105237_10093576 3300009545 Bacteria 2995
304 Ga0105237_10143492 3300009545 Bacteria 2382
305 Ga0105249_10003569 3300009553 Bacteria 13468
306 Ga0105249_10031634 3300009553 Bacteria 4786
307 Ga0105249_10050414 3300009553 Bacteria 3795
308 Ga0105249_10059940 3300009553 Bacteria 3491
309 Ga0105249_10208644 3300009553 Bacteria 1916
310 Ga0105249_10220964 3300009553 Bacteria 1864
311 Ga0105249_10265321 3300009553 Bacteria 1708
312 Ga0099796_10006814 3300010159 Bacteria 2948
313 Ga0105239_10042407 3300010375 Bacteria 4986
314 Ga0105246_10004229 3300011119 Bacteria 8730
315 Ga0157373_10009902 3300013100 Bacteria 7026
316 Ga0157373_10206307 3300013100 Bacteria 1386
317 Ga0157371_10002099 3300013102 Bacteria 19457
318 Ga0157371_10044656 3300013102 Bacteria 3155
319 Ga0157370_10011428 3300013104 Bacteria 9284
320 Ga0157370_10019171 3300013104 Bacteria 6874
321 Ga0157370_10033592 3300013104 Bacteria 5002
322 Ga0157370_10039400 3300013104 Bacteria 4567
323 Ga0157369_10073263 3300013105 Bacteria 3675
324 Ga0157374_10011166 3300013296 Bacteria 7764
325 Ga0157374_10024259 3300013296 Bacteria 5435
326 Ga0157374_10098146 3300013296 Bacteria 2804
327 Ga0157374_10420429 3300013296 Bacteria 1335
328 Ga0157378_10000513 3300013297 Bacteria 36841
329 Ga0157378_10009903 3300013297 Bacteria 8309
330 Ga0157378_10053762 3300013297 Bacteria 3585
331 Ga0157378_10076259 3300013297 Bacteria 3021
332 Ga0163162_10016190 3300013306 Bacteria 7292
333 Ga0163162_10035127 3300013306 Bacteria 4992
334 Ga0163162_10060878 3300013306 Bacteria 3812
335 Ga0163162_10099873 3300013306 Bacteria 2993
336 Ga0157372_10002796 3300013307 Bacteria 18867
337 Ga0157372_10020807 3300013307 Bacteria 7085
338 Ga0157372_10070958 3300013307 Bacteria 3921
339 Ga0157372_10086116 3300013307 Bacteria 3565
340 Ga0157372_10107329 3300013307 Bacteria 3195
341 Ga0157372_10147435 3300013307 Bacteria 2714
342 Ga0157375_10128455 3300013308 Bacteria 2652
343 Ga0157375_10200891 3300013308 Bacteria 2149
344 Ga0157375_10208708 3300013308 Bacteria 2110
345 Ga0157375_10218469 3300013308 Bacteria 2064
346 Ga0163163_10010180 3300014325 Bacteria 8441
347 Ga0163163_10035789 3300014325 Bacteria 4819
348 Ga0163163_10180510 3300014325 Bacteria 2158
349 Ga0163163_10387937 3300014325 Unclassified 1454
350 Ga0157380_10087441 3300014326 Bacteria 2563
351 Ga0157380_10096710 3300014326 Bacteria 2449
352 Ga0157380_10116711 3300014326 Bacteria 2253
353 Ga0157380_10160607 3300014326 Bacteria 1953
354 Ga0157380_10279869 3300014326 Bacteria 1526
355 Ga0157377_10050364 3300014745 Bacteria 2345
356 Ga0157377_10078653 3300014745 Bacteria 1923
357 Ga0157379_10011496 3300014968 Bacteria 7726
358 Ga0157379_10023755 3300014968 Bacteria 5443
359 Ga0157379_10109497 3300014968 Bacteria 2481
360 Ga0157379_10164364 3300014968 Bacteria 2003
361 Ga0157376_10006851 3300014969 Bacteria 8067
362 Ga0157376_10020315 3300014969 Bacteria 5136
363 Ga0157376_10025322 3300014969 Bacteria 4672
364 Ga0157376_10042371 3300014969 Bacteria 3731
365 Ga0213872_10002840 3300021361 Bacteria 9903
366 Ga0213872_10042638 3300021361 Bacteria 2069
367 Ga0207697_10001236 3300025315 Bacteria 14007
368 Ga0207697_10005837 3300025315 Bacteria 5660
369 Ga0207697_10028346 3300025315 Bacteria 2290
370 Ga0207697_10062256 3300025315 Bacteria 1553
371 Ga0207656_10014928 3300025321 Bacteria 3001
372 Ga0207656_10019839 3300025321 Bacteria 2663
373 Ga0207656_10020499 3300025321 Bacteria 2629
374 Ga0207653_10020696 3300025885 Bacteria 2084
375 Ga0207682_10000591 3300025893 Bacteria 16825
376 Ga0207682_10002805 3300025893 Bacteria 7708
377 Ga0207642_10000571 3300025899 Bacteria 11335
378 Ga0207680_10030801 3300025903 Bacteria 3031
379 Ga0207680_10097531 3300025903 Bacteria 1882
380 Ga0207680_10164001 3300025903 Bacteria 1492
381 Ga0207699_10118891 3300025906 Bacteria 1706
382 Ga0207645_10002628 3300025907 Bacteria 14013
383 Ga0207645_10003041 3300025907 Bacteria 12911
384 Ga0207645_10007073 3300025907 Bacteria 7980
385 Ga0207645_10015078 3300025907 Bacteria 5148
386 Ga0207643_10000499 3300025908 Bacteria 25068
387 Ga0207643_10014374 3300025908 Bacteria 4298
388 Ga0207643_10017637 3300025908 Bacteria 3905
389 Ga0207705_10087109 3300025909 Bacteria 2283
390 Ga0207705_10148010 3300025909 Bacteria 1758
391 Ga0207684_10000011 3300025910 Bacteria 502991
392 Ga0207684_10012905 3300025910 Bacteria 7236
393 Ga0207684_10136096 3300025910 Bacteria 2109
394 Ga0207654_10068443 3300025911 Bacteria 2100
395 Ga0207707_10005874 3300025912 Bacteria 10731
396 Ga0207707_10007548 3300025912 Bacteria 9476
397 Ga0207707_10046103 3300025912 Bacteria 3796
398 Ga0207707_10056787 3300025912 Bacteria 3406
399 Ga0207707_10271143 3300025912 Bacteria 1471
400 Ga0207695_10096007 3300025913 Bacteria 2967
401 Ga0207693_10167898 3300025915 Bacteria 1728
402 Ga0207660_10037128 3300025917 Bacteria 3393
403 Ga0207660_10037879 3300025917 Bacteria 3363
404 Ga0207662_10000165 3300025918 Bacteria 31387
405 Ga0207662_10023040 3300025918 Bacteria 3574
406 Ga0207662_10062741 3300025918 Bacteria 2234
407 Ga0207657_10001461 3300025919 Bacteria 25304
408 Ga0207657_10004800 3300025919 Bacteria 14258
409 Ga0207657_10004830 3300025919 Bacteria 14197
410 Ga0207657_10120581 3300025919 Bacteria 2158
411 Ga0207649_10004780 3300025920 Bacteria 7325
412 Ga0207649_10008725 3300025920 Bacteria 5534
413 Ga0207649_10127255 3300025920 Bacteria 1726
414 Ga0207652_10005474 3300025921 Bacteria 10304
415 Ga0207652_10015335 3300025921 Bacteria 6222
416 Ga0207652_10085744 3300025921 Bacteria 2760
417 Ga0207646_10034163 3300025922 Bacteria 4596
418 Ga0207681_10004257 3300025923 Bacteria 8833
419 Ga0207681_10032634 3300025923 Bacteria 3410
420 Ga0207681_10034101 3300025923 Bacteria 3344
421 Ga0207681_10046733 3300025923 Bacteria 2912
422 Ga0207681_10278528 3300025923 Bacteria 1316
423 Ga0207650_10003776 3300025925 Bacteria 10360
424 Ga0207650_10018964 3300025925 Bacteria 4833
425 Ga0207650_10025714 3300025925 Bacteria 4195
426 Ga0207659_10002570 3300025926 Bacteria 10805
427 Ga0207659_10011642 3300025926 Bacteria 5565
428 Ga0207659_10019110 3300025926 Bacteria 4503
429 Ga0207659_10161775 3300025926 Bacteria 1758
430 Ga0207659_10211293 3300025926 Bacteria 1555
431 Ga0207687_10004557 3300025927 Bacteria 9222
432 Ga0207664_10374727 3300025929 Bacteria 1263
433 Ga0207644_10018852 3300025931 Bacteria 4675
434 Ga0207644_10025187 3300025931 Bacteria 4090
435 Ga0207644_10043980 3300025931 Bacteria 3171
436 Ga0207644_10050722 3300025931 Bacteria 2975
437 Ga0207644_10196913 3300025931 Bacteria 1587
438 Ga0207644_10200593 3300025931 Bacteria 1573
439 Ga0207690_10002569 3300025932 Bacteria 10965
440 Ga0207690_10164059 3300025932 Bacteria 1659
441 Ga0207706_10000040 3300025933 Bacteria 132285
442 Ga0207706_10002512 3300025933 Bacteria 17885
443 Ga0207706_10018329 3300025933 Bacteria 6300
444 Ga0207706_10036204 3300025933 Bacteria 4385
445 Ga0207706_10073637 3300025933 Bacteria 3004
446 Ga0207706_10099342 3300025933 Bacteria 2560
447 Ga0207706_10158273 3300025933 Bacteria 1991
448 Ga0207686_10002408 3300025934 Bacteria 10187
449 Ga0207709_10006187 3300025935 Bacteria 6739
450 Ga0207709_10039123 3300025935 Bacteria 2830
451 Ga0207709_10075431 3300025935 Bacteria 2155
452 Ga0207670_10019224 3300025936 Bacteria 4168
453 Ga0207669_10125569 3300025937 Bacteria 1752
454 Ga0207669_10181699 3300025937 Bacteria 1509
455 Ga0207704_10000191 3300025938 Bacteria 32206
456 Ga0207704_10000578 3300025938 Bacteria 16311
457 Ga0207704_10008379 3300025938 Bacteria 4940
458 Ga0207665_10059228 3300025939 Bacteria 2591
459 Ga0207691_10002088 3300025940 Bacteria 19508
460 Ga0207691_10002892 3300025940 Bacteria 16739
461 Ga0207691_10011283 3300025940 Bacteria 8572
462 Ga0207691_10023496 3300025940 Bacteria 5804
463 Ga0207691_10071431 3300025940 Bacteria 3132
464 Ga0207691_10072372 3300025940 Bacteria 3109
465 Ga0207691_10096585 3300025940 Bacteria 2642
466 Ga0207711_10032978 3300025941 Bacteria 4380
467 Ga0207711_10037450 3300025941 Bacteria 4120
468 Ga0207711_10047226 3300025941 Bacteria 3680
469 Ga0207689_10000475 3300025942 Bacteria 37746
470 Ga0207689_10000859 3300025942 Bacteria 29309
471 Ga0207689_10003002 3300025942 Bacteria 15561
472 Ga0207689_10016138 3300025942 Bacteria 6324
473 Ga0207689_10045413 3300025942 Bacteria 3632
474 Ga0207689_10055979 3300025942 Bacteria 3245
475 Ga0207661_10023637 3300025944 Bacteria 4646
476 Ga0207661_10046948 3300025944 Bacteria 3426
477 Ga0207679_10007077 3300025945 Bacteria 7112
478 Ga0207679_10010729 3300025945 Bacteria 5910
479 Ga0207679_10033663 3300025945 Bacteria 3608
480 Ga0207679_10177424 3300025945 Bacteria 1759
481 Ga0207679_10179301 3300025945 Bacteria 1751
482 Ga0207667_10016457 3300025949 Bacteria 8356
483 Ga0207667_10025236 3300025949 Bacteria 6509
484 Ga0207667_10415657 3300025949 Bacteria 1369
485 Ga0207667_10439886 3300025949 Bacteria 1326
486 Ga0207651_10032603 3300025960 Bacteria 3349
487 Ga0207651_10039003 3300025960 Bacteria 3127
488 Ga0207651_10271649 3300025960 Bacteria 1396
489 Ga0207712_10121541 3300025961 Bacteria 1976
490 Ga0207712_10211564 3300025961 Bacteria 1545
491 Ga0207712_10425808 3300025961 Bacteria 1121
492 Ga0207668_10026334 3300025972 Bacteria 3775
493 Ga0207668_10061110 3300025972 Bacteria 2648
494 Ga0207668_10103129 3300025972 Bacteria 2124
495 Ga0207640_10031905 3300025981 Bacteria 3262
496 Ga0207640_10035874 3300025981 Bacteria 3107
497 Ga0207640_10038600 3300025981 Bacteria 3015
498 Ga0207658_10020441 3300025986 Bacteria 4583
499 Ga0207658_10028439 3300025986 Bacteria 3936
500 Ga0207677_10009984 3300026023 Bacteria 5357
501 Ga0207677_10036364 3300026023 Bacteria 3209
502 Ga0207677_10070928 3300026023 Bacteria 2457
503 Ga0207677_10081003 3300026023 Bacteria 2328
504 Ga0207677_10123312 3300026023 Bacteria 1953
505 Ga0207703_10001336 3300026035 Bacteria 22598
506 Ga0207703_10029051 3300026035 Bacteria 4361
507 Ga0207703_10037690 3300026035 Bacteria 3852
508 Ga0207703_10078016 3300026035 Bacteria 2751
509 Ga0207703_10115623 3300026035 Bacteria 2296
510 Ga0207703_10168487 3300026035 Bacteria 1925
511 Ga0207639_10022909 3300026041 Bacteria 4504
512 Ga0207639_10250317 3300026041 Bacteria 1545
513 Ga0207678_10005737 3300026067 Bacteria 11079
514 Ga0207678_10201809 3300026067 Bacteria 1701
515 Ga0207708_10000465 3300026075 Bacteria 31214
516 Ga0207708_10000874 3300026075 Bacteria 22683
517 Ga0207708_10119162 3300026075 Bacteria 2056
518 Ga0207702_10079932 3300026078 Bacteria 2835
519 Ga0207702_10084879 3300026078 Bacteria 2758
520 Ga0207702_10122576 3300026078 Bacteria 2329
521 Ga0207702_10211194 3300026078 Bacteria 1804
522 Ga0207702_10273703 3300026078 Bacteria 1593
523 Ga0207641_10061543 3300026088 Bacteria 3201
524 Ga0207641_10102622 3300026088 Bacteria 2522
525 Ga0207641_10158709 3300026088 Bacteria 2054
526 Ga0207641_10183493 3300026088 Bacteria 1918
527 Ga0207641_10209669 3300026088 Bacteria 1801
528 Ga0207641_10387955 3300026088 Bacteria 1339
529 Ga0207641_10440816 3300026088 Bacteria 1257
530 Ga0207648_10000171 3300026089 Bacteria 67246
531 Ga0207648_10000711 3300026089 Bacteria 37350
532 Ga0207648_10007174 3300026089 Bacteria 10985
533 Ga0207648_10012551 3300026089 Bacteria 7927
534 Ga0207648_10033218 3300026089 Bacteria 4551
535 Ga0207648_10194084 3300026089 Bacteria 1800
536 Ga0207648_10262874 3300026089 Bacteria 1540
537 Ga0207676_10153236 3300026095 Bacteria 1987
538 Ga0207676_10237503 3300026095 Bacteria 1633
539 Ga0207676_10282200 3300026095 Bacteria 1508
540 Ga0207674_10001481 3300026116 Bacteria 30323
541 Ga0207674_10003155 3300026116 Bacteria 20315
542 Ga0207674_10020682 3300026116 Bacteria 7102
543 Ga0207674_10064045 3300026116 Bacteria 3709
544 Ga0207675_100000321 3300026118 Bacteria 45579
545 Ga0207675_100006158 3300026118 Bacteria 11397
546 Ga0207675_100013607 3300026118 Bacteria 7596
547 Ga0207675_100021027 3300026118 Bacteria 6083
548 Ga0207675_100068014 3300026118 Bacteria 3330
549 Ga0207675_100138421 3300026118 Bacteria 2311
550 Ga0207675_100167502 3300026118 Bacteria 2099
551 Ga0207683_10000495 3300026121 Bacteria 36463
552 Ga0207683_10003852 3300026121 Bacteria 13017
553 Ga0207683_10080683 3300026121 Bacteria 2886
554 Ga0207698_10007657 3300026142 Bacteria 6773
555 Ga0207698_10074746 3300026142 Bacteria 2705
556 Ga0207698_10093542 3300026142 Bacteria 2468
557 Ga0207698_10125633 3300026142 Bacteria 2181
558 Ga0207698_10295962 3300026142 Bacteria 1504
559 Ga0207698_10372329 3300026142 Bacteria 1356
560 Ga0209969_1000330 3300027360 Bacteria 6325
561 Ga0209981_1001876 3300027378 Bacteria 2677
562 Ga0210000_1000147 3300027462 Bacteria 9923
563 Ga0209999_1001932 3300027543 Bacteria 3604
564 Ga0209970_1003429 3300027614 Bacteria 2667
565 Ga0209983_1007041 3300027665 Bacteria 2309
566 Ga0209588_1000012 3300027671 Bacteria 141363
567 Ga0209588_1004068 3300027671 Bacteria 4096
568 Ga0209971_1001105 3300027682 Bacteria 6847
569 Ga0209971_1021721 3300027682 Bacteria 1527
570 Ga0209966_1002806 3300027695 Bacteria 2920
571 Ga0209974_10000361 3300027876 Bacteria 14944
572 Ga0209974_10004246 3300027876 Bacteria 5116
573 Ga0207428_10005465 3300027907 Bacteria 11846
574 Ga0207428_10098204 3300027907 Bacteria 2266
575 Ga0268266_10104709 3300028379 Bacteria 2498
576 Ga0268265_10000628 3300028380 Bacteria 35160
577 Ga0268265_10000632 3300028380 Bacteria 35050
578 Ga0268265_10015330 3300028380 Bacteria 5242
579 Ga0268265_10347951 3300028380 Bacteria 1352
580 Ga0268265_10356661 3300028380 Bacteria 1337
581 Ga0268264_10000745 3300028381 Bacteria 36883
582 Ga0268264_10041569 3300028381 Bacteria 3804
583 Ga0268264_10053965 3300028381 Bacteria 3355
584 Ga0268264_10528131 3300028381 Bacteria 1154
585 Ga0265318_10001865 3300028577 Bacteria 11857
586 Ga0265330_10011762 3300031235 Bacteria 4099
587 Ga0265332_10001879 3300031238 Bacteria 11159
588 Ga0265329_10009644 3300031242 Bacteria 3587
589 Ga0265331_10001401 3300031250 Bacteria 17695
590 Ga0265327_10005966 3300031251 Bacteria 9925
591 Ga0265316_10039732 3300031344 Bacteria 3777
592 Ga0307408_100003702 3300031548 Bacteria 10411
593 Ga0307408_100025589 3300031548 Bacteria 4044
594 Ga0307408_100173265 3300031548 Bacteria 1724
595 Ga0307408_100236196 3300031548 Bacteria 1500
596 Ga0316575_10004283 3300031665 Bacteria 5014
597 Ga0265314_10000660 3300031711 Bacteria 42242
598 Ga0316576_10024457 3300031727 Bacteria 4218
599 Ga0316578_10086363 3300031728 Bacteria 1870
600 Ga0307405_10011070 3300031731 Bacteria 4709
601 Ga0307413_10007215 3300031824 Bacteria 5142
602 Ga0307413_10070379 3300031824 Bacteria 2200
603 Ga0307410_10051952 3300031852 Bacteria 2765
604 Ga0307410_10153245 3300031852 Bacteria 1718
605 Ga0307406_10014335 3300031901 Bacteria 4559
606 Ga0307407_10216374 3300031903 Bacteria 1293
607 Ga0307412_10018282 3300031911 Bacteria 4215
608 Ga0307409_100075555 3300031995 Bacteria 2698
609 Ga0307416_100006356 3300032002 Bacteria 7388
610 Ga0307416_100007756 3300032002 Bacteria 6861
611 Ga0307416_100192463 3300032002 Bacteria 1925
612 Ga0307414_10038324 3300032004 Bacteria 3218
613 Ga0307414_10069181 3300032004 Bacteria 2537
614 Ga0307414_10139567 3300032004 Bacteria 1895
615 Ga0316583_10000317 3300032133 Bacteria 13570
616 Ga0373930_0002774 3300034816 Bacteria 2736
617 Ga0373938_0014320 3300034957 Bacteria 1520
618 Ga0373929_0002976 3300035085 Bacteria 3082
619 Ga0373934_0000665 3300035086 Bacteria 12185
620 Ga0373944_0053331 3300035089 Bacteria 1279
621 Ga0373952_0008361 3300035092 Bacteria 1962
622 Ga0373923_0031043 3300035111 Bacteria 2152
623 Ga0373936_0009560 3300035113 Bacteria 3653
624 Ga0373939_0002617 3300035114 Bacteria 4228
625 Ga0373939_0037568 3300035114 Bacteria 1439
626 Ga0373945_0009999 3300035116 Bacteria 3117
627 Ga0373953_0004673 3300035117 Bacteria 4383
628 Ga0373954_0000389 3300035118 Bacteria 16397
629 Ga0373956_0000018 3300035119 Bacteria 50671
630 Ga0373956_0056558 3300035119 Bacteria 1771
631 Ga0373957_0039924 3300035120 Bacteria 1762
632 Ga0373960_0004502 3300035121 Bacteria 3200
633 Ga0373960_0033058 3300035121 Bacteria 1456
634 Ga0373946_0011173 3300035171 Bacteria 3343
635 Ga0373955_0009217 3300035172 Bacteria 4618
636 Ga0373942_0011370 3300035207 Bacteria 2110
637 Ga0373961_0003067 3300035241 Bacteria 4203
638 Ga0373962_0016319 3300035242 Bacteria 1914
639 Ga0316574_0072415 3300035398 Bacteria 2178
640 Ga0316574_0102261 3300035398 Bacteria 1834
641 Ga0316574_0192804 3300035398 Bacteria 1310
642 Ga0373931_0000773 3300035691 Bacteria 13396
643 Ga0373931_0045669 3300035691 Bacteria 2314
644 Ga0373935_0018030 3300035692 Bacteria 4290
645 Ga0373935_0020582 3300035692 Bacteria 4031
646 Ga0373927_0147834 3300035695 Bacteria 1538
647 Ga0373933_0000035 3300035724 Bacteria 82702
648 Ga0373933_0009221 3300035724 Bacteria 5387
649 Ga0373933_0169588 3300035724 Bacteria 1388
650 Ga0373947_0099612 3300035725 Bacteria 1824
651 Ga0373937_0001626 3300036401 Bacteria 18870
652 Ga0373937_0002135 3300036401 Bacteria 16540
653 Ga0373937_0005243 3300036401 Bacteria 11072
654 Ga0373937_0037732 3300036401 Bacteria 4404
655 Ga0373937_0046927 3300036401 Bacteria 3951
656 Ga0316582_0183874 3300036647 Bacteria 1423
657 Ga0316584_0021550 3300036712 Bacteria 4685
658 Ga0316584_0061119 3300036712 Bacteria 2822
659 Ga0436360_0957938 3300039438 Bacteria 3100
660 Ga0436361_0000750 3300039447 Bacteria 11682
661 Ga0436361_0024448 3300039447 Bacteria 32744
662 Ga0436361_0469964 3300039447 Bacteria 3776
663 Ga0439435_0000410 3300042436 Bacteria 6651
664 Ga0439435_0030399 3300042436 Bacteria 1464
665 Ga0439444_0007833 3300042437 Bacteria 1652
666 Ga0451577_0000198 3300042876 Bacteria 126177
667 Ga0451577_0005723 3300042876 Bacteria 12612
668 Ga0451577_0019539 3300042876 Bacteria 6228
669 Ga0451577_0026224 3300042876 Bacteria 5278
670 Ga0451577_0116022 3300042876 Bacteria 2398
671 Ga0451577_0151938 3300042876 Bacteria 2083
672 Ga0451577_0273658 3300042876 Bacteria 1529
673 Ga0453683_0000297 3300044673 Bacteria 63651
674 Ga0453683_0000327 3300044673 Bacteria 58419
675 Ga0453683_0000574 3300044673 Bacteria 40638
676 Ga0453683_0006691 3300044673 Bacteria 7887
677 Ga0453683_0009683 3300044673 Bacteria 6424
678 Ga0453683_0017269 3300044673 Bacteria 4648
679 Ga0453683_0019936 3300044673 Bacteria 4288
680 Ga0453684_0000014 3300044712 Bacteria 993311
681 Ga0453684_0000237 3300044712 Bacteria 236999
682 Ga0453684_0000654 3300044712 Bacteria 124616
683 Ga0453684_0000736 3300044712 Bacteria 114722
684 Ga0453684_0002679 3300044712 Bacteria 42376
685 Ga0453684_0003313 3300044712 Bacteria 36677
686 Ga0453684_0003721 3300044712 Bacteria 33765
687 Ga0453684_0006018 3300044712 Bacteria 23488
688 Ga0453684_0006774 3300044712 Bacteria 21561
689 Ga0453684_0049307 3300044712 Bacteria 5555
690 Ga0453684_0052107 3300044712 Bacteria 5355
691 Ga0453684_0055351 3300044712 Bacteria 5158
692 Ga0453684_0116990 3300044712 Bacteria 3226
693 Ga0453684_0119048 3300044712 Bacteria 3192
694 Ga0453684_0169758 3300044712 Bacteria 2572
695 Ga0453684_0359907 3300044712 Bacteria 1638
696 Ga0451576_0000519 3300045051 Bacteria 84375
697 Ga0451576_0001482 3300045051 Bacteria 39694
698 Ga0451576_0002358 3300045051 Bacteria 28480
699 Ga0451576_0002911 3300045051 Bacteria 24410
700 Ga0451576_0003917 3300045051 Bacteria 19880
701 Ga0451576_0005086 3300045051 Bacteria 16671
702 Ga0451576_0032170 3300045051 Bacteria 5589
703 Ga0451576_0168532 3300045051 Bacteria 2285
704 Ga0451576_0219477 3300045051 Bacteria 1985
705 Ga0451576_0241404 3300045051 Bacteria 1887
706 Ga0451576_0361155 3300045051 Bacteria 1521
707 Ga0495592_0000274 3300046454 Bacteria 44078
708 Ga0495651_0000350 3300046462 Bacteria 35585
709 Ga0495653_0060544 3300046463 Bacteria 2868
710 Ga0495653_0136307 3300046463 Bacteria 1731
711 Ga0495582_0049451 3300046473 Bacteria 2315
712 Ga0495582_0101702 3300046473 Bacteria 1609
713 Ga0495639_0040638 3300046475 Bacteria 2093
714 Ga0495662_0006621 3300046476 Bacteria 5782
715 Ga0495608_0000280 3300046511 Bacteria 36413
716 Ga0495618_0110775 3300046514 Bacteria 1757
717 Ga0495628_0000155 3300046516 Bacteria 59667
718 Ga0495628_0051437 3300046516 Bacteria 3257
719 Ga0495630_0001456 3300046517 Bacteria 16398
720 Ga0495630_0015088 3300046517 Bacteria 5637
721 Ga0495630_0060932 3300046517 Bacteria 2833
722 Ga0495642_0018049 3300046528 Bacteria 2759
723 Ga0495642_0021115 3300046528 Bacteria 2560
724 Ga0495652_0078352 3300046529 Bacteria 2736
725 Ga0495665_0011370 3300046531 Bacteria 4818
726 Ga0495640_0000538 3300046533 Bacteria 27842
727 Ga0495586_0000293 3300046535 Bacteria 31784
728 Ga0495586_0000714 3300046535 Bacteria 18914
729 Ga0495586_0126856 3300046535 Bacteria 1427
730 Ga0495586_0139818 3300046535 Bacteria 1359
731 Ga0495621_0013645 3300046539 Bacteria 2557
732 Ga0495621_0053449 3300046539 Bacteria 1450
733 Ga0495645_0023581 3300046543 Bacteria 4457
734 Ga0495622_0127485 3300046557 Bacteria 1160
735 Ga0495667_0010591 3300046559 Bacteria 6237
736 Ga0495667_0018886 3300046559 Bacteria 4656
737 Ga0495656_0033759 3300046615 Bacteria 2090
738 Ga0495634_0006512 3300046642 Bacteria 8871
739 Ga0495635_0038509 3300046663 Bacteria 3310
740 Ga0495588_0029651 3300046674 Bacteria 2746
741 Ga0495588_0125924 3300046674 Bacteria 1351
742 Ga0495599_0007055 3300046678 Bacteria 6799
743 Ga0495599_0068387 3300046678 Bacteria 2217
744 Ga0495647_0000064 3300046681 Bacteria 26717
745 Ga0495647_0070227 3300046681 Bacteria 1401
746 Ga0495658_0002106 3300046683 Bacteria 10101
747 Ga0495658_0007860 3300046683 Bacteria 5281
748 Ga0495669_0002344 3300046684 Bacteria 7764
749 Ga0495613_0016043 3300046689 Bacteria 5577
750 Ga0495604_0018583 3300047317 Bacteria 5568
751 Ga0495636_0017142 3300047318 Bacteria 2898
752 Ga0495680_0000202 3300047322 Bacteria 64368
753 Ga0496100_0093665 3300048903 Bacteria 2056
754 Ga0496102_0246842 3300048905 Bacteria 1683
755 Ga0496102_0398117 3300048905 Bacteria 1295
756 Ga0496103_0092145 3300048906 Bacteria 1913
757 Ga0496104_0013528 3300048907 Bacteria 7353
758 Ga0496106_0009674 3300048909 Bacteria 7120
759 Ga0496108_0131271 3300048911 Bacteria 2153
760 Ga0496108_0291553 3300048911 Bacteria 1421
761 Ga0496109_0010599 3300048912 Bacteria 7883
762 Ga0496109_0055244 3300048912 Bacteria 3622
763 Ga0496109_0191294 3300048912 Bacteria 1923
764 Ga0496110_0082827 3300048913 Bacteria 2861
765 Ga0496110_0117557 3300048913 Bacteria 2394
766 Ga0496111_0041992 3300048914 Bacteria 3283
767 Ga0496111_0113117 3300048914 Bacteria 2000
768 Ga0496114_0014237 3300048917 Bacteria 6381
769 Ga0496114_0065149 3300048917 Bacteria 3052
770 Ga0501031_0003010 3300049568 Bacteria 10783
771 Ga0501031_0025095 3300049568 Bacteria 3887
772 Ga0501031_0056734 3300049568 Bacteria 2552
773 Ga0501032_0000317 3300049569 Bacteria 40467
774 Ga0501032_0016039 3300049569 Bacteria 5275
775 Ga0501032_0025946 3300049569 Bacteria 4036
776 Ga0501033_0078581 3300049570 Bacteria 2421
777 Ga0501033_0106304 3300049570 Bacteria 2044
778 Ga0501034_0214346 3300049571 Bacteria 1880
779 Ga0501036_0000184 3300049572 Bacteria 41502
780 Ga0501036_0006006 3300049572 Bacteria 9844
781 Ga0501036_0017451 3300049572 Bacteria 6000
782 Ga0501036_0042851 3300049572 Bacteria 3832
783 Ga0501036_0271103 3300049572 Bacteria 1421
784 Ga0501037_0003621 3300049573 Bacteria 11200
785 Ga0501037_0013481 3300049573 Bacteria 6019
786 Ga0501038_0000918 3300049574 Bacteria 26154
787 Ga0501038_0012407 3300049574 Bacteria 7788
788 Ga0501038_0088306 3300049574 Bacteria 2602
789 Ga0501038_0129652 3300049574 Bacteria 2072
790 Ga0501039_0000053 3300049575 Bacteria 94861
791 Ga0501039_0000984 3300049575 Bacteria 20724
792 Ga0501039_0007780 3300049575 Bacteria 8174
793 Ga0501039_0100328 3300049575 Bacteria 2259
794 Ga0501039_0110234 3300049575 Bacteria 2152
795 Ga0501039_0124217 3300049575 Bacteria 2024
796 Ga0501039_0185917 3300049575 Bacteria 1634
797 Ga0501039_0306046 3300049575 Bacteria 1249
798 Ga0501040_0000676 3300049576 Bacteria 21081
799 Ga0501040_0001174 3300049576 Bacteria 16665
800 Ga0501040_0010702 3300049576 Bacteria 5999
801 Ga0501040_0017033 3300049576 Bacteria 4819
802 Ga0501040_0035877 3300049576 Bacteria 3364
803 Ga0501040_0069915 3300049576 Bacteria 2422
804 Ga0501040_0227533 3300049576 Bacteria 1328
805 Ga0501041_0000118 3300049577 Bacteria 33545
806 Ga0501041_0001447 3300049577 Bacteria 13110
807 Ga0501041_0007398 3300049577 Bacteria 6448
808 Ga0501041_0020768 3300049577 Bacteria 3929
809 Ga0501041_0030752 3300049577 Bacteria 3241
810 Ga0501041_0034485 3300049577 Bacteria 3064
811 Ga0501041_0128945 3300049577 Bacteria 1575
812 Ga0501042_0000120 3300049578 Bacteria 33485
813 Ga0501042_0000461 3300049578 Bacteria 20972
814 Ga0501042_0004086 3300049578 Bacteria 9267
815 Ga0501042_0006533 3300049578 Bacteria 7576
816 Ga0501042_0015564 3300049578 Bacteria 5210
817 Ga0501042_0115461 3300049578 Bacteria 1933
818 Ga0501043_0017213 3300049579 Bacteria 5670
819 Ga0501043_0042253 3300049579 Bacteria 3582
820 Ga0501043_0214957 3300049579 Bacteria 1489
821 Ga0501046_0000144 3300049580 Bacteria 74352
822 Ga0501046_0036565 3300049580 Bacteria 3950
823 Ga0501046_0058443 3300049580 Bacteria 3023
824 Ga0501046_0257403 3300049580 Bacteria 1283
825 Ga0501047_0080903 3300049581 Bacteria 3123
826 Ga0501048_0002750 3300049582 Bacteria 13416
827 Ga0501048_0005713 3300049582 Bacteria 9455
828 Ga0501048_0005913 3300049582 Bacteria 9315
829 Ga0501048_0027873 3300049582 Bacteria 4102
830 Ga0501048_0142436 3300049582 Bacteria 1695
831 Ga0501067_0024210 3300049583 Bacteria 3367
832 Ga0501068_0003519 3300049584 Bacteria 8460
833 Ga0501068_0011077 3300049584 Bacteria 5076
834 Ga0501068_0026532 3300049584 Bacteria 3414
835 Ga0501069_0002389 3300049585 Bacteria 9526
836 Ga0501069_0017219 3300049585 Bacteria 3887
837 Ga0501069_0032873 3300049585 Bacteria 2856
838 Ga0501069_0044384 3300049585 Bacteria 2461
839 Ga0501069_0092095 3300049585 Bacteria 1715
840 Ga0501070_0022126 3300049586 Bacteria 5325
841 Ga0501070_0042303 3300049586 Bacteria 3794
842 Ga0501071_0000524 3300049587 Bacteria 19601
843 Ga0501071_0009263 3300049587 Bacteria 6549
844 Ga0501071_0012759 3300049587 Bacteria 5712
845 Ga0501071_0016342 3300049587 Bacteria 5102
846 Ga0501071_0038552 3300049587 Bacteria 3415
847 Ga0501072_0000147 3300049588 Bacteria 52765
848 Ga0501072_0000692 3300049588 Bacteria 24435
849 Ga0501072_0008575 3300049588 Bacteria 7755
850 Ga0501072_0027386 3300049588 Bacteria 4445
851 Ga0501072_0073475 3300049588 Bacteria 2704
852 Ga0501072_0225954 3300049588 Bacteria 1491
853 Ga0501072_0252501 3300049588 Bacteria 1404
854 Ga0501073_0006688 3300049589 Bacteria 8585
855 Ga0501073_0106348 3300049589 Bacteria 1947
856 Ga0501073_0118346 3300049589 Bacteria 1836
857 Ga0501074_0003883 3300049590 Bacteria 10649
858 Ga0501074_0006840 3300049590 Bacteria 8239
859 Ga0501074_0071627 3300049590 Bacteria 2491
860 Ga0501075_0000301 3300049591 Bacteria 27561
861 Ga0501075_0000632 3300049591 Bacteria 21539
862 Ga0501075_0000662 3300049591 Bacteria 21182
863 Ga0501075_0008244 3300049591 Bacteria 7257
864 Ga0501075_0017277 3300049591 Bacteria 5210
865 Ga0501075_0039475 3300049591 Bacteria 3533
866 Ga0501075_0060838 3300049591 Bacteria 2845
867 Ga0501075_0112404 3300049591 Bacteria 2071
868 Ga0501075_0336494 3300049591 Bacteria 1150
869 Ga0501076_0000098 3300049592 Bacteria 47158
870 Ga0501076_0000265 3300049592 Bacteria 32365
871 Ga0501076_0000904 3300049592 Bacteria 19305
872 Ga0501076_0005617 3300049592 Bacteria 9036
873 Ga0501076_0007862 3300049592 Bacteria 7773
874 Ga0501076_0011579 3300049592 Bacteria 6578
875 Ga0501076_0087928 3300049592 Bacteria 2498
876 Ga0501076_0093686 3300049592 Bacteria 2417
877 Ga0501077_0000448 3300049593 Bacteria 24957
878 Ga0501077_0000582 3300049593 Bacteria 22106
879 Ga0501077_0027943 3300049593 Bacteria 3584
880 Ga0501077_0035602 3300049593 Bacteria 3169
881 Ga0501079_0000132 3300049741 Bacteria 40276
882 Ga0501079_0000722 3300049741 Bacteria 22311
883 Ga0501079_0000752 3300049741 Bacteria 22032
884 Ga0501079_0000932 3300049741 Bacteria 20112
885 Ga0501079_0004003 3300049741 Bacteria 10896
886 Ga0501079_0047754 3300049741 Bacteria 3303
887 Ga0501079_0170952 3300049741 Bacteria 1694
888 Ga0501079_0278371 3300049741 Bacteria 1308
889 Ga0501080_0002706 3300049742 Bacteria 15539
890 Ga0501080_0004132 3300049742 Bacteria 12868
891 Ga0501080_0006087 3300049742 Bacteria 10814
892 Ga0501080_0006551 3300049742 Bacteria 10466
893 Ga0501080_0077064 3300049742 Bacteria 3100
894 Ga0501080_0085167 3300049742 Bacteria 2937
895 Ga0501080_0212429 3300049742 Bacteria 1773
896 Ga0501081_0000052 3300049743 Bacteria 43945
897 Ga0501081_0000911 3300049743 Bacteria 17521
898 Ga0501081_0001770 3300049743 Bacteria 13393
899 Ga0501081_0036404 3300049743 Bacteria 3356
900 Ga0501081_0190389 3300049743 Bacteria 1485
901 Ga0501083_0036573 3300049744 Bacteria 3349
902 Ga0501083_0038979 3300049744 Bacteria 3228
903 Ga0501083_0045395 3300049744 Bacteria 2973
904 Ga0501083_0101560 3300049744 Bacteria 1896
905 Ga0501035_0028508 3300049822 Bacteria 5096
906 Ga0501035_0055328 3300049822 Bacteria 3542
907 Ga0501035_0055373 3300049822 Bacteria 3541
908 Ga0501035_0366685 3300049822 Bacteria 1203
909 Ga0501044_0011394 3300049823 Bacteria 9630
910 Ga0501045_0000924 3300049824 Bacteria 19166
911 Ga0501045_0011716 3300049824 Bacteria 6161
912 Ga0501045_0016856 3300049824 Bacteria 5189
913 Ga0501045_0021087 3300049824 Bacteria 4659
914 Ga0501045_0039127 3300049824 Bacteria 3451
915 Ga0501045_0076454 3300049824 Bacteria 2467
916 Ga0501045_0105158 3300049824 Bacteria 2092
917 Ga0501045_0114227 3300049824 Bacteria 2002
918 Ga0501045_0316522 3300049824 Bacteria 1161
919 nmdc:mga05p37_116363_c1 3300050507 Bacteria 3285
920 nmdc:mga05p37_137_c1 3300050507 Bacteria 67873
921 nmdc:mga05p37_164023_c1 3300050507 Bacteria 2712
922 nmdc:mga05p37_22094_c1 3300050507 Bacteria 7712
923 nmdc:mga05p37_38175_c1 3300050507 Bacteria 5890
924 nmdc:mga05p37_53903_c1 3300050507 Bacteria 4948
925 nmdc:mga05p37_63292_c1 3300050507 Bacteria 4552
926 nmdc:mga05p37_8710_c1 3300050507 Bacteria 11988
927 nmdc:mga09592_13246_c1 3300050508 Bacteria 6733
928 nmdc:mga09592_258_c1 3300050508 Bacteria 38667
929 nmdc:mga09592_312745_c1 3300050508 Bacteria 1361
930 nmdc:mga09592_58319_c1 3300050508 Bacteria 3264
931 nmdc:mga0qj67_13046_c1 3300050509 Bacteria 6274
932 nmdc:mga0qj67_18450_c1 3300050509 Bacteria 5316
933 nmdc:mga0qj67_218332_c1 3300050509 Bacteria 1548
934 nmdc:mga0qj67_24062_c1 3300050509 Bacteria 4692
935 nmdc:mga06r32_12623_c1 3300050510 Bacteria 7632
936 nmdc:mga06r32_146080_c1 3300050510 Bacteria 2342
937 nmdc:mga06r32_22153_c1 3300050510 Bacteria 5870
938 nmdc:mga06r32_27741_c1 3300050510 Bacteria 5293
939 nmdc:mga06r32_363351_c1 3300050510 Bacteria 1431
940 nmdc:mga06r32_40460_c1 3300050510 Bacteria 4426
941 nmdc:mga08y16_100089_c1 3300050511 Bacteria 3018
942 nmdc:mga08y16_126502_c1 3300050511 Bacteria 2658
943 nmdc:mga08y16_136104_c1 3300050511 Bacteria 2553
944 nmdc:mga08y16_158980_c1 3300050511 Bacteria 2348
945 nmdc:mga08y16_18747_c1 3300050511 Bacteria 7290
946 nmdc:mga08y16_21512_c1 3300050511 Bacteria 6810
947 nmdc:mga08y16_328530_c1 3300050511 Bacteria 1574
948 nmdc:mga08y16_478956_c1 3300050511 Bacteria 1267
949 nmdc:mga08y16_81879_c1 3300050511 Bacteria 3365
950 nmdc:mga0n895_1305_c1 3300050512 Bacteria 18449
951 nmdc:mga0n895_134_c1 3300050512 Bacteria 44336
952 nmdc:mga0n895_1724_c1 3300050512 Bacteria 16524
953 nmdc:mga0n895_178858_c1 3300050512 Bacteria 2152
954 nmdc:mga0n895_218_c1 3300050512 Bacteria 36114
955 nmdc:mga0n895_324947_c1 3300050512 Bacteria 1559
956 nmdc:mga0rr50_121377_c1 3300050513 Bacteria 2080
957 nmdc:mga0rr50_291_c1 3300050513 Bacteria 27216
958 nmdc:mga0rr50_4456_c1 3300050513 Bacteria 8243
959 nmdc:mga0rr50_799_c1 3300050513 Bacteria 16986
960 nmdc:mga08x19_10182_c1 3300050514 Bacteria 5642
961 nmdc:mga08x19_1128_c1 3300050514 Bacteria 16645
962 nmdc:mga08x19_129454_c1 3300050514 Bacteria 1696
963 nmdc:mga08x19_141997_c1 3300050514 Bacteria 1622
964 nmdc:mga08x19_24601_c1 3300050514 Bacteria 3745
965 nmdc:mga08x19_281_c1 3300050514 Bacteria 38370
966 nmdc:mga08x19_46585_c1 3300050514 Bacteria 2773
967 nmdc:mga08x19_6434_c1 3300050514 Bacteria 6956
968 nmdc:mga08x19_70312_c1 3300050514 Bacteria 2280
969 nmdc:mga0a205_115560_c1 3300050515 Bacteria 2582
970 nmdc:mga0a205_1457_c1 3300050515 Bacteria 20176
971 nmdc:mga0a205_390084_c1 3300050515 Bacteria 1257
972 nmdc:mga0a205_48833_c1 3300050515 Bacteria 4085
973 nmdc:mga0a205_5718_c1 3300050515 Bacteria 11205
974 nmdc:mga0a205_601_c1 3300050515 Bacteria 28637
975 nmdc:mga0a205_6732_c1 3300050515 Bacteria 10391
976 Ga0495601_0002885 3300053077 Bacteria 9782
977 Ga0495601_0007232 3300053077 Bacteria 6512
978 Ga0500568_0010731 3300053139 Bacteria 4277
979 Ga0500616_0030834 3300053153 Bacteria 2941
980 Ga0501084_0000260 3300054114 Bacteria 39924
981 Ga0501084_0002574 3300054114 Bacteria 14611
982 Ga0501084_0003695 3300054114 Bacteria 12420
983 Ga0501084_0008499 3300054114 Bacteria 8487
984 Ga0590071_002602 3300059421 Bacteria 4540
985 Ga0590077_001830 3300059426 Bacteria 4728
986 Ga0501082_0001136 3300060353 Bacteria 23513
987 Ga0501082_0002351 3300060353 Bacteria 16565
988 Ga0501082_0008334 3300060353 Bacteria 8941
989 Ga0501082_0013158 3300060353 Bacteria 7114
990 Ga0501082_0069334 3300060353 Bacteria 3035
991 Ga0501082_0077653 3300060353 Bacteria 2863
992 Ga0501082_0081946 3300060353 Bacteria 2784
993 Ga0501082_0086132 3300060353 Bacteria 2710
994 Ga0530510_0000174 3300061734 Bacteria 39084
995 Ga0530510_0000351 3300061734 Bacteria 29770
996 Ga0530510_0001536 3300061734 Bacteria 15567
997 Ga0530510_0019099 3300061734 Bacteria 4861
998 Ga0530510_0024317 3300061734 Bacteria 4321
999 Ga0530510_0090402 3300061734 Bacteria 2233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10425808 Ga0207712_104258082 271
2 iso_pu_bacteria 641228493 641335961 272
3 3300005367 Ga0070667_100336853 Ga0070667_1003368532 274
4 3300005339 Ga0070660_100015860 Ga0070660_1000158604 277
5 3300005355 Ga0070671_100035876 Ga0070671_1000358763 277
6 3300005366 Ga0070659_100001017 Ga0070659_1000010175 277
7 3300005457 Ga0070662_100004111 Ga0070662_1000041114 277
8 3300005539 Ga0068853_100005087 Ga0068853_1000050874 277
9 3300005563 Ga0068855_100045835 Ga0068855_1000458351 277
10 3300005564 Ga0070664_100021164 Ga0070664_1000211643 277
11 3300005614 Ga0068856_100005065 Ga0068856_1000050659 277
12 3300005616 Ga0068852_100025692 Ga0068852_1000256925 277
13 3300005834 Ga0068851_10097611 Ga0068851_100976111 277
14 3300013100 Ga0157373_10009902 Ga0157373_100099024 277
15 3300013102 Ga0157371_10002099 Ga0157371_1000209912 277
16 3300013307 Ga0157372_10002796 Ga0157372_1000279611 277
17 3300025919 Ga0207657_10001461 Ga0207657_1000146115 277
18 3300025931 Ga0207644_10043980 Ga0207644_100439802 277
19 3300025932 Ga0207690_10002569 Ga0207690_100025698 277
20 3300025933 Ga0207706_10000040 Ga0207706_1000004095 277
21 3300025945 Ga0207679_10007077 Ga0207679_100070771 277
22 3300025949 Ga0207667_10016457 Ga0207667_100164576 277
23 3300025981 Ga0207640_10038600 Ga0207640_100386003 277
24 3300026041 Ga0207639_10022909 Ga0207639_100229092 277
25 3300026078 Ga0207702_10084879 Ga0207702_100848793 277
26 3300026142 Ga0207698_10295962 Ga0207698_102959622 277
27 3300048909 Ga0496106_0009674 Ga0496106_0009674_5887_6942 277
28 3300025940 Ga0207691_10071431 Ga0207691_100714313 279
29 3300044712 Ga0453684_0359907 Ga0453684_0359907_14_952 279
30 3300025933 Ga0207706_10158273 Ga0207706_101582732 280
31 3300050510 nmdc:mga06r32_363351_c1 nmdc:mga06r32_363351_c1_467_1399 280
32 3300027665 Ga0209983_1007041 Ga0209983_10070412 281
33 3300031548 Ga0307408_100173265 Ga0307408_1001732652 281
34 3300031731 Ga0307405_10011070 Ga0307405_100110703 281
35 3300031852 Ga0307410_10051952 Ga0307410_100519521 281
36 3300031901 Ga0307406_10014335 Ga0307406_100143356 281
37 3300032002 Ga0307416_100192463 Ga0307416_1001924632 281
38 3300032004 Ga0307414_10038324 Ga0307414_100383243 281
39 3300005457 Ga0070662_100318850 Ga0070662_1003188501 282
40 3300009147 Ga0114129_10300936 Ga0114129_103009362 282
41 3300013104 Ga0157370_10019171 Ga0157370_100191711 283
42 3300025912 Ga0207707_10271143 Ga0207707_102711432 283
43 3300025949 Ga0207667_10439886 Ga0207667_104398861 283
44 3300050511 nmdc:mga08y16_478956_c1 nmdc:mga08y16_478956_c1_331_1242 283
45 3300049742 Ga0501080_0077064 Ga0501080_0077064_2149_3087 285
46 3300025919 Ga0207657_10120581 Ga0207657_101205811 296
47 3300005544 Ga0070686_100049402 Ga0070686_1000494023 297
48 3300027671 Ga0209588_1000012 Ga0209588_100001214 298
49 3300005614 Ga0068856_100069726 Ga0068856_1000697263 300
50 3300009174 Ga0105241_10150284 Ga0105241_101502842 300
51 3300026078 Ga0207702_10122576 Ga0207702_101225762 300
52 3300026142 Ga0207698_10074746 Ga0207698_100747462 300
53 3300035398 Ga0316574_0192804 Ga0316574_0192804_38_1045 300
54 3300013307 Ga0157372_10147435 Ga0157372_101474353 301
55 3300005544 Ga0070686_100013191 Ga0070686_1000131916 302
56 3300005618 Ga0068864_100108838 Ga0068864_1001088383 302
57 3300014325 Ga0163163_10010180 Ga0163163_100101805 302
58 3300046539 Ga0495621_0013645 Ga0495621_0013645_1384_2496 302
59 3300048907 Ga0496104_0013528 Ga0496104_0013528_2358_3470 302
60 3300048912 Ga0496109_0055244 Ga0496109_0055244_2273_3385 302
61 3300048917 Ga0496114_0014237 Ga0496114_0014237_2939_4051 302
62 3300005329 Ga0070683_100003976 Ga0070683_10000397611 303
63 3300005330 Ga0070690_100005120 Ga0070690_1000051206 303
64 3300005333 Ga0070677_10001307 Ga0070677_100013074 303
65 3300005334 Ga0068869_100009966 Ga0068869_1000099666 303
66 3300005338 Ga0068868_100049644 Ga0068868_1000496441 303
67 3300005340 Ga0070689_100188759 Ga0070689_1001887592 303
68 3300005343 Ga0070687_100008251 Ga0070687_1000082513 303
69 3300005347 Ga0070668_100288519 Ga0070668_1002885191 303
70 3300005353 Ga0070669_100063106 Ga0070669_1000631063 303
71 3300005355 Ga0070671_100008298 Ga0070671_1000082988 303
72 3300005365 Ga0070688_100002481 Ga0070688_1000024819 303
73 3300005366 Ga0070659_100021088 Ga0070659_1000210883 303
74 3300005367 Ga0070667_100066127 Ga0070667_1000661273 303
75 3300005438 Ga0070701_10015244 Ga0070701_100152443 303
76 3300005457 Ga0070662_100013160 Ga0070662_1000131605 303
77 3300005466 Ga0070685_10004184 Ga0070685_100041844 303
78 3300005535 Ga0070684_100028247 Ga0070684_1000282473 303
79 3300005543 Ga0070672_100018571 Ga0070672_1000185712 303
80 3300005543 Ga0070672_100022344 Ga0070672_1000223444 303
81 3300005544 Ga0070686_100020266 Ga0070686_1000202663 303
82 3300005548 Ga0070665_100234755 Ga0070665_1002347552 303
83 3300005564 Ga0070664_100021130 Ga0070664_1000211303 303
84 3300005577 Ga0068857_100026226 Ga0068857_1000262265 303
85 3300005618 Ga0068864_100031635 Ga0068864_1000316352 303
86 3300005719 Ga0068861_100006204 Ga0068861_1000062047 303
87 3300005834 Ga0068851_10008679 Ga0068851_100086794 303
88 3300005840 Ga0068870_10051460 Ga0068870_100514602 303
89 3300005842 Ga0068858_100019089 Ga0068858_1000190897 303
90 3300005844 Ga0068862_100018871 Ga0068862_1000188713 303
91 3300006237 Ga0097621_100032120 Ga0097621_1000321202 303
92 3300009094 Ga0111539_10054521 Ga0111539_100545213 303
93 3300009177 Ga0105248_10008760 Ga0105248_100087607 303
94 3300009553 Ga0105249_10050414 Ga0105249_100504144 303
95 3300013105 Ga0157369_10073263 Ga0157369_100732631 303
96 3300013308 Ga0157375_10208708 Ga0157375_102087082 303
97 3300014326 Ga0157380_10087441 Ga0157380_100874413 303
98 3300014745 Ga0157377_10050364 Ga0157377_100503642 303
99 3300014968 Ga0157379_10023755 Ga0157379_100237555 303
100 3300025315 Ga0207697_10001236 Ga0207697_100012369 303
101 3300025321 Ga0207656_10014928 Ga0207656_100149282 303
102 3300025893 Ga0207682_10000591 Ga0207682_1000059110 303
103 3300025903 Ga0207680_10030801 Ga0207680_100308012 303
104 3300025907 Ga0207645_10003041 Ga0207645_1000304110 303
105 3300025908 Ga0207643_10000499 Ga0207643_100004995 303
106 3300025918 Ga0207662_10023040 Ga0207662_100230403 303
107 3300025923 Ga0207681_10046733 Ga0207681_100467333 303
108 3300025925 Ga0207650_10018964 Ga0207650_100189643 303
109 3300025926 Ga0207659_10161775 Ga0207659_101617752 303
110 3300025931 Ga0207644_10025187 Ga0207644_100251874 303
111 3300025931 Ga0207644_10050722 Ga0207644_100507222 303
112 3300025933 Ga0207706_10036204 Ga0207706_100362046 303
113 3300025936 Ga0207670_10019224 Ga0207670_100192244 303
114 3300025940 Ga0207691_10011283 Ga0207691_100112832 303
115 3300025940 Ga0207691_10023496 Ga0207691_100234966 303
116 3300025941 Ga0207711_10032978 Ga0207711_100329785 303
117 3300025941 Ga0207711_10047226 Ga0207711_100472263 303
118 3300025942 Ga0207689_10003002 Ga0207689_1000300212 303
119 3300025944 Ga0207661_10023637 Ga0207661_100236374 303
120 3300025945 Ga0207679_10033663 Ga0207679_100336633 303
121 3300025960 Ga0207651_10039003 Ga0207651_100390032 303
122 3300025981 Ga0207640_10035874 Ga0207640_100358742 303
123 3300025986 Ga0207658_10020441 Ga0207658_100204413 303
124 3300026023 Ga0207677_10036364 Ga0207677_100363643 303
125 3300026035 Ga0207703_10037690 Ga0207703_100376904 303
126 3300026041 Ga0207639_10250317 Ga0207639_102503172 303
127 3300026067 Ga0207678_10005737 Ga0207678_1000573712 303
128 3300026075 Ga0207708_10000874 Ga0207708_100008747 303
129 3300026088 Ga0207641_10061543 Ga0207641_100615432 303
130 3300026089 Ga0207648_10007174 Ga0207648_100071746 303
131 3300026089 Ga0207648_10194084 Ga0207648_101940842 303
132 3300026095 Ga0207676_10153236 Ga0207676_101532362 303
133 3300026116 Ga0207674_10001481 Ga0207674_1000148123 303
134 3300026118 Ga0207675_100006158 Ga0207675_1000061584 303
135 3300026121 Ga0207683_10003852 Ga0207683_100038522 303
136 3300026142 Ga0207698_10093542 Ga0207698_100935422 303
137 3300028379 Ga0268266_10104709 Ga0268266_101047092 303
138 3300028380 Ga0268265_10015330 Ga0268265_100153303 303
139 3300035086 Ga0373934_0000665 Ga0373934_0000665_8873_9910 303
140 3300035089 Ga0373944_0053331 Ga0373944_0053331_71_1069 303
141 3300035113 Ga0373936_0009560 Ga0373936_0009560_1958_2980 303
142 3300035116 Ga0373945_0009999 Ga0373945_0009999_148_1170 303
143 3300035119 Ga0373956_0000018 Ga0373956_0000018_32076_33113 303
144 3300035171 Ga0373946_0011173 Ga0373946_0011173_1948_2946 303
145 3300035172 Ga0373955_0009217 Ga0373955_0009217_3380_4417 303
146 3300035692 Ga0373935_0018030 Ga0373935_0018030_1285_2307 303
147 3300035695 Ga0373927_0147834 Ga0373927_0147834_459_1481 303
148 3300035724 Ga0373933_0000035 Ga0373933_0000035_33921_34958 303
149 3300035725 Ga0373947_0099612 Ga0373947_0099612_342_1340 303
150 3300036401 Ga0373937_0002135 Ga0373937_0002135_3804_4841 303
151 3300036712 Ga0316584_0061119 Ga0316584_0061119_1088_2104 303
152 3300046462 Ga0495651_0000350 Ga0495651_0000350_14952_15989 303
153 3300046473 Ga0495582_0101702 Ga0495582_0101702_480_1478 303
154 3300046475 Ga0495639_0040638 Ga0495639_0040638_656_1678 303
155 3300046517 Ga0495630_0015088 Ga0495630_0015088_4461_5483 303
156 3300046531 Ga0495665_0011370 Ga0495665_0011370_189_1211 303
157 3300046535 Ga0495586_0000714 Ga0495586_0000714_15631_16653 303
158 3300046674 Ga0495588_0029651 Ga0495588_0029651_794_1816 303
159 3300046681 Ga0495647_0000064 Ga0495647_0000064_16703_17725 303
160 3300046683 Ga0495658_0002106 Ga0495658_0002106_3633_4655 303
161 3300048903 Ga0496100_0093665 Ga0496100_0093665_244_1299 303
162 3300048906 Ga0496103_0092145 Ga0496103_0092145_184_1239 303
163 3300048911 Ga0496108_0131271 Ga0496108_0131271_1076_2131 303
164 3300048911 Ga0496108_0291553 Ga0496108_0291553_148_1203 303
165 3300048913 Ga0496110_0082827 Ga0496110_0082827_1753_2808 303
166 3300048914 Ga0496111_0113117 Ga0496111_0113117_55_1110 303
167 3300005336 Ga0070680_100285061 Ga0070680_1002850611 304
168 3300036401 Ga0373937_0037732 Ga0373937_0037732_1268_2323 304
169 3300005341 Ga0070691_10012037 Ga0070691_100120375 305
170 3300005366 Ga0070659_100203622 Ga0070659_1002036222 305
171 3300005439 Ga0070711_100082894 Ga0070711_1000828942 305
172 3300005564 Ga0070664_100084795 Ga0070664_1000847953 305
173 3300005834 Ga0068851_10003974 Ga0068851_100039748 305
174 3300009094 Ga0111539_10095513 Ga0111539_100955134 305
175 3300009545 Ga0105237_10143492 Ga0105237_101434922 305
176 3300013102 Ga0157371_10044656 Ga0157371_100446563 305
177 3300013104 Ga0157370_10039400 Ga0157370_100394004 305
178 3300013307 Ga0157372_10070958 Ga0157372_100709583 305
179 3300021361 Ga0213872_10042638 Ga0213872_100426383 305
180 3300025321 Ga0207656_10020499 Ga0207656_100204992 305
181 3300025906 Ga0207699_10118891 Ga0207699_101188912 305
182 3300025919 Ga0207657_10004800 Ga0207657_100048007 305
183 3300026023 Ga0207677_10081003 Ga0207677_100810032 305
184 3300026067 Ga0207678_10201809 Ga0207678_102018092 305
185 3300026116 Ga0207674_10003155 Ga0207674_100031559 305
186 3300026142 Ga0207698_10372329 Ga0207698_103723291 305
187 3300035398 Ga0316574_0072415 Ga0316574_0072415_509_1531 305
188 3300039438 Ga0436360_0957938 Ga0436360_0957938_999_2090 305
189 3300039447 Ga0436361_0469964 Ga0436361_0469964_1534_2625 305
190 3300048912 Ga0496109_0191294 Ga0496109_0191294_365_1363 305
191 3300048917 Ga0496114_0065149 Ga0496114_0065149_841_1839 305
192 3300050511 nmdc:mga08y16_158980_c1 nmdc:mga08y16_158980_c1_1076_2074 305
193 3300050512 nmdc:mga0n895_324947_c1 nmdc:mga0n895_324947_c1_91_1089 305
194 3300050513 nmdc:mga0rr50_121377_c1 nmdc:mga0rr50_121377_c1_282_1280 305
195 3300009545 Ga0105237_10093576 Ga0105237_100935762 306
196 3300013307 Ga0157372_10086116 Ga0157372_100861162 306
197 3300025929 Ga0207664_10374727 Ga0207664_103747271 306
198 3300025945 Ga0207679_10177424 Ga0207679_101774242 306
199 3300025949 Ga0207667_10415657 Ga0207667_104156571 306
200 3300050514 nmdc:mga08x19_70312_c1 nmdc:mga08x19_70312_c1_464_1471 306
201 3300005436 Ga0070713_100040710 Ga0070713_1000407101 307
202 3300005458 Ga0070681_10119883 Ga0070681_101198833 307
203 3300005578 Ga0068854_100139316 Ga0068854_1001393162 307
204 3300005614 Ga0068856_100046734 Ga0068856_1000467342 307
205 3300009093 Ga0105240_10070494 Ga0105240_100704942 307
206 3300013104 Ga0157370_10033592 Ga0157370_100335922 307
207 3300013307 Ga0157372_10020807 Ga0157372_100208075 307
208 3300025912 Ga0207707_10046103 Ga0207707_100461032 307
209 3300044712 Ga0453684_0000237 Ga0453684_0000237_30389_31432 307
210 3300049574 Ga0501038_0129652 Ga0501038_0129652_852_1883 307
211 3300049575 Ga0501039_0306046 Ga0501039_0306046_10_1041 307
212 3300049576 Ga0501040_0035877 Ga0501040_0035877_2036_3067 307
213 3300049577 Ga0501041_0128945 Ga0501041_0128945_247_1278 307
214 3300049578 Ga0501042_0004086 Ga0501042_0004086_175_1206 307
215 3300049584 Ga0501068_0011077 Ga0501068_0011077_3873_4904 307
216 3300049588 Ga0501072_0027386 Ga0501072_0027386_3247_4278 307
217 3300049591 Ga0501075_0008244 Ga0501075_0008244_77_1108 307
218 3300049592 Ga0501076_0005617 Ga0501076_0005617_2594_3625 307
219 3300049593 Ga0501077_0035602 Ga0501077_0035602_2109_3140 307
220 3300049741 Ga0501079_0004003 Ga0501079_0004003_1904_2935 307
221 3300049742 Ga0501080_0004132 Ga0501080_0004132_401_1432 307
222 3300049744 Ga0501083_0038979 Ga0501083_0038979_707_1738 307
223 3300049824 Ga0501045_0021087 Ga0501045_0021087_1428_2459 307
224 3300054114 Ga0501084_0003695 Ga0501084_0003695_5945_6976 307
225 3300061734 Ga0530510_0024317 Ga0530510_0024317_560_1591 307
226 3300005444 Ga0070694_100029825 Ga0070694_1000298252 308
227 3300005549 Ga0070704_100060738 Ga0070704_1000607383 308
228 3300045051 Ga0451576_0001482 Ga0451576_0001482_37416_38582 308
229 3300005444 Ga0070694_100134597 Ga0070694_1001345972 309
230 3300025926 Ga0207659_10019110 Ga0207659_100191105 309
231 3300026088 Ga0207641_10387955 Ga0207641_103879552 309
232 3300026116 Ga0207674_10064045 Ga0207674_100640453 309
233 3300046557 Ga0495622_0127485 Ga0495622_0127485_67_1098 309
234 3300027360 Ga0209969_1000330 Ga0209969_10003304 310
235 3300027378 Ga0209981_1001876 Ga0209981_10018761 310
236 3300027462 Ga0210000_1000147 Ga0210000_10001474 310
237 3300027543 Ga0209999_1001932 Ga0209999_10019324 310
238 3300027614 Ga0209970_1003429 Ga0209970_10034293 310
239 3300027682 Ga0209971_1001105 Ga0209971_10011057 310
240 3300027876 Ga0209974_10004246 Ga0209974_100042464 310
241 3300003911 JGI25405J52794_10004864 JGI25405J52794_100048642 311
242 3300005355 Ga0070671_100304393 Ga0070671_1003043931 311
243 3300005937 Ga0081455_10000235 Ga0081455_1000023559 311
244 3300006844 Ga0075428_100006527 Ga0075428_1000065279 311
245 3300006844 Ga0075428_100413172 Ga0075428_1004131722 311
246 3300006847 Ga0075431_100146359 Ga0075431_1001463592 311
247 3300006880 Ga0075429_100036912 Ga0075429_1000369123 311
248 3300009094 Ga0111539_10066933 Ga0111539_100669333 311
249 3300009553 Ga0105249_10220964 Ga0105249_102209641 311
250 3300013296 Ga0157374_10420429 Ga0157374_104204292 311
251 3300031548 Ga0307408_100025589 Ga0307408_1000255894 311
252 3300031728 Ga0316578_10086363 Ga0316578_100863632 311
253 3300031824 Ga0307413_10007215 Ga0307413_100072152 311
254 3300031852 Ga0307410_10153245 Ga0307410_101532452 311
255 3300031903 Ga0307407_10216374 Ga0307407_102163742 311
256 3300031911 Ga0307412_10018282 Ga0307412_100182823 311
257 3300031995 Ga0307409_100075555 Ga0307409_1000755552 311
258 3300032002 Ga0307416_100006356 Ga0307416_1000063564 311
259 3300032004 Ga0307414_10139567 Ga0307414_101395672 311
260 3300036647 Ga0316582_0183874 Ga0316582_0183874_244_1308 311
261 3300036712 Ga0316584_0021550 Ga0316584_0021550_3207_4271 311
262 3300049572 Ga0501036_0042851 Ga0501036_0042851_1176_2210 311
263 3300049572 Ga0501036_0271103 Ga0501036_0271103_14_1093 311
264 3300049575 Ga0501039_0110234 Ga0501039_0110234_996_2030 311
265 3300049576 Ga0501040_0227533 Ga0501040_0227533_155_1189 311
266 3300049578 Ga0501042_0115461 Ga0501042_0115461_164_1198 311
267 3300049582 Ga0501048_0142436 Ga0501048_0142436_588_1622 311
268 3300049591 Ga0501075_0112404 Ga0501075_0112404_942_1976 311
269 3300049592 Ga0501076_0087928 Ga0501076_0087928_465_1544 311
270 3300049741 Ga0501079_0278371 Ga0501079_0278371_191_1225 311
271 3300049824 Ga0501045_0114227 Ga0501045_0114227_56_1090 311
272 3300050507 nmdc:mga05p37_53903_c1 nmdc:mga05p37_53903_c1_3696_4721 311
273 3300050508 nmdc:mga09592_58319_c1 nmdc:mga09592_58319_c1_687_1772 311
274 3300050510 nmdc:mga06r32_12623_c1 nmdc:mga06r32_12623_c1_771_1799 311
275 3300050510 nmdc:mga06r32_146080_c1 nmdc:mga06r32_146080_c1_135_1157 311
276 3300050511 nmdc:mga08y16_100089_c1 nmdc:mga08y16_100089_c1_1240_2271 311
277 3300060353 Ga0501082_0081946 Ga0501082_0081946_1063_2097 311
278 3300061734 Ga0530510_0019099 Ga0530510_0019099_2667_3701 311
279 iso_pu_bacteria 643348555 643389766 311
280 3300005290 Ga0065712_10000192 Ga0065712_1000019228 312
281 3300005293 Ga0065715_10000385 Ga0065715_100003855 312
282 3300005295 Ga0065707_10000602 Ga0065707_100006028 312
283 3300005327 Ga0070658_10188952 Ga0070658_101889522 312
284 3300005328 Ga0070676_10013414 Ga0070676_100134142 312
285 3300005329 Ga0070683_100064417 Ga0070683_1000644173 312
286 3300005330 Ga0070690_100023712 Ga0070690_1000237123 312
287 3300005331 Ga0070670_100010770 Ga0070670_1000107705 312
288 3300005331 Ga0070670_100025655 Ga0070670_1000256555 312
289 3300005335 Ga0070666_10129335 Ga0070666_101293352 312
290 3300005336 Ga0070680_100021809 Ga0070680_1000218093 312
291 3300005337 Ga0070682_100013004 Ga0070682_1000130043 312
292 3300005340 Ga0070689_100082369 Ga0070689_1000823692 312
293 3300005341 Ga0070691_10016272 Ga0070691_100162722 312
294 3300005344 Ga0070661_100005648 Ga0070661_1000056483 312
295 3300005344 Ga0070661_100053601 Ga0070661_1000536013 312
296 3300005347 Ga0070668_100060433 Ga0070668_1000604331 312
297 3300005347 Ga0070668_100124210 Ga0070668_1001242103 312
298 3300005353 Ga0070669_100055174 Ga0070669_1000551742 312
299 3300005354 Ga0070675_100000071 Ga0070675_1000000713 312
300 3300005355 Ga0070671_100008154 Ga0070671_1000081545 312
301 3300005364 Ga0070673_100027794 Ga0070673_1000277941 312
302 3300005444 Ga0070694_100120168 Ga0070694_1001201682 312
303 3300005456 Ga0070678_100036062 Ga0070678_1000360624 312
304 3300005457 Ga0070662_100084726 Ga0070662_1000847262 312
305 3300005535 Ga0070684_100202092 Ga0070684_1002020922 312
306 3300005543 Ga0070672_100114944 Ga0070672_1001149442 312
307 3300005546 Ga0070696_100012727 Ga0070696_1000127272 312
308 3300005549 Ga0070704_100020456 Ga0070704_1000204561 312
309 3300005564 Ga0070664_100017510 Ga0070664_1000175103 312
310 3300005614 Ga0068856_100004397 Ga0068856_1000043975 312
311 3300005616 Ga0068852_100002993 Ga0068852_1000029939 312
312 3300005719 Ga0068861_100286089 Ga0068861_1002860892 312
313 3300005841 Ga0068863_100061998 Ga0068863_1000619984 312
314 3300006847 Ga0075431_100025953 Ga0075431_1000259535 312
315 3300006847 Ga0075431_100031001 Ga0075431_1000310014 312
316 3300006852 Ga0075433_10279580 Ga0075433_102795801 312
317 3300006871 Ga0075434_100009247 Ga0075434_1000092475 312
318 3300006880 Ga0075429_100027878 Ga0075429_1000278782 312
319 3300006914 Ga0075436_100013290 Ga0075436_1000132905 312
320 3300007076 Ga0075435_100015103 Ga0075435_1000151035 312
321 3300007788 Ga0099795_10022451 Ga0099795_100224512 312
322 3300009094 Ga0111539_10102152 Ga0111539_101021523 312
323 3300009094 Ga0111539_10104229 Ga0111539_101042292 312
324 3300009147 Ga0114129_10004111 Ga0114129_1000411114 312
325 3300009147 Ga0114129_10063467 Ga0114129_100634674 312
326 3300009147 Ga0114129_10159021 Ga0114129_101590213 312
327 3300009148 Ga0105243_10262958 Ga0105243_102629582 312
328 3300009174 Ga0105241_10016620 Ga0105241_100166205 312
329 3300009553 Ga0105249_10031634 Ga0105249_100316345 312
330 3300010159 Ga0099796_10006814 Ga0099796_100068144 312
331 3300011119 Ga0105246_10004229 Ga0105246_100042293 312
332 3300013296 Ga0157374_10011166 Ga0157374_100111664 312
333 3300013296 Ga0157374_10024259 Ga0157374_100242594 312
334 3300013297 Ga0157378_10076259 Ga0157378_100762594 312
335 3300013306 Ga0163162_10016190 Ga0163162_100161909 312
336 3300013306 Ga0163162_10035127 Ga0163162_100351276 312
337 3300013308 Ga0157375_10218469 Ga0157375_102184692 312
338 3300014325 Ga0163163_10387937 Ga0163163_103879372 312
339 3300014968 Ga0157379_10109497 Ga0157379_101094973 312
340 3300014969 Ga0157376_10006851 Ga0157376_100068518 312
341 3300025315 Ga0207697_10005837 Ga0207697_100058374 312
342 3300025315 Ga0207697_10062256 Ga0207697_100622562 312
343 3300025321 Ga0207656_10019839 Ga0207656_100198392 312
344 3300025903 Ga0207680_10164001 Ga0207680_101640012 312
345 3300025907 Ga0207645_10002628 Ga0207645_100026283 312
346 3300025909 Ga0207705_10148010 Ga0207705_101480102 312
347 3300025912 Ga0207707_10005874 Ga0207707_100058746 312
348 3300025919 Ga0207657_10004830 Ga0207657_1000483014 312
349 3300025920 Ga0207649_10004780 Ga0207649_100047807 312
350 3300025920 Ga0207649_10127255 Ga0207649_101272552 312
351 3300025921 Ga0207652_10015335 Ga0207652_100153354 312
352 3300025923 Ga0207681_10034101 Ga0207681_100341013 312
353 3300025925 Ga0207650_10025714 Ga0207650_100257145 312
354 3300025931 Ga0207644_10200593 Ga0207644_102005932 312
355 3300025933 Ga0207706_10002512 Ga0207706_100025128 312
356 3300025933 Ga0207706_10073637 Ga0207706_100736372 312
357 3300025933 Ga0207706_10099342 Ga0207706_100993422 312
358 3300025940 Ga0207691_10002892 Ga0207691_1000289212 312
359 3300025944 Ga0207661_10046948 Ga0207661_100469483 312
360 3300025945 Ga0207679_10010729 Ga0207679_100107293 312
361 3300025945 Ga0207679_10179301 Ga0207679_101793011 312
362 3300025960 Ga0207651_10032603 Ga0207651_100326033 312
363 3300025960 Ga0207651_10271649 Ga0207651_102716491 312
364 3300025981 Ga0207640_10031905 Ga0207640_100319052 312
365 3300026035 Ga0207703_10115623 Ga0207703_101156232 312
366 3300026075 Ga0207708_10119162 Ga0207708_101191622 312
367 3300026088 Ga0207641_10102622 Ga0207641_101026223 312
368 3300026121 Ga0207683_10000495 Ga0207683_1000049525 312
369 3300026121 Ga0207683_10080683 Ga0207683_100806835 312
370 3300026142 Ga0207698_10007657 Ga0207698_100076577 312
371 3300027876 Ga0209974_10000361 Ga0209974_100003616 312
372 3300028381 Ga0268264_10528131 Ga0268264_105281311 312
373 3300035691 Ga0373931_0045669 Ga0373931_0045669_825_1865 312
374 3300035692 Ga0373935_0020582 Ga0373935_0020582_1488_2528 312
375 3300042437 Ga0439444_0007833 Ga0439444_0007833_21_1058 312
376 3300042876 Ga0451577_0000198 Ga0451577_0000198_50672_51706 312
377 3300042876 Ga0451577_0005723 Ga0451577_0005723_3289_4323 312
378 3300042876 Ga0451577_0019539 Ga0451577_0019539_2305_3339 312
379 3300042876 Ga0451577_0026224 Ga0451577_0026224_2713_3747 312
380 3300042876 Ga0451577_0116022 Ga0451577_0116022_478_1512 312
381 3300042876 Ga0451577_0151938 Ga0451577_0151938_856_1893 312
382 3300042876 Ga0451577_0273658 Ga0451577_0273658_20_1057 312
383 3300044673 Ga0453683_0000297 Ga0453683_0000297_46400_47434 312
384 3300044673 Ga0453683_0000327 Ga0453683_0000327_9060_10094 312
385 3300044673 Ga0453683_0006691 Ga0453683_0006691_5644_6678 312
386 3300044673 Ga0453683_0009683 Ga0453683_0009683_3295_4329 312
387 3300044673 Ga0453683_0017269 Ga0453683_0017269_2678_3715 312
388 3300044673 Ga0453683_0019936 Ga0453683_0019936_1014_2048 312
389 3300044712 Ga0453684_0000654 Ga0453684_0000654_48984_50018 312
390 3300044712 Ga0453684_0003313 Ga0453684_0003313_14622_15656 312
391 3300044712 Ga0453684_0003721 Ga0453684_0003721_6683_7720 312
392 3300044712 Ga0453684_0006018 Ga0453684_0006018_20931_21968 312
393 3300044712 Ga0453684_0006774 Ga0453684_0006774_7911_8948 312
394 3300044712 Ga0453684_0049307 Ga0453684_0049307_4494_5531 312
395 3300044712 Ga0453684_0052107 Ga0453684_0052107_175_1212 312
396 3300044712 Ga0453684_0055351 Ga0453684_0055351_1881_2915 312
397 3300044712 Ga0453684_0116990 Ga0453684_0116990_1048_2082 312
398 3300044712 Ga0453684_0119048 Ga0453684_0119048_1194_2231 312
399 3300044712 Ga0453684_0169758 Ga0453684_0169758_1199_2236 312
400 3300045051 Ga0451576_0002911 Ga0451576_0002911_16218_17252 312
401 3300045051 Ga0451576_0003917 Ga0451576_0003917_7151_8185 312
402 3300045051 Ga0451576_0032170 Ga0451576_0032170_1597_2634 312
403 3300045051 Ga0451576_0168532 Ga0451576_0168532_872_1906 312
404 3300045051 Ga0451576_0219477 Ga0451576_0219477_936_1955 312
405 3300045051 Ga0451576_0241404 Ga0451576_0241404_838_1875 312
406 3300045051 Ga0451576_0361155 Ga0451576_0361155_244_1281 312
407 3300046535 Ga0495586_0139818 Ga0495586_0139818_154_1194 312
408 3300046681 Ga0495647_0070227 Ga0495647_0070227_164_1204 312
409 3300048905 Ga0496102_0398117 Ga0496102_0398117_77_1117 312
410 3300048912 Ga0496109_0010599 Ga0496109_0010599_2860_3879 312
411 3300048914 Ga0496111_0041992 Ga0496111_0041992_617_1636 312
412 3300049568 Ga0501031_0025095 Ga0501031_0025095_2730_3764 312
413 3300049569 Ga0501032_0016039 Ga0501032_0016039_2123_3157 312
414 3300049570 Ga0501033_0106304 Ga0501033_0106304_219_1253 312
415 3300049573 Ga0501037_0003621 Ga0501037_0003621_6114_7148 312
416 3300049574 Ga0501038_0088306 Ga0501038_0088306_220_1254 312
417 3300049575 Ga0501039_0124217 Ga0501039_0124217_423_1460 312
418 3300049575 Ga0501039_0185917 Ga0501039_0185917_305_1342 312
419 3300049576 Ga0501040_0069915 Ga0501040_0069915_472_1509 312
420 3300049577 Ga0501041_0020768 Ga0501041_0020768_2676_3713 312
421 3300049577 Ga0501041_0030752 Ga0501041_0030752_665_1699 312
422 3300049580 Ga0501046_0036565 Ga0501046_0036565_1349_2383 312
423 3300049580 Ga0501046_0257403 Ga0501046_0257403_28_1065 312
424 3300049582 Ga0501048_0005713 Ga0501048_0005713_1815_2849 312
425 3300049585 Ga0501069_0002389 Ga0501069_0002389_2446_3480 312
426 3300049586 Ga0501070_0022126 Ga0501070_0022126_3795_4829 312
427 3300049587 Ga0501071_0038552 Ga0501071_0038552_620_1657 312
428 3300049588 Ga0501072_0073475 Ga0501072_0073475_926_1963 312
429 3300049590 Ga0501074_0071627 Ga0501074_0071627_184_1218 312
430 3300049591 Ga0501075_0017277 Ga0501075_0017277_1901_2938 312
431 3300049591 Ga0501075_0060838 Ga0501075_0060838_874_1911 312
432 3300049591 Ga0501075_0336494 Ga0501075_0336494_39_1073 312
433 3300049592 Ga0501076_0007862 Ga0501076_0007862_743_1780 312
434 3300049592 Ga0501076_0093686 Ga0501076_0093686_791_1825 312
435 3300049741 Ga0501079_0047754 Ga0501079_0047754_2228_3265 312
436 3300049741 Ga0501079_0170952 Ga0501079_0170952_441_1475 312
437 3300049742 Ga0501080_0085167 Ga0501080_0085167_1548_2585 312
438 3300049743 Ga0501081_0190389 Ga0501081_0190389_11_1045 312
439 3300049822 Ga0501035_0055328 Ga0501035_0055328_2068_3102 312
440 3300049823 Ga0501044_0011394 Ga0501044_0011394_6217_7251 312
441 3300049824 Ga0501045_0076454 Ga0501045_0076454_731_1768 312
442 3300050507 nmdc:mga05p37_63292_c1 nmdc:mga05p37_63292_c1_2328_3368 312
443 3300050507 nmdc:mga05p37_8710_c1 nmdc:mga05p37_8710_c1_3904_4944 312
444 3300050510 nmdc:mga06r32_22153_c1 nmdc:mga06r32_22153_c1_4229_5269 312
445 3300050510 nmdc:mga06r32_40460_c1 nmdc:mga06r32_40460_c1_2818_3855 312
446 3300050511 nmdc:mga08y16_126502_c1 nmdc:mga08y16_126502_c1_1260_2300 312
447 3300050511 nmdc:mga08y16_136104_c1 nmdc:mga08y16_136104_c1_272_1312 312
448 3300050512 nmdc:mga0n895_1305_c1 nmdc:mga0n895_1305_c1_12758_13798 312
449 3300050512 nmdc:mga0n895_178858_c1 nmdc:mga0n895_178858_c1_672_1712 312
450 3300050512 nmdc:mga0n895_218_c1 nmdc:mga0n895_218_c1_10410_11450 312
451 3300050513 nmdc:mga0rr50_4456_c1 nmdc:mga0rr50_4456_c1_660_1700 312
452 3300050513 nmdc:mga0rr50_799_c1 nmdc:mga0rr50_799_c1_4212_5252 312
453 3300050514 nmdc:mga08x19_10182_c1 nmdc:mga08x19_10182_c1_2974_4014 312
454 3300050514 nmdc:mga08x19_129454_c1 nmdc:mga08x19_129454_c1_438_1478 312
455 3300050514 nmdc:mga08x19_141997_c1 nmdc:mga08x19_141997_c1_569_1609 312
456 3300050514 nmdc:mga08x19_46585_c1 nmdc:mga08x19_46585_c1_204_1244 312
457 3300050515 nmdc:mga0a205_115560_c1 nmdc:mga0a205_115560_c1_436_1476 312
458 3300050515 nmdc:mga0a205_5718_c1 nmdc:mga0a205_5718_c1_9802_10842 312
459 3300050515 nmdc:mga0a205_6732_c1 nmdc:mga0a205_6732_c1_169_1209 312
460 3300053139 Ga0500568_0010731 Ga0500568_0010731_2426_3457 312
461 3300053153 Ga0500616_0030834 Ga0500616_0030834_585_1613 312
462 3300060353 Ga0501082_0069334 Ga0501082_0069334_791_1825 312
463 3300060353 Ga0501082_0077653 Ga0501082_0077653_1127_2164 312
464 3300061734 Ga0530510_0090402 Ga0530510_0090402_534_1571 312
465 3300005295 Ga0065707_10095781 Ga0065707_100957811 313
466 3300005330 Ga0070690_100145933 Ga0070690_1001459331 313
467 3300005334 Ga0068869_100135380 Ga0068869_1001353802 313
468 3300005364 Ga0070673_100121157 Ga0070673_1001211572 313
469 3300005458 Ga0070681_10024123 Ga0070681_100241231 313
470 3300005530 Ga0070679_100026411 Ga0070679_1000264112 313
471 3300005544 Ga0070686_100188780 Ga0070686_1001887802 313
472 3300005719 Ga0068861_100085033 Ga0068861_1000850333 313
473 3300005841 Ga0068863_100182880 Ga0068863_1001828802 313
474 3300005937 Ga0081455_10081050 Ga0081455_100810502 313
475 3300005981 Ga0081538_10005747 Ga0081538_100057474 313
476 3300006846 Ga0075430_100031706 Ga0075430_1000317062 313
477 3300006852 Ga0075433_10007284 Ga0075433_100072841 313
478 3300006852 Ga0075433_10156071 Ga0075433_101560712 313
479 3300009094 Ga0111539_10101073 Ga0111539_101010732 313
480 3300009094 Ga0111539_10281188 Ga0111539_102811882 313
481 3300009147 Ga0114129_10012098 Ga0114129_100120988 313
482 3300009147 Ga0114129_10013997 Ga0114129_100139975 313
483 3300009147 Ga0114129_10025255 Ga0114129_100252553 313
484 3300009147 Ga0114129_10031678 Ga0114129_100316785 313
485 3300013297 Ga0157378_10053762 Ga0157378_100537624 313
486 3300025903 Ga0207680_10097531 Ga0207680_100975312 313
487 3300025908 Ga0207643_10014374 Ga0207643_100143744 313
488 3300025912 Ga0207707_10007548 Ga0207707_100075485 313
489 3300025926 Ga0207659_10211293 Ga0207659_102112932 313
490 3300031548 Ga0307408_100003702 Ga0307408_1000037023 313
491 3300032002 Ga0307416_100007756 Ga0307416_1000077563 313
492 3300042436 Ga0439435_0030399 Ga0439435_0030399_258_1313 313
493 3300044673 Ga0453683_0000574 Ga0453683_0000574_17957_19000 313
494 3300049568 Ga0501031_0056734 Ga0501031_0056734_1020_2060 313
495 3300049570 Ga0501033_0078581 Ga0501033_0078581_526_1566 313
496 3300049572 Ga0501036_0006006 Ga0501036_0006006_927_1967 313
497 3300049574 Ga0501038_0000918 Ga0501038_0000918_10233_11273 313
498 3300049575 Ga0501039_0000984 Ga0501039_0000984_11266_12306 313
499 3300049576 Ga0501040_0000676 Ga0501040_0000676_8044_9084 313
500 3300049577 Ga0501041_0001447 Ga0501041_0001447_5368_6408 313
501 3300049578 Ga0501042_0000461 Ga0501042_0000461_11384_12424 313
502 3300049579 Ga0501043_0017213 Ga0501043_0017213_1531_2571 313
503 3300049582 Ga0501048_0005913 Ga0501048_0005913_3406_4446 313
504 3300049584 Ga0501068_0003519 Ga0501068_0003519_6590_7630 313
505 3300049587 Ga0501071_0000524 Ga0501071_0000524_11896_12936 313
506 3300049588 Ga0501072_0000692 Ga0501072_0000692_11395_12435 313
507 3300049589 Ga0501073_0106348 Ga0501073_0106348_814_1854 313
508 3300049590 Ga0501074_0006840 Ga0501074_0006840_1222_2262 313
509 3300049591 Ga0501075_0000632 Ga0501075_0000632_8486_9526 313
510 3300049592 Ga0501076_0000904 Ga0501076_0000904_10314_11354 313
511 3300049593 Ga0501077_0000582 Ga0501077_0000582_9527_10567 313
512 3300049741 Ga0501079_0000722 Ga0501079_0000722_9646_10686 313
513 3300049742 Ga0501080_0006087 Ga0501080_0006087_1634_2674 313
514 3300049743 Ga0501081_0000911 Ga0501081_0000911_9502_10542 313
515 3300049744 Ga0501083_0036573 Ga0501083_0036573_1589_2629 313
516 3300049822 Ga0501035_0028508 Ga0501035_0028508_3613_4653 313
517 3300049824 Ga0501045_0000924 Ga0501045_0000924_6225_7265 313
518 3300050507 nmdc:mga05p37_22094_c1 nmdc:mga05p37_22094_c1_1324_2367 313
519 3300050507 nmdc:mga05p37_38175_c1 nmdc:mga05p37_38175_c1_391_1434 313
520 3300050511 nmdc:mga08y16_21512_c1 nmdc:mga08y16_21512_c1_2261_3265 313
521 3300050511 nmdc:mga08y16_81879_c1 nmdc:mga08y16_81879_c1_529_1566 313
522 3300050515 nmdc:mga0a205_1457_c1 nmdc:mga0a205_1457_c1_11485_12528 313
523 3300054114 Ga0501084_0002574 Ga0501084_0002574_7119_8159 313
524 3300059421 Ga0590071_002602 Ga0590071_002602_3184_4272 313
525 3300059426 Ga0590077_001830 Ga0590077_001830_352_1440 313
526 3300060353 Ga0501082_0002351 Ga0501082_0002351_8887_9927 313
527 3300061734 Ga0530510_0001536 Ga0530510_0001536_9298_10338 313
528 3300005295 Ga0065707_10014078 Ga0065707_100140782 314
529 3300005330 Ga0070690_100000182 Ga0070690_10000018222 314
530 3300005334 Ga0068869_100000785 Ga0068869_1000007852 314
531 3300005336 Ga0070680_100001823 Ga0070680_1000018235 314
532 3300005337 Ga0070682_100013879 Ga0070682_1000138795 314
533 3300005338 Ga0068868_100000782 Ga0068868_1000007827 314
534 3300005340 Ga0070689_100000521 Ga0070689_10000052119 314
535 3300005341 Ga0070691_10002091 Ga0070691_100020912 314
536 3300005343 Ga0070687_100000050 Ga0070687_10000005022 314
537 3300005345 Ga0070692_10003200 Ga0070692_100032003 314
538 3300005353 Ga0070669_100009604 Ga0070669_1000096042 314
539 3300005355 Ga0070671_100139576 Ga0070671_1001395761 314
540 3300005438 Ga0070701_10000918 Ga0070701_1000091813 314
541 3300005440 Ga0070705_100000752 Ga0070705_1000007522 314
542 3300005441 Ga0070700_100010913 Ga0070700_1000109133 314
543 3300005441 Ga0070700_100094000 Ga0070700_1000940002 314
544 3300005444 Ga0070694_100000128 Ga0070694_10000012820 314
545 3300005459 Ga0068867_100000411 Ga0068867_10000041124 314
546 3300005459 Ga0068867_100000511 Ga0068867_10000051115 314
547 3300005467 Ga0070706_100000049 Ga0070706_10000004971 314
548 3300005468 Ga0070707_100005499 Ga0070707_1000054998 314
549 3300005471 Ga0070698_100286410 Ga0070698_1002864102 314
550 3300005530 Ga0070679_100002560 Ga0070679_10000256014 314
551 3300005543 Ga0070672_100206875 Ga0070672_1002068752 314
552 3300005544 Ga0070686_100000107 Ga0070686_10000010752 314
553 3300005545 Ga0070695_100000172 Ga0070695_10000017214 314
554 3300005546 Ga0070696_100003396 Ga0070696_1000033962 314
555 3300005547 Ga0070693_100000078 Ga0070693_10000007815 314
556 3300005549 Ga0070704_100000256 Ga0070704_10000025622 314
557 3300005563 Ga0068855_100004148 Ga0068855_10000414816 314
558 3300005563 Ga0068855_100441711 Ga0068855_1004417112 314
559 3300005614 Ga0068856_100184111 Ga0068856_1001841113 314
560 3300005615 Ga0070702_100000048 Ga0070702_10000004814 314
561 3300005617 Ga0068859_100000873 Ga0068859_10000087321 314
562 3300005617 Ga0068859_100390752 Ga0068859_1003907522 314
563 3300005618 Ga0068864_100292689 Ga0068864_1002926892 314
564 3300005718 Ga0068866_10022435 Ga0068866_100224354 314
565 3300005719 Ga0068861_100000373 Ga0068861_10000037316 314
566 3300005719 Ga0068861_100005597 Ga0068861_1000055978 314
567 3300005842 Ga0068858_100000324 Ga0068858_10000032433 314
568 3300005842 Ga0068858_100062343 Ga0068858_1000623433 314
569 3300005843 Ga0068860_100000687 Ga0068860_10000068720 314
570 3300005844 Ga0068862_100000430 Ga0068862_10000043022 314
571 3300005844 Ga0068862_100166029 Ga0068862_1001660292 314
572 3300005985 Ga0081539_10017313 Ga0081539_100173136 314
573 3300006237 Ga0097621_100000180 Ga0097621_10000018029 314
574 3300006358 Ga0068871_100006394 Ga0068871_10000639412 314
575 3300006844 Ga0075428_100002149 Ga0075428_1000021494 314
576 3300006844 Ga0075428_100042960 Ga0075428_1000429603 314
577 3300006844 Ga0075428_100149383 Ga0075428_1001493832 314
578 3300006846 Ga0075430_100006463 Ga0075430_10000646310 314
579 3300006847 Ga0075431_100056793 Ga0075431_1000567933 314
580 3300006852 Ga0075433_10002531 Ga0075433_100025314 314
581 3300006852 Ga0075433_10377353 Ga0075433_103773532 314
582 3300006871 Ga0075434_100000204 Ga0075434_10000020427 314
583 3300006871 Ga0075434_100008705 Ga0075434_1000087056 314
584 3300006880 Ga0075429_100000208 Ga0075429_1000002089 314
585 3300006880 Ga0075429_100032477 Ga0075429_1000324773 314
586 3300006881 Ga0068865_100000148 Ga0068865_10000014820 314
587 3300006881 Ga0068865_100023180 Ga0068865_1000231804 314
588 3300006881 Ga0068865_100189197 Ga0068865_1001891971 314
589 3300006914 Ga0075436_100000422 Ga0075436_1000004226 314
590 3300006931 Ga0097620_100000874 Ga0097620_10000087414 314
591 3300006931 Ga0097620_100390762 Ga0097620_1003907622 314
592 3300007076 Ga0075435_100002321 Ga0075435_1000023217 314
593 3300007265 Ga0099794_10000009 Ga0099794_1000000910 314
594 3300009094 Ga0111539_10044518 Ga0111539_100445185 314
595 3300009094 Ga0111539_10278054 Ga0111539_102780541 314
596 3300009098 Ga0105245_10000429 Ga0105245_1000042921 314
597 3300009147 Ga0114129_10000140 Ga0114129_1000014028 314
598 3300009148 Ga0105243_10010939 Ga0105243_100109395 314
599 3300009148 Ga0105243_10053140 Ga0105243_100531404 314
600 3300009176 Ga0105242_10002750 Ga0105242_100027505 314
601 3300009553 Ga0105249_10003569 Ga0105249_100035695 314
602 3300009553 Ga0105249_10059940 Ga0105249_100599404 314
603 3300010375 Ga0105239_10042407 Ga0105239_100424075 314
604 3300013297 Ga0157378_10000513 Ga0157378_1000051322 314
605 3300014326 Ga0157380_10096710 Ga0157380_100967104 314
606 3300014326 Ga0157380_10160607 Ga0157380_101606072 314
607 3300014326 Ga0157380_10279869 Ga0157380_102798692 314
608 3300014745 Ga0157377_10078653 Ga0157377_100786532 314
609 3300014968 Ga0157379_10164364 Ga0157379_101643642 314
610 3300014969 Ga0157376_10042371 Ga0157376_100423712 314
611 3300025885 Ga0207653_10020696 Ga0207653_100206961 314
612 3300025899 Ga0207642_10000571 Ga0207642_1000057113 314
613 3300025908 Ga0207643_10017637 Ga0207643_100176373 314
614 3300025910 Ga0207684_10000011 Ga0207684_10000011153 314
615 3300025911 Ga0207654_10068443 Ga0207654_100684432 314
616 3300025917 Ga0207660_10037128 Ga0207660_100371284 314
617 3300025917 Ga0207660_10037879 Ga0207660_100378794 314
618 3300025918 Ga0207662_10000165 Ga0207662_1000016516 314
619 3300025921 Ga0207652_10005474 Ga0207652_1000547410 314
620 3300025923 Ga0207681_10004257 Ga0207681_100042579 314
621 3300025927 Ga0207687_10004557 Ga0207687_100045576 314
622 3300025931 Ga0207644_10196913 Ga0207644_101969131 314
623 3300025934 Ga0207686_10002408 Ga0207686_100024084 314
624 3300025935 Ga0207709_10006187 Ga0207709_100061875 314
625 3300025935 Ga0207709_10039123 Ga0207709_100391234 314
626 3300025938 Ga0207704_10000191 Ga0207704_1000019114 314
627 3300025938 Ga0207704_10000578 Ga0207704_100005784 314
628 3300025939 Ga0207665_10059228 Ga0207665_100592282 314
629 3300025940 Ga0207691_10072372 Ga0207691_100723722 314
630 3300025942 Ga0207689_10000475 Ga0207689_1000047522 314
631 3300025942 Ga0207689_10016138 Ga0207689_100161385 314
632 3300025942 Ga0207689_10055979 Ga0207689_100559793 314
633 3300025949 Ga0207667_10025236 Ga0207667_100252365 314
634 3300025961 Ga0207712_10211564 Ga0207712_102115642 314
635 3300026023 Ga0207677_10009984 Ga0207677_100099847 314
636 3300026035 Ga0207703_10001336 Ga0207703_100013367 314
637 3300026035 Ga0207703_10078016 Ga0207703_100780163 314
638 3300026075 Ga0207708_10000465 Ga0207708_1000046519 314
639 3300026078 Ga0207702_10211194 Ga0207702_102111942 314
640 3300026088 Ga0207641_10209669 Ga0207641_102096692 314
641 3300026088 Ga0207641_10440816 Ga0207641_104408161 314
642 3300026089 Ga0207648_10000171 Ga0207648_1000017122 314
643 3300026089 Ga0207648_10000711 Ga0207648_1000071118 314
644 3300026095 Ga0207676_10282200 Ga0207676_102822002 314
645 3300026118 Ga0207675_100000321 Ga0207675_10000032114 314
646 3300026118 Ga0207675_100013607 Ga0207675_1000136074 314
647 3300026118 Ga0207675_100138421 Ga0207675_1001384213 314
648 3300027682 Ga0209971_1021721 Ga0209971_10217212 314
649 3300027695 Ga0209966_1002806 Ga0209966_10028063 314
650 3300027907 Ga0207428_10005465 Ga0207428_1000546514 314
651 3300028380 Ga0268265_10000628 Ga0268265_100006284 314
652 3300028380 Ga0268265_10000632 Ga0268265_1000063221 314
653 3300028380 Ga0268265_10347951 Ga0268265_103479512 314
654 3300028381 Ga0268264_10000745 Ga0268264_1000074539 314
655 3300028381 Ga0268264_10041569 Ga0268264_100415692 314
656 3300034816 Ga0373930_0002774 Ga0373930_0002774_20_1027 314
657 3300034957 Ga0373938_0014320 Ga0373938_0014320_239_1270 314
658 3300035085 Ga0373929_0002976 Ga0373929_0002976_1651_2682 314
659 3300035092 Ga0373952_0008361 Ga0373952_0008361_940_1944 314
660 3300035111 Ga0373923_0031043 Ga0373923_0031043_942_1964 314
661 3300035114 Ga0373939_0002617 Ga0373939_0002617_2247_3254 314
662 3300035114 Ga0373939_0037568 Ga0373939_0037568_70_1074 314
663 3300035121 Ga0373960_0004502 Ga0373960_0004502_1530_2561 314
664 3300035121 Ga0373960_0033058 Ga0373960_0033058_363_1409 314
665 3300035207 Ga0373942_0011370 Ga0373942_0011370_215_1219 314
666 3300035241 Ga0373961_0003067 Ga0373961_0003067_1313_2344 314
667 3300035242 Ga0373962_0016319 Ga0373962_0016319_647_1654 314
668 3300035691 Ga0373931_0000773 Ga0373931_0000773_261_1292 314
669 3300042436 Ga0439435_0000410 Ga0439435_0000410_5403_6398 314
670 3300045051 Ga0451576_0002358 Ga0451576_0002358_13026_14024 314
671 3300045051 Ga0451576_0005086 Ga0451576_0005086_7838_8869 314
672 3300046674 Ga0495588_0125924 Ga0495588_0125924_203_1240 314
673 3300047318 Ga0495636_0017142 Ga0495636_0017142_243_1280 314
674 3300049568 Ga0501031_0003010 Ga0501031_0003010_7346_8341 314
675 3300049569 Ga0501032_0025946 Ga0501032_0025946_2582_3577 314
676 3300049572 Ga0501036_0000184 Ga0501036_0000184_18286_19281 314
677 3300049573 Ga0501037_0013481 Ga0501037_0013481_4742_5737 314
678 3300049574 Ga0501038_0012407 Ga0501038_0012407_1891_2886 314
679 3300049575 Ga0501039_0000053 Ga0501039_0000053_52382_53377 314
680 3300049576 Ga0501040_0001174 Ga0501040_0001174_14812_15807 314
681 3300049577 Ga0501041_0000118 Ga0501041_0000118_18596_19591 314
682 3300049578 Ga0501042_0000120 Ga0501042_0000120_13003_13998 314
683 3300049580 Ga0501046_0000144 Ga0501046_0000144_4745_5740 314
684 3300049580 Ga0501046_0058443 Ga0501046_0058443_1623_2618 314
685 3300049581 Ga0501047_0080903 Ga0501047_0080903_799_1794 314
686 3300049582 Ga0501048_0002750 Ga0501048_0002750_7788_8783 314
687 3300049584 Ga0501068_0026532 Ga0501068_0026532_2132_3127 314
688 3300049585 Ga0501069_0032873 Ga0501069_0032873_832_1836 314
689 3300049585 Ga0501069_0044384 Ga0501069_0044384_44_1081 314
690 3300049587 Ga0501071_0012759 Ga0501071_0012759_33_1028 314
691 3300049588 Ga0501072_0000147 Ga0501072_0000147_17465_18460 314
692 3300049588 Ga0501072_0008575 Ga0501072_0008575_5373_6371 314
693 3300049588 Ga0501072_0225954 Ga0501072_0225954_454_1449 314
694 3300049588 Ga0501072_0252501 Ga0501072_0252501_83_1093 314
695 3300049589 Ga0501073_0118346 Ga0501073_0118346_344_1339 314
696 3300049590 Ga0501074_0003883 Ga0501074_0003883_8498_9493 314
697 3300049591 Ga0501075_0000662 Ga0501075_0000662_1891_2886 314
698 3300049592 Ga0501076_0000265 Ga0501076_0000265_18297_19292 314
699 3300049593 Ga0501077_0000448 Ga0501077_0000448_10592_11587 314
700 3300049741 Ga0501079_0000132 Ga0501079_0000132_18278_19273 314
701 3300049742 Ga0501080_0002706 Ga0501080_0002706_3603_4598 314
702 3300049743 Ga0501081_0000052 Ga0501081_0000052_3188_4183 314
703 3300049743 Ga0501081_0036404 Ga0501081_0036404_984_1979 314
704 3300049822 Ga0501035_0055373 Ga0501035_0055373_2098_3093 314
705 3300049822 Ga0501035_0366685 Ga0501035_0366685_150_1145 314
706 3300049824 Ga0501045_0016856 Ga0501045_0016856_910_1905 314
707 3300049824 Ga0501045_0105158 Ga0501045_0105158_281_1279 314
708 3300049824 Ga0501045_0316522 Ga0501045_0316522_62_1057 314
709 3300050507 nmdc:mga05p37_137_c1 nmdc:mga05p37_137_c1_49261_50292 314
710 3300050507 nmdc:mga05p37_164023_c1 nmdc:mga05p37_164023_c1_1314_2309 314
711 3300050508 nmdc:mga09592_258_c1 nmdc:mga09592_258_c1_10540_11571 314
712 3300050509 nmdc:mga0qj67_24062_c1 nmdc:mga0qj67_24062_c1_1607_2602 314
713 3300050511 nmdc:mga08y16_328530_c1 nmdc:mga08y16_328530_c1_478_1482 314
714 3300050512 nmdc:mga0n895_134_c1 nmdc:mga0n895_134_c1_31378_32379 314
715 3300050512 nmdc:mga0n895_1724_c1 nmdc:mga0n895_1724_c1_2637_3647 314
716 3300050513 nmdc:mga0rr50_291_c1 nmdc:mga0rr50_291_c1_4800_5801 314
717 3300050514 nmdc:mga08x19_1128_c1 nmdc:mga08x19_1128_c1_2841_3842 314
718 3300050515 nmdc:mga0a205_390084_c1 nmdc:mga0a205_390084_c1_98_1105 314
719 3300050515 nmdc:mga0a205_601_c1 nmdc:mga0a205_601_c1_26368_27369 314
720 3300054114 Ga0501084_0000260 Ga0501084_0000260_18297_19292 314
721 3300060353 Ga0501082_0008334 Ga0501082_0008334_816_1811 314
722 3300061734 Ga0530510_0000174 Ga0530510_0000174_26901_27896 314
723 3300005344 Ga0070661_100085142 Ga0070661_1000851422 315
724 3300005347 Ga0070668_100028302 Ga0070668_1000283023 315
725 3300005347 Ga0070668_100028483 Ga0070668_1000284834 315
726 3300005355 Ga0070671_100017520 Ga0070671_1000175206 315
727 3300005530 Ga0070679_100049543 Ga0070679_1000495432 315
728 3300005536 Ga0070697_100083742 Ga0070697_1000837423 315
729 3300005563 Ga0068855_100333597 Ga0068855_1003335972 315
730 3300005577 Ga0068857_100009677 Ga0068857_1000096778 315
731 3300005616 Ga0068852_100130983 Ga0068852_1001309832 315
732 3300005844 Ga0068862_100016928 Ga0068862_1000169287 315
733 3300005844 Ga0068862_100101554 Ga0068862_1001015542 315
734 3300006931 Ga0097620_100025304 Ga0097620_1000253043 315
735 3300009098 Ga0105245_10075495 Ga0105245_100754954 315
736 3300009148 Ga0105243_10077088 Ga0105243_100770882 315
737 3300009177 Ga0105248_10028581 Ga0105248_100285814 315
738 3300009553 Ga0105249_10208644 Ga0105249_102086442 315
739 3300013100 Ga0157373_10206307 Ga0157373_102063071 315
740 3300013104 Ga0157370_10011428 Ga0157370_100114285 315
741 3300013297 Ga0157378_10009903 Ga0157378_100099031 315
742 3300013306 Ga0163162_10060878 Ga0163162_100608782 315
743 3300013307 Ga0157372_10107329 Ga0157372_101073293 315
744 3300014325 Ga0163163_10035789 Ga0163163_100357894 315
745 3300014968 Ga0157379_10011496 Ga0157379_100114964 315
746 3300021361 Ga0213872_10002840 Ga0213872_100028406 315
747 3300025907 Ga0207645_10007073 Ga0207645_100070739 315
748 3300025909 Ga0207705_10087109 Ga0207705_100871093 315
749 3300025913 Ga0207695_10096007 Ga0207695_100960071 315
750 3300025920 Ga0207649_10008725 Ga0207649_100087252 315
751 3300025921 Ga0207652_10085744 Ga0207652_100857441 315
752 3300025923 Ga0207681_10278528 Ga0207681_102785282 315
753 3300025931 Ga0207644_10018852 Ga0207644_100188522 315
754 3300025937 Ga0207669_10181699 Ga0207669_101816992 315
755 3300025961 Ga0207712_10121541 Ga0207712_101215412 315
756 3300025972 Ga0207668_10026334 Ga0207668_100263344 315
757 3300025972 Ga0207668_10061110 Ga0207668_100611103 315
758 3300026023 Ga0207677_10070928 Ga0207677_100709282 315
759 3300026088 Ga0207641_10158709 Ga0207641_101587092 315
760 3300026089 Ga0207648_10012551 Ga0207648_100125514 315
761 3300026116 Ga0207674_10020682 Ga0207674_100206824 315
762 3300026118 Ga0207675_100021027 Ga0207675_1000210273 315
763 3300026118 Ga0207675_100167502 Ga0207675_1001675023 315
764 3300027671 Ga0209588_1004068 Ga0209588_10040684 315
765 3300028380 Ga0268265_10356661 Ga0268265_103566611 315
766 3300028381 Ga0268264_10053965 Ga0268264_100539653 315
767 3300035117 Ga0373953_0004673 Ga0373953_0004673_740_1777 315
768 3300035119 Ga0373956_0056558 Ga0373956_0056558_64_1101 315
769 3300035120 Ga0373957_0039924 Ga0373957_0039924_660_1697 315
770 3300035724 Ga0373933_0009221 Ga0373933_0009221_66_1103 315
771 3300036401 Ga0373937_0005243 Ga0373937_0005243_2308_3345 315
772 3300039447 Ga0436361_0000750 Ga0436361_0000750_7315_8361 315
773 3300039447 Ga0436361_0024448 Ga0436361_0024448_21443_22489 315
774 3300046463 Ga0495653_0136307 Ga0495653_0136307_39_1076 315
775 3300046514 Ga0495618_0110775 Ga0495618_0110775_369_1406 315
776 3300046516 Ga0495628_0051437 Ga0495628_0051437_643_1680 315
777 3300046517 Ga0495630_0060932 Ga0495630_0060932_66_1103 315
778 3300046529 Ga0495652_0078352 Ga0495652_0078352_678_1715 315
779 3300046535 Ga0495586_0126856 Ga0495586_0126856_264_1301 315
780 3300046539 Ga0495621_0053449 Ga0495621_0053449_252_1253 315
781 3300046559 Ga0495667_0010591 Ga0495667_0010591_3741_4778 315
782 3300046615 Ga0495656_0033759 Ga0495656_0033759_616_1635 315
783 3300046678 Ga0495599_0068387 Ga0495599_0068387_312_1349 315
784 3300048905 Ga0496102_0246842 Ga0496102_0246842_588_1634 315
785 3300049571 Ga0501034_0214346 Ga0501034_0214346_324_1367 315
786 3300049575 Ga0501039_0007780 Ga0501039_0007780_6414_7457 315
787 3300049576 Ga0501040_0010702 Ga0501040_0010702_2395_3438 315
788 3300049577 Ga0501041_0007398 Ga0501041_0007398_1892_2935 315
789 3300049578 Ga0501042_0006533 Ga0501042_0006533_3037_4080 315
790 3300049579 Ga0501043_0042253 Ga0501043_0042253_637_1680 315
791 3300049583 Ga0501067_0024210 Ga0501067_0024210_801_1844 315
792 3300049585 Ga0501069_0092095 Ga0501069_0092095_64_1107 315
793 3300049587 Ga0501071_0016342 Ga0501071_0016342_4034_5077 315
794 3300049589 Ga0501073_0006688 Ga0501073_0006688_6096_7139 315
795 3300049591 Ga0501075_0039475 Ga0501075_0039475_2131_3174 315
796 3300049592 Ga0501076_0011579 Ga0501076_0011579_5126_6169 315
797 3300049741 Ga0501079_0000752 Ga0501079_0000752_5859_6902 315
798 3300049742 Ga0501080_0006551 Ga0501080_0006551_7702_8745 315
799 3300049743 Ga0501081_0001770 Ga0501081_0001770_10997_12040 315
800 3300049744 Ga0501083_0045395 Ga0501083_0045395_433_1476 315
801 3300049744 Ga0501083_0101560 Ga0501083_0101560_480_1523 315
802 3300053077 Ga0495601_0002885 Ga0495601_0002885_5301_6338 315
803 3300060353 Ga0501082_0013158 Ga0501082_0013158_5093_6136 315
804 3300060353 Ga0501082_0086132 Ga0501082_0086132_102_1145 315
805 3300005328 Ga0070676_10042161 Ga0070676_100421611 316
806 3300005330 Ga0070690_100089090 Ga0070690_1000890901 316
807 3300005340 Ga0070689_100231833 Ga0070689_1002318331 316
808 3300005354 Ga0070675_100067178 Ga0070675_1000671782 316
809 3300005356 Ga0070674_100023890 Ga0070674_1000238901 316
810 3300005366 Ga0070659_100073065 Ga0070659_1000730651 316
811 3300005438 Ga0070701_10016039 Ga0070701_100160394 316
812 3300005456 Ga0070678_100075992 Ga0070678_1000759922 316
813 3300005457 Ga0070662_100035144 Ga0070662_1000351444 316
814 3300005457 Ga0070662_100245291 Ga0070662_1002452912 316
815 3300005457 Ga0070662_100253442 Ga0070662_1002534422 316
816 3300005458 Ga0070681_10011237 Ga0070681_100112374 316
817 3300005458 Ga0070681_10025978 Ga0070681_100259785 316
818 3300005458 Ga0070681_10042940 Ga0070681_100429403 316
819 3300005459 Ga0068867_100023044 Ga0068867_1000230444 316
820 3300005459 Ga0068867_100048586 Ga0068867_1000485862 316
821 3300005468 Ga0070707_100050967 Ga0070707_1000509672 316
822 3300005530 Ga0070679_100290556 Ga0070679_1002905562 316
823 3300005536 Ga0070697_100100623 Ga0070697_1001006232 316
824 3300005543 Ga0070672_100093259 Ga0070672_1000932593 316
825 3300005548 Ga0070665_100008476 Ga0070665_1000084769 316
826 3300005548 Ga0070665_100040250 Ga0070665_1000402505 316
827 3300005548 Ga0070665_100230064 Ga0070665_1002300642 316
828 3300005549 Ga0070704_100200682 Ga0070704_1002006822 316
829 3300005564 Ga0070664_100003033 Ga0070664_1000030334 316
830 3300005564 Ga0070664_100183961 Ga0070664_1001839612 316
831 3300005614 Ga0068856_100027421 Ga0068856_1000274215 316
832 3300005614 Ga0068856_100052324 Ga0068856_1000523243 316
833 3300005617 Ga0068859_100049097 Ga0068859_1000490975 316
834 3300005618 Ga0068864_100150357 Ga0068864_1001503572 316
835 3300005841 Ga0068863_100223213 Ga0068863_1002232132 316
836 3300005842 Ga0068858_100008217 Ga0068858_1000082178 316
837 3300005842 Ga0068858_100027824 Ga0068858_1000278242 316
838 3300005842 Ga0068858_100135647 Ga0068858_1001356472 316
839 3300005843 Ga0068860_100120401 Ga0068860_1001204011 316
840 3300005844 Ga0068862_100194977 Ga0068862_1001949772 316
841 3300006175 Ga0070712_100133078 Ga0070712_1001330782 316
842 3300006358 Ga0068871_100007928 Ga0068871_1000079284 316
843 3300006844 Ga0075428_100090114 Ga0075428_1000901142 316
844 3300006846 Ga0075430_100035077 Ga0075430_1000350773 316
845 3300006846 Ga0075430_100114549 Ga0075430_1001145493 316
846 3300006847 Ga0075431_100010159 Ga0075431_1000101595 316
847 3300006871 Ga0075434_100140254 Ga0075434_1001402543 316
848 3300006880 Ga0075429_100006909 Ga0075429_1000069094 316
849 3300006931 Ga0097620_100049098 Ga0097620_1000490982 316
850 3300007265 Ga0099794_10002614 Ga0099794_100026143 316
851 3300009094 Ga0111539_10002337 Ga0111539_1000233717 316
852 3300009176 Ga0105242_10139885 Ga0105242_101398852 316
853 3300009176 Ga0105242_10364229 Ga0105242_103642292 316
854 3300009177 Ga0105248_10082693 Ga0105248_100826932 316
855 3300009177 Ga0105248_10174301 Ga0105248_101743012 316
856 3300009553 Ga0105249_10265321 Ga0105249_102653212 316
857 3300013296 Ga0157374_10098146 Ga0157374_100981461 316
858 3300013306 Ga0163162_10099873 Ga0163162_100998733 316
859 3300013308 Ga0157375_10128455 Ga0157375_101284552 316
860 3300013308 Ga0157375_10200891 Ga0157375_102008912 316
861 3300014325 Ga0163163_10180510 Ga0163163_101805102 316
862 3300014326 Ga0157380_10116711 Ga0157380_101167113 316
863 3300014969 Ga0157376_10020315 Ga0157376_100203152 316
864 3300014969 Ga0157376_10025322 Ga0157376_100253226 316
865 3300025315 Ga0207697_10028346 Ga0207697_100283462 316
866 3300025893 Ga0207682_10002805 Ga0207682_100028053 316
867 3300025907 Ga0207645_10015078 Ga0207645_100150782 316
868 3300025910 Ga0207684_10012905 Ga0207684_100129057 316
869 3300025912 Ga0207707_10056787 Ga0207707_100567872 316
870 3300025915 Ga0207693_10167898 Ga0207693_101678981 316
871 3300025918 Ga0207662_10062741 Ga0207662_100627412 316
872 3300025922 Ga0207646_10034163 Ga0207646_100341634 316
873 3300025923 Ga0207681_10032634 Ga0207681_100326344 316
874 3300025925 Ga0207650_10003776 Ga0207650_100037762 316
875 3300025926 Ga0207659_10002570 Ga0207659_1000257013 316
876 3300025926 Ga0207659_10011642 Ga0207659_100116424 316
877 3300025932 Ga0207690_10164059 Ga0207690_101640592 316
878 3300025933 Ga0207706_10018329 Ga0207706_100183295 316
879 3300025935 Ga0207709_10075431 Ga0207709_100754312 316
880 3300025937 Ga0207669_10125569 Ga0207669_101255692 316
881 3300025938 Ga0207704_10008379 Ga0207704_100083794 316
882 3300025940 Ga0207691_10002088 Ga0207691_1000208823 316
883 3300025940 Ga0207691_10096585 Ga0207691_100965852 316
884 3300025941 Ga0207711_10037450 Ga0207711_100374502 316
885 3300025942 Ga0207689_10000859 Ga0207689_100008595 316
886 3300025942 Ga0207689_10045413 Ga0207689_100454132 316
887 3300025972 Ga0207668_10103129 Ga0207668_101031293 316
888 3300025986 Ga0207658_10028439 Ga0207658_100284392 316
889 3300026023 Ga0207677_10123312 Ga0207677_101233122 316
890 3300026035 Ga0207703_10029051 Ga0207703_100290512 316
891 3300026035 Ga0207703_10168487 Ga0207703_101684872 316
892 3300026078 Ga0207702_10079932 Ga0207702_100799323 316
893 3300026078 Ga0207702_10273703 Ga0207702_102737031 316
894 3300026088 Ga0207641_10183493 Ga0207641_101834932 316
895 3300026089 Ga0207648_10033218 Ga0207648_100332184 316
896 3300026089 Ga0207648_10262874 Ga0207648_102628741 316
897 3300026095 Ga0207676_10237503 Ga0207676_102375032 316
898 3300026118 Ga0207675_100068014 Ga0207675_1000680144 316
899 3300026142 Ga0207698_10125633 Ga0207698_101256332 316
900 3300027907 Ga0207428_10098204 Ga0207428_100982043 316
901 3300028577 Ga0265318_10001865 Ga0265318_100018655 316
902 3300031235 Ga0265330_10011762 Ga0265330_100117624 316
903 3300031238 Ga0265332_10001879 Ga0265332_100018793 316
904 3300031242 Ga0265329_10009644 Ga0265329_100096442 316
905 3300031250 Ga0265331_10001401 Ga0265331_100014017 316
906 3300031251 Ga0265327_10005966 Ga0265327_100059664 316
907 3300031344 Ga0265316_10039732 Ga0265316_100397323 316
908 3300031548 Ga0307408_100236196 Ga0307408_1002361961 316
909 3300031665 Ga0316575_10004283 Ga0316575_100042832 316
910 3300031711 Ga0265314_10000660 Ga0265314_1000066036 316
911 3300031727 Ga0316576_10024457 Ga0316576_100244574 316
912 3300031824 Ga0307413_10070379 Ga0307413_100703792 316
913 3300032004 Ga0307414_10069181 Ga0307414_100691813 316
914 3300032133 Ga0316583_10000317 Ga0316583_1000031711 316
915 3300035398 Ga0316574_0102261 Ga0316574_0102261_551_1582 316
916 3300044712 Ga0453684_0000014 Ga0453684_0000014_918166_919218 316
917 3300044712 Ga0453684_0000736 Ga0453684_0000736_66794_67846 316
918 3300044712 Ga0453684_0002679 Ga0453684_0002679_13462_14529 316
919 3300045051 Ga0451576_0000519 Ga0451576_0000519_67085_68137 316
920 3300046528 Ga0495642_0021115 Ga0495642_0021115_447_1493 316
921 3300048913 Ga0496110_0117557 Ga0496110_0117557_1001_2047 316
922 3300049569 Ga0501032_0000317 Ga0501032_0000317_4583_5638 316
923 3300049572 Ga0501036_0017451 Ga0501036_0017451_2488_3528 316
924 3300049575 Ga0501039_0100328 Ga0501039_0100328_869_1909 316
925 3300049576 Ga0501040_0017033 Ga0501040_0017033_3147_4187 316
926 3300049577 Ga0501041_0034485 Ga0501041_0034485_1917_2957 316
927 3300049578 Ga0501042_0015564 Ga0501042_0015564_4139_5179 316
928 3300049579 Ga0501043_0214957 Ga0501043_0214957_261_1307 316
929 3300049582 Ga0501048_0027873 Ga0501048_0027873_1346_2386 316
930 3300049585 Ga0501069_0017219 Ga0501069_0017219_2624_3733 316
931 3300049586 Ga0501070_0042303 Ga0501070_0042303_2047_3156 316
932 3300049587 Ga0501071_0009263 Ga0501071_0009263_2024_3064 316
933 3300049591 Ga0501075_0000301 Ga0501075_0000301_5064_6104 316
934 3300049592 Ga0501076_0000098 Ga0501076_0000098_20241_21281 316
935 3300049593 Ga0501077_0027943 Ga0501077_0027943_1714_2754 316
936 3300049741 Ga0501079_0000932 Ga0501079_0000932_14643_15683 316
937 3300049742 Ga0501080_0212429 Ga0501080_0212429_40_1149 316
938 3300049824 Ga0501045_0011716 Ga0501045_0011716_2230_3270 316
939 3300049824 Ga0501045_0039127 Ga0501045_0039127_1286_2326 316
940 3300050508 nmdc:mga09592_13246_c1 nmdc:mga09592_13246_c1_3213_4259 316
941 3300050509 nmdc:mga0qj67_13046_c1 nmdc:mga0qj67_13046_c1_4982_5989 316
942 3300050509 nmdc:mga0qj67_218332_c1 nmdc:mga0qj67_218332_c1_221_1270 316
943 3300050510 nmdc:mga06r32_27741_c1 nmdc:mga06r32_27741_c1_924_1973 316
944 3300050511 nmdc:mga08y16_18747_c1 nmdc:mga08y16_18747_c1_3329_4375 316
945 3300054114 Ga0501084_0008499 Ga0501084_0008499_5324_6364 316
946 3300060353 Ga0501082_0001136 Ga0501082_0001136_7394_8434 316
947 3300061734 Ga0530510_0000351 Ga0530510_0000351_26588_27628 316
948 3300006846 Ga0075430_100012241 Ga0075430_1000122412 317
949 3300050509 nmdc:mga0qj67_18450_c1 nmdc:mga0qj67_18450_c1_1759_2766 317
950 3300003203 JGI25406J46586_10022481 JGI25406J46586_100224812 318
951 3300005345 Ga0070692_10015262 Ga0070692_100152623 318
952 3300005444 Ga0070694_100044666 Ga0070694_1000446664 318
953 3300005444 Ga0070694_100097120 Ga0070694_1000971203 318
954 3300005467 Ga0070706_100072507 Ga0070706_1000725074 318
955 3300005471 Ga0070698_100045644 Ga0070698_1000456443 318
956 3300005536 Ga0070697_100003863 Ga0070697_1000038633 318
957 3300005545 Ga0070695_100000952 Ga0070695_10000095213 318
958 3300005545 Ga0070695_100123361 Ga0070695_1001233612 318
959 3300005545 Ga0070695_100165033 Ga0070695_1001650332 318
960 3300005985 Ga0081539_10000188 Ga0081539_10000188132 318
961 3300006844 Ga0075428_100007657 Ga0075428_1000076573 318
962 3300006844 Ga0075428_100073629 Ga0075428_1000736293 318
963 3300006847 Ga0075431_100047368 Ga0075431_1000473683 318
964 3300006852 Ga0075433_10069699 Ga0075433_100696992 318
965 3300006914 Ga0075436_100000090 Ga0075436_10000009035 318
966 3300006914 Ga0075436_100002022 Ga0075436_10000202214 318
967 3300006914 Ga0075436_100014350 Ga0075436_1000143503 318
968 3300007076 Ga0075435_100035388 Ga0075435_1000353882 318
969 3300009147 Ga0114129_10146982 Ga0114129_101469823 318
970 3300025910 Ga0207684_10136096 Ga0207684_101360963 318
971 3300035118 Ga0373954_0000389 Ga0373954_0000389_14890_15900 318
972 3300035724 Ga0373933_0169588 Ga0373933_0169588_302_1312 318
973 3300036401 Ga0373937_0001626 Ga0373937_0001626_2025_3035 318
974 3300036401 Ga0373937_0046927 Ga0373937_0046927_2463_3473 318
975 3300046454 Ga0495592_0000274 Ga0495592_0000274_11582_12592 318
976 3300046463 Ga0495653_0060544 Ga0495653_0060544_1143_2153 318
977 3300046473 Ga0495582_0049451 Ga0495582_0049451_110_1120 318
978 3300046476 Ga0495662_0006621 Ga0495662_0006621_3595_4605 318
979 3300046511 Ga0495608_0000280 Ga0495608_0000280_11404_12414 318
980 3300046516 Ga0495628_0000155 Ga0495628_0000155_11337_12347 318
981 3300046517 Ga0495630_0001456 Ga0495630_0001456_4197_5207 318
982 3300046528 Ga0495642_0018049 Ga0495642_0018049_877_1884 318
983 3300046533 Ga0495640_0000538 Ga0495640_0000538_5900_6910 318
984 3300046535 Ga0495586_0000293 Ga0495586_0000293_21669_22679 318
985 3300046543 Ga0495645_0023581 Ga0495645_0023581_791_1801 318
986 3300046559 Ga0495667_0018886 Ga0495667_0018886_19_1029 318
987 3300046642 Ga0495634_0006512 Ga0495634_0006512_4656_5666 318
988 3300046663 Ga0495635_0038509 Ga0495635_0038509_448_1458 318
989 3300046678 Ga0495599_0007055 Ga0495599_0007055_4599_5609 318
990 3300046683 Ga0495658_0007860 Ga0495658_0007860_3890_4900 318
991 3300046684 Ga0495669_0002344 Ga0495669_0002344_4458_5465 318
992 3300046689 Ga0495613_0016043 Ga0495613_0016043_3853_4863 318
993 3300047317 Ga0495604_0018583 Ga0495604_0018583_4170_5180 318
994 3300047322 Ga0495680_0000202 Ga0495680_0000202_61437_62447 318
995 3300050507 nmdc:mga05p37_116363_c1 nmdc:mga05p37_116363_c1_1392_2399 318
996 3300050508 nmdc:mga09592_312745_c1 nmdc:mga09592_312745_c1_98_1189 318
997 3300050514 nmdc:mga08x19_24601_c1 nmdc:mga08x19_24601_c1_906_1913 318
998 3300050514 nmdc:mga08x19_281_c1 nmdc:mga08x19_281_c1_7539_8546 318
999 3300050514 nmdc:mga08x19_6434_c1 nmdc:mga08x19_6434_c1_2660_3667 318
1000 3300050515 nmdc:mga0a205_48833_c1 nmdc:mga0a205_48833_c1_1156_2166 318
1001 3300053077 Ga0495601_0007232 Ga0495601_0007232_847_1857 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

98

216

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

228

394

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v9y-assembly1.cif.gz_A human aminoimidazole ribonucleotide synthetase 0.9383 51 315
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9347 16 318
5vk4-assembly1.cif.gz_B crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9345 16 318
1cli-assembly2.cif.gz_C x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution 0.9199 3 317
3p4e-assembly1.cif.gz_A-2 phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae 0.9119 16 316
ID Description Score Start End Superfamily
af_Q54GJ2_634_814_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9507 155 316 3.90.650.10
5vk4B02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9485 155 318 3.90.650.10
af_I6Y4V6_182_356_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9475 156 316 3.90.650.10
af_Q2FZI8_168_339_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.943 152 314 3.90.650.10
af_P07244_618_801_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9402 154 317 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A661E4Z0-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9946 197 318 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A352CA30-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9895 215 309 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A1Y1QT65-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9873 217 318 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A533BA74-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9868 211 318 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A1J8PN17-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9856 195 309 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084

Feature Viewer

pLDDT pTM Quality
88.43 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map