F487886
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1001 | 344 | 999 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10011237|Ga0070681_100112374 |
| Length | 397 |
| Sequence | MLLRQAGRGSFQVKFEAPNGVQRGRKRTRLVILTYSRLIRLFTIRESPPLNTPDKSPSLTYRDAGVDIDAGDALVENIKPFAKKTLRPEVLAGIGGFGAMCNIPAKYREPVLVSGTDGVGTKLKLAFELGFHDTIGIDLVAMSVNDILTQGAEPLFFLDYYACGKLDVATATAVVKGIAAGCEQAGCALIGGETAEMPGMYPPGEYDLAGFAVGVVEKSKIIDGSTIAAGDAVLGMASSGAHSNGYSLIRRIIGTRRDDLAADFGGRTLGQALLEPTRIYVKSVLQLIEKIPVKGLAHITGGGLVENVPRILSEGLAARLERASWPQPPLYAWLQRQGKVDDDEMLRVFNCGIGMVAIVAEQHADAAARLLRAAGETVWRIGSVQTRAAAEAQTTVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 229 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 243 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 340 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 341 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 343 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 344 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 97.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10022481 | 3300003203 | Bacteria | 2511 |
| 2 | JGI25405J52794_10004864 | 3300003911 | Bacteria | 2407 |
| 3 | Ga0065712_10000192 | 3300005290 | Bacteria | 34231 |
| 4 | Ga0065715_10000385 | 3300005293 | Bacteria | 24803 |
| 5 | Ga0065707_10000602 | 3300005295 | Bacteria | 17078 |
| 6 | Ga0065707_10014078 | 3300005295 | Bacteria | 1875 |
| 7 | Ga0065707_10095781 | 3300005295 | Bacteria | 3338 |
| 8 | Ga0070658_10188952 | 3300005327 | Bacteria | 1736 |
| 9 | Ga0070676_10013414 | 3300005328 | Bacteria | 4491 |
| 10 | Ga0070676_10042161 | 3300005328 | Bacteria | 2648 |
| 11 | Ga0070683_100003976 | 3300005329 | Bacteria | 12106 |
| 12 | Ga0070683_100064417 | 3300005329 | Bacteria | 3412 |
| 13 | Ga0070690_100000182 | 3300005330 | Bacteria | 32371 |
| 14 | Ga0070690_100005120 | 3300005330 | Bacteria | 7342 |
| 15 | Ga0070690_100023712 | 3300005330 | Bacteria | 3767 |
| 16 | Ga0070690_100089090 | 3300005330 | Bacteria | 2029 |
| 17 | Ga0070690_100145933 | 3300005330 | Bacteria | 1610 |
| 18 | Ga0070670_100010770 | 3300005331 | Bacteria | 7812 |
| 19 | Ga0070670_100025655 | 3300005331 | Bacteria | 5070 |
| 20 | Ga0070677_10001307 | 3300005333 | Bacteria | 7969 |
| 21 | Ga0068869_100000785 | 3300005334 | Bacteria | 18102 |
| 22 | Ga0068869_100009966 | 3300005334 | Bacteria | 6176 |
| 23 | Ga0068869_100135380 | 3300005334 | Bacteria | 1897 |
| 24 | Ga0070666_10129335 | 3300005335 | Bacteria | 1754 |
| 25 | Ga0070680_100001823 | 3300005336 | Bacteria | 15647 |
| 26 | Ga0070680_100021809 | 3300005336 | Bacteria | 5094 |
| 27 | Ga0070680_100285061 | 3300005336 | Bacteria | 1400 |
| 28 | Ga0070682_100013004 | 3300005337 | Bacteria | 4779 |
| 29 | Ga0070682_100013879 | 3300005337 | Bacteria | 4645 |
| 30 | Ga0068868_100000782 | 3300005338 | Bacteria | 21532 |
| 31 | Ga0068868_100049644 | 3300005338 | Bacteria | 3293 |
| 32 | Ga0070660_100015860 | 3300005339 | Bacteria | 5454 |
| 33 | Ga0070689_100000521 | 3300005340 | Bacteria | 22753 |
| 34 | Ga0070689_100082369 | 3300005340 | Bacteria | 2527 |
| 35 | Ga0070689_100188759 | 3300005340 | Bacteria | 1677 |
| 36 | Ga0070689_100231833 | 3300005340 | Bacteria | 1518 |
| 37 | Ga0070691_10002091 | 3300005341 | Bacteria | 8828 |
| 38 | Ga0070691_10012037 | 3300005341 | Bacteria | 3962 |
| 39 | Ga0070691_10016272 | 3300005341 | Bacteria | 3416 |
| 40 | Ga0070687_100000050 | 3300005343 | Bacteria | 37797 |
| 41 | Ga0070687_100008251 | 3300005343 | Bacteria | 4400 |
| 42 | Ga0070661_100005648 | 3300005344 | Bacteria | 8619 |
| 43 | Ga0070661_100053601 | 3300005344 | Bacteria | 2953 |
| 44 | Ga0070661_100085142 | 3300005344 | Bacteria | 2335 |
| 45 | Ga0070692_10003200 | 3300005345 | Bacteria | 6586 |
| 46 | Ga0070692_10015262 | 3300005345 | Bacteria | 3630 |
| 47 | Ga0070668_100028302 | 3300005347 | Bacteria | 4254 |
| 48 | Ga0070668_100028483 | 3300005347 | Bacteria | 4240 |
| 49 | Ga0070668_100060433 | 3300005347 | Bacteria | 2934 |
| 50 | Ga0070668_100124210 | 3300005347 | Bacteria | 2066 |
| 51 | Ga0070668_100288519 | 3300005347 | Bacteria | 1373 |
| 52 | Ga0070669_100009604 | 3300005353 | Bacteria | 6888 |
| 53 | Ga0070669_100055174 | 3300005353 | Bacteria | 2911 |
| 54 | Ga0070669_100063106 | 3300005353 | Bacteria | 2726 |
| 55 | Ga0070675_100000071 | 3300005354 | Bacteria | 59417 |
| 56 | Ga0070675_100067178 | 3300005354 | Bacteria | 2966 |
| 57 | Ga0070671_100008154 | 3300005355 | Bacteria | 8385 |
| 58 | Ga0070671_100008298 | 3300005355 | Bacteria | 8312 |
| 59 | Ga0070671_100017520 | 3300005355 | Bacteria | 5804 |
| 60 | Ga0070671_100035876 | 3300005355 | Bacteria | 4110 |
| 61 | Ga0070671_100139576 | 3300005355 | Bacteria | 2045 |
| 62 | Ga0070671_100304393 | 3300005355 | Bacteria | 1357 |
| 63 | Ga0070674_100023890 | 3300005356 | Bacteria | 3963 |
| 64 | Ga0070673_100027794 | 3300005364 | Bacteria | 4197 |
| 65 | Ga0070673_100121157 | 3300005364 | Bacteria | 2182 |
| 66 | Ga0070688_100002481 | 3300005365 | Bacteria | 9334 |
| 67 | Ga0070659_100001017 | 3300005366 | Bacteria | 20562 |
| 68 | Ga0070659_100021088 | 3300005366 | Bacteria | 4956 |
| 69 | Ga0070659_100073065 | 3300005366 | Bacteria | 2730 |
| 70 | Ga0070659_100203622 | 3300005366 | Bacteria | 1630 |
| 71 | Ga0070667_100066127 | 3300005367 | Bacteria | 3071 |
| 72 | Ga0070667_100336853 | 3300005367 | Bacteria | 1364 |
| 73 | Ga0070713_100040710 | 3300005436 | Bacteria | 3779 |
| 74 | Ga0070701_10000918 | 3300005438 | Bacteria | 10655 |
| 75 | Ga0070701_10015244 | 3300005438 | Bacteria | 3544 |
| 76 | Ga0070701_10016039 | 3300005438 | Bacteria | 3474 |
| 77 | Ga0070711_100082894 | 3300005439 | Bacteria | 2290 |
| 78 | Ga0070705_100000752 | 3300005440 | Bacteria | 18382 |
| 79 | Ga0070700_100010913 | 3300005441 | Bacteria | 5024 |
| 80 | Ga0070700_100094000 | 3300005441 | Bacteria | 1962 |
| 81 | Ga0070694_100000128 | 3300005444 | Bacteria | 37863 |
| 82 | Ga0070694_100029825 | 3300005444 | Bacteria | 3563 |
| 83 | Ga0070694_100044666 | 3300005444 | Bacteria | 2966 |
| 84 | Ga0070694_100097120 | 3300005444 | Bacteria | 2078 |
| 85 | Ga0070694_100120168 | 3300005444 | Bacteria | 1884 |
| 86 | Ga0070694_100134597 | 3300005444 | Bacteria | 1789 |
| 87 | Ga0070678_100036062 | 3300005456 | Bacteria | 3458 |
| 88 | Ga0070678_100075992 | 3300005456 | Bacteria | 2529 |
| 89 | Ga0070662_100004111 | 3300005457 | Bacteria | 9145 |
| 90 | Ga0070662_100013160 | 3300005457 | Bacteria | 5499 |
| 91 | Ga0070662_100035144 | 3300005457 | Bacteria | 3537 |
| 92 | Ga0070662_100084726 | 3300005457 | Bacteria | 2368 |
| 93 | Ga0070662_100245291 | 3300005457 | Bacteria | 1438 |
| 94 | Ga0070662_100253442 | 3300005457 | Bacteria | 1416 |
| 95 | Ga0070662_100318850 | 3300005457 | Bacteria | 1267 |
| 96 | Ga0070681_10011237 | 3300005458 | Bacteria | 8856 |
| 97 | Ga0070681_10024123 | 3300005458 | Bacteria | 6123 |
| 98 | Ga0070681_10025978 | 3300005458 | Bacteria | 5888 |
| 99 | Ga0070681_10042940 | 3300005458 | Bacteria | 4530 |
| 100 | Ga0070681_10119883 | 3300005458 | Bacteria | 2566 |
| 101 | Ga0068867_100000411 | 3300005459 | Bacteria | 28681 |
| 102 | Ga0068867_100000511 | 3300005459 | Bacteria | 25862 |
| 103 | Ga0068867_100023044 | 3300005459 | Bacteria | 4455 |
| 104 | Ga0068867_100048586 | 3300005459 | Bacteria | 3122 |
| 105 | Ga0070685_10004184 | 3300005466 | Bacteria | 7279 |
| 106 | Ga0070706_100000049 | 3300005467 | Bacteria | 141287 |
| 107 | Ga0070706_100072507 | 3300005467 | Bacteria | 3187 |
| 108 | Ga0070707_100005499 | 3300005468 | Bacteria | 11845 |
| 109 | Ga0070707_100050967 | 3300005468 | Bacteria | 3968 |
| 110 | Ga0070698_100045644 | 3300005471 | Bacteria | 4484 |
| 111 | Ga0070698_100286410 | 3300005471 | Bacteria | 1579 |
| 112 | Ga0070679_100002560 | 3300005530 | Bacteria | 16500 |
| 113 | Ga0070679_100026411 | 3300005530 | Bacteria | 5704 |
| 114 | Ga0070679_100049543 | 3300005530 | Bacteria | 4183 |
| 115 | Ga0070679_100290556 | 3300005530 | Bacteria | 1586 |
| 116 | Ga0070684_100028247 | 3300005535 | Bacteria | 4744 |
| 117 | Ga0070684_100202092 | 3300005535 | Bacteria | 1810 |
| 118 | Ga0070697_100003863 | 3300005536 | Bacteria | 11510 |
| 119 | Ga0070697_100083742 | 3300005536 | Bacteria | 2630 |
| 120 | Ga0070697_100100623 | 3300005536 | Bacteria | 2401 |
| 121 | Ga0068853_100005087 | 3300005539 | Bacteria | 10262 |
| 122 | Ga0070672_100018571 | 3300005543 | Bacteria | 5031 |
| 123 | Ga0070672_100022344 | 3300005543 | Bacteria | 4645 |
| 124 | Ga0070672_100093259 | 3300005543 | Bacteria | 2432 |
| 125 | Ga0070672_100114944 | 3300005543 | Bacteria | 2197 |
| 126 | Ga0070672_100206875 | 3300005543 | Bacteria | 1642 |
| 127 | Ga0070686_100000107 | 3300005544 | Bacteria | 57801 |
| 128 | Ga0070686_100013191 | 3300005544 | Bacteria | 4723 |
| 129 | Ga0070686_100020266 | 3300005544 | Bacteria | 3931 |
| 130 | Ga0070686_100049402 | 3300005544 | Bacteria | 2669 |
| 131 | Ga0070686_100188780 | 3300005544 | Bacteria | 1470 |
| 132 | Ga0070695_100000172 | 3300005545 | Bacteria | 30962 |
| 133 | Ga0070695_100000952 | 3300005545 | Bacteria | 15714 |
| 134 | Ga0070695_100123361 | 3300005545 | Bacteria | 1776 |
| 135 | Ga0070695_100165033 | 3300005545 | Bacteria | 1558 |
| 136 | Ga0070696_100003396 | 3300005546 | Bacteria | 10625 |
| 137 | Ga0070696_100012727 | 3300005546 | Bacteria | 5650 |
| 138 | Ga0070693_100000078 | 3300005547 | Bacteria | 40457 |
| 139 | Ga0070665_100008476 | 3300005548 | Bacteria | 10402 |
| 140 | Ga0070665_100040250 | 3300005548 | Bacteria | 4698 |
| 141 | Ga0070665_100230064 | 3300005548 | Bacteria | 1854 |
| 142 | Ga0070665_100234755 | 3300005548 | Bacteria | 1834 |
| 143 | Ga0070704_100000256 | 3300005549 | Bacteria | 23053 |
| 144 | Ga0070704_100020456 | 3300005549 | Bacteria | 4268 |
| 145 | Ga0070704_100060738 | 3300005549 | Bacteria | 2701 |
| 146 | Ga0070704_100200682 | 3300005549 | Bacteria | 1610 |
| 147 | Ga0068855_100004148 | 3300005563 | Bacteria | 17675 |
| 148 | Ga0068855_100045835 | 3300005563 | Bacteria | 5170 |
| 149 | Ga0068855_100333597 | 3300005563 | Bacteria | 1674 |
| 150 | Ga0068855_100441711 | 3300005563 | Bacteria | 1421 |
| 151 | Ga0070664_100003033 | 3300005564 | Bacteria | 13581 |
| 152 | Ga0070664_100017510 | 3300005564 | Bacteria | 5886 |
| 153 | Ga0070664_100021130 | 3300005564 | Bacteria | 5362 |
| 154 | Ga0070664_100021164 | 3300005564 | Bacteria | 5357 |
| 155 | Ga0070664_100084795 | 3300005564 | Bacteria | 2735 |
| 156 | Ga0070664_100183961 | 3300005564 | Bacteria | 1859 |
| 157 | Ga0068857_100009677 | 3300005577 | Bacteria | 8373 |
| 158 | Ga0068857_100026226 | 3300005577 | Bacteria | 5135 |
| 159 | Ga0068854_100139316 | 3300005578 | Bacteria | 1860 |
| 160 | Ga0068856_100004397 | 3300005614 | Bacteria | 14044 |
| 161 | Ga0068856_100005065 | 3300005614 | Bacteria | 13041 |
| 162 | Ga0068856_100027421 | 3300005614 | Bacteria | 5558 |
| 163 | Ga0068856_100046734 | 3300005614 | Bacteria | 4263 |
| 164 | Ga0068856_100052324 | 3300005614 | Bacteria | 4026 |
| 165 | Ga0068856_100069726 | 3300005614 | Bacteria | 3476 |
| 166 | Ga0068856_100184111 | 3300005614 | Bacteria | 2102 |
| 167 | Ga0070702_100000048 | 3300005615 | Bacteria | 33172 |
| 168 | Ga0068852_100002993 | 3300005616 | Bacteria | 11740 |
| 169 | Ga0068852_100025692 | 3300005616 | Bacteria | 4776 |
| 170 | Ga0068852_100130983 | 3300005616 | Bacteria | 2309 |
| 171 | Ga0068859_100000873 | 3300005617 | Bacteria | 30722 |
| 172 | Ga0068859_100049097 | 3300005617 | Bacteria | 4238 |
| 173 | Ga0068859_100390752 | 3300005617 | Bacteria | 1487 |
| 174 | Ga0068864_100031635 | 3300005618 | Bacteria | 4491 |
| 175 | Ga0068864_100108838 | 3300005618 | Bacteria | 2466 |
| 176 | Ga0068864_100150357 | 3300005618 | Bacteria | 2109 |
| 177 | Ga0068864_100292689 | 3300005618 | Bacteria | 1522 |
| 178 | Ga0068866_10022435 | 3300005718 | Bacteria | 2921 |
| 179 | Ga0068861_100000373 | 3300005719 | Bacteria | 25769 |
| 180 | Ga0068861_100005597 | 3300005719 | Bacteria | 8516 |
| 181 | Ga0068861_100006204 | 3300005719 | Bacteria | 8134 |
| 182 | Ga0068861_100085033 | 3300005719 | Bacteria | 2484 |
| 183 | Ga0068861_100286089 | 3300005719 | Bacteria | 1422 |
| 184 | Ga0068851_10003974 | 3300005834 | Bacteria | 6624 |
| 185 | Ga0068851_10008679 | 3300005834 | Bacteria | 4707 |
| 186 | Ga0068851_10097611 | 3300005834 | Bacteria | 1555 |
| 187 | Ga0068870_10051460 | 3300005840 | Bacteria | 2180 |
| 188 | Ga0068863_100061998 | 3300005841 | Bacteria | 3536 |
| 189 | Ga0068863_100182880 | 3300005841 | Bacteria | 2012 |
| 190 | Ga0068863_100223213 | 3300005841 | Bacteria | 1816 |
| 191 | Ga0068858_100000324 | 3300005842 | Bacteria | 50505 |
| 192 | Ga0068858_100008217 | 3300005842 | Bacteria | 10034 |
| 193 | Ga0068858_100019089 | 3300005842 | Bacteria | 6412 |
| 194 | Ga0068858_100027824 | 3300005842 | Bacteria | 5252 |
| 195 | Ga0068858_100062343 | 3300005842 | Bacteria | 3447 |
| 196 | Ga0068858_100135647 | 3300005842 | Bacteria | 2309 |
| 197 | Ga0068860_100000687 | 3300005843 | Bacteria | 39010 |
| 198 | Ga0068860_100120401 | 3300005843 | Bacteria | 2513 |
| 199 | Ga0068862_100000430 | 3300005844 | Bacteria | 45618 |
| 200 | Ga0068862_100016928 | 3300005844 | Bacteria | 6068 |
| 201 | Ga0068862_100018871 | 3300005844 | Bacteria | 5747 |
| 202 | Ga0068862_100101554 | 3300005844 | Bacteria | 2516 |
| 203 | Ga0068862_100166029 | 3300005844 | Bacteria | 1973 |
| 204 | Ga0068862_100194977 | 3300005844 | Bacteria | 1824 |
| 205 | Ga0081455_10000235 | 3300005937 | Bacteria | 71796 |
| 206 | Ga0081455_10081050 | 3300005937 | Bacteria | 2659 |
| 207 | Ga0081538_10005747 | 3300005981 | Bacteria | 11081 |
| 208 | Ga0081539_10000188 | 3300005985 | Bacteria | 143987 |
| 209 | Ga0081539_10017313 | 3300005985 | Bacteria | 5068 |
| 210 | Ga0070712_100133078 | 3300006175 | Bacteria | 1887 |
| 211 | Ga0097621_100000180 | 3300006237 | Bacteria | 40011 |
| 212 | Ga0097621_100032120 | 3300006237 | Bacteria | 4171 |
| 213 | Ga0068871_100006394 | 3300006358 | Bacteria | 8330 |
| 214 | Ga0068871_100007928 | 3300006358 | Bacteria | 7614 |
| 215 | Ga0075428_100002149 | 3300006844 | Bacteria | 21295 |
| 216 | Ga0075428_100006527 | 3300006844 | Bacteria | 12971 |
| 217 | Ga0075428_100007657 | 3300006844 | Bacteria | 11973 |
| 218 | Ga0075428_100042960 | 3300006844 | Bacteria | 4970 |
| 219 | Ga0075428_100073629 | 3300006844 | Bacteria | 3731 |
| 220 | Ga0075428_100090114 | 3300006844 | Bacteria | 3345 |
| 221 | Ga0075428_100149383 | 3300006844 | Bacteria | 2538 |
| 222 | Ga0075428_100413172 | 3300006844 | Bacteria | 1446 |
| 223 | Ga0075430_100006463 | 3300006846 | Bacteria | 9874 |
| 224 | Ga0075430_100012241 | 3300006846 | Bacteria | 7300 |
| 225 | Ga0075430_100031706 | 3300006846 | Bacteria | 4485 |
| 226 | Ga0075430_100035077 | 3300006846 | Bacteria | 4258 |
| 227 | Ga0075430_100114549 | 3300006846 | Bacteria | 2247 |
| 228 | Ga0075431_100010159 | 3300006847 | Bacteria | 9463 |
| 229 | Ga0075431_100025953 | 3300006847 | Bacteria | 6006 |
| 230 | Ga0075431_100031001 | 3300006847 | Bacteria | 5507 |
| 231 | Ga0075431_100047368 | 3300006847 | Bacteria | 4432 |
| 232 | Ga0075431_100056793 | 3300006847 | Bacteria | 4037 |
| 233 | Ga0075431_100146359 | 3300006847 | Bacteria | 2435 |
| 234 | Ga0075433_10002531 | 3300006852 | Bacteria | 13913 |
| 235 | Ga0075433_10007284 | 3300006852 | Bacteria | 8770 |
| 236 | Ga0075433_10069699 | 3300006852 | Bacteria | 3089 |
| 237 | Ga0075433_10156071 | 3300006852 | Bacteria | 2030 |
| 238 | Ga0075433_10279580 | 3300006852 | Bacteria | 1479 |
| 239 | Ga0075433_10377353 | 3300006852 | Bacteria | 1252 |
| 240 | Ga0075434_100000204 | 3300006871 | Bacteria | 40084 |
| 241 | Ga0075434_100008705 | 3300006871 | Bacteria | 9444 |
| 242 | Ga0075434_100009247 | 3300006871 | Bacteria | 9182 |
| 243 | Ga0075434_100140254 | 3300006871 | Bacteria | 2437 |
| 244 | Ga0075429_100000208 | 3300006880 | Bacteria | 39267 |
| 245 | Ga0075429_100006909 | 3300006880 | Bacteria | 9859 |
| 246 | Ga0075429_100027878 | 3300006880 | Bacteria | 4903 |
| 247 | Ga0075429_100032477 | 3300006880 | Bacteria | 4537 |
| 248 | Ga0075429_100036912 | 3300006880 | Bacteria | 4253 |
| 249 | Ga0068865_100000148 | 3300006881 | Bacteria | 37832 |
| 250 | Ga0068865_100023180 | 3300006881 | Bacteria | 4061 |
| 251 | Ga0068865_100189197 | 3300006881 | Bacteria | 1590 |
| 252 | Ga0075436_100000090 | 3300006914 | Bacteria | 52278 |
| 253 | Ga0075436_100000422 | 3300006914 | Bacteria | 27110 |
| 254 | Ga0075436_100002022 | 3300006914 | Bacteria | 13988 |
| 255 | Ga0075436_100013290 | 3300006914 | Bacteria | 5639 |
| 256 | Ga0075436_100014350 | 3300006914 | Bacteria | 5425 |
| 257 | Ga0097620_100000874 | 3300006931 | Bacteria | 30722 |
| 258 | Ga0097620_100025304 | 3300006931 | Bacteria | 5954 |
| 259 | Ga0097620_100049098 | 3300006931 | Bacteria | 4238 |
| 260 | Ga0097620_100390762 | 3300006931 | Bacteria | 1487 |
| 261 | Ga0075435_100002321 | 3300007076 | Bacteria | 12584 |
| 262 | Ga0075435_100015103 | 3300007076 | Bacteria | 5796 |
| 263 | Ga0075435_100035388 | 3300007076 | Bacteria | 3963 |
| 264 | Ga0099794_10000009 | 3300007265 | Bacteria | 92040 |
| 265 | Ga0099794_10002614 | 3300007265 | Bacteria | 6695 |
| 266 | Ga0099795_10022451 | 3300007788 | Bacteria | 2083 |
| 267 | Ga0105240_10070494 | 3300009093 | Bacteria | 4324 |
| 268 | Ga0111539_10002337 | 3300009094 | Bacteria | 25250 |
| 269 | Ga0111539_10044518 | 3300009094 | Bacteria | 5317 |
| 270 | Ga0111539_10054521 | 3300009094 | Bacteria | 4756 |
| 271 | Ga0111539_10066933 | 3300009094 | Bacteria | 4243 |
| 272 | Ga0111539_10095513 | 3300009094 | Bacteria | 3492 |
| 273 | Ga0111539_10101073 | 3300009094 | Bacteria | 3385 |
| 274 | Ga0111539_10102152 | 3300009094 | Bacteria | 3365 |
| 275 | Ga0111539_10104229 | 3300009094 | Unclassified | 3328 |
| 276 | Ga0111539_10278054 | 3300009094 | Bacteria | 1948 |
| 277 | Ga0111539_10281188 | 3300009094 | Bacteria | 1936 |
| 278 | Ga0105245_10000429 | 3300009098 | Bacteria | 39127 |
| 279 | Ga0105245_10075495 | 3300009098 | Bacteria | 3069 |
| 280 | Ga0114129_10000140 | 3300009147 | Bacteria | 75593 |
| 281 | Ga0114129_10004111 | 3300009147 | Bacteria | 20570 |
| 282 | Ga0114129_10012098 | 3300009147 | Bacteria | 12285 |
| 283 | Ga0114129_10013997 | 3300009147 | Bacteria | 11428 |
| 284 | Ga0114129_10025255 | 3300009147 | Bacteria | 8418 |
| 285 | Ga0114129_10031678 | 3300009147 | Bacteria | 7475 |
| 286 | Ga0114129_10063467 | 3300009147 | Bacteria | 5158 |
| 287 | Ga0114129_10146982 | 3300009147 | Bacteria | 3228 |
| 288 | Ga0114129_10159021 | 3300009147 | Bacteria | 3088 |
| 289 | Ga0114129_10300936 | 3300009147 | Bacteria | 2138 |
| 290 | Ga0105243_10010939 | 3300009148 | Bacteria | 6863 |
| 291 | Ga0105243_10053140 | 3300009148 | Bacteria | 3212 |
| 292 | Ga0105243_10077088 | 3300009148 | Bacteria | 2710 |
| 293 | Ga0105243_10262958 | 3300009148 | Bacteria | 1546 |
| 294 | Ga0105241_10016620 | 3300009174 | Bacteria | 5400 |
| 295 | Ga0105241_10150284 | 3300009174 | Bacteria | 1905 |
| 296 | Ga0105242_10002750 | 3300009176 | Bacteria | 13769 |
| 297 | Ga0105242_10139885 | 3300009176 | Bacteria | 2099 |
| 298 | Ga0105242_10364229 | 3300009176 | Bacteria | 1339 |
| 299 | Ga0105248_10008760 | 3300009177 | Bacteria | 11109 |
| 300 | Ga0105248_10028581 | 3300009177 | Bacteria | 6213 |
| 301 | Ga0105248_10082693 | 3300009177 | Bacteria | 3612 |
| 302 | Ga0105248_10174301 | 3300009177 | Bacteria | 2424 |
| 303 | Ga0105237_10093576 | 3300009545 | Bacteria | 2995 |
| 304 | Ga0105237_10143492 | 3300009545 | Bacteria | 2382 |
| 305 | Ga0105249_10003569 | 3300009553 | Bacteria | 13468 |
| 306 | Ga0105249_10031634 | 3300009553 | Bacteria | 4786 |
| 307 | Ga0105249_10050414 | 3300009553 | Bacteria | 3795 |
| 308 | Ga0105249_10059940 | 3300009553 | Bacteria | 3491 |
| 309 | Ga0105249_10208644 | 3300009553 | Bacteria | 1916 |
| 310 | Ga0105249_10220964 | 3300009553 | Bacteria | 1864 |
| 311 | Ga0105249_10265321 | 3300009553 | Bacteria | 1708 |
| 312 | Ga0099796_10006814 | 3300010159 | Bacteria | 2948 |
| 313 | Ga0105239_10042407 | 3300010375 | Bacteria | 4986 |
| 314 | Ga0105246_10004229 | 3300011119 | Bacteria | 8730 |
| 315 | Ga0157373_10009902 | 3300013100 | Bacteria | 7026 |
| 316 | Ga0157373_10206307 | 3300013100 | Bacteria | 1386 |
| 317 | Ga0157371_10002099 | 3300013102 | Bacteria | 19457 |
| 318 | Ga0157371_10044656 | 3300013102 | Bacteria | 3155 |
| 319 | Ga0157370_10011428 | 3300013104 | Bacteria | 9284 |
| 320 | Ga0157370_10019171 | 3300013104 | Bacteria | 6874 |
| 321 | Ga0157370_10033592 | 3300013104 | Bacteria | 5002 |
| 322 | Ga0157370_10039400 | 3300013104 | Bacteria | 4567 |
| 323 | Ga0157369_10073263 | 3300013105 | Bacteria | 3675 |
| 324 | Ga0157374_10011166 | 3300013296 | Bacteria | 7764 |
| 325 | Ga0157374_10024259 | 3300013296 | Bacteria | 5435 |
| 326 | Ga0157374_10098146 | 3300013296 | Bacteria | 2804 |
| 327 | Ga0157374_10420429 | 3300013296 | Bacteria | 1335 |
| 328 | Ga0157378_10000513 | 3300013297 | Bacteria | 36841 |
| 329 | Ga0157378_10009903 | 3300013297 | Bacteria | 8309 |
| 330 | Ga0157378_10053762 | 3300013297 | Bacteria | 3585 |
| 331 | Ga0157378_10076259 | 3300013297 | Bacteria | 3021 |
| 332 | Ga0163162_10016190 | 3300013306 | Bacteria | 7292 |
| 333 | Ga0163162_10035127 | 3300013306 | Bacteria | 4992 |
| 334 | Ga0163162_10060878 | 3300013306 | Bacteria | 3812 |
| 335 | Ga0163162_10099873 | 3300013306 | Bacteria | 2993 |
| 336 | Ga0157372_10002796 | 3300013307 | Bacteria | 18867 |
| 337 | Ga0157372_10020807 | 3300013307 | Bacteria | 7085 |
| 338 | Ga0157372_10070958 | 3300013307 | Bacteria | 3921 |
| 339 | Ga0157372_10086116 | 3300013307 | Bacteria | 3565 |
| 340 | Ga0157372_10107329 | 3300013307 | Bacteria | 3195 |
| 341 | Ga0157372_10147435 | 3300013307 | Bacteria | 2714 |
| 342 | Ga0157375_10128455 | 3300013308 | Bacteria | 2652 |
| 343 | Ga0157375_10200891 | 3300013308 | Bacteria | 2149 |
| 344 | Ga0157375_10208708 | 3300013308 | Bacteria | 2110 |
| 345 | Ga0157375_10218469 | 3300013308 | Bacteria | 2064 |
| 346 | Ga0163163_10010180 | 3300014325 | Bacteria | 8441 |
| 347 | Ga0163163_10035789 | 3300014325 | Bacteria | 4819 |
| 348 | Ga0163163_10180510 | 3300014325 | Bacteria | 2158 |
| 349 | Ga0163163_10387937 | 3300014325 | Unclassified | 1454 |
| 350 | Ga0157380_10087441 | 3300014326 | Bacteria | 2563 |
| 351 | Ga0157380_10096710 | 3300014326 | Bacteria | 2449 |
| 352 | Ga0157380_10116711 | 3300014326 | Bacteria | 2253 |
| 353 | Ga0157380_10160607 | 3300014326 | Bacteria | 1953 |
| 354 | Ga0157380_10279869 | 3300014326 | Bacteria | 1526 |
| 355 | Ga0157377_10050364 | 3300014745 | Bacteria | 2345 |
| 356 | Ga0157377_10078653 | 3300014745 | Bacteria | 1923 |
| 357 | Ga0157379_10011496 | 3300014968 | Bacteria | 7726 |
| 358 | Ga0157379_10023755 | 3300014968 | Bacteria | 5443 |
| 359 | Ga0157379_10109497 | 3300014968 | Bacteria | 2481 |
| 360 | Ga0157379_10164364 | 3300014968 | Bacteria | 2003 |
| 361 | Ga0157376_10006851 | 3300014969 | Bacteria | 8067 |
| 362 | Ga0157376_10020315 | 3300014969 | Bacteria | 5136 |
| 363 | Ga0157376_10025322 | 3300014969 | Bacteria | 4672 |
| 364 | Ga0157376_10042371 | 3300014969 | Bacteria | 3731 |
| 365 | Ga0213872_10002840 | 3300021361 | Bacteria | 9903 |
| 366 | Ga0213872_10042638 | 3300021361 | Bacteria | 2069 |
| 367 | Ga0207697_10001236 | 3300025315 | Bacteria | 14007 |
| 368 | Ga0207697_10005837 | 3300025315 | Bacteria | 5660 |
| 369 | Ga0207697_10028346 | 3300025315 | Bacteria | 2290 |
| 370 | Ga0207697_10062256 | 3300025315 | Bacteria | 1553 |
| 371 | Ga0207656_10014928 | 3300025321 | Bacteria | 3001 |
| 372 | Ga0207656_10019839 | 3300025321 | Bacteria | 2663 |
| 373 | Ga0207656_10020499 | 3300025321 | Bacteria | 2629 |
| 374 | Ga0207653_10020696 | 3300025885 | Bacteria | 2084 |
| 375 | Ga0207682_10000591 | 3300025893 | Bacteria | 16825 |
| 376 | Ga0207682_10002805 | 3300025893 | Bacteria | 7708 |
| 377 | Ga0207642_10000571 | 3300025899 | Bacteria | 11335 |
| 378 | Ga0207680_10030801 | 3300025903 | Bacteria | 3031 |
| 379 | Ga0207680_10097531 | 3300025903 | Bacteria | 1882 |
| 380 | Ga0207680_10164001 | 3300025903 | Bacteria | 1492 |
| 381 | Ga0207699_10118891 | 3300025906 | Bacteria | 1706 |
| 382 | Ga0207645_10002628 | 3300025907 | Bacteria | 14013 |
| 383 | Ga0207645_10003041 | 3300025907 | Bacteria | 12911 |
| 384 | Ga0207645_10007073 | 3300025907 | Bacteria | 7980 |
| 385 | Ga0207645_10015078 | 3300025907 | Bacteria | 5148 |
| 386 | Ga0207643_10000499 | 3300025908 | Bacteria | 25068 |
| 387 | Ga0207643_10014374 | 3300025908 | Bacteria | 4298 |
| 388 | Ga0207643_10017637 | 3300025908 | Bacteria | 3905 |
| 389 | Ga0207705_10087109 | 3300025909 | Bacteria | 2283 |
| 390 | Ga0207705_10148010 | 3300025909 | Bacteria | 1758 |
| 391 | Ga0207684_10000011 | 3300025910 | Bacteria | 502991 |
| 392 | Ga0207684_10012905 | 3300025910 | Bacteria | 7236 |
| 393 | Ga0207684_10136096 | 3300025910 | Bacteria | 2109 |
| 394 | Ga0207654_10068443 | 3300025911 | Bacteria | 2100 |
| 395 | Ga0207707_10005874 | 3300025912 | Bacteria | 10731 |
| 396 | Ga0207707_10007548 | 3300025912 | Bacteria | 9476 |
| 397 | Ga0207707_10046103 | 3300025912 | Bacteria | 3796 |
| 398 | Ga0207707_10056787 | 3300025912 | Bacteria | 3406 |
| 399 | Ga0207707_10271143 | 3300025912 | Bacteria | 1471 |
| 400 | Ga0207695_10096007 | 3300025913 | Bacteria | 2967 |
| 401 | Ga0207693_10167898 | 3300025915 | Bacteria | 1728 |
| 402 | Ga0207660_10037128 | 3300025917 | Bacteria | 3393 |
| 403 | Ga0207660_10037879 | 3300025917 | Bacteria | 3363 |
| 404 | Ga0207662_10000165 | 3300025918 | Bacteria | 31387 |
| 405 | Ga0207662_10023040 | 3300025918 | Bacteria | 3574 |
| 406 | Ga0207662_10062741 | 3300025918 | Bacteria | 2234 |
| 407 | Ga0207657_10001461 | 3300025919 | Bacteria | 25304 |
| 408 | Ga0207657_10004800 | 3300025919 | Bacteria | 14258 |
| 409 | Ga0207657_10004830 | 3300025919 | Bacteria | 14197 |
| 410 | Ga0207657_10120581 | 3300025919 | Bacteria | 2158 |
| 411 | Ga0207649_10004780 | 3300025920 | Bacteria | 7325 |
| 412 | Ga0207649_10008725 | 3300025920 | Bacteria | 5534 |
| 413 | Ga0207649_10127255 | 3300025920 | Bacteria | 1726 |
| 414 | Ga0207652_10005474 | 3300025921 | Bacteria | 10304 |
| 415 | Ga0207652_10015335 | 3300025921 | Bacteria | 6222 |
| 416 | Ga0207652_10085744 | 3300025921 | Bacteria | 2760 |
| 417 | Ga0207646_10034163 | 3300025922 | Bacteria | 4596 |
| 418 | Ga0207681_10004257 | 3300025923 | Bacteria | 8833 |
| 419 | Ga0207681_10032634 | 3300025923 | Bacteria | 3410 |
| 420 | Ga0207681_10034101 | 3300025923 | Bacteria | 3344 |
| 421 | Ga0207681_10046733 | 3300025923 | Bacteria | 2912 |
| 422 | Ga0207681_10278528 | 3300025923 | Bacteria | 1316 |
| 423 | Ga0207650_10003776 | 3300025925 | Bacteria | 10360 |
| 424 | Ga0207650_10018964 | 3300025925 | Bacteria | 4833 |
| 425 | Ga0207650_10025714 | 3300025925 | Bacteria | 4195 |
| 426 | Ga0207659_10002570 | 3300025926 | Bacteria | 10805 |
| 427 | Ga0207659_10011642 | 3300025926 | Bacteria | 5565 |
| 428 | Ga0207659_10019110 | 3300025926 | Bacteria | 4503 |
| 429 | Ga0207659_10161775 | 3300025926 | Bacteria | 1758 |
| 430 | Ga0207659_10211293 | 3300025926 | Bacteria | 1555 |
| 431 | Ga0207687_10004557 | 3300025927 | Bacteria | 9222 |
| 432 | Ga0207664_10374727 | 3300025929 | Bacteria | 1263 |
| 433 | Ga0207644_10018852 | 3300025931 | Bacteria | 4675 |
| 434 | Ga0207644_10025187 | 3300025931 | Bacteria | 4090 |
| 435 | Ga0207644_10043980 | 3300025931 | Bacteria | 3171 |
| 436 | Ga0207644_10050722 | 3300025931 | Bacteria | 2975 |
| 437 | Ga0207644_10196913 | 3300025931 | Bacteria | 1587 |
| 438 | Ga0207644_10200593 | 3300025931 | Bacteria | 1573 |
| 439 | Ga0207690_10002569 | 3300025932 | Bacteria | 10965 |
| 440 | Ga0207690_10164059 | 3300025932 | Bacteria | 1659 |
| 441 | Ga0207706_10000040 | 3300025933 | Bacteria | 132285 |
| 442 | Ga0207706_10002512 | 3300025933 | Bacteria | 17885 |
| 443 | Ga0207706_10018329 | 3300025933 | Bacteria | 6300 |
| 444 | Ga0207706_10036204 | 3300025933 | Bacteria | 4385 |
| 445 | Ga0207706_10073637 | 3300025933 | Bacteria | 3004 |
| 446 | Ga0207706_10099342 | 3300025933 | Bacteria | 2560 |
| 447 | Ga0207706_10158273 | 3300025933 | Bacteria | 1991 |
| 448 | Ga0207686_10002408 | 3300025934 | Bacteria | 10187 |
| 449 | Ga0207709_10006187 | 3300025935 | Bacteria | 6739 |
| 450 | Ga0207709_10039123 | 3300025935 | Bacteria | 2830 |
| 451 | Ga0207709_10075431 | 3300025935 | Bacteria | 2155 |
| 452 | Ga0207670_10019224 | 3300025936 | Bacteria | 4168 |
| 453 | Ga0207669_10125569 | 3300025937 | Bacteria | 1752 |
| 454 | Ga0207669_10181699 | 3300025937 | Bacteria | 1509 |
| 455 | Ga0207704_10000191 | 3300025938 | Bacteria | 32206 |
| 456 | Ga0207704_10000578 | 3300025938 | Bacteria | 16311 |
| 457 | Ga0207704_10008379 | 3300025938 | Bacteria | 4940 |
| 458 | Ga0207665_10059228 | 3300025939 | Bacteria | 2591 |
| 459 | Ga0207691_10002088 | 3300025940 | Bacteria | 19508 |
| 460 | Ga0207691_10002892 | 3300025940 | Bacteria | 16739 |
| 461 | Ga0207691_10011283 | 3300025940 | Bacteria | 8572 |
| 462 | Ga0207691_10023496 | 3300025940 | Bacteria | 5804 |
| 463 | Ga0207691_10071431 | 3300025940 | Bacteria | 3132 |
| 464 | Ga0207691_10072372 | 3300025940 | Bacteria | 3109 |
| 465 | Ga0207691_10096585 | 3300025940 | Bacteria | 2642 |
| 466 | Ga0207711_10032978 | 3300025941 | Bacteria | 4380 |
| 467 | Ga0207711_10037450 | 3300025941 | Bacteria | 4120 |
| 468 | Ga0207711_10047226 | 3300025941 | Bacteria | 3680 |
| 469 | Ga0207689_10000475 | 3300025942 | Bacteria | 37746 |
| 470 | Ga0207689_10000859 | 3300025942 | Bacteria | 29309 |
| 471 | Ga0207689_10003002 | 3300025942 | Bacteria | 15561 |
| 472 | Ga0207689_10016138 | 3300025942 | Bacteria | 6324 |
| 473 | Ga0207689_10045413 | 3300025942 | Bacteria | 3632 |
| 474 | Ga0207689_10055979 | 3300025942 | Bacteria | 3245 |
| 475 | Ga0207661_10023637 | 3300025944 | Bacteria | 4646 |
| 476 | Ga0207661_10046948 | 3300025944 | Bacteria | 3426 |
| 477 | Ga0207679_10007077 | 3300025945 | Bacteria | 7112 |
| 478 | Ga0207679_10010729 | 3300025945 | Bacteria | 5910 |
| 479 | Ga0207679_10033663 | 3300025945 | Bacteria | 3608 |
| 480 | Ga0207679_10177424 | 3300025945 | Bacteria | 1759 |
| 481 | Ga0207679_10179301 | 3300025945 | Bacteria | 1751 |
| 482 | Ga0207667_10016457 | 3300025949 | Bacteria | 8356 |
| 483 | Ga0207667_10025236 | 3300025949 | Bacteria | 6509 |
| 484 | Ga0207667_10415657 | 3300025949 | Bacteria | 1369 |
| 485 | Ga0207667_10439886 | 3300025949 | Bacteria | 1326 |
| 486 | Ga0207651_10032603 | 3300025960 | Bacteria | 3349 |
| 487 | Ga0207651_10039003 | 3300025960 | Bacteria | 3127 |
| 488 | Ga0207651_10271649 | 3300025960 | Bacteria | 1396 |
| 489 | Ga0207712_10121541 | 3300025961 | Bacteria | 1976 |
| 490 | Ga0207712_10211564 | 3300025961 | Bacteria | 1545 |
| 491 | Ga0207712_10425808 | 3300025961 | Bacteria | 1121 |
| 492 | Ga0207668_10026334 | 3300025972 | Bacteria | 3775 |
| 493 | Ga0207668_10061110 | 3300025972 | Bacteria | 2648 |
| 494 | Ga0207668_10103129 | 3300025972 | Bacteria | 2124 |
| 495 | Ga0207640_10031905 | 3300025981 | Bacteria | 3262 |
| 496 | Ga0207640_10035874 | 3300025981 | Bacteria | 3107 |
| 497 | Ga0207640_10038600 | 3300025981 | Bacteria | 3015 |
| 498 | Ga0207658_10020441 | 3300025986 | Bacteria | 4583 |
| 499 | Ga0207658_10028439 | 3300025986 | Bacteria | 3936 |
| 500 | Ga0207677_10009984 | 3300026023 | Bacteria | 5357 |
| 501 | Ga0207677_10036364 | 3300026023 | Bacteria | 3209 |
| 502 | Ga0207677_10070928 | 3300026023 | Bacteria | 2457 |
| 503 | Ga0207677_10081003 | 3300026023 | Bacteria | 2328 |
| 504 | Ga0207677_10123312 | 3300026023 | Bacteria | 1953 |
| 505 | Ga0207703_10001336 | 3300026035 | Bacteria | 22598 |
| 506 | Ga0207703_10029051 | 3300026035 | Bacteria | 4361 |
| 507 | Ga0207703_10037690 | 3300026035 | Bacteria | 3852 |
| 508 | Ga0207703_10078016 | 3300026035 | Bacteria | 2751 |
| 509 | Ga0207703_10115623 | 3300026035 | Bacteria | 2296 |
| 510 | Ga0207703_10168487 | 3300026035 | Bacteria | 1925 |
| 511 | Ga0207639_10022909 | 3300026041 | Bacteria | 4504 |
| 512 | Ga0207639_10250317 | 3300026041 | Bacteria | 1545 |
| 513 | Ga0207678_10005737 | 3300026067 | Bacteria | 11079 |
| 514 | Ga0207678_10201809 | 3300026067 | Bacteria | 1701 |
| 515 | Ga0207708_10000465 | 3300026075 | Bacteria | 31214 |
| 516 | Ga0207708_10000874 | 3300026075 | Bacteria | 22683 |
| 517 | Ga0207708_10119162 | 3300026075 | Bacteria | 2056 |
| 518 | Ga0207702_10079932 | 3300026078 | Bacteria | 2835 |
| 519 | Ga0207702_10084879 | 3300026078 | Bacteria | 2758 |
| 520 | Ga0207702_10122576 | 3300026078 | Bacteria | 2329 |
| 521 | Ga0207702_10211194 | 3300026078 | Bacteria | 1804 |
| 522 | Ga0207702_10273703 | 3300026078 | Bacteria | 1593 |
| 523 | Ga0207641_10061543 | 3300026088 | Bacteria | 3201 |
| 524 | Ga0207641_10102622 | 3300026088 | Bacteria | 2522 |
| 525 | Ga0207641_10158709 | 3300026088 | Bacteria | 2054 |
| 526 | Ga0207641_10183493 | 3300026088 | Bacteria | 1918 |
| 527 | Ga0207641_10209669 | 3300026088 | Bacteria | 1801 |
| 528 | Ga0207641_10387955 | 3300026088 | Bacteria | 1339 |
| 529 | Ga0207641_10440816 | 3300026088 | Bacteria | 1257 |
| 530 | Ga0207648_10000171 | 3300026089 | Bacteria | 67246 |
| 531 | Ga0207648_10000711 | 3300026089 | Bacteria | 37350 |
| 532 | Ga0207648_10007174 | 3300026089 | Bacteria | 10985 |
| 533 | Ga0207648_10012551 | 3300026089 | Bacteria | 7927 |
| 534 | Ga0207648_10033218 | 3300026089 | Bacteria | 4551 |
| 535 | Ga0207648_10194084 | 3300026089 | Bacteria | 1800 |
| 536 | Ga0207648_10262874 | 3300026089 | Bacteria | 1540 |
| 537 | Ga0207676_10153236 | 3300026095 | Bacteria | 1987 |
| 538 | Ga0207676_10237503 | 3300026095 | Bacteria | 1633 |
| 539 | Ga0207676_10282200 | 3300026095 | Bacteria | 1508 |
| 540 | Ga0207674_10001481 | 3300026116 | Bacteria | 30323 |
| 541 | Ga0207674_10003155 | 3300026116 | Bacteria | 20315 |
| 542 | Ga0207674_10020682 | 3300026116 | Bacteria | 7102 |
| 543 | Ga0207674_10064045 | 3300026116 | Bacteria | 3709 |
| 544 | Ga0207675_100000321 | 3300026118 | Bacteria | 45579 |
| 545 | Ga0207675_100006158 | 3300026118 | Bacteria | 11397 |
| 546 | Ga0207675_100013607 | 3300026118 | Bacteria | 7596 |
| 547 | Ga0207675_100021027 | 3300026118 | Bacteria | 6083 |
| 548 | Ga0207675_100068014 | 3300026118 | Bacteria | 3330 |
| 549 | Ga0207675_100138421 | 3300026118 | Bacteria | 2311 |
| 550 | Ga0207675_100167502 | 3300026118 | Bacteria | 2099 |
| 551 | Ga0207683_10000495 | 3300026121 | Bacteria | 36463 |
| 552 | Ga0207683_10003852 | 3300026121 | Bacteria | 13017 |
| 553 | Ga0207683_10080683 | 3300026121 | Bacteria | 2886 |
| 554 | Ga0207698_10007657 | 3300026142 | Bacteria | 6773 |
| 555 | Ga0207698_10074746 | 3300026142 | Bacteria | 2705 |
| 556 | Ga0207698_10093542 | 3300026142 | Bacteria | 2468 |
| 557 | Ga0207698_10125633 | 3300026142 | Bacteria | 2181 |
| 558 | Ga0207698_10295962 | 3300026142 | Bacteria | 1504 |
| 559 | Ga0207698_10372329 | 3300026142 | Bacteria | 1356 |
| 560 | Ga0209969_1000330 | 3300027360 | Bacteria | 6325 |
| 561 | Ga0209981_1001876 | 3300027378 | Bacteria | 2677 |
| 562 | Ga0210000_1000147 | 3300027462 | Bacteria | 9923 |
| 563 | Ga0209999_1001932 | 3300027543 | Bacteria | 3604 |
| 564 | Ga0209970_1003429 | 3300027614 | Bacteria | 2667 |
| 565 | Ga0209983_1007041 | 3300027665 | Bacteria | 2309 |
| 566 | Ga0209588_1000012 | 3300027671 | Bacteria | 141363 |
| 567 | Ga0209588_1004068 | 3300027671 | Bacteria | 4096 |
| 568 | Ga0209971_1001105 | 3300027682 | Bacteria | 6847 |
| 569 | Ga0209971_1021721 | 3300027682 | Bacteria | 1527 |
| 570 | Ga0209966_1002806 | 3300027695 | Bacteria | 2920 |
| 571 | Ga0209974_10000361 | 3300027876 | Bacteria | 14944 |
| 572 | Ga0209974_10004246 | 3300027876 | Bacteria | 5116 |
| 573 | Ga0207428_10005465 | 3300027907 | Bacteria | 11846 |
| 574 | Ga0207428_10098204 | 3300027907 | Bacteria | 2266 |
| 575 | Ga0268266_10104709 | 3300028379 | Bacteria | 2498 |
| 576 | Ga0268265_10000628 | 3300028380 | Bacteria | 35160 |
| 577 | Ga0268265_10000632 | 3300028380 | Bacteria | 35050 |
| 578 | Ga0268265_10015330 | 3300028380 | Bacteria | 5242 |
| 579 | Ga0268265_10347951 | 3300028380 | Bacteria | 1352 |
| 580 | Ga0268265_10356661 | 3300028380 | Bacteria | 1337 |
| 581 | Ga0268264_10000745 | 3300028381 | Bacteria | 36883 |
| 582 | Ga0268264_10041569 | 3300028381 | Bacteria | 3804 |
| 583 | Ga0268264_10053965 | 3300028381 | Bacteria | 3355 |
| 584 | Ga0268264_10528131 | 3300028381 | Bacteria | 1154 |
| 585 | Ga0265318_10001865 | 3300028577 | Bacteria | 11857 |
| 586 | Ga0265330_10011762 | 3300031235 | Bacteria | 4099 |
| 587 | Ga0265332_10001879 | 3300031238 | Bacteria | 11159 |
| 588 | Ga0265329_10009644 | 3300031242 | Bacteria | 3587 |
| 589 | Ga0265331_10001401 | 3300031250 | Bacteria | 17695 |
| 590 | Ga0265327_10005966 | 3300031251 | Bacteria | 9925 |
| 591 | Ga0265316_10039732 | 3300031344 | Bacteria | 3777 |
| 592 | Ga0307408_100003702 | 3300031548 | Bacteria | 10411 |
| 593 | Ga0307408_100025589 | 3300031548 | Bacteria | 4044 |
| 594 | Ga0307408_100173265 | 3300031548 | Bacteria | 1724 |
| 595 | Ga0307408_100236196 | 3300031548 | Bacteria | 1500 |
| 596 | Ga0316575_10004283 | 3300031665 | Bacteria | 5014 |
| 597 | Ga0265314_10000660 | 3300031711 | Bacteria | 42242 |
| 598 | Ga0316576_10024457 | 3300031727 | Bacteria | 4218 |
| 599 | Ga0316578_10086363 | 3300031728 | Bacteria | 1870 |
| 600 | Ga0307405_10011070 | 3300031731 | Bacteria | 4709 |
| 601 | Ga0307413_10007215 | 3300031824 | Bacteria | 5142 |
| 602 | Ga0307413_10070379 | 3300031824 | Bacteria | 2200 |
| 603 | Ga0307410_10051952 | 3300031852 | Bacteria | 2765 |
| 604 | Ga0307410_10153245 | 3300031852 | Bacteria | 1718 |
| 605 | Ga0307406_10014335 | 3300031901 | Bacteria | 4559 |
| 606 | Ga0307407_10216374 | 3300031903 | Bacteria | 1293 |
| 607 | Ga0307412_10018282 | 3300031911 | Bacteria | 4215 |
| 608 | Ga0307409_100075555 | 3300031995 | Bacteria | 2698 |
| 609 | Ga0307416_100006356 | 3300032002 | Bacteria | 7388 |
| 610 | Ga0307416_100007756 | 3300032002 | Bacteria | 6861 |
| 611 | Ga0307416_100192463 | 3300032002 | Bacteria | 1925 |
| 612 | Ga0307414_10038324 | 3300032004 | Bacteria | 3218 |
| 613 | Ga0307414_10069181 | 3300032004 | Bacteria | 2537 |
| 614 | Ga0307414_10139567 | 3300032004 | Bacteria | 1895 |
| 615 | Ga0316583_10000317 | 3300032133 | Bacteria | 13570 |
| 616 | Ga0373930_0002774 | 3300034816 | Bacteria | 2736 |
| 617 | Ga0373938_0014320 | 3300034957 | Bacteria | 1520 |
| 618 | Ga0373929_0002976 | 3300035085 | Bacteria | 3082 |
| 619 | Ga0373934_0000665 | 3300035086 | Bacteria | 12185 |
| 620 | Ga0373944_0053331 | 3300035089 | Bacteria | 1279 |
| 621 | Ga0373952_0008361 | 3300035092 | Bacteria | 1962 |
| 622 | Ga0373923_0031043 | 3300035111 | Bacteria | 2152 |
| 623 | Ga0373936_0009560 | 3300035113 | Bacteria | 3653 |
| 624 | Ga0373939_0002617 | 3300035114 | Bacteria | 4228 |
| 625 | Ga0373939_0037568 | 3300035114 | Bacteria | 1439 |
| 626 | Ga0373945_0009999 | 3300035116 | Bacteria | 3117 |
| 627 | Ga0373953_0004673 | 3300035117 | Bacteria | 4383 |
| 628 | Ga0373954_0000389 | 3300035118 | Bacteria | 16397 |
| 629 | Ga0373956_0000018 | 3300035119 | Bacteria | 50671 |
| 630 | Ga0373956_0056558 | 3300035119 | Bacteria | 1771 |
| 631 | Ga0373957_0039924 | 3300035120 | Bacteria | 1762 |
| 632 | Ga0373960_0004502 | 3300035121 | Bacteria | 3200 |
| 633 | Ga0373960_0033058 | 3300035121 | Bacteria | 1456 |
| 634 | Ga0373946_0011173 | 3300035171 | Bacteria | 3343 |
| 635 | Ga0373955_0009217 | 3300035172 | Bacteria | 4618 |
| 636 | Ga0373942_0011370 | 3300035207 | Bacteria | 2110 |
| 637 | Ga0373961_0003067 | 3300035241 | Bacteria | 4203 |
| 638 | Ga0373962_0016319 | 3300035242 | Bacteria | 1914 |
| 639 | Ga0316574_0072415 | 3300035398 | Bacteria | 2178 |
| 640 | Ga0316574_0102261 | 3300035398 | Bacteria | 1834 |
| 641 | Ga0316574_0192804 | 3300035398 | Bacteria | 1310 |
| 642 | Ga0373931_0000773 | 3300035691 | Bacteria | 13396 |
| 643 | Ga0373931_0045669 | 3300035691 | Bacteria | 2314 |
| 644 | Ga0373935_0018030 | 3300035692 | Bacteria | 4290 |
| 645 | Ga0373935_0020582 | 3300035692 | Bacteria | 4031 |
| 646 | Ga0373927_0147834 | 3300035695 | Bacteria | 1538 |
| 647 | Ga0373933_0000035 | 3300035724 | Bacteria | 82702 |
| 648 | Ga0373933_0009221 | 3300035724 | Bacteria | 5387 |
| 649 | Ga0373933_0169588 | 3300035724 | Bacteria | 1388 |
| 650 | Ga0373947_0099612 | 3300035725 | Bacteria | 1824 |
| 651 | Ga0373937_0001626 | 3300036401 | Bacteria | 18870 |
| 652 | Ga0373937_0002135 | 3300036401 | Bacteria | 16540 |
| 653 | Ga0373937_0005243 | 3300036401 | Bacteria | 11072 |
| 654 | Ga0373937_0037732 | 3300036401 | Bacteria | 4404 |
| 655 | Ga0373937_0046927 | 3300036401 | Bacteria | 3951 |
| 656 | Ga0316582_0183874 | 3300036647 | Bacteria | 1423 |
| 657 | Ga0316584_0021550 | 3300036712 | Bacteria | 4685 |
| 658 | Ga0316584_0061119 | 3300036712 | Bacteria | 2822 |
| 659 | Ga0436360_0957938 | 3300039438 | Bacteria | 3100 |
| 660 | Ga0436361_0000750 | 3300039447 | Bacteria | 11682 |
| 661 | Ga0436361_0024448 | 3300039447 | Bacteria | 32744 |
| 662 | Ga0436361_0469964 | 3300039447 | Bacteria | 3776 |
| 663 | Ga0439435_0000410 | 3300042436 | Bacteria | 6651 |
| 664 | Ga0439435_0030399 | 3300042436 | Bacteria | 1464 |
| 665 | Ga0439444_0007833 | 3300042437 | Bacteria | 1652 |
| 666 | Ga0451577_0000198 | 3300042876 | Bacteria | 126177 |
| 667 | Ga0451577_0005723 | 3300042876 | Bacteria | 12612 |
| 668 | Ga0451577_0019539 | 3300042876 | Bacteria | 6228 |
| 669 | Ga0451577_0026224 | 3300042876 | Bacteria | 5278 |
| 670 | Ga0451577_0116022 | 3300042876 | Bacteria | 2398 |
| 671 | Ga0451577_0151938 | 3300042876 | Bacteria | 2083 |
| 672 | Ga0451577_0273658 | 3300042876 | Bacteria | 1529 |
| 673 | Ga0453683_0000297 | 3300044673 | Bacteria | 63651 |
| 674 | Ga0453683_0000327 | 3300044673 | Bacteria | 58419 |
| 675 | Ga0453683_0000574 | 3300044673 | Bacteria | 40638 |
| 676 | Ga0453683_0006691 | 3300044673 | Bacteria | 7887 |
| 677 | Ga0453683_0009683 | 3300044673 | Bacteria | 6424 |
| 678 | Ga0453683_0017269 | 3300044673 | Bacteria | 4648 |
| 679 | Ga0453683_0019936 | 3300044673 | Bacteria | 4288 |
| 680 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 681 | Ga0453684_0000237 | 3300044712 | Bacteria | 236999 |
| 682 | Ga0453684_0000654 | 3300044712 | Bacteria | 124616 |
| 683 | Ga0453684_0000736 | 3300044712 | Bacteria | 114722 |
| 684 | Ga0453684_0002679 | 3300044712 | Bacteria | 42376 |
| 685 | Ga0453684_0003313 | 3300044712 | Bacteria | 36677 |
| 686 | Ga0453684_0003721 | 3300044712 | Bacteria | 33765 |
| 687 | Ga0453684_0006018 | 3300044712 | Bacteria | 23488 |
| 688 | Ga0453684_0006774 | 3300044712 | Bacteria | 21561 |
| 689 | Ga0453684_0049307 | 3300044712 | Bacteria | 5555 |
| 690 | Ga0453684_0052107 | 3300044712 | Bacteria | 5355 |
| 691 | Ga0453684_0055351 | 3300044712 | Bacteria | 5158 |
| 692 | Ga0453684_0116990 | 3300044712 | Bacteria | 3226 |
| 693 | Ga0453684_0119048 | 3300044712 | Bacteria | 3192 |
| 694 | Ga0453684_0169758 | 3300044712 | Bacteria | 2572 |
| 695 | Ga0453684_0359907 | 3300044712 | Bacteria | 1638 |
| 696 | Ga0451576_0000519 | 3300045051 | Bacteria | 84375 |
| 697 | Ga0451576_0001482 | 3300045051 | Bacteria | 39694 |
| 698 | Ga0451576_0002358 | 3300045051 | Bacteria | 28480 |
| 699 | Ga0451576_0002911 | 3300045051 | Bacteria | 24410 |
| 700 | Ga0451576_0003917 | 3300045051 | Bacteria | 19880 |
| 701 | Ga0451576_0005086 | 3300045051 | Bacteria | 16671 |
| 702 | Ga0451576_0032170 | 3300045051 | Bacteria | 5589 |
| 703 | Ga0451576_0168532 | 3300045051 | Bacteria | 2285 |
| 704 | Ga0451576_0219477 | 3300045051 | Bacteria | 1985 |
| 705 | Ga0451576_0241404 | 3300045051 | Bacteria | 1887 |
| 706 | Ga0451576_0361155 | 3300045051 | Bacteria | 1521 |
| 707 | Ga0495592_0000274 | 3300046454 | Bacteria | 44078 |
| 708 | Ga0495651_0000350 | 3300046462 | Bacteria | 35585 |
| 709 | Ga0495653_0060544 | 3300046463 | Bacteria | 2868 |
| 710 | Ga0495653_0136307 | 3300046463 | Bacteria | 1731 |
| 711 | Ga0495582_0049451 | 3300046473 | Bacteria | 2315 |
| 712 | Ga0495582_0101702 | 3300046473 | Bacteria | 1609 |
| 713 | Ga0495639_0040638 | 3300046475 | Bacteria | 2093 |
| 714 | Ga0495662_0006621 | 3300046476 | Bacteria | 5782 |
| 715 | Ga0495608_0000280 | 3300046511 | Bacteria | 36413 |
| 716 | Ga0495618_0110775 | 3300046514 | Bacteria | 1757 |
| 717 | Ga0495628_0000155 | 3300046516 | Bacteria | 59667 |
| 718 | Ga0495628_0051437 | 3300046516 | Bacteria | 3257 |
| 719 | Ga0495630_0001456 | 3300046517 | Bacteria | 16398 |
| 720 | Ga0495630_0015088 | 3300046517 | Bacteria | 5637 |
| 721 | Ga0495630_0060932 | 3300046517 | Bacteria | 2833 |
| 722 | Ga0495642_0018049 | 3300046528 | Bacteria | 2759 |
| 723 | Ga0495642_0021115 | 3300046528 | Bacteria | 2560 |
| 724 | Ga0495652_0078352 | 3300046529 | Bacteria | 2736 |
| 725 | Ga0495665_0011370 | 3300046531 | Bacteria | 4818 |
| 726 | Ga0495640_0000538 | 3300046533 | Bacteria | 27842 |
| 727 | Ga0495586_0000293 | 3300046535 | Bacteria | 31784 |
| 728 | Ga0495586_0000714 | 3300046535 | Bacteria | 18914 |
| 729 | Ga0495586_0126856 | 3300046535 | Bacteria | 1427 |
| 730 | Ga0495586_0139818 | 3300046535 | Bacteria | 1359 |
| 731 | Ga0495621_0013645 | 3300046539 | Bacteria | 2557 |
| 732 | Ga0495621_0053449 | 3300046539 | Bacteria | 1450 |
| 733 | Ga0495645_0023581 | 3300046543 | Bacteria | 4457 |
| 734 | Ga0495622_0127485 | 3300046557 | Bacteria | 1160 |
| 735 | Ga0495667_0010591 | 3300046559 | Bacteria | 6237 |
| 736 | Ga0495667_0018886 | 3300046559 | Bacteria | 4656 |
| 737 | Ga0495656_0033759 | 3300046615 | Bacteria | 2090 |
| 738 | Ga0495634_0006512 | 3300046642 | Bacteria | 8871 |
| 739 | Ga0495635_0038509 | 3300046663 | Bacteria | 3310 |
| 740 | Ga0495588_0029651 | 3300046674 | Bacteria | 2746 |
| 741 | Ga0495588_0125924 | 3300046674 | Bacteria | 1351 |
| 742 | Ga0495599_0007055 | 3300046678 | Bacteria | 6799 |
| 743 | Ga0495599_0068387 | 3300046678 | Bacteria | 2217 |
| 744 | Ga0495647_0000064 | 3300046681 | Bacteria | 26717 |
| 745 | Ga0495647_0070227 | 3300046681 | Bacteria | 1401 |
| 746 | Ga0495658_0002106 | 3300046683 | Bacteria | 10101 |
| 747 | Ga0495658_0007860 | 3300046683 | Bacteria | 5281 |
| 748 | Ga0495669_0002344 | 3300046684 | Bacteria | 7764 |
| 749 | Ga0495613_0016043 | 3300046689 | Bacteria | 5577 |
| 750 | Ga0495604_0018583 | 3300047317 | Bacteria | 5568 |
| 751 | Ga0495636_0017142 | 3300047318 | Bacteria | 2898 |
| 752 | Ga0495680_0000202 | 3300047322 | Bacteria | 64368 |
| 753 | Ga0496100_0093665 | 3300048903 | Bacteria | 2056 |
| 754 | Ga0496102_0246842 | 3300048905 | Bacteria | 1683 |
| 755 | Ga0496102_0398117 | 3300048905 | Bacteria | 1295 |
| 756 | Ga0496103_0092145 | 3300048906 | Bacteria | 1913 |
| 757 | Ga0496104_0013528 | 3300048907 | Bacteria | 7353 |
| 758 | Ga0496106_0009674 | 3300048909 | Bacteria | 7120 |
| 759 | Ga0496108_0131271 | 3300048911 | Bacteria | 2153 |
| 760 | Ga0496108_0291553 | 3300048911 | Bacteria | 1421 |
| 761 | Ga0496109_0010599 | 3300048912 | Bacteria | 7883 |
| 762 | Ga0496109_0055244 | 3300048912 | Bacteria | 3622 |
| 763 | Ga0496109_0191294 | 3300048912 | Bacteria | 1923 |
| 764 | Ga0496110_0082827 | 3300048913 | Bacteria | 2861 |
| 765 | Ga0496110_0117557 | 3300048913 | Bacteria | 2394 |
| 766 | Ga0496111_0041992 | 3300048914 | Bacteria | 3283 |
| 767 | Ga0496111_0113117 | 3300048914 | Bacteria | 2000 |
| 768 | Ga0496114_0014237 | 3300048917 | Bacteria | 6381 |
| 769 | Ga0496114_0065149 | 3300048917 | Bacteria | 3052 |
| 770 | Ga0501031_0003010 | 3300049568 | Bacteria | 10783 |
| 771 | Ga0501031_0025095 | 3300049568 | Bacteria | 3887 |
| 772 | Ga0501031_0056734 | 3300049568 | Bacteria | 2552 |
| 773 | Ga0501032_0000317 | 3300049569 | Bacteria | 40467 |
| 774 | Ga0501032_0016039 | 3300049569 | Bacteria | 5275 |
| 775 | Ga0501032_0025946 | 3300049569 | Bacteria | 4036 |
| 776 | Ga0501033_0078581 | 3300049570 | Bacteria | 2421 |
| 777 | Ga0501033_0106304 | 3300049570 | Bacteria | 2044 |
| 778 | Ga0501034_0214346 | 3300049571 | Bacteria | 1880 |
| 779 | Ga0501036_0000184 | 3300049572 | Bacteria | 41502 |
| 780 | Ga0501036_0006006 | 3300049572 | Bacteria | 9844 |
| 781 | Ga0501036_0017451 | 3300049572 | Bacteria | 6000 |
| 782 | Ga0501036_0042851 | 3300049572 | Bacteria | 3832 |
| 783 | Ga0501036_0271103 | 3300049572 | Bacteria | 1421 |
| 784 | Ga0501037_0003621 | 3300049573 | Bacteria | 11200 |
| 785 | Ga0501037_0013481 | 3300049573 | Bacteria | 6019 |
| 786 | Ga0501038_0000918 | 3300049574 | Bacteria | 26154 |
| 787 | Ga0501038_0012407 | 3300049574 | Bacteria | 7788 |
| 788 | Ga0501038_0088306 | 3300049574 | Bacteria | 2602 |
| 789 | Ga0501038_0129652 | 3300049574 | Bacteria | 2072 |
| 790 | Ga0501039_0000053 | 3300049575 | Bacteria | 94861 |
| 791 | Ga0501039_0000984 | 3300049575 | Bacteria | 20724 |
| 792 | Ga0501039_0007780 | 3300049575 | Bacteria | 8174 |
| 793 | Ga0501039_0100328 | 3300049575 | Bacteria | 2259 |
| 794 | Ga0501039_0110234 | 3300049575 | Bacteria | 2152 |
| 795 | Ga0501039_0124217 | 3300049575 | Bacteria | 2024 |
| 796 | Ga0501039_0185917 | 3300049575 | Bacteria | 1634 |
| 797 | Ga0501039_0306046 | 3300049575 | Bacteria | 1249 |
| 798 | Ga0501040_0000676 | 3300049576 | Bacteria | 21081 |
| 799 | Ga0501040_0001174 | 3300049576 | Bacteria | 16665 |
| 800 | Ga0501040_0010702 | 3300049576 | Bacteria | 5999 |
| 801 | Ga0501040_0017033 | 3300049576 | Bacteria | 4819 |
| 802 | Ga0501040_0035877 | 3300049576 | Bacteria | 3364 |
| 803 | Ga0501040_0069915 | 3300049576 | Bacteria | 2422 |
| 804 | Ga0501040_0227533 | 3300049576 | Bacteria | 1328 |
| 805 | Ga0501041_0000118 | 3300049577 | Bacteria | 33545 |
| 806 | Ga0501041_0001447 | 3300049577 | Bacteria | 13110 |
| 807 | Ga0501041_0007398 | 3300049577 | Bacteria | 6448 |
| 808 | Ga0501041_0020768 | 3300049577 | Bacteria | 3929 |
| 809 | Ga0501041_0030752 | 3300049577 | Bacteria | 3241 |
| 810 | Ga0501041_0034485 | 3300049577 | Bacteria | 3064 |
| 811 | Ga0501041_0128945 | 3300049577 | Bacteria | 1575 |
| 812 | Ga0501042_0000120 | 3300049578 | Bacteria | 33485 |
| 813 | Ga0501042_0000461 | 3300049578 | Bacteria | 20972 |
| 814 | Ga0501042_0004086 | 3300049578 | Bacteria | 9267 |
| 815 | Ga0501042_0006533 | 3300049578 | Bacteria | 7576 |
| 816 | Ga0501042_0015564 | 3300049578 | Bacteria | 5210 |
| 817 | Ga0501042_0115461 | 3300049578 | Bacteria | 1933 |
| 818 | Ga0501043_0017213 | 3300049579 | Bacteria | 5670 |
| 819 | Ga0501043_0042253 | 3300049579 | Bacteria | 3582 |
| 820 | Ga0501043_0214957 | 3300049579 | Bacteria | 1489 |
| 821 | Ga0501046_0000144 | 3300049580 | Bacteria | 74352 |
| 822 | Ga0501046_0036565 | 3300049580 | Bacteria | 3950 |
| 823 | Ga0501046_0058443 | 3300049580 | Bacteria | 3023 |
| 824 | Ga0501046_0257403 | 3300049580 | Bacteria | 1283 |
| 825 | Ga0501047_0080903 | 3300049581 | Bacteria | 3123 |
| 826 | Ga0501048_0002750 | 3300049582 | Bacteria | 13416 |
| 827 | Ga0501048_0005713 | 3300049582 | Bacteria | 9455 |
| 828 | Ga0501048_0005913 | 3300049582 | Bacteria | 9315 |
| 829 | Ga0501048_0027873 | 3300049582 | Bacteria | 4102 |
| 830 | Ga0501048_0142436 | 3300049582 | Bacteria | 1695 |
| 831 | Ga0501067_0024210 | 3300049583 | Bacteria | 3367 |
| 832 | Ga0501068_0003519 | 3300049584 | Bacteria | 8460 |
| 833 | Ga0501068_0011077 | 3300049584 | Bacteria | 5076 |
| 834 | Ga0501068_0026532 | 3300049584 | Bacteria | 3414 |
| 835 | Ga0501069_0002389 | 3300049585 | Bacteria | 9526 |
| 836 | Ga0501069_0017219 | 3300049585 | Bacteria | 3887 |
| 837 | Ga0501069_0032873 | 3300049585 | Bacteria | 2856 |
| 838 | Ga0501069_0044384 | 3300049585 | Bacteria | 2461 |
| 839 | Ga0501069_0092095 | 3300049585 | Bacteria | 1715 |
| 840 | Ga0501070_0022126 | 3300049586 | Bacteria | 5325 |
| 841 | Ga0501070_0042303 | 3300049586 | Bacteria | 3794 |
| 842 | Ga0501071_0000524 | 3300049587 | Bacteria | 19601 |
| 843 | Ga0501071_0009263 | 3300049587 | Bacteria | 6549 |
| 844 | Ga0501071_0012759 | 3300049587 | Bacteria | 5712 |
| 845 | Ga0501071_0016342 | 3300049587 | Bacteria | 5102 |
| 846 | Ga0501071_0038552 | 3300049587 | Bacteria | 3415 |
| 847 | Ga0501072_0000147 | 3300049588 | Bacteria | 52765 |
| 848 | Ga0501072_0000692 | 3300049588 | Bacteria | 24435 |
| 849 | Ga0501072_0008575 | 3300049588 | Bacteria | 7755 |
| 850 | Ga0501072_0027386 | 3300049588 | Bacteria | 4445 |
| 851 | Ga0501072_0073475 | 3300049588 | Bacteria | 2704 |
| 852 | Ga0501072_0225954 | 3300049588 | Bacteria | 1491 |
| 853 | Ga0501072_0252501 | 3300049588 | Bacteria | 1404 |
| 854 | Ga0501073_0006688 | 3300049589 | Bacteria | 8585 |
| 855 | Ga0501073_0106348 | 3300049589 | Bacteria | 1947 |
| 856 | Ga0501073_0118346 | 3300049589 | Bacteria | 1836 |
| 857 | Ga0501074_0003883 | 3300049590 | Bacteria | 10649 |
| 858 | Ga0501074_0006840 | 3300049590 | Bacteria | 8239 |
| 859 | Ga0501074_0071627 | 3300049590 | Bacteria | 2491 |
| 860 | Ga0501075_0000301 | 3300049591 | Bacteria | 27561 |
| 861 | Ga0501075_0000632 | 3300049591 | Bacteria | 21539 |
| 862 | Ga0501075_0000662 | 3300049591 | Bacteria | 21182 |
| 863 | Ga0501075_0008244 | 3300049591 | Bacteria | 7257 |
| 864 | Ga0501075_0017277 | 3300049591 | Bacteria | 5210 |
| 865 | Ga0501075_0039475 | 3300049591 | Bacteria | 3533 |
| 866 | Ga0501075_0060838 | 3300049591 | Bacteria | 2845 |
| 867 | Ga0501075_0112404 | 3300049591 | Bacteria | 2071 |
| 868 | Ga0501075_0336494 | 3300049591 | Bacteria | 1150 |
| 869 | Ga0501076_0000098 | 3300049592 | Bacteria | 47158 |
| 870 | Ga0501076_0000265 | 3300049592 | Bacteria | 32365 |
| 871 | Ga0501076_0000904 | 3300049592 | Bacteria | 19305 |
| 872 | Ga0501076_0005617 | 3300049592 | Bacteria | 9036 |
| 873 | Ga0501076_0007862 | 3300049592 | Bacteria | 7773 |
| 874 | Ga0501076_0011579 | 3300049592 | Bacteria | 6578 |
| 875 | Ga0501076_0087928 | 3300049592 | Bacteria | 2498 |
| 876 | Ga0501076_0093686 | 3300049592 | Bacteria | 2417 |
| 877 | Ga0501077_0000448 | 3300049593 | Bacteria | 24957 |
| 878 | Ga0501077_0000582 | 3300049593 | Bacteria | 22106 |
| 879 | Ga0501077_0027943 | 3300049593 | Bacteria | 3584 |
| 880 | Ga0501077_0035602 | 3300049593 | Bacteria | 3169 |
| 881 | Ga0501079_0000132 | 3300049741 | Bacteria | 40276 |
| 882 | Ga0501079_0000722 | 3300049741 | Bacteria | 22311 |
| 883 | Ga0501079_0000752 | 3300049741 | Bacteria | 22032 |
| 884 | Ga0501079_0000932 | 3300049741 | Bacteria | 20112 |
| 885 | Ga0501079_0004003 | 3300049741 | Bacteria | 10896 |
| 886 | Ga0501079_0047754 | 3300049741 | Bacteria | 3303 |
| 887 | Ga0501079_0170952 | 3300049741 | Bacteria | 1694 |
| 888 | Ga0501079_0278371 | 3300049741 | Bacteria | 1308 |
| 889 | Ga0501080_0002706 | 3300049742 | Bacteria | 15539 |
| 890 | Ga0501080_0004132 | 3300049742 | Bacteria | 12868 |
| 891 | Ga0501080_0006087 | 3300049742 | Bacteria | 10814 |
| 892 | Ga0501080_0006551 | 3300049742 | Bacteria | 10466 |
| 893 | Ga0501080_0077064 | 3300049742 | Bacteria | 3100 |
| 894 | Ga0501080_0085167 | 3300049742 | Bacteria | 2937 |
| 895 | Ga0501080_0212429 | 3300049742 | Bacteria | 1773 |
| 896 | Ga0501081_0000052 | 3300049743 | Bacteria | 43945 |
| 897 | Ga0501081_0000911 | 3300049743 | Bacteria | 17521 |
| 898 | Ga0501081_0001770 | 3300049743 | Bacteria | 13393 |
| 899 | Ga0501081_0036404 | 3300049743 | Bacteria | 3356 |
| 900 | Ga0501081_0190389 | 3300049743 | Bacteria | 1485 |
| 901 | Ga0501083_0036573 | 3300049744 | Bacteria | 3349 |
| 902 | Ga0501083_0038979 | 3300049744 | Bacteria | 3228 |
| 903 | Ga0501083_0045395 | 3300049744 | Bacteria | 2973 |
| 904 | Ga0501083_0101560 | 3300049744 | Bacteria | 1896 |
| 905 | Ga0501035_0028508 | 3300049822 | Bacteria | 5096 |
| 906 | Ga0501035_0055328 | 3300049822 | Bacteria | 3542 |
| 907 | Ga0501035_0055373 | 3300049822 | Bacteria | 3541 |
| 908 | Ga0501035_0366685 | 3300049822 | Bacteria | 1203 |
| 909 | Ga0501044_0011394 | 3300049823 | Bacteria | 9630 |
| 910 | Ga0501045_0000924 | 3300049824 | Bacteria | 19166 |
| 911 | Ga0501045_0011716 | 3300049824 | Bacteria | 6161 |
| 912 | Ga0501045_0016856 | 3300049824 | Bacteria | 5189 |
| 913 | Ga0501045_0021087 | 3300049824 | Bacteria | 4659 |
| 914 | Ga0501045_0039127 | 3300049824 | Bacteria | 3451 |
| 915 | Ga0501045_0076454 | 3300049824 | Bacteria | 2467 |
| 916 | Ga0501045_0105158 | 3300049824 | Bacteria | 2092 |
| 917 | Ga0501045_0114227 | 3300049824 | Bacteria | 2002 |
| 918 | Ga0501045_0316522 | 3300049824 | Bacteria | 1161 |
| 919 | nmdc:mga05p37_116363_c1 | 3300050507 | Bacteria | 3285 |
| 920 | nmdc:mga05p37_137_c1 | 3300050507 | Bacteria | 67873 |
| 921 | nmdc:mga05p37_164023_c1 | 3300050507 | Bacteria | 2712 |
| 922 | nmdc:mga05p37_22094_c1 | 3300050507 | Bacteria | 7712 |
| 923 | nmdc:mga05p37_38175_c1 | 3300050507 | Bacteria | 5890 |
| 924 | nmdc:mga05p37_53903_c1 | 3300050507 | Bacteria | 4948 |
| 925 | nmdc:mga05p37_63292_c1 | 3300050507 | Bacteria | 4552 |
| 926 | nmdc:mga05p37_8710_c1 | 3300050507 | Bacteria | 11988 |
| 927 | nmdc:mga09592_13246_c1 | 3300050508 | Bacteria | 6733 |
| 928 | nmdc:mga09592_258_c1 | 3300050508 | Bacteria | 38667 |
| 929 | nmdc:mga09592_312745_c1 | 3300050508 | Bacteria | 1361 |
| 930 | nmdc:mga09592_58319_c1 | 3300050508 | Bacteria | 3264 |
| 931 | nmdc:mga0qj67_13046_c1 | 3300050509 | Bacteria | 6274 |
| 932 | nmdc:mga0qj67_18450_c1 | 3300050509 | Bacteria | 5316 |
| 933 | nmdc:mga0qj67_218332_c1 | 3300050509 | Bacteria | 1548 |
| 934 | nmdc:mga0qj67_24062_c1 | 3300050509 | Bacteria | 4692 |
| 935 | nmdc:mga06r32_12623_c1 | 3300050510 | Bacteria | 7632 |
| 936 | nmdc:mga06r32_146080_c1 | 3300050510 | Bacteria | 2342 |
| 937 | nmdc:mga06r32_22153_c1 | 3300050510 | Bacteria | 5870 |
| 938 | nmdc:mga06r32_27741_c1 | 3300050510 | Bacteria | 5293 |
| 939 | nmdc:mga06r32_363351_c1 | 3300050510 | Bacteria | 1431 |
| 940 | nmdc:mga06r32_40460_c1 | 3300050510 | Bacteria | 4426 |
| 941 | nmdc:mga08y16_100089_c1 | 3300050511 | Bacteria | 3018 |
| 942 | nmdc:mga08y16_126502_c1 | 3300050511 | Bacteria | 2658 |
| 943 | nmdc:mga08y16_136104_c1 | 3300050511 | Bacteria | 2553 |
| 944 | nmdc:mga08y16_158980_c1 | 3300050511 | Bacteria | 2348 |
| 945 | nmdc:mga08y16_18747_c1 | 3300050511 | Bacteria | 7290 |
| 946 | nmdc:mga08y16_21512_c1 | 3300050511 | Bacteria | 6810 |
| 947 | nmdc:mga08y16_328530_c1 | 3300050511 | Bacteria | 1574 |
| 948 | nmdc:mga08y16_478956_c1 | 3300050511 | Bacteria | 1267 |
| 949 | nmdc:mga08y16_81879_c1 | 3300050511 | Bacteria | 3365 |
| 950 | nmdc:mga0n895_1305_c1 | 3300050512 | Bacteria | 18449 |
| 951 | nmdc:mga0n895_134_c1 | 3300050512 | Bacteria | 44336 |
| 952 | nmdc:mga0n895_1724_c1 | 3300050512 | Bacteria | 16524 |
| 953 | nmdc:mga0n895_178858_c1 | 3300050512 | Bacteria | 2152 |
| 954 | nmdc:mga0n895_218_c1 | 3300050512 | Bacteria | 36114 |
| 955 | nmdc:mga0n895_324947_c1 | 3300050512 | Bacteria | 1559 |
| 956 | nmdc:mga0rr50_121377_c1 | 3300050513 | Bacteria | 2080 |
| 957 | nmdc:mga0rr50_291_c1 | 3300050513 | Bacteria | 27216 |
| 958 | nmdc:mga0rr50_4456_c1 | 3300050513 | Bacteria | 8243 |
| 959 | nmdc:mga0rr50_799_c1 | 3300050513 | Bacteria | 16986 |
| 960 | nmdc:mga08x19_10182_c1 | 3300050514 | Bacteria | 5642 |
| 961 | nmdc:mga08x19_1128_c1 | 3300050514 | Bacteria | 16645 |
| 962 | nmdc:mga08x19_129454_c1 | 3300050514 | Bacteria | 1696 |
| 963 | nmdc:mga08x19_141997_c1 | 3300050514 | Bacteria | 1622 |
| 964 | nmdc:mga08x19_24601_c1 | 3300050514 | Bacteria | 3745 |
| 965 | nmdc:mga08x19_281_c1 | 3300050514 | Bacteria | 38370 |
| 966 | nmdc:mga08x19_46585_c1 | 3300050514 | Bacteria | 2773 |
| 967 | nmdc:mga08x19_6434_c1 | 3300050514 | Bacteria | 6956 |
| 968 | nmdc:mga08x19_70312_c1 | 3300050514 | Bacteria | 2280 |
| 969 | nmdc:mga0a205_115560_c1 | 3300050515 | Bacteria | 2582 |
| 970 | nmdc:mga0a205_1457_c1 | 3300050515 | Bacteria | 20176 |
| 971 | nmdc:mga0a205_390084_c1 | 3300050515 | Bacteria | 1257 |
| 972 | nmdc:mga0a205_48833_c1 | 3300050515 | Bacteria | 4085 |
| 973 | nmdc:mga0a205_5718_c1 | 3300050515 | Bacteria | 11205 |
| 974 | nmdc:mga0a205_601_c1 | 3300050515 | Bacteria | 28637 |
| 975 | nmdc:mga0a205_6732_c1 | 3300050515 | Bacteria | 10391 |
| 976 | Ga0495601_0002885 | 3300053077 | Bacteria | 9782 |
| 977 | Ga0495601_0007232 | 3300053077 | Bacteria | 6512 |
| 978 | Ga0500568_0010731 | 3300053139 | Bacteria | 4277 |
| 979 | Ga0500616_0030834 | 3300053153 | Bacteria | 2941 |
| 980 | Ga0501084_0000260 | 3300054114 | Bacteria | 39924 |
| 981 | Ga0501084_0002574 | 3300054114 | Bacteria | 14611 |
| 982 | Ga0501084_0003695 | 3300054114 | Bacteria | 12420 |
| 983 | Ga0501084_0008499 | 3300054114 | Bacteria | 8487 |
| 984 | Ga0590071_002602 | 3300059421 | Bacteria | 4540 |
| 985 | Ga0590077_001830 | 3300059426 | Bacteria | 4728 |
| 986 | Ga0501082_0001136 | 3300060353 | Bacteria | 23513 |
| 987 | Ga0501082_0002351 | 3300060353 | Bacteria | 16565 |
| 988 | Ga0501082_0008334 | 3300060353 | Bacteria | 8941 |
| 989 | Ga0501082_0013158 | 3300060353 | Bacteria | 7114 |
| 990 | Ga0501082_0069334 | 3300060353 | Bacteria | 3035 |
| 991 | Ga0501082_0077653 | 3300060353 | Bacteria | 2863 |
| 992 | Ga0501082_0081946 | 3300060353 | Bacteria | 2784 |
| 993 | Ga0501082_0086132 | 3300060353 | Bacteria | 2710 |
| 994 | Ga0530510_0000174 | 3300061734 | Bacteria | 39084 |
| 995 | Ga0530510_0000351 | 3300061734 | Bacteria | 29770 |
| 996 | Ga0530510_0001536 | 3300061734 | Bacteria | 15567 |
| 997 | Ga0530510_0019099 | 3300061734 | Bacteria | 4861 |
| 998 | Ga0530510_0024317 | 3300061734 | Bacteria | 4321 |
| 999 | Ga0530510_0090402 | 3300061734 | Bacteria | 2233 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025961 | Ga0207712_10425808 | Ga0207712_104258082 | 271 |
| 2 | iso_pu_bacteria | 641228493 | 641335961 | 272 |
| 3 | 3300005367 | Ga0070667_100336853 | Ga0070667_1003368532 | 274 |
| 4 | 3300005339 | Ga0070660_100015860 | Ga0070660_1000158604 | 277 |
| 5 | 3300005355 | Ga0070671_100035876 | Ga0070671_1000358763 | 277 |
| 6 | 3300005366 | Ga0070659_100001017 | Ga0070659_1000010175 | 277 |
| 7 | 3300005457 | Ga0070662_100004111 | Ga0070662_1000041114 | 277 |
| 8 | 3300005539 | Ga0068853_100005087 | Ga0068853_1000050874 | 277 |
| 9 | 3300005563 | Ga0068855_100045835 | Ga0068855_1000458351 | 277 |
| 10 | 3300005564 | Ga0070664_100021164 | Ga0070664_1000211643 | 277 |
| 11 | 3300005614 | Ga0068856_100005065 | Ga0068856_1000050659 | 277 |
| 12 | 3300005616 | Ga0068852_100025692 | Ga0068852_1000256925 | 277 |
| 13 | 3300005834 | Ga0068851_10097611 | Ga0068851_100976111 | 277 |
| 14 | 3300013100 | Ga0157373_10009902 | Ga0157373_100099024 | 277 |
| 15 | 3300013102 | Ga0157371_10002099 | Ga0157371_1000209912 | 277 |
| 16 | 3300013307 | Ga0157372_10002796 | Ga0157372_1000279611 | 277 |
| 17 | 3300025919 | Ga0207657_10001461 | Ga0207657_1000146115 | 277 |
| 18 | 3300025931 | Ga0207644_10043980 | Ga0207644_100439802 | 277 |
| 19 | 3300025932 | Ga0207690_10002569 | Ga0207690_100025698 | 277 |
| 20 | 3300025933 | Ga0207706_10000040 | Ga0207706_1000004095 | 277 |
| 21 | 3300025945 | Ga0207679_10007077 | Ga0207679_100070771 | 277 |
| 22 | 3300025949 | Ga0207667_10016457 | Ga0207667_100164576 | 277 |
| 23 | 3300025981 | Ga0207640_10038600 | Ga0207640_100386003 | 277 |
| 24 | 3300026041 | Ga0207639_10022909 | Ga0207639_100229092 | 277 |
| 25 | 3300026078 | Ga0207702_10084879 | Ga0207702_100848793 | 277 |
| 26 | 3300026142 | Ga0207698_10295962 | Ga0207698_102959622 | 277 |
| 27 | 3300048909 | Ga0496106_0009674 | Ga0496106_0009674_5887_6942 | 277 |
| 28 | 3300025940 | Ga0207691_10071431 | Ga0207691_100714313 | 279 |
| 29 | 3300044712 | Ga0453684_0359907 | Ga0453684_0359907_14_952 | 279 |
| 30 | 3300025933 | Ga0207706_10158273 | Ga0207706_101582732 | 280 |
| 31 | 3300050510 | nmdc:mga06r32_363351_c1 | nmdc:mga06r32_363351_c1_467_1399 | 280 |
| 32 | 3300027665 | Ga0209983_1007041 | Ga0209983_10070412 | 281 |
| 33 | 3300031548 | Ga0307408_100173265 | Ga0307408_1001732652 | 281 |
| 34 | 3300031731 | Ga0307405_10011070 | Ga0307405_100110703 | 281 |
| 35 | 3300031852 | Ga0307410_10051952 | Ga0307410_100519521 | 281 |
| 36 | 3300031901 | Ga0307406_10014335 | Ga0307406_100143356 | 281 |
| 37 | 3300032002 | Ga0307416_100192463 | Ga0307416_1001924632 | 281 |
| 38 | 3300032004 | Ga0307414_10038324 | Ga0307414_100383243 | 281 |
| 39 | 3300005457 | Ga0070662_100318850 | Ga0070662_1003188501 | 282 |
| 40 | 3300009147 | Ga0114129_10300936 | Ga0114129_103009362 | 282 |
| 41 | 3300013104 | Ga0157370_10019171 | Ga0157370_100191711 | 283 |
| 42 | 3300025912 | Ga0207707_10271143 | Ga0207707_102711432 | 283 |
| 43 | 3300025949 | Ga0207667_10439886 | Ga0207667_104398861 | 283 |
| 44 | 3300050511 | nmdc:mga08y16_478956_c1 | nmdc:mga08y16_478956_c1_331_1242 | 283 |
| 45 | 3300049742 | Ga0501080_0077064 | Ga0501080_0077064_2149_3087 | 285 |
| 46 | 3300025919 | Ga0207657_10120581 | Ga0207657_101205811 | 296 |
| 47 | 3300005544 | Ga0070686_100049402 | Ga0070686_1000494023 | 297 |
| 48 | 3300027671 | Ga0209588_1000012 | Ga0209588_100001214 | 298 |
| 49 | 3300005614 | Ga0068856_100069726 | Ga0068856_1000697263 | 300 |
| 50 | 3300009174 | Ga0105241_10150284 | Ga0105241_101502842 | 300 |
| 51 | 3300026078 | Ga0207702_10122576 | Ga0207702_101225762 | 300 |
| 52 | 3300026142 | Ga0207698_10074746 | Ga0207698_100747462 | 300 |
| 53 | 3300035398 | Ga0316574_0192804 | Ga0316574_0192804_38_1045 | 300 |
| 54 | 3300013307 | Ga0157372_10147435 | Ga0157372_101474353 | 301 |
| 55 | 3300005544 | Ga0070686_100013191 | Ga0070686_1000131916 | 302 |
| 56 | 3300005618 | Ga0068864_100108838 | Ga0068864_1001088383 | 302 |
| 57 | 3300014325 | Ga0163163_10010180 | Ga0163163_100101805 | 302 |
| 58 | 3300046539 | Ga0495621_0013645 | Ga0495621_0013645_1384_2496 | 302 |
| 59 | 3300048907 | Ga0496104_0013528 | Ga0496104_0013528_2358_3470 | 302 |
| 60 | 3300048912 | Ga0496109_0055244 | Ga0496109_0055244_2273_3385 | 302 |
| 61 | 3300048917 | Ga0496114_0014237 | Ga0496114_0014237_2939_4051 | 302 |
| 62 | 3300005329 | Ga0070683_100003976 | Ga0070683_10000397611 | 303 |
| 63 | 3300005330 | Ga0070690_100005120 | Ga0070690_1000051206 | 303 |
| 64 | 3300005333 | Ga0070677_10001307 | Ga0070677_100013074 | 303 |
| 65 | 3300005334 | Ga0068869_100009966 | Ga0068869_1000099666 | 303 |
| 66 | 3300005338 | Ga0068868_100049644 | Ga0068868_1000496441 | 303 |
| 67 | 3300005340 | Ga0070689_100188759 | Ga0070689_1001887592 | 303 |
| 68 | 3300005343 | Ga0070687_100008251 | Ga0070687_1000082513 | 303 |
| 69 | 3300005347 | Ga0070668_100288519 | Ga0070668_1002885191 | 303 |
| 70 | 3300005353 | Ga0070669_100063106 | Ga0070669_1000631063 | 303 |
| 71 | 3300005355 | Ga0070671_100008298 | Ga0070671_1000082988 | 303 |
| 72 | 3300005365 | Ga0070688_100002481 | Ga0070688_1000024819 | 303 |
| 73 | 3300005366 | Ga0070659_100021088 | Ga0070659_1000210883 | 303 |
| 74 | 3300005367 | Ga0070667_100066127 | Ga0070667_1000661273 | 303 |
| 75 | 3300005438 | Ga0070701_10015244 | Ga0070701_100152443 | 303 |
| 76 | 3300005457 | Ga0070662_100013160 | Ga0070662_1000131605 | 303 |
| 77 | 3300005466 | Ga0070685_10004184 | Ga0070685_100041844 | 303 |
| 78 | 3300005535 | Ga0070684_100028247 | Ga0070684_1000282473 | 303 |
| 79 | 3300005543 | Ga0070672_100018571 | Ga0070672_1000185712 | 303 |
| 80 | 3300005543 | Ga0070672_100022344 | Ga0070672_1000223444 | 303 |
| 81 | 3300005544 | Ga0070686_100020266 | Ga0070686_1000202663 | 303 |
| 82 | 3300005548 | Ga0070665_100234755 | Ga0070665_1002347552 | 303 |
| 83 | 3300005564 | Ga0070664_100021130 | Ga0070664_1000211303 | 303 |
| 84 | 3300005577 | Ga0068857_100026226 | Ga0068857_1000262265 | 303 |
| 85 | 3300005618 | Ga0068864_100031635 | Ga0068864_1000316352 | 303 |
| 86 | 3300005719 | Ga0068861_100006204 | Ga0068861_1000062047 | 303 |
| 87 | 3300005834 | Ga0068851_10008679 | Ga0068851_100086794 | 303 |
| 88 | 3300005840 | Ga0068870_10051460 | Ga0068870_100514602 | 303 |
| 89 | 3300005842 | Ga0068858_100019089 | Ga0068858_1000190897 | 303 |
| 90 | 3300005844 | Ga0068862_100018871 | Ga0068862_1000188713 | 303 |
| 91 | 3300006237 | Ga0097621_100032120 | Ga0097621_1000321202 | 303 |
| 92 | 3300009094 | Ga0111539_10054521 | Ga0111539_100545213 | 303 |
| 93 | 3300009177 | Ga0105248_10008760 | Ga0105248_100087607 | 303 |
| 94 | 3300009553 | Ga0105249_10050414 | Ga0105249_100504144 | 303 |
| 95 | 3300013105 | Ga0157369_10073263 | Ga0157369_100732631 | 303 |
| 96 | 3300013308 | Ga0157375_10208708 | Ga0157375_102087082 | 303 |
| 97 | 3300014326 | Ga0157380_10087441 | Ga0157380_100874413 | 303 |
| 98 | 3300014745 | Ga0157377_10050364 | Ga0157377_100503642 | 303 |
| 99 | 3300014968 | Ga0157379_10023755 | Ga0157379_100237555 | 303 |
| 100 | 3300025315 | Ga0207697_10001236 | Ga0207697_100012369 | 303 |
| 101 | 3300025321 | Ga0207656_10014928 | Ga0207656_100149282 | 303 |
| 102 | 3300025893 | Ga0207682_10000591 | Ga0207682_1000059110 | 303 |
| 103 | 3300025903 | Ga0207680_10030801 | Ga0207680_100308012 | 303 |
| 104 | 3300025907 | Ga0207645_10003041 | Ga0207645_1000304110 | 303 |
| 105 | 3300025908 | Ga0207643_10000499 | Ga0207643_100004995 | 303 |
| 106 | 3300025918 | Ga0207662_10023040 | Ga0207662_100230403 | 303 |
| 107 | 3300025923 | Ga0207681_10046733 | Ga0207681_100467333 | 303 |
| 108 | 3300025925 | Ga0207650_10018964 | Ga0207650_100189643 | 303 |
| 109 | 3300025926 | Ga0207659_10161775 | Ga0207659_101617752 | 303 |
| 110 | 3300025931 | Ga0207644_10025187 | Ga0207644_100251874 | 303 |
| 111 | 3300025931 | Ga0207644_10050722 | Ga0207644_100507222 | 303 |
| 112 | 3300025933 | Ga0207706_10036204 | Ga0207706_100362046 | 303 |
| 113 | 3300025936 | Ga0207670_10019224 | Ga0207670_100192244 | 303 |
| 114 | 3300025940 | Ga0207691_10011283 | Ga0207691_100112832 | 303 |
| 115 | 3300025940 | Ga0207691_10023496 | Ga0207691_100234966 | 303 |
| 116 | 3300025941 | Ga0207711_10032978 | Ga0207711_100329785 | 303 |
| 117 | 3300025941 | Ga0207711_10047226 | Ga0207711_100472263 | 303 |
| 118 | 3300025942 | Ga0207689_10003002 | Ga0207689_1000300212 | 303 |
| 119 | 3300025944 | Ga0207661_10023637 | Ga0207661_100236374 | 303 |
| 120 | 3300025945 | Ga0207679_10033663 | Ga0207679_100336633 | 303 |
| 121 | 3300025960 | Ga0207651_10039003 | Ga0207651_100390032 | 303 |
| 122 | 3300025981 | Ga0207640_10035874 | Ga0207640_100358742 | 303 |
| 123 | 3300025986 | Ga0207658_10020441 | Ga0207658_100204413 | 303 |
| 124 | 3300026023 | Ga0207677_10036364 | Ga0207677_100363643 | 303 |
| 125 | 3300026035 | Ga0207703_10037690 | Ga0207703_100376904 | 303 |
| 126 | 3300026041 | Ga0207639_10250317 | Ga0207639_102503172 | 303 |
| 127 | 3300026067 | Ga0207678_10005737 | Ga0207678_1000573712 | 303 |
| 128 | 3300026075 | Ga0207708_10000874 | Ga0207708_100008747 | 303 |
| 129 | 3300026088 | Ga0207641_10061543 | Ga0207641_100615432 | 303 |
| 130 | 3300026089 | Ga0207648_10007174 | Ga0207648_100071746 | 303 |
| 131 | 3300026089 | Ga0207648_10194084 | Ga0207648_101940842 | 303 |
| 132 | 3300026095 | Ga0207676_10153236 | Ga0207676_101532362 | 303 |
| 133 | 3300026116 | Ga0207674_10001481 | Ga0207674_1000148123 | 303 |
| 134 | 3300026118 | Ga0207675_100006158 | Ga0207675_1000061584 | 303 |
| 135 | 3300026121 | Ga0207683_10003852 | Ga0207683_100038522 | 303 |
| 136 | 3300026142 | Ga0207698_10093542 | Ga0207698_100935422 | 303 |
| 137 | 3300028379 | Ga0268266_10104709 | Ga0268266_101047092 | 303 |
| 138 | 3300028380 | Ga0268265_10015330 | Ga0268265_100153303 | 303 |
| 139 | 3300035086 | Ga0373934_0000665 | Ga0373934_0000665_8873_9910 | 303 |
| 140 | 3300035089 | Ga0373944_0053331 | Ga0373944_0053331_71_1069 | 303 |
| 141 | 3300035113 | Ga0373936_0009560 | Ga0373936_0009560_1958_2980 | 303 |
| 142 | 3300035116 | Ga0373945_0009999 | Ga0373945_0009999_148_1170 | 303 |
| 143 | 3300035119 | Ga0373956_0000018 | Ga0373956_0000018_32076_33113 | 303 |
| 144 | 3300035171 | Ga0373946_0011173 | Ga0373946_0011173_1948_2946 | 303 |
| 145 | 3300035172 | Ga0373955_0009217 | Ga0373955_0009217_3380_4417 | 303 |
| 146 | 3300035692 | Ga0373935_0018030 | Ga0373935_0018030_1285_2307 | 303 |
| 147 | 3300035695 | Ga0373927_0147834 | Ga0373927_0147834_459_1481 | 303 |
| 148 | 3300035724 | Ga0373933_0000035 | Ga0373933_0000035_33921_34958 | 303 |
| 149 | 3300035725 | Ga0373947_0099612 | Ga0373947_0099612_342_1340 | 303 |
| 150 | 3300036401 | Ga0373937_0002135 | Ga0373937_0002135_3804_4841 | 303 |
| 151 | 3300036712 | Ga0316584_0061119 | Ga0316584_0061119_1088_2104 | 303 |
| 152 | 3300046462 | Ga0495651_0000350 | Ga0495651_0000350_14952_15989 | 303 |
| 153 | 3300046473 | Ga0495582_0101702 | Ga0495582_0101702_480_1478 | 303 |
| 154 | 3300046475 | Ga0495639_0040638 | Ga0495639_0040638_656_1678 | 303 |
| 155 | 3300046517 | Ga0495630_0015088 | Ga0495630_0015088_4461_5483 | 303 |
| 156 | 3300046531 | Ga0495665_0011370 | Ga0495665_0011370_189_1211 | 303 |
| 157 | 3300046535 | Ga0495586_0000714 | Ga0495586_0000714_15631_16653 | 303 |
| 158 | 3300046674 | Ga0495588_0029651 | Ga0495588_0029651_794_1816 | 303 |
| 159 | 3300046681 | Ga0495647_0000064 | Ga0495647_0000064_16703_17725 | 303 |
| 160 | 3300046683 | Ga0495658_0002106 | Ga0495658_0002106_3633_4655 | 303 |
| 161 | 3300048903 | Ga0496100_0093665 | Ga0496100_0093665_244_1299 | 303 |
| 162 | 3300048906 | Ga0496103_0092145 | Ga0496103_0092145_184_1239 | 303 |
| 163 | 3300048911 | Ga0496108_0131271 | Ga0496108_0131271_1076_2131 | 303 |
| 164 | 3300048911 | Ga0496108_0291553 | Ga0496108_0291553_148_1203 | 303 |
| 165 | 3300048913 | Ga0496110_0082827 | Ga0496110_0082827_1753_2808 | 303 |
| 166 | 3300048914 | Ga0496111_0113117 | Ga0496111_0113117_55_1110 | 303 |
| 167 | 3300005336 | Ga0070680_100285061 | Ga0070680_1002850611 | 304 |
| 168 | 3300036401 | Ga0373937_0037732 | Ga0373937_0037732_1268_2323 | 304 |
| 169 | 3300005341 | Ga0070691_10012037 | Ga0070691_100120375 | 305 |
| 170 | 3300005366 | Ga0070659_100203622 | Ga0070659_1002036222 | 305 |
| 171 | 3300005439 | Ga0070711_100082894 | Ga0070711_1000828942 | 305 |
| 172 | 3300005564 | Ga0070664_100084795 | Ga0070664_1000847953 | 305 |
| 173 | 3300005834 | Ga0068851_10003974 | Ga0068851_100039748 | 305 |
| 174 | 3300009094 | Ga0111539_10095513 | Ga0111539_100955134 | 305 |
| 175 | 3300009545 | Ga0105237_10143492 | Ga0105237_101434922 | 305 |
| 176 | 3300013102 | Ga0157371_10044656 | Ga0157371_100446563 | 305 |
| 177 | 3300013104 | Ga0157370_10039400 | Ga0157370_100394004 | 305 |
| 178 | 3300013307 | Ga0157372_10070958 | Ga0157372_100709583 | 305 |
| 179 | 3300021361 | Ga0213872_10042638 | Ga0213872_100426383 | 305 |
| 180 | 3300025321 | Ga0207656_10020499 | Ga0207656_100204992 | 305 |
| 181 | 3300025906 | Ga0207699_10118891 | Ga0207699_101188912 | 305 |
| 182 | 3300025919 | Ga0207657_10004800 | Ga0207657_100048007 | 305 |
| 183 | 3300026023 | Ga0207677_10081003 | Ga0207677_100810032 | 305 |
| 184 | 3300026067 | Ga0207678_10201809 | Ga0207678_102018092 | 305 |
| 185 | 3300026116 | Ga0207674_10003155 | Ga0207674_100031559 | 305 |
| 186 | 3300026142 | Ga0207698_10372329 | Ga0207698_103723291 | 305 |
| 187 | 3300035398 | Ga0316574_0072415 | Ga0316574_0072415_509_1531 | 305 |
| 188 | 3300039438 | Ga0436360_0957938 | Ga0436360_0957938_999_2090 | 305 |
| 189 | 3300039447 | Ga0436361_0469964 | Ga0436361_0469964_1534_2625 | 305 |
| 190 | 3300048912 | Ga0496109_0191294 | Ga0496109_0191294_365_1363 | 305 |
| 191 | 3300048917 | Ga0496114_0065149 | Ga0496114_0065149_841_1839 | 305 |
| 192 | 3300050511 | nmdc:mga08y16_158980_c1 | nmdc:mga08y16_158980_c1_1076_2074 | 305 |
| 193 | 3300050512 | nmdc:mga0n895_324947_c1 | nmdc:mga0n895_324947_c1_91_1089 | 305 |
| 194 | 3300050513 | nmdc:mga0rr50_121377_c1 | nmdc:mga0rr50_121377_c1_282_1280 | 305 |
| 195 | 3300009545 | Ga0105237_10093576 | Ga0105237_100935762 | 306 |
| 196 | 3300013307 | Ga0157372_10086116 | Ga0157372_100861162 | 306 |
| 197 | 3300025929 | Ga0207664_10374727 | Ga0207664_103747271 | 306 |
| 198 | 3300025945 | Ga0207679_10177424 | Ga0207679_101774242 | 306 |
| 199 | 3300025949 | Ga0207667_10415657 | Ga0207667_104156571 | 306 |
| 200 | 3300050514 | nmdc:mga08x19_70312_c1 | nmdc:mga08x19_70312_c1_464_1471 | 306 |
| 201 | 3300005436 | Ga0070713_100040710 | Ga0070713_1000407101 | 307 |
| 202 | 3300005458 | Ga0070681_10119883 | Ga0070681_101198833 | 307 |
| 203 | 3300005578 | Ga0068854_100139316 | Ga0068854_1001393162 | 307 |
| 204 | 3300005614 | Ga0068856_100046734 | Ga0068856_1000467342 | 307 |
| 205 | 3300009093 | Ga0105240_10070494 | Ga0105240_100704942 | 307 |
| 206 | 3300013104 | Ga0157370_10033592 | Ga0157370_100335922 | 307 |
| 207 | 3300013307 | Ga0157372_10020807 | Ga0157372_100208075 | 307 |
| 208 | 3300025912 | Ga0207707_10046103 | Ga0207707_100461032 | 307 |
| 209 | 3300044712 | Ga0453684_0000237 | Ga0453684_0000237_30389_31432 | 307 |
| 210 | 3300049574 | Ga0501038_0129652 | Ga0501038_0129652_852_1883 | 307 |
| 211 | 3300049575 | Ga0501039_0306046 | Ga0501039_0306046_10_1041 | 307 |
| 212 | 3300049576 | Ga0501040_0035877 | Ga0501040_0035877_2036_3067 | 307 |
| 213 | 3300049577 | Ga0501041_0128945 | Ga0501041_0128945_247_1278 | 307 |
| 214 | 3300049578 | Ga0501042_0004086 | Ga0501042_0004086_175_1206 | 307 |
| 215 | 3300049584 | Ga0501068_0011077 | Ga0501068_0011077_3873_4904 | 307 |
| 216 | 3300049588 | Ga0501072_0027386 | Ga0501072_0027386_3247_4278 | 307 |
| 217 | 3300049591 | Ga0501075_0008244 | Ga0501075_0008244_77_1108 | 307 |
| 218 | 3300049592 | Ga0501076_0005617 | Ga0501076_0005617_2594_3625 | 307 |
| 219 | 3300049593 | Ga0501077_0035602 | Ga0501077_0035602_2109_3140 | 307 |
| 220 | 3300049741 | Ga0501079_0004003 | Ga0501079_0004003_1904_2935 | 307 |
| 221 | 3300049742 | Ga0501080_0004132 | Ga0501080_0004132_401_1432 | 307 |
| 222 | 3300049744 | Ga0501083_0038979 | Ga0501083_0038979_707_1738 | 307 |
| 223 | 3300049824 | Ga0501045_0021087 | Ga0501045_0021087_1428_2459 | 307 |
| 224 | 3300054114 | Ga0501084_0003695 | Ga0501084_0003695_5945_6976 | 307 |
| 225 | 3300061734 | Ga0530510_0024317 | Ga0530510_0024317_560_1591 | 307 |
| 226 | 3300005444 | Ga0070694_100029825 | Ga0070694_1000298252 | 308 |
| 227 | 3300005549 | Ga0070704_100060738 | Ga0070704_1000607383 | 308 |
| 228 | 3300045051 | Ga0451576_0001482 | Ga0451576_0001482_37416_38582 | 308 |
| 229 | 3300005444 | Ga0070694_100134597 | Ga0070694_1001345972 | 309 |
| 230 | 3300025926 | Ga0207659_10019110 | Ga0207659_100191105 | 309 |
| 231 | 3300026088 | Ga0207641_10387955 | Ga0207641_103879552 | 309 |
| 232 | 3300026116 | Ga0207674_10064045 | Ga0207674_100640453 | 309 |
| 233 | 3300046557 | Ga0495622_0127485 | Ga0495622_0127485_67_1098 | 309 |
| 234 | 3300027360 | Ga0209969_1000330 | Ga0209969_10003304 | 310 |
| 235 | 3300027378 | Ga0209981_1001876 | Ga0209981_10018761 | 310 |
| 236 | 3300027462 | Ga0210000_1000147 | Ga0210000_10001474 | 310 |
| 237 | 3300027543 | Ga0209999_1001932 | Ga0209999_10019324 | 310 |
| 238 | 3300027614 | Ga0209970_1003429 | Ga0209970_10034293 | 310 |
| 239 | 3300027682 | Ga0209971_1001105 | Ga0209971_10011057 | 310 |
| 240 | 3300027876 | Ga0209974_10004246 | Ga0209974_100042464 | 310 |
| 241 | 3300003911 | JGI25405J52794_10004864 | JGI25405J52794_100048642 | 311 |
| 242 | 3300005355 | Ga0070671_100304393 | Ga0070671_1003043931 | 311 |
| 243 | 3300005937 | Ga0081455_10000235 | Ga0081455_1000023559 | 311 |
| 244 | 3300006844 | Ga0075428_100006527 | Ga0075428_1000065279 | 311 |
| 245 | 3300006844 | Ga0075428_100413172 | Ga0075428_1004131722 | 311 |
| 246 | 3300006847 | Ga0075431_100146359 | Ga0075431_1001463592 | 311 |
| 247 | 3300006880 | Ga0075429_100036912 | Ga0075429_1000369123 | 311 |
| 248 | 3300009094 | Ga0111539_10066933 | Ga0111539_100669333 | 311 |
| 249 | 3300009553 | Ga0105249_10220964 | Ga0105249_102209641 | 311 |
| 250 | 3300013296 | Ga0157374_10420429 | Ga0157374_104204292 | 311 |
| 251 | 3300031548 | Ga0307408_100025589 | Ga0307408_1000255894 | 311 |
| 252 | 3300031728 | Ga0316578_10086363 | Ga0316578_100863632 | 311 |
| 253 | 3300031824 | Ga0307413_10007215 | Ga0307413_100072152 | 311 |
| 254 | 3300031852 | Ga0307410_10153245 | Ga0307410_101532452 | 311 |
| 255 | 3300031903 | Ga0307407_10216374 | Ga0307407_102163742 | 311 |
| 256 | 3300031911 | Ga0307412_10018282 | Ga0307412_100182823 | 311 |
| 257 | 3300031995 | Ga0307409_100075555 | Ga0307409_1000755552 | 311 |
| 258 | 3300032002 | Ga0307416_100006356 | Ga0307416_1000063564 | 311 |
| 259 | 3300032004 | Ga0307414_10139567 | Ga0307414_101395672 | 311 |
| 260 | 3300036647 | Ga0316582_0183874 | Ga0316582_0183874_244_1308 | 311 |
| 261 | 3300036712 | Ga0316584_0021550 | Ga0316584_0021550_3207_4271 | 311 |
| 262 | 3300049572 | Ga0501036_0042851 | Ga0501036_0042851_1176_2210 | 311 |
| 263 | 3300049572 | Ga0501036_0271103 | Ga0501036_0271103_14_1093 | 311 |
| 264 | 3300049575 | Ga0501039_0110234 | Ga0501039_0110234_996_2030 | 311 |
| 265 | 3300049576 | Ga0501040_0227533 | Ga0501040_0227533_155_1189 | 311 |
| 266 | 3300049578 | Ga0501042_0115461 | Ga0501042_0115461_164_1198 | 311 |
| 267 | 3300049582 | Ga0501048_0142436 | Ga0501048_0142436_588_1622 | 311 |
| 268 | 3300049591 | Ga0501075_0112404 | Ga0501075_0112404_942_1976 | 311 |
| 269 | 3300049592 | Ga0501076_0087928 | Ga0501076_0087928_465_1544 | 311 |
| 270 | 3300049741 | Ga0501079_0278371 | Ga0501079_0278371_191_1225 | 311 |
| 271 | 3300049824 | Ga0501045_0114227 | Ga0501045_0114227_56_1090 | 311 |
| 272 | 3300050507 | nmdc:mga05p37_53903_c1 | nmdc:mga05p37_53903_c1_3696_4721 | 311 |
| 273 | 3300050508 | nmdc:mga09592_58319_c1 | nmdc:mga09592_58319_c1_687_1772 | 311 |
| 274 | 3300050510 | nmdc:mga06r32_12623_c1 | nmdc:mga06r32_12623_c1_771_1799 | 311 |
| 275 | 3300050510 | nmdc:mga06r32_146080_c1 | nmdc:mga06r32_146080_c1_135_1157 | 311 |
| 276 | 3300050511 | nmdc:mga08y16_100089_c1 | nmdc:mga08y16_100089_c1_1240_2271 | 311 |
| 277 | 3300060353 | Ga0501082_0081946 | Ga0501082_0081946_1063_2097 | 311 |
| 278 | 3300061734 | Ga0530510_0019099 | Ga0530510_0019099_2667_3701 | 311 |
| 279 | iso_pu_bacteria | 643348555 | 643389766 | 311 |
| 280 | 3300005290 | Ga0065712_10000192 | Ga0065712_1000019228 | 312 |
| 281 | 3300005293 | Ga0065715_10000385 | Ga0065715_100003855 | 312 |
| 282 | 3300005295 | Ga0065707_10000602 | Ga0065707_100006028 | 312 |
| 283 | 3300005327 | Ga0070658_10188952 | Ga0070658_101889522 | 312 |
| 284 | 3300005328 | Ga0070676_10013414 | Ga0070676_100134142 | 312 |
| 285 | 3300005329 | Ga0070683_100064417 | Ga0070683_1000644173 | 312 |
| 286 | 3300005330 | Ga0070690_100023712 | Ga0070690_1000237123 | 312 |
| 287 | 3300005331 | Ga0070670_100010770 | Ga0070670_1000107705 | 312 |
| 288 | 3300005331 | Ga0070670_100025655 | Ga0070670_1000256555 | 312 |
| 289 | 3300005335 | Ga0070666_10129335 | Ga0070666_101293352 | 312 |
| 290 | 3300005336 | Ga0070680_100021809 | Ga0070680_1000218093 | 312 |
| 291 | 3300005337 | Ga0070682_100013004 | Ga0070682_1000130043 | 312 |
| 292 | 3300005340 | Ga0070689_100082369 | Ga0070689_1000823692 | 312 |
| 293 | 3300005341 | Ga0070691_10016272 | Ga0070691_100162722 | 312 |
| 294 | 3300005344 | Ga0070661_100005648 | Ga0070661_1000056483 | 312 |
| 295 | 3300005344 | Ga0070661_100053601 | Ga0070661_1000536013 | 312 |
| 296 | 3300005347 | Ga0070668_100060433 | Ga0070668_1000604331 | 312 |
| 297 | 3300005347 | Ga0070668_100124210 | Ga0070668_1001242103 | 312 |
| 298 | 3300005353 | Ga0070669_100055174 | Ga0070669_1000551742 | 312 |
| 299 | 3300005354 | Ga0070675_100000071 | Ga0070675_1000000713 | 312 |
| 300 | 3300005355 | Ga0070671_100008154 | Ga0070671_1000081545 | 312 |
| 301 | 3300005364 | Ga0070673_100027794 | Ga0070673_1000277941 | 312 |
| 302 | 3300005444 | Ga0070694_100120168 | Ga0070694_1001201682 | 312 |
| 303 | 3300005456 | Ga0070678_100036062 | Ga0070678_1000360624 | 312 |
| 304 | 3300005457 | Ga0070662_100084726 | Ga0070662_1000847262 | 312 |
| 305 | 3300005535 | Ga0070684_100202092 | Ga0070684_1002020922 | 312 |
| 306 | 3300005543 | Ga0070672_100114944 | Ga0070672_1001149442 | 312 |
| 307 | 3300005546 | Ga0070696_100012727 | Ga0070696_1000127272 | 312 |
| 308 | 3300005549 | Ga0070704_100020456 | Ga0070704_1000204561 | 312 |
| 309 | 3300005564 | Ga0070664_100017510 | Ga0070664_1000175103 | 312 |
| 310 | 3300005614 | Ga0068856_100004397 | Ga0068856_1000043975 | 312 |
| 311 | 3300005616 | Ga0068852_100002993 | Ga0068852_1000029939 | 312 |
| 312 | 3300005719 | Ga0068861_100286089 | Ga0068861_1002860892 | 312 |
| 313 | 3300005841 | Ga0068863_100061998 | Ga0068863_1000619984 | 312 |
| 314 | 3300006847 | Ga0075431_100025953 | Ga0075431_1000259535 | 312 |
| 315 | 3300006847 | Ga0075431_100031001 | Ga0075431_1000310014 | 312 |
| 316 | 3300006852 | Ga0075433_10279580 | Ga0075433_102795801 | 312 |
| 317 | 3300006871 | Ga0075434_100009247 | Ga0075434_1000092475 | 312 |
| 318 | 3300006880 | Ga0075429_100027878 | Ga0075429_1000278782 | 312 |
| 319 | 3300006914 | Ga0075436_100013290 | Ga0075436_1000132905 | 312 |
| 320 | 3300007076 | Ga0075435_100015103 | Ga0075435_1000151035 | 312 |
| 321 | 3300007788 | Ga0099795_10022451 | Ga0099795_100224512 | 312 |
| 322 | 3300009094 | Ga0111539_10102152 | Ga0111539_101021523 | 312 |
| 323 | 3300009094 | Ga0111539_10104229 | Ga0111539_101042292 | 312 |
| 324 | 3300009147 | Ga0114129_10004111 | Ga0114129_1000411114 | 312 |
| 325 | 3300009147 | Ga0114129_10063467 | Ga0114129_100634674 | 312 |
| 326 | 3300009147 | Ga0114129_10159021 | Ga0114129_101590213 | 312 |
| 327 | 3300009148 | Ga0105243_10262958 | Ga0105243_102629582 | 312 |
| 328 | 3300009174 | Ga0105241_10016620 | Ga0105241_100166205 | 312 |
| 329 | 3300009553 | Ga0105249_10031634 | Ga0105249_100316345 | 312 |
| 330 | 3300010159 | Ga0099796_10006814 | Ga0099796_100068144 | 312 |
| 331 | 3300011119 | Ga0105246_10004229 | Ga0105246_100042293 | 312 |
| 332 | 3300013296 | Ga0157374_10011166 | Ga0157374_100111664 | 312 |
| 333 | 3300013296 | Ga0157374_10024259 | Ga0157374_100242594 | 312 |
| 334 | 3300013297 | Ga0157378_10076259 | Ga0157378_100762594 | 312 |
| 335 | 3300013306 | Ga0163162_10016190 | Ga0163162_100161909 | 312 |
| 336 | 3300013306 | Ga0163162_10035127 | Ga0163162_100351276 | 312 |
| 337 | 3300013308 | Ga0157375_10218469 | Ga0157375_102184692 | 312 |
| 338 | 3300014325 | Ga0163163_10387937 | Ga0163163_103879372 | 312 |
| 339 | 3300014968 | Ga0157379_10109497 | Ga0157379_101094973 | 312 |
| 340 | 3300014969 | Ga0157376_10006851 | Ga0157376_100068518 | 312 |
| 341 | 3300025315 | Ga0207697_10005837 | Ga0207697_100058374 | 312 |
| 342 | 3300025315 | Ga0207697_10062256 | Ga0207697_100622562 | 312 |
| 343 | 3300025321 | Ga0207656_10019839 | Ga0207656_100198392 | 312 |
| 344 | 3300025903 | Ga0207680_10164001 | Ga0207680_101640012 | 312 |
| 345 | 3300025907 | Ga0207645_10002628 | Ga0207645_100026283 | 312 |
| 346 | 3300025909 | Ga0207705_10148010 | Ga0207705_101480102 | 312 |
| 347 | 3300025912 | Ga0207707_10005874 | Ga0207707_100058746 | 312 |
| 348 | 3300025919 | Ga0207657_10004830 | Ga0207657_1000483014 | 312 |
| 349 | 3300025920 | Ga0207649_10004780 | Ga0207649_100047807 | 312 |
| 350 | 3300025920 | Ga0207649_10127255 | Ga0207649_101272552 | 312 |
| 351 | 3300025921 | Ga0207652_10015335 | Ga0207652_100153354 | 312 |
| 352 | 3300025923 | Ga0207681_10034101 | Ga0207681_100341013 | 312 |
| 353 | 3300025925 | Ga0207650_10025714 | Ga0207650_100257145 | 312 |
| 354 | 3300025931 | Ga0207644_10200593 | Ga0207644_102005932 | 312 |
| 355 | 3300025933 | Ga0207706_10002512 | Ga0207706_100025128 | 312 |
| 356 | 3300025933 | Ga0207706_10073637 | Ga0207706_100736372 | 312 |
| 357 | 3300025933 | Ga0207706_10099342 | Ga0207706_100993422 | 312 |
| 358 | 3300025940 | Ga0207691_10002892 | Ga0207691_1000289212 | 312 |
| 359 | 3300025944 | Ga0207661_10046948 | Ga0207661_100469483 | 312 |
| 360 | 3300025945 | Ga0207679_10010729 | Ga0207679_100107293 | 312 |
| 361 | 3300025945 | Ga0207679_10179301 | Ga0207679_101793011 | 312 |
| 362 | 3300025960 | Ga0207651_10032603 | Ga0207651_100326033 | 312 |
| 363 | 3300025960 | Ga0207651_10271649 | Ga0207651_102716491 | 312 |
| 364 | 3300025981 | Ga0207640_10031905 | Ga0207640_100319052 | 312 |
| 365 | 3300026035 | Ga0207703_10115623 | Ga0207703_101156232 | 312 |
| 366 | 3300026075 | Ga0207708_10119162 | Ga0207708_101191622 | 312 |
| 367 | 3300026088 | Ga0207641_10102622 | Ga0207641_101026223 | 312 |
| 368 | 3300026121 | Ga0207683_10000495 | Ga0207683_1000049525 | 312 |
| 369 | 3300026121 | Ga0207683_10080683 | Ga0207683_100806835 | 312 |
| 370 | 3300026142 | Ga0207698_10007657 | Ga0207698_100076577 | 312 |
| 371 | 3300027876 | Ga0209974_10000361 | Ga0209974_100003616 | 312 |
| 372 | 3300028381 | Ga0268264_10528131 | Ga0268264_105281311 | 312 |
| 373 | 3300035691 | Ga0373931_0045669 | Ga0373931_0045669_825_1865 | 312 |
| 374 | 3300035692 | Ga0373935_0020582 | Ga0373935_0020582_1488_2528 | 312 |
| 375 | 3300042437 | Ga0439444_0007833 | Ga0439444_0007833_21_1058 | 312 |
| 376 | 3300042876 | Ga0451577_0000198 | Ga0451577_0000198_50672_51706 | 312 |
| 377 | 3300042876 | Ga0451577_0005723 | Ga0451577_0005723_3289_4323 | 312 |
| 378 | 3300042876 | Ga0451577_0019539 | Ga0451577_0019539_2305_3339 | 312 |
| 379 | 3300042876 | Ga0451577_0026224 | Ga0451577_0026224_2713_3747 | 312 |
| 380 | 3300042876 | Ga0451577_0116022 | Ga0451577_0116022_478_1512 | 312 |
| 381 | 3300042876 | Ga0451577_0151938 | Ga0451577_0151938_856_1893 | 312 |
| 382 | 3300042876 | Ga0451577_0273658 | Ga0451577_0273658_20_1057 | 312 |
| 383 | 3300044673 | Ga0453683_0000297 | Ga0453683_0000297_46400_47434 | 312 |
| 384 | 3300044673 | Ga0453683_0000327 | Ga0453683_0000327_9060_10094 | 312 |
| 385 | 3300044673 | Ga0453683_0006691 | Ga0453683_0006691_5644_6678 | 312 |
| 386 | 3300044673 | Ga0453683_0009683 | Ga0453683_0009683_3295_4329 | 312 |
| 387 | 3300044673 | Ga0453683_0017269 | Ga0453683_0017269_2678_3715 | 312 |
| 388 | 3300044673 | Ga0453683_0019936 | Ga0453683_0019936_1014_2048 | 312 |
| 389 | 3300044712 | Ga0453684_0000654 | Ga0453684_0000654_48984_50018 | 312 |
| 390 | 3300044712 | Ga0453684_0003313 | Ga0453684_0003313_14622_15656 | 312 |
| 391 | 3300044712 | Ga0453684_0003721 | Ga0453684_0003721_6683_7720 | 312 |
| 392 | 3300044712 | Ga0453684_0006018 | Ga0453684_0006018_20931_21968 | 312 |
| 393 | 3300044712 | Ga0453684_0006774 | Ga0453684_0006774_7911_8948 | 312 |
| 394 | 3300044712 | Ga0453684_0049307 | Ga0453684_0049307_4494_5531 | 312 |
| 395 | 3300044712 | Ga0453684_0052107 | Ga0453684_0052107_175_1212 | 312 |
| 396 | 3300044712 | Ga0453684_0055351 | Ga0453684_0055351_1881_2915 | 312 |
| 397 | 3300044712 | Ga0453684_0116990 | Ga0453684_0116990_1048_2082 | 312 |
| 398 | 3300044712 | Ga0453684_0119048 | Ga0453684_0119048_1194_2231 | 312 |
| 399 | 3300044712 | Ga0453684_0169758 | Ga0453684_0169758_1199_2236 | 312 |
| 400 | 3300045051 | Ga0451576_0002911 | Ga0451576_0002911_16218_17252 | 312 |
| 401 | 3300045051 | Ga0451576_0003917 | Ga0451576_0003917_7151_8185 | 312 |
| 402 | 3300045051 | Ga0451576_0032170 | Ga0451576_0032170_1597_2634 | 312 |
| 403 | 3300045051 | Ga0451576_0168532 | Ga0451576_0168532_872_1906 | 312 |
| 404 | 3300045051 | Ga0451576_0219477 | Ga0451576_0219477_936_1955 | 312 |
| 405 | 3300045051 | Ga0451576_0241404 | Ga0451576_0241404_838_1875 | 312 |
| 406 | 3300045051 | Ga0451576_0361155 | Ga0451576_0361155_244_1281 | 312 |
| 407 | 3300046535 | Ga0495586_0139818 | Ga0495586_0139818_154_1194 | 312 |
| 408 | 3300046681 | Ga0495647_0070227 | Ga0495647_0070227_164_1204 | 312 |
| 409 | 3300048905 | Ga0496102_0398117 | Ga0496102_0398117_77_1117 | 312 |
| 410 | 3300048912 | Ga0496109_0010599 | Ga0496109_0010599_2860_3879 | 312 |
| 411 | 3300048914 | Ga0496111_0041992 | Ga0496111_0041992_617_1636 | 312 |
| 412 | 3300049568 | Ga0501031_0025095 | Ga0501031_0025095_2730_3764 | 312 |
| 413 | 3300049569 | Ga0501032_0016039 | Ga0501032_0016039_2123_3157 | 312 |
| 414 | 3300049570 | Ga0501033_0106304 | Ga0501033_0106304_219_1253 | 312 |
| 415 | 3300049573 | Ga0501037_0003621 | Ga0501037_0003621_6114_7148 | 312 |
| 416 | 3300049574 | Ga0501038_0088306 | Ga0501038_0088306_220_1254 | 312 |
| 417 | 3300049575 | Ga0501039_0124217 | Ga0501039_0124217_423_1460 | 312 |
| 418 | 3300049575 | Ga0501039_0185917 | Ga0501039_0185917_305_1342 | 312 |
| 419 | 3300049576 | Ga0501040_0069915 | Ga0501040_0069915_472_1509 | 312 |
| 420 | 3300049577 | Ga0501041_0020768 | Ga0501041_0020768_2676_3713 | 312 |
| 421 | 3300049577 | Ga0501041_0030752 | Ga0501041_0030752_665_1699 | 312 |
| 422 | 3300049580 | Ga0501046_0036565 | Ga0501046_0036565_1349_2383 | 312 |
| 423 | 3300049580 | Ga0501046_0257403 | Ga0501046_0257403_28_1065 | 312 |
| 424 | 3300049582 | Ga0501048_0005713 | Ga0501048_0005713_1815_2849 | 312 |
| 425 | 3300049585 | Ga0501069_0002389 | Ga0501069_0002389_2446_3480 | 312 |
| 426 | 3300049586 | Ga0501070_0022126 | Ga0501070_0022126_3795_4829 | 312 |
| 427 | 3300049587 | Ga0501071_0038552 | Ga0501071_0038552_620_1657 | 312 |
| 428 | 3300049588 | Ga0501072_0073475 | Ga0501072_0073475_926_1963 | 312 |
| 429 | 3300049590 | Ga0501074_0071627 | Ga0501074_0071627_184_1218 | 312 |
| 430 | 3300049591 | Ga0501075_0017277 | Ga0501075_0017277_1901_2938 | 312 |
| 431 | 3300049591 | Ga0501075_0060838 | Ga0501075_0060838_874_1911 | 312 |
| 432 | 3300049591 | Ga0501075_0336494 | Ga0501075_0336494_39_1073 | 312 |
| 433 | 3300049592 | Ga0501076_0007862 | Ga0501076_0007862_743_1780 | 312 |
| 434 | 3300049592 | Ga0501076_0093686 | Ga0501076_0093686_791_1825 | 312 |
| 435 | 3300049741 | Ga0501079_0047754 | Ga0501079_0047754_2228_3265 | 312 |
| 436 | 3300049741 | Ga0501079_0170952 | Ga0501079_0170952_441_1475 | 312 |
| 437 | 3300049742 | Ga0501080_0085167 | Ga0501080_0085167_1548_2585 | 312 |
| 438 | 3300049743 | Ga0501081_0190389 | Ga0501081_0190389_11_1045 | 312 |
| 439 | 3300049822 | Ga0501035_0055328 | Ga0501035_0055328_2068_3102 | 312 |
| 440 | 3300049823 | Ga0501044_0011394 | Ga0501044_0011394_6217_7251 | 312 |
| 441 | 3300049824 | Ga0501045_0076454 | Ga0501045_0076454_731_1768 | 312 |
| 442 | 3300050507 | nmdc:mga05p37_63292_c1 | nmdc:mga05p37_63292_c1_2328_3368 | 312 |
| 443 | 3300050507 | nmdc:mga05p37_8710_c1 | nmdc:mga05p37_8710_c1_3904_4944 | 312 |
| 444 | 3300050510 | nmdc:mga06r32_22153_c1 | nmdc:mga06r32_22153_c1_4229_5269 | 312 |
| 445 | 3300050510 | nmdc:mga06r32_40460_c1 | nmdc:mga06r32_40460_c1_2818_3855 | 312 |
| 446 | 3300050511 | nmdc:mga08y16_126502_c1 | nmdc:mga08y16_126502_c1_1260_2300 | 312 |
| 447 | 3300050511 | nmdc:mga08y16_136104_c1 | nmdc:mga08y16_136104_c1_272_1312 | 312 |
| 448 | 3300050512 | nmdc:mga0n895_1305_c1 | nmdc:mga0n895_1305_c1_12758_13798 | 312 |
| 449 | 3300050512 | nmdc:mga0n895_178858_c1 | nmdc:mga0n895_178858_c1_672_1712 | 312 |
| 450 | 3300050512 | nmdc:mga0n895_218_c1 | nmdc:mga0n895_218_c1_10410_11450 | 312 |
| 451 | 3300050513 | nmdc:mga0rr50_4456_c1 | nmdc:mga0rr50_4456_c1_660_1700 | 312 |
| 452 | 3300050513 | nmdc:mga0rr50_799_c1 | nmdc:mga0rr50_799_c1_4212_5252 | 312 |
| 453 | 3300050514 | nmdc:mga08x19_10182_c1 | nmdc:mga08x19_10182_c1_2974_4014 | 312 |
| 454 | 3300050514 | nmdc:mga08x19_129454_c1 | nmdc:mga08x19_129454_c1_438_1478 | 312 |
| 455 | 3300050514 | nmdc:mga08x19_141997_c1 | nmdc:mga08x19_141997_c1_569_1609 | 312 |
| 456 | 3300050514 | nmdc:mga08x19_46585_c1 | nmdc:mga08x19_46585_c1_204_1244 | 312 |
| 457 | 3300050515 | nmdc:mga0a205_115560_c1 | nmdc:mga0a205_115560_c1_436_1476 | 312 |
| 458 | 3300050515 | nmdc:mga0a205_5718_c1 | nmdc:mga0a205_5718_c1_9802_10842 | 312 |
| 459 | 3300050515 | nmdc:mga0a205_6732_c1 | nmdc:mga0a205_6732_c1_169_1209 | 312 |
| 460 | 3300053139 | Ga0500568_0010731 | Ga0500568_0010731_2426_3457 | 312 |
| 461 | 3300053153 | Ga0500616_0030834 | Ga0500616_0030834_585_1613 | 312 |
| 462 | 3300060353 | Ga0501082_0069334 | Ga0501082_0069334_791_1825 | 312 |
| 463 | 3300060353 | Ga0501082_0077653 | Ga0501082_0077653_1127_2164 | 312 |
| 464 | 3300061734 | Ga0530510_0090402 | Ga0530510_0090402_534_1571 | 312 |
| 465 | 3300005295 | Ga0065707_10095781 | Ga0065707_100957811 | 313 |
| 466 | 3300005330 | Ga0070690_100145933 | Ga0070690_1001459331 | 313 |
| 467 | 3300005334 | Ga0068869_100135380 | Ga0068869_1001353802 | 313 |
| 468 | 3300005364 | Ga0070673_100121157 | Ga0070673_1001211572 | 313 |
| 469 | 3300005458 | Ga0070681_10024123 | Ga0070681_100241231 | 313 |
| 470 | 3300005530 | Ga0070679_100026411 | Ga0070679_1000264112 | 313 |
| 471 | 3300005544 | Ga0070686_100188780 | Ga0070686_1001887802 | 313 |
| 472 | 3300005719 | Ga0068861_100085033 | Ga0068861_1000850333 | 313 |
| 473 | 3300005841 | Ga0068863_100182880 | Ga0068863_1001828802 | 313 |
| 474 | 3300005937 | Ga0081455_10081050 | Ga0081455_100810502 | 313 |
| 475 | 3300005981 | Ga0081538_10005747 | Ga0081538_100057474 | 313 |
| 476 | 3300006846 | Ga0075430_100031706 | Ga0075430_1000317062 | 313 |
| 477 | 3300006852 | Ga0075433_10007284 | Ga0075433_100072841 | 313 |
| 478 | 3300006852 | Ga0075433_10156071 | Ga0075433_101560712 | 313 |
| 479 | 3300009094 | Ga0111539_10101073 | Ga0111539_101010732 | 313 |
| 480 | 3300009094 | Ga0111539_10281188 | Ga0111539_102811882 | 313 |
| 481 | 3300009147 | Ga0114129_10012098 | Ga0114129_100120988 | 313 |
| 482 | 3300009147 | Ga0114129_10013997 | Ga0114129_100139975 | 313 |
| 483 | 3300009147 | Ga0114129_10025255 | Ga0114129_100252553 | 313 |
| 484 | 3300009147 | Ga0114129_10031678 | Ga0114129_100316785 | 313 |
| 485 | 3300013297 | Ga0157378_10053762 | Ga0157378_100537624 | 313 |
| 486 | 3300025903 | Ga0207680_10097531 | Ga0207680_100975312 | 313 |
| 487 | 3300025908 | Ga0207643_10014374 | Ga0207643_100143744 | 313 |
| 488 | 3300025912 | Ga0207707_10007548 | Ga0207707_100075485 | 313 |
| 489 | 3300025926 | Ga0207659_10211293 | Ga0207659_102112932 | 313 |
| 490 | 3300031548 | Ga0307408_100003702 | Ga0307408_1000037023 | 313 |
| 491 | 3300032002 | Ga0307416_100007756 | Ga0307416_1000077563 | 313 |
| 492 | 3300042436 | Ga0439435_0030399 | Ga0439435_0030399_258_1313 | 313 |
| 493 | 3300044673 | Ga0453683_0000574 | Ga0453683_0000574_17957_19000 | 313 |
| 494 | 3300049568 | Ga0501031_0056734 | Ga0501031_0056734_1020_2060 | 313 |
| 495 | 3300049570 | Ga0501033_0078581 | Ga0501033_0078581_526_1566 | 313 |
| 496 | 3300049572 | Ga0501036_0006006 | Ga0501036_0006006_927_1967 | 313 |
| 497 | 3300049574 | Ga0501038_0000918 | Ga0501038_0000918_10233_11273 | 313 |
| 498 | 3300049575 | Ga0501039_0000984 | Ga0501039_0000984_11266_12306 | 313 |
| 499 | 3300049576 | Ga0501040_0000676 | Ga0501040_0000676_8044_9084 | 313 |
| 500 | 3300049577 | Ga0501041_0001447 | Ga0501041_0001447_5368_6408 | 313 |
| 501 | 3300049578 | Ga0501042_0000461 | Ga0501042_0000461_11384_12424 | 313 |
| 502 | 3300049579 | Ga0501043_0017213 | Ga0501043_0017213_1531_2571 | 313 |
| 503 | 3300049582 | Ga0501048_0005913 | Ga0501048_0005913_3406_4446 | 313 |
| 504 | 3300049584 | Ga0501068_0003519 | Ga0501068_0003519_6590_7630 | 313 |
| 505 | 3300049587 | Ga0501071_0000524 | Ga0501071_0000524_11896_12936 | 313 |
| 506 | 3300049588 | Ga0501072_0000692 | Ga0501072_0000692_11395_12435 | 313 |
| 507 | 3300049589 | Ga0501073_0106348 | Ga0501073_0106348_814_1854 | 313 |
| 508 | 3300049590 | Ga0501074_0006840 | Ga0501074_0006840_1222_2262 | 313 |
| 509 | 3300049591 | Ga0501075_0000632 | Ga0501075_0000632_8486_9526 | 313 |
| 510 | 3300049592 | Ga0501076_0000904 | Ga0501076_0000904_10314_11354 | 313 |
| 511 | 3300049593 | Ga0501077_0000582 | Ga0501077_0000582_9527_10567 | 313 |
| 512 | 3300049741 | Ga0501079_0000722 | Ga0501079_0000722_9646_10686 | 313 |
| 513 | 3300049742 | Ga0501080_0006087 | Ga0501080_0006087_1634_2674 | 313 |
| 514 | 3300049743 | Ga0501081_0000911 | Ga0501081_0000911_9502_10542 | 313 |
| 515 | 3300049744 | Ga0501083_0036573 | Ga0501083_0036573_1589_2629 | 313 |
| 516 | 3300049822 | Ga0501035_0028508 | Ga0501035_0028508_3613_4653 | 313 |
| 517 | 3300049824 | Ga0501045_0000924 | Ga0501045_0000924_6225_7265 | 313 |
| 518 | 3300050507 | nmdc:mga05p37_22094_c1 | nmdc:mga05p37_22094_c1_1324_2367 | 313 |
| 519 | 3300050507 | nmdc:mga05p37_38175_c1 | nmdc:mga05p37_38175_c1_391_1434 | 313 |
| 520 | 3300050511 | nmdc:mga08y16_21512_c1 | nmdc:mga08y16_21512_c1_2261_3265 | 313 |
| 521 | 3300050511 | nmdc:mga08y16_81879_c1 | nmdc:mga08y16_81879_c1_529_1566 | 313 |
| 522 | 3300050515 | nmdc:mga0a205_1457_c1 | nmdc:mga0a205_1457_c1_11485_12528 | 313 |
| 523 | 3300054114 | Ga0501084_0002574 | Ga0501084_0002574_7119_8159 | 313 |
| 524 | 3300059421 | Ga0590071_002602 | Ga0590071_002602_3184_4272 | 313 |
| 525 | 3300059426 | Ga0590077_001830 | Ga0590077_001830_352_1440 | 313 |
| 526 | 3300060353 | Ga0501082_0002351 | Ga0501082_0002351_8887_9927 | 313 |
| 527 | 3300061734 | Ga0530510_0001536 | Ga0530510_0001536_9298_10338 | 313 |
| 528 | 3300005295 | Ga0065707_10014078 | Ga0065707_100140782 | 314 |
| 529 | 3300005330 | Ga0070690_100000182 | Ga0070690_10000018222 | 314 |
| 530 | 3300005334 | Ga0068869_100000785 | Ga0068869_1000007852 | 314 |
| 531 | 3300005336 | Ga0070680_100001823 | Ga0070680_1000018235 | 314 |
| 532 | 3300005337 | Ga0070682_100013879 | Ga0070682_1000138795 | 314 |
| 533 | 3300005338 | Ga0068868_100000782 | Ga0068868_1000007827 | 314 |
| 534 | 3300005340 | Ga0070689_100000521 | Ga0070689_10000052119 | 314 |
| 535 | 3300005341 | Ga0070691_10002091 | Ga0070691_100020912 | 314 |
| 536 | 3300005343 | Ga0070687_100000050 | Ga0070687_10000005022 | 314 |
| 537 | 3300005345 | Ga0070692_10003200 | Ga0070692_100032003 | 314 |
| 538 | 3300005353 | Ga0070669_100009604 | Ga0070669_1000096042 | 314 |
| 539 | 3300005355 | Ga0070671_100139576 | Ga0070671_1001395761 | 314 |
| 540 | 3300005438 | Ga0070701_10000918 | Ga0070701_1000091813 | 314 |
| 541 | 3300005440 | Ga0070705_100000752 | Ga0070705_1000007522 | 314 |
| 542 | 3300005441 | Ga0070700_100010913 | Ga0070700_1000109133 | 314 |
| 543 | 3300005441 | Ga0070700_100094000 | Ga0070700_1000940002 | 314 |
| 544 | 3300005444 | Ga0070694_100000128 | Ga0070694_10000012820 | 314 |
| 545 | 3300005459 | Ga0068867_100000411 | Ga0068867_10000041124 | 314 |
| 546 | 3300005459 | Ga0068867_100000511 | Ga0068867_10000051115 | 314 |
| 547 | 3300005467 | Ga0070706_100000049 | Ga0070706_10000004971 | 314 |
| 548 | 3300005468 | Ga0070707_100005499 | Ga0070707_1000054998 | 314 |
| 549 | 3300005471 | Ga0070698_100286410 | Ga0070698_1002864102 | 314 |
| 550 | 3300005530 | Ga0070679_100002560 | Ga0070679_10000256014 | 314 |
| 551 | 3300005543 | Ga0070672_100206875 | Ga0070672_1002068752 | 314 |
| 552 | 3300005544 | Ga0070686_100000107 | Ga0070686_10000010752 | 314 |
| 553 | 3300005545 | Ga0070695_100000172 | Ga0070695_10000017214 | 314 |
| 554 | 3300005546 | Ga0070696_100003396 | Ga0070696_1000033962 | 314 |
| 555 | 3300005547 | Ga0070693_100000078 | Ga0070693_10000007815 | 314 |
| 556 | 3300005549 | Ga0070704_100000256 | Ga0070704_10000025622 | 314 |
| 557 | 3300005563 | Ga0068855_100004148 | Ga0068855_10000414816 | 314 |
| 558 | 3300005563 | Ga0068855_100441711 | Ga0068855_1004417112 | 314 |
| 559 | 3300005614 | Ga0068856_100184111 | Ga0068856_1001841113 | 314 |
| 560 | 3300005615 | Ga0070702_100000048 | Ga0070702_10000004814 | 314 |
| 561 | 3300005617 | Ga0068859_100000873 | Ga0068859_10000087321 | 314 |
| 562 | 3300005617 | Ga0068859_100390752 | Ga0068859_1003907522 | 314 |
| 563 | 3300005618 | Ga0068864_100292689 | Ga0068864_1002926892 | 314 |
| 564 | 3300005718 | Ga0068866_10022435 | Ga0068866_100224354 | 314 |
| 565 | 3300005719 | Ga0068861_100000373 | Ga0068861_10000037316 | 314 |
| 566 | 3300005719 | Ga0068861_100005597 | Ga0068861_1000055978 | 314 |
| 567 | 3300005842 | Ga0068858_100000324 | Ga0068858_10000032433 | 314 |
| 568 | 3300005842 | Ga0068858_100062343 | Ga0068858_1000623433 | 314 |
| 569 | 3300005843 | Ga0068860_100000687 | Ga0068860_10000068720 | 314 |
| 570 | 3300005844 | Ga0068862_100000430 | Ga0068862_10000043022 | 314 |
| 571 | 3300005844 | Ga0068862_100166029 | Ga0068862_1001660292 | 314 |
| 572 | 3300005985 | Ga0081539_10017313 | Ga0081539_100173136 | 314 |
| 573 | 3300006237 | Ga0097621_100000180 | Ga0097621_10000018029 | 314 |
| 574 | 3300006358 | Ga0068871_100006394 | Ga0068871_10000639412 | 314 |
| 575 | 3300006844 | Ga0075428_100002149 | Ga0075428_1000021494 | 314 |
| 576 | 3300006844 | Ga0075428_100042960 | Ga0075428_1000429603 | 314 |
| 577 | 3300006844 | Ga0075428_100149383 | Ga0075428_1001493832 | 314 |
| 578 | 3300006846 | Ga0075430_100006463 | Ga0075430_10000646310 | 314 |
| 579 | 3300006847 | Ga0075431_100056793 | Ga0075431_1000567933 | 314 |
| 580 | 3300006852 | Ga0075433_10002531 | Ga0075433_100025314 | 314 |
| 581 | 3300006852 | Ga0075433_10377353 | Ga0075433_103773532 | 314 |
| 582 | 3300006871 | Ga0075434_100000204 | Ga0075434_10000020427 | 314 |
| 583 | 3300006871 | Ga0075434_100008705 | Ga0075434_1000087056 | 314 |
| 584 | 3300006880 | Ga0075429_100000208 | Ga0075429_1000002089 | 314 |
| 585 | 3300006880 | Ga0075429_100032477 | Ga0075429_1000324773 | 314 |
| 586 | 3300006881 | Ga0068865_100000148 | Ga0068865_10000014820 | 314 |
| 587 | 3300006881 | Ga0068865_100023180 | Ga0068865_1000231804 | 314 |
| 588 | 3300006881 | Ga0068865_100189197 | Ga0068865_1001891971 | 314 |
| 589 | 3300006914 | Ga0075436_100000422 | Ga0075436_1000004226 | 314 |
| 590 | 3300006931 | Ga0097620_100000874 | Ga0097620_10000087414 | 314 |
| 591 | 3300006931 | Ga0097620_100390762 | Ga0097620_1003907622 | 314 |
| 592 | 3300007076 | Ga0075435_100002321 | Ga0075435_1000023217 | 314 |
| 593 | 3300007265 | Ga0099794_10000009 | Ga0099794_1000000910 | 314 |
| 594 | 3300009094 | Ga0111539_10044518 | Ga0111539_100445185 | 314 |
| 595 | 3300009094 | Ga0111539_10278054 | Ga0111539_102780541 | 314 |
| 596 | 3300009098 | Ga0105245_10000429 | Ga0105245_1000042921 | 314 |
| 597 | 3300009147 | Ga0114129_10000140 | Ga0114129_1000014028 | 314 |
| 598 | 3300009148 | Ga0105243_10010939 | Ga0105243_100109395 | 314 |
| 599 | 3300009148 | Ga0105243_10053140 | Ga0105243_100531404 | 314 |
| 600 | 3300009176 | Ga0105242_10002750 | Ga0105242_100027505 | 314 |
| 601 | 3300009553 | Ga0105249_10003569 | Ga0105249_100035695 | 314 |
| 602 | 3300009553 | Ga0105249_10059940 | Ga0105249_100599404 | 314 |
| 603 | 3300010375 | Ga0105239_10042407 | Ga0105239_100424075 | 314 |
| 604 | 3300013297 | Ga0157378_10000513 | Ga0157378_1000051322 | 314 |
| 605 | 3300014326 | Ga0157380_10096710 | Ga0157380_100967104 | 314 |
| 606 | 3300014326 | Ga0157380_10160607 | Ga0157380_101606072 | 314 |
| 607 | 3300014326 | Ga0157380_10279869 | Ga0157380_102798692 | 314 |
| 608 | 3300014745 | Ga0157377_10078653 | Ga0157377_100786532 | 314 |
| 609 | 3300014968 | Ga0157379_10164364 | Ga0157379_101643642 | 314 |
| 610 | 3300014969 | Ga0157376_10042371 | Ga0157376_100423712 | 314 |
| 611 | 3300025885 | Ga0207653_10020696 | Ga0207653_100206961 | 314 |
| 612 | 3300025899 | Ga0207642_10000571 | Ga0207642_1000057113 | 314 |
| 613 | 3300025908 | Ga0207643_10017637 | Ga0207643_100176373 | 314 |
| 614 | 3300025910 | Ga0207684_10000011 | Ga0207684_10000011153 | 314 |
| 615 | 3300025911 | Ga0207654_10068443 | Ga0207654_100684432 | 314 |
| 616 | 3300025917 | Ga0207660_10037128 | Ga0207660_100371284 | 314 |
| 617 | 3300025917 | Ga0207660_10037879 | Ga0207660_100378794 | 314 |
| 618 | 3300025918 | Ga0207662_10000165 | Ga0207662_1000016516 | 314 |
| 619 | 3300025921 | Ga0207652_10005474 | Ga0207652_1000547410 | 314 |
| 620 | 3300025923 | Ga0207681_10004257 | Ga0207681_100042579 | 314 |
| 621 | 3300025927 | Ga0207687_10004557 | Ga0207687_100045576 | 314 |
| 622 | 3300025931 | Ga0207644_10196913 | Ga0207644_101969131 | 314 |
| 623 | 3300025934 | Ga0207686_10002408 | Ga0207686_100024084 | 314 |
| 624 | 3300025935 | Ga0207709_10006187 | Ga0207709_100061875 | 314 |
| 625 | 3300025935 | Ga0207709_10039123 | Ga0207709_100391234 | 314 |
| 626 | 3300025938 | Ga0207704_10000191 | Ga0207704_1000019114 | 314 |
| 627 | 3300025938 | Ga0207704_10000578 | Ga0207704_100005784 | 314 |
| 628 | 3300025939 | Ga0207665_10059228 | Ga0207665_100592282 | 314 |
| 629 | 3300025940 | Ga0207691_10072372 | Ga0207691_100723722 | 314 |
| 630 | 3300025942 | Ga0207689_10000475 | Ga0207689_1000047522 | 314 |
| 631 | 3300025942 | Ga0207689_10016138 | Ga0207689_100161385 | 314 |
| 632 | 3300025942 | Ga0207689_10055979 | Ga0207689_100559793 | 314 |
| 633 | 3300025949 | Ga0207667_10025236 | Ga0207667_100252365 | 314 |
| 634 | 3300025961 | Ga0207712_10211564 | Ga0207712_102115642 | 314 |
| 635 | 3300026023 | Ga0207677_10009984 | Ga0207677_100099847 | 314 |
| 636 | 3300026035 | Ga0207703_10001336 | Ga0207703_100013367 | 314 |
| 637 | 3300026035 | Ga0207703_10078016 | Ga0207703_100780163 | 314 |
| 638 | 3300026075 | Ga0207708_10000465 | Ga0207708_1000046519 | 314 |
| 639 | 3300026078 | Ga0207702_10211194 | Ga0207702_102111942 | 314 |
| 640 | 3300026088 | Ga0207641_10209669 | Ga0207641_102096692 | 314 |
| 641 | 3300026088 | Ga0207641_10440816 | Ga0207641_104408161 | 314 |
| 642 | 3300026089 | Ga0207648_10000171 | Ga0207648_1000017122 | 314 |
| 643 | 3300026089 | Ga0207648_10000711 | Ga0207648_1000071118 | 314 |
| 644 | 3300026095 | Ga0207676_10282200 | Ga0207676_102822002 | 314 |
| 645 | 3300026118 | Ga0207675_100000321 | Ga0207675_10000032114 | 314 |
| 646 | 3300026118 | Ga0207675_100013607 | Ga0207675_1000136074 | 314 |
| 647 | 3300026118 | Ga0207675_100138421 | Ga0207675_1001384213 | 314 |
| 648 | 3300027682 | Ga0209971_1021721 | Ga0209971_10217212 | 314 |
| 649 | 3300027695 | Ga0209966_1002806 | Ga0209966_10028063 | 314 |
| 650 | 3300027907 | Ga0207428_10005465 | Ga0207428_1000546514 | 314 |
| 651 | 3300028380 | Ga0268265_10000628 | Ga0268265_100006284 | 314 |
| 652 | 3300028380 | Ga0268265_10000632 | Ga0268265_1000063221 | 314 |
| 653 | 3300028380 | Ga0268265_10347951 | Ga0268265_103479512 | 314 |
| 654 | 3300028381 | Ga0268264_10000745 | Ga0268264_1000074539 | 314 |
| 655 | 3300028381 | Ga0268264_10041569 | Ga0268264_100415692 | 314 |
| 656 | 3300034816 | Ga0373930_0002774 | Ga0373930_0002774_20_1027 | 314 |
| 657 | 3300034957 | Ga0373938_0014320 | Ga0373938_0014320_239_1270 | 314 |
| 658 | 3300035085 | Ga0373929_0002976 | Ga0373929_0002976_1651_2682 | 314 |
| 659 | 3300035092 | Ga0373952_0008361 | Ga0373952_0008361_940_1944 | 314 |
| 660 | 3300035111 | Ga0373923_0031043 | Ga0373923_0031043_942_1964 | 314 |
| 661 | 3300035114 | Ga0373939_0002617 | Ga0373939_0002617_2247_3254 | 314 |
| 662 | 3300035114 | Ga0373939_0037568 | Ga0373939_0037568_70_1074 | 314 |
| 663 | 3300035121 | Ga0373960_0004502 | Ga0373960_0004502_1530_2561 | 314 |
| 664 | 3300035121 | Ga0373960_0033058 | Ga0373960_0033058_363_1409 | 314 |
| 665 | 3300035207 | Ga0373942_0011370 | Ga0373942_0011370_215_1219 | 314 |
| 666 | 3300035241 | Ga0373961_0003067 | Ga0373961_0003067_1313_2344 | 314 |
| 667 | 3300035242 | Ga0373962_0016319 | Ga0373962_0016319_647_1654 | 314 |
| 668 | 3300035691 | Ga0373931_0000773 | Ga0373931_0000773_261_1292 | 314 |
| 669 | 3300042436 | Ga0439435_0000410 | Ga0439435_0000410_5403_6398 | 314 |
| 670 | 3300045051 | Ga0451576_0002358 | Ga0451576_0002358_13026_14024 | 314 |
| 671 | 3300045051 | Ga0451576_0005086 | Ga0451576_0005086_7838_8869 | 314 |
| 672 | 3300046674 | Ga0495588_0125924 | Ga0495588_0125924_203_1240 | 314 |
| 673 | 3300047318 | Ga0495636_0017142 | Ga0495636_0017142_243_1280 | 314 |
| 674 | 3300049568 | Ga0501031_0003010 | Ga0501031_0003010_7346_8341 | 314 |
| 675 | 3300049569 | Ga0501032_0025946 | Ga0501032_0025946_2582_3577 | 314 |
| 676 | 3300049572 | Ga0501036_0000184 | Ga0501036_0000184_18286_19281 | 314 |
| 677 | 3300049573 | Ga0501037_0013481 | Ga0501037_0013481_4742_5737 | 314 |
| 678 | 3300049574 | Ga0501038_0012407 | Ga0501038_0012407_1891_2886 | 314 |
| 679 | 3300049575 | Ga0501039_0000053 | Ga0501039_0000053_52382_53377 | 314 |
| 680 | 3300049576 | Ga0501040_0001174 | Ga0501040_0001174_14812_15807 | 314 |
| 681 | 3300049577 | Ga0501041_0000118 | Ga0501041_0000118_18596_19591 | 314 |
| 682 | 3300049578 | Ga0501042_0000120 | Ga0501042_0000120_13003_13998 | 314 |
| 683 | 3300049580 | Ga0501046_0000144 | Ga0501046_0000144_4745_5740 | 314 |
| 684 | 3300049580 | Ga0501046_0058443 | Ga0501046_0058443_1623_2618 | 314 |
| 685 | 3300049581 | Ga0501047_0080903 | Ga0501047_0080903_799_1794 | 314 |
| 686 | 3300049582 | Ga0501048_0002750 | Ga0501048_0002750_7788_8783 | 314 |
| 687 | 3300049584 | Ga0501068_0026532 | Ga0501068_0026532_2132_3127 | 314 |
| 688 | 3300049585 | Ga0501069_0032873 | Ga0501069_0032873_832_1836 | 314 |
| 689 | 3300049585 | Ga0501069_0044384 | Ga0501069_0044384_44_1081 | 314 |
| 690 | 3300049587 | Ga0501071_0012759 | Ga0501071_0012759_33_1028 | 314 |
| 691 | 3300049588 | Ga0501072_0000147 | Ga0501072_0000147_17465_18460 | 314 |
| 692 | 3300049588 | Ga0501072_0008575 | Ga0501072_0008575_5373_6371 | 314 |
| 693 | 3300049588 | Ga0501072_0225954 | Ga0501072_0225954_454_1449 | 314 |
| 694 | 3300049588 | Ga0501072_0252501 | Ga0501072_0252501_83_1093 | 314 |
| 695 | 3300049589 | Ga0501073_0118346 | Ga0501073_0118346_344_1339 | 314 |
| 696 | 3300049590 | Ga0501074_0003883 | Ga0501074_0003883_8498_9493 | 314 |
| 697 | 3300049591 | Ga0501075_0000662 | Ga0501075_0000662_1891_2886 | 314 |
| 698 | 3300049592 | Ga0501076_0000265 | Ga0501076_0000265_18297_19292 | 314 |
| 699 | 3300049593 | Ga0501077_0000448 | Ga0501077_0000448_10592_11587 | 314 |
| 700 | 3300049741 | Ga0501079_0000132 | Ga0501079_0000132_18278_19273 | 314 |
| 701 | 3300049742 | Ga0501080_0002706 | Ga0501080_0002706_3603_4598 | 314 |
| 702 | 3300049743 | Ga0501081_0000052 | Ga0501081_0000052_3188_4183 | 314 |
| 703 | 3300049743 | Ga0501081_0036404 | Ga0501081_0036404_984_1979 | 314 |
| 704 | 3300049822 | Ga0501035_0055373 | Ga0501035_0055373_2098_3093 | 314 |
| 705 | 3300049822 | Ga0501035_0366685 | Ga0501035_0366685_150_1145 | 314 |
| 706 | 3300049824 | Ga0501045_0016856 | Ga0501045_0016856_910_1905 | 314 |
| 707 | 3300049824 | Ga0501045_0105158 | Ga0501045_0105158_281_1279 | 314 |
| 708 | 3300049824 | Ga0501045_0316522 | Ga0501045_0316522_62_1057 | 314 |
| 709 | 3300050507 | nmdc:mga05p37_137_c1 | nmdc:mga05p37_137_c1_49261_50292 | 314 |
| 710 | 3300050507 | nmdc:mga05p37_164023_c1 | nmdc:mga05p37_164023_c1_1314_2309 | 314 |
| 711 | 3300050508 | nmdc:mga09592_258_c1 | nmdc:mga09592_258_c1_10540_11571 | 314 |
| 712 | 3300050509 | nmdc:mga0qj67_24062_c1 | nmdc:mga0qj67_24062_c1_1607_2602 | 314 |
| 713 | 3300050511 | nmdc:mga08y16_328530_c1 | nmdc:mga08y16_328530_c1_478_1482 | 314 |
| 714 | 3300050512 | nmdc:mga0n895_134_c1 | nmdc:mga0n895_134_c1_31378_32379 | 314 |
| 715 | 3300050512 | nmdc:mga0n895_1724_c1 | nmdc:mga0n895_1724_c1_2637_3647 | 314 |
| 716 | 3300050513 | nmdc:mga0rr50_291_c1 | nmdc:mga0rr50_291_c1_4800_5801 | 314 |
| 717 | 3300050514 | nmdc:mga08x19_1128_c1 | nmdc:mga08x19_1128_c1_2841_3842 | 314 |
| 718 | 3300050515 | nmdc:mga0a205_390084_c1 | nmdc:mga0a205_390084_c1_98_1105 | 314 |
| 719 | 3300050515 | nmdc:mga0a205_601_c1 | nmdc:mga0a205_601_c1_26368_27369 | 314 |
| 720 | 3300054114 | Ga0501084_0000260 | Ga0501084_0000260_18297_19292 | 314 |
| 721 | 3300060353 | Ga0501082_0008334 | Ga0501082_0008334_816_1811 | 314 |
| 722 | 3300061734 | Ga0530510_0000174 | Ga0530510_0000174_26901_27896 | 314 |
| 723 | 3300005344 | Ga0070661_100085142 | Ga0070661_1000851422 | 315 |
| 724 | 3300005347 | Ga0070668_100028302 | Ga0070668_1000283023 | 315 |
| 725 | 3300005347 | Ga0070668_100028483 | Ga0070668_1000284834 | 315 |
| 726 | 3300005355 | Ga0070671_100017520 | Ga0070671_1000175206 | 315 |
| 727 | 3300005530 | Ga0070679_100049543 | Ga0070679_1000495432 | 315 |
| 728 | 3300005536 | Ga0070697_100083742 | Ga0070697_1000837423 | 315 |
| 729 | 3300005563 | Ga0068855_100333597 | Ga0068855_1003335972 | 315 |
| 730 | 3300005577 | Ga0068857_100009677 | Ga0068857_1000096778 | 315 |
| 731 | 3300005616 | Ga0068852_100130983 | Ga0068852_1001309832 | 315 |
| 732 | 3300005844 | Ga0068862_100016928 | Ga0068862_1000169287 | 315 |
| 733 | 3300005844 | Ga0068862_100101554 | Ga0068862_1001015542 | 315 |
| 734 | 3300006931 | Ga0097620_100025304 | Ga0097620_1000253043 | 315 |
| 735 | 3300009098 | Ga0105245_10075495 | Ga0105245_100754954 | 315 |
| 736 | 3300009148 | Ga0105243_10077088 | Ga0105243_100770882 | 315 |
| 737 | 3300009177 | Ga0105248_10028581 | Ga0105248_100285814 | 315 |
| 738 | 3300009553 | Ga0105249_10208644 | Ga0105249_102086442 | 315 |
| 739 | 3300013100 | Ga0157373_10206307 | Ga0157373_102063071 | 315 |
| 740 | 3300013104 | Ga0157370_10011428 | Ga0157370_100114285 | 315 |
| 741 | 3300013297 | Ga0157378_10009903 | Ga0157378_100099031 | 315 |
| 742 | 3300013306 | Ga0163162_10060878 | Ga0163162_100608782 | 315 |
| 743 | 3300013307 | Ga0157372_10107329 | Ga0157372_101073293 | 315 |
| 744 | 3300014325 | Ga0163163_10035789 | Ga0163163_100357894 | 315 |
| 745 | 3300014968 | Ga0157379_10011496 | Ga0157379_100114964 | 315 |
| 746 | 3300021361 | Ga0213872_10002840 | Ga0213872_100028406 | 315 |
| 747 | 3300025907 | Ga0207645_10007073 | Ga0207645_100070739 | 315 |
| 748 | 3300025909 | Ga0207705_10087109 | Ga0207705_100871093 | 315 |
| 749 | 3300025913 | Ga0207695_10096007 | Ga0207695_100960071 | 315 |
| 750 | 3300025920 | Ga0207649_10008725 | Ga0207649_100087252 | 315 |
| 751 | 3300025921 | Ga0207652_10085744 | Ga0207652_100857441 | 315 |
| 752 | 3300025923 | Ga0207681_10278528 | Ga0207681_102785282 | 315 |
| 753 | 3300025931 | Ga0207644_10018852 | Ga0207644_100188522 | 315 |
| 754 | 3300025937 | Ga0207669_10181699 | Ga0207669_101816992 | 315 |
| 755 | 3300025961 | Ga0207712_10121541 | Ga0207712_101215412 | 315 |
| 756 | 3300025972 | Ga0207668_10026334 | Ga0207668_100263344 | 315 |
| 757 | 3300025972 | Ga0207668_10061110 | Ga0207668_100611103 | 315 |
| 758 | 3300026023 | Ga0207677_10070928 | Ga0207677_100709282 | 315 |
| 759 | 3300026088 | Ga0207641_10158709 | Ga0207641_101587092 | 315 |
| 760 | 3300026089 | Ga0207648_10012551 | Ga0207648_100125514 | 315 |
| 761 | 3300026116 | Ga0207674_10020682 | Ga0207674_100206824 | 315 |
| 762 | 3300026118 | Ga0207675_100021027 | Ga0207675_1000210273 | 315 |
| 763 | 3300026118 | Ga0207675_100167502 | Ga0207675_1001675023 | 315 |
| 764 | 3300027671 | Ga0209588_1004068 | Ga0209588_10040684 | 315 |
| 765 | 3300028380 | Ga0268265_10356661 | Ga0268265_103566611 | 315 |
| 766 | 3300028381 | Ga0268264_10053965 | Ga0268264_100539653 | 315 |
| 767 | 3300035117 | Ga0373953_0004673 | Ga0373953_0004673_740_1777 | 315 |
| 768 | 3300035119 | Ga0373956_0056558 | Ga0373956_0056558_64_1101 | 315 |
| 769 | 3300035120 | Ga0373957_0039924 | Ga0373957_0039924_660_1697 | 315 |
| 770 | 3300035724 | Ga0373933_0009221 | Ga0373933_0009221_66_1103 | 315 |
| 771 | 3300036401 | Ga0373937_0005243 | Ga0373937_0005243_2308_3345 | 315 |
| 772 | 3300039447 | Ga0436361_0000750 | Ga0436361_0000750_7315_8361 | 315 |
| 773 | 3300039447 | Ga0436361_0024448 | Ga0436361_0024448_21443_22489 | 315 |
| 774 | 3300046463 | Ga0495653_0136307 | Ga0495653_0136307_39_1076 | 315 |
| 775 | 3300046514 | Ga0495618_0110775 | Ga0495618_0110775_369_1406 | 315 |
| 776 | 3300046516 | Ga0495628_0051437 | Ga0495628_0051437_643_1680 | 315 |
| 777 | 3300046517 | Ga0495630_0060932 | Ga0495630_0060932_66_1103 | 315 |
| 778 | 3300046529 | Ga0495652_0078352 | Ga0495652_0078352_678_1715 | 315 |
| 779 | 3300046535 | Ga0495586_0126856 | Ga0495586_0126856_264_1301 | 315 |
| 780 | 3300046539 | Ga0495621_0053449 | Ga0495621_0053449_252_1253 | 315 |
| 781 | 3300046559 | Ga0495667_0010591 | Ga0495667_0010591_3741_4778 | 315 |
| 782 | 3300046615 | Ga0495656_0033759 | Ga0495656_0033759_616_1635 | 315 |
| 783 | 3300046678 | Ga0495599_0068387 | Ga0495599_0068387_312_1349 | 315 |
| 784 | 3300048905 | Ga0496102_0246842 | Ga0496102_0246842_588_1634 | 315 |
| 785 | 3300049571 | Ga0501034_0214346 | Ga0501034_0214346_324_1367 | 315 |
| 786 | 3300049575 | Ga0501039_0007780 | Ga0501039_0007780_6414_7457 | 315 |
| 787 | 3300049576 | Ga0501040_0010702 | Ga0501040_0010702_2395_3438 | 315 |
| 788 | 3300049577 | Ga0501041_0007398 | Ga0501041_0007398_1892_2935 | 315 |
| 789 | 3300049578 | Ga0501042_0006533 | Ga0501042_0006533_3037_4080 | 315 |
| 790 | 3300049579 | Ga0501043_0042253 | Ga0501043_0042253_637_1680 | 315 |
| 791 | 3300049583 | Ga0501067_0024210 | Ga0501067_0024210_801_1844 | 315 |
| 792 | 3300049585 | Ga0501069_0092095 | Ga0501069_0092095_64_1107 | 315 |
| 793 | 3300049587 | Ga0501071_0016342 | Ga0501071_0016342_4034_5077 | 315 |
| 794 | 3300049589 | Ga0501073_0006688 | Ga0501073_0006688_6096_7139 | 315 |
| 795 | 3300049591 | Ga0501075_0039475 | Ga0501075_0039475_2131_3174 | 315 |
| 796 | 3300049592 | Ga0501076_0011579 | Ga0501076_0011579_5126_6169 | 315 |
| 797 | 3300049741 | Ga0501079_0000752 | Ga0501079_0000752_5859_6902 | 315 |
| 798 | 3300049742 | Ga0501080_0006551 | Ga0501080_0006551_7702_8745 | 315 |
| 799 | 3300049743 | Ga0501081_0001770 | Ga0501081_0001770_10997_12040 | 315 |
| 800 | 3300049744 | Ga0501083_0045395 | Ga0501083_0045395_433_1476 | 315 |
| 801 | 3300049744 | Ga0501083_0101560 | Ga0501083_0101560_480_1523 | 315 |
| 802 | 3300053077 | Ga0495601_0002885 | Ga0495601_0002885_5301_6338 | 315 |
| 803 | 3300060353 | Ga0501082_0013158 | Ga0501082_0013158_5093_6136 | 315 |
| 804 | 3300060353 | Ga0501082_0086132 | Ga0501082_0086132_102_1145 | 315 |
| 805 | 3300005328 | Ga0070676_10042161 | Ga0070676_100421611 | 316 |
| 806 | 3300005330 | Ga0070690_100089090 | Ga0070690_1000890901 | 316 |
| 807 | 3300005340 | Ga0070689_100231833 | Ga0070689_1002318331 | 316 |
| 808 | 3300005354 | Ga0070675_100067178 | Ga0070675_1000671782 | 316 |
| 809 | 3300005356 | Ga0070674_100023890 | Ga0070674_1000238901 | 316 |
| 810 | 3300005366 | Ga0070659_100073065 | Ga0070659_1000730651 | 316 |
| 811 | 3300005438 | Ga0070701_10016039 | Ga0070701_100160394 | 316 |
| 812 | 3300005456 | Ga0070678_100075992 | Ga0070678_1000759922 | 316 |
| 813 | 3300005457 | Ga0070662_100035144 | Ga0070662_1000351444 | 316 |
| 814 | 3300005457 | Ga0070662_100245291 | Ga0070662_1002452912 | 316 |
| 815 | 3300005457 | Ga0070662_100253442 | Ga0070662_1002534422 | 316 |
| 816 | 3300005458 | Ga0070681_10011237 | Ga0070681_100112374 | 316 |
| 817 | 3300005458 | Ga0070681_10025978 | Ga0070681_100259785 | 316 |
| 818 | 3300005458 | Ga0070681_10042940 | Ga0070681_100429403 | 316 |
| 819 | 3300005459 | Ga0068867_100023044 | Ga0068867_1000230444 | 316 |
| 820 | 3300005459 | Ga0068867_100048586 | Ga0068867_1000485862 | 316 |
| 821 | 3300005468 | Ga0070707_100050967 | Ga0070707_1000509672 | 316 |
| 822 | 3300005530 | Ga0070679_100290556 | Ga0070679_1002905562 | 316 |
| 823 | 3300005536 | Ga0070697_100100623 | Ga0070697_1001006232 | 316 |
| 824 | 3300005543 | Ga0070672_100093259 | Ga0070672_1000932593 | 316 |
| 825 | 3300005548 | Ga0070665_100008476 | Ga0070665_1000084769 | 316 |
| 826 | 3300005548 | Ga0070665_100040250 | Ga0070665_1000402505 | 316 |
| 827 | 3300005548 | Ga0070665_100230064 | Ga0070665_1002300642 | 316 |
| 828 | 3300005549 | Ga0070704_100200682 | Ga0070704_1002006822 | 316 |
| 829 | 3300005564 | Ga0070664_100003033 | Ga0070664_1000030334 | 316 |
| 830 | 3300005564 | Ga0070664_100183961 | Ga0070664_1001839612 | 316 |
| 831 | 3300005614 | Ga0068856_100027421 | Ga0068856_1000274215 | 316 |
| 832 | 3300005614 | Ga0068856_100052324 | Ga0068856_1000523243 | 316 |
| 833 | 3300005617 | Ga0068859_100049097 | Ga0068859_1000490975 | 316 |
| 834 | 3300005618 | Ga0068864_100150357 | Ga0068864_1001503572 | 316 |
| 835 | 3300005841 | Ga0068863_100223213 | Ga0068863_1002232132 | 316 |
| 836 | 3300005842 | Ga0068858_100008217 | Ga0068858_1000082178 | 316 |
| 837 | 3300005842 | Ga0068858_100027824 | Ga0068858_1000278242 | 316 |
| 838 | 3300005842 | Ga0068858_100135647 | Ga0068858_1001356472 | 316 |
| 839 | 3300005843 | Ga0068860_100120401 | Ga0068860_1001204011 | 316 |
| 840 | 3300005844 | Ga0068862_100194977 | Ga0068862_1001949772 | 316 |
| 841 | 3300006175 | Ga0070712_100133078 | Ga0070712_1001330782 | 316 |
| 842 | 3300006358 | Ga0068871_100007928 | Ga0068871_1000079284 | 316 |
| 843 | 3300006844 | Ga0075428_100090114 | Ga0075428_1000901142 | 316 |
| 844 | 3300006846 | Ga0075430_100035077 | Ga0075430_1000350773 | 316 |
| 845 | 3300006846 | Ga0075430_100114549 | Ga0075430_1001145493 | 316 |
| 846 | 3300006847 | Ga0075431_100010159 | Ga0075431_1000101595 | 316 |
| 847 | 3300006871 | Ga0075434_100140254 | Ga0075434_1001402543 | 316 |
| 848 | 3300006880 | Ga0075429_100006909 | Ga0075429_1000069094 | 316 |
| 849 | 3300006931 | Ga0097620_100049098 | Ga0097620_1000490982 | 316 |
| 850 | 3300007265 | Ga0099794_10002614 | Ga0099794_100026143 | 316 |
| 851 | 3300009094 | Ga0111539_10002337 | Ga0111539_1000233717 | 316 |
| 852 | 3300009176 | Ga0105242_10139885 | Ga0105242_101398852 | 316 |
| 853 | 3300009176 | Ga0105242_10364229 | Ga0105242_103642292 | 316 |
| 854 | 3300009177 | Ga0105248_10082693 | Ga0105248_100826932 | 316 |
| 855 | 3300009177 | Ga0105248_10174301 | Ga0105248_101743012 | 316 |
| 856 | 3300009553 | Ga0105249_10265321 | Ga0105249_102653212 | 316 |
| 857 | 3300013296 | Ga0157374_10098146 | Ga0157374_100981461 | 316 |
| 858 | 3300013306 | Ga0163162_10099873 | Ga0163162_100998733 | 316 |
| 859 | 3300013308 | Ga0157375_10128455 | Ga0157375_101284552 | 316 |
| 860 | 3300013308 | Ga0157375_10200891 | Ga0157375_102008912 | 316 |
| 861 | 3300014325 | Ga0163163_10180510 | Ga0163163_101805102 | 316 |
| 862 | 3300014326 | Ga0157380_10116711 | Ga0157380_101167113 | 316 |
| 863 | 3300014969 | Ga0157376_10020315 | Ga0157376_100203152 | 316 |
| 864 | 3300014969 | Ga0157376_10025322 | Ga0157376_100253226 | 316 |
| 865 | 3300025315 | Ga0207697_10028346 | Ga0207697_100283462 | 316 |
| 866 | 3300025893 | Ga0207682_10002805 | Ga0207682_100028053 | 316 |
| 867 | 3300025907 | Ga0207645_10015078 | Ga0207645_100150782 | 316 |
| 868 | 3300025910 | Ga0207684_10012905 | Ga0207684_100129057 | 316 |
| 869 | 3300025912 | Ga0207707_10056787 | Ga0207707_100567872 | 316 |
| 870 | 3300025915 | Ga0207693_10167898 | Ga0207693_101678981 | 316 |
| 871 | 3300025918 | Ga0207662_10062741 | Ga0207662_100627412 | 316 |
| 872 | 3300025922 | Ga0207646_10034163 | Ga0207646_100341634 | 316 |
| 873 | 3300025923 | Ga0207681_10032634 | Ga0207681_100326344 | 316 |
| 874 | 3300025925 | Ga0207650_10003776 | Ga0207650_100037762 | 316 |
| 875 | 3300025926 | Ga0207659_10002570 | Ga0207659_1000257013 | 316 |
| 876 | 3300025926 | Ga0207659_10011642 | Ga0207659_100116424 | 316 |
| 877 | 3300025932 | Ga0207690_10164059 | Ga0207690_101640592 | 316 |
| 878 | 3300025933 | Ga0207706_10018329 | Ga0207706_100183295 | 316 |
| 879 | 3300025935 | Ga0207709_10075431 | Ga0207709_100754312 | 316 |
| 880 | 3300025937 | Ga0207669_10125569 | Ga0207669_101255692 | 316 |
| 881 | 3300025938 | Ga0207704_10008379 | Ga0207704_100083794 | 316 |
| 882 | 3300025940 | Ga0207691_10002088 | Ga0207691_1000208823 | 316 |
| 883 | 3300025940 | Ga0207691_10096585 | Ga0207691_100965852 | 316 |
| 884 | 3300025941 | Ga0207711_10037450 | Ga0207711_100374502 | 316 |
| 885 | 3300025942 | Ga0207689_10000859 | Ga0207689_100008595 | 316 |
| 886 | 3300025942 | Ga0207689_10045413 | Ga0207689_100454132 | 316 |
| 887 | 3300025972 | Ga0207668_10103129 | Ga0207668_101031293 | 316 |
| 888 | 3300025986 | Ga0207658_10028439 | Ga0207658_100284392 | 316 |
| 889 | 3300026023 | Ga0207677_10123312 | Ga0207677_101233122 | 316 |
| 890 | 3300026035 | Ga0207703_10029051 | Ga0207703_100290512 | 316 |
| 891 | 3300026035 | Ga0207703_10168487 | Ga0207703_101684872 | 316 |
| 892 | 3300026078 | Ga0207702_10079932 | Ga0207702_100799323 | 316 |
| 893 | 3300026078 | Ga0207702_10273703 | Ga0207702_102737031 | 316 |
| 894 | 3300026088 | Ga0207641_10183493 | Ga0207641_101834932 | 316 |
| 895 | 3300026089 | Ga0207648_10033218 | Ga0207648_100332184 | 316 |
| 896 | 3300026089 | Ga0207648_10262874 | Ga0207648_102628741 | 316 |
| 897 | 3300026095 | Ga0207676_10237503 | Ga0207676_102375032 | 316 |
| 898 | 3300026118 | Ga0207675_100068014 | Ga0207675_1000680144 | 316 |
| 899 | 3300026142 | Ga0207698_10125633 | Ga0207698_101256332 | 316 |
| 900 | 3300027907 | Ga0207428_10098204 | Ga0207428_100982043 | 316 |
| 901 | 3300028577 | Ga0265318_10001865 | Ga0265318_100018655 | 316 |
| 902 | 3300031235 | Ga0265330_10011762 | Ga0265330_100117624 | 316 |
| 903 | 3300031238 | Ga0265332_10001879 | Ga0265332_100018793 | 316 |
| 904 | 3300031242 | Ga0265329_10009644 | Ga0265329_100096442 | 316 |
| 905 | 3300031250 | Ga0265331_10001401 | Ga0265331_100014017 | 316 |
| 906 | 3300031251 | Ga0265327_10005966 | Ga0265327_100059664 | 316 |
| 907 | 3300031344 | Ga0265316_10039732 | Ga0265316_100397323 | 316 |
| 908 | 3300031548 | Ga0307408_100236196 | Ga0307408_1002361961 | 316 |
| 909 | 3300031665 | Ga0316575_10004283 | Ga0316575_100042832 | 316 |
| 910 | 3300031711 | Ga0265314_10000660 | Ga0265314_1000066036 | 316 |
| 911 | 3300031727 | Ga0316576_10024457 | Ga0316576_100244574 | 316 |
| 912 | 3300031824 | Ga0307413_10070379 | Ga0307413_100703792 | 316 |
| 913 | 3300032004 | Ga0307414_10069181 | Ga0307414_100691813 | 316 |
| 914 | 3300032133 | Ga0316583_10000317 | Ga0316583_1000031711 | 316 |
| 915 | 3300035398 | Ga0316574_0102261 | Ga0316574_0102261_551_1582 | 316 |
| 916 | 3300044712 | Ga0453684_0000014 | Ga0453684_0000014_918166_919218 | 316 |
| 917 | 3300044712 | Ga0453684_0000736 | Ga0453684_0000736_66794_67846 | 316 |
| 918 | 3300044712 | Ga0453684_0002679 | Ga0453684_0002679_13462_14529 | 316 |
| 919 | 3300045051 | Ga0451576_0000519 | Ga0451576_0000519_67085_68137 | 316 |
| 920 | 3300046528 | Ga0495642_0021115 | Ga0495642_0021115_447_1493 | 316 |
| 921 | 3300048913 | Ga0496110_0117557 | Ga0496110_0117557_1001_2047 | 316 |
| 922 | 3300049569 | Ga0501032_0000317 | Ga0501032_0000317_4583_5638 | 316 |
| 923 | 3300049572 | Ga0501036_0017451 | Ga0501036_0017451_2488_3528 | 316 |
| 924 | 3300049575 | Ga0501039_0100328 | Ga0501039_0100328_869_1909 | 316 |
| 925 | 3300049576 | Ga0501040_0017033 | Ga0501040_0017033_3147_4187 | 316 |
| 926 | 3300049577 | Ga0501041_0034485 | Ga0501041_0034485_1917_2957 | 316 |
| 927 | 3300049578 | Ga0501042_0015564 | Ga0501042_0015564_4139_5179 | 316 |
| 928 | 3300049579 | Ga0501043_0214957 | Ga0501043_0214957_261_1307 | 316 |
| 929 | 3300049582 | Ga0501048_0027873 | Ga0501048_0027873_1346_2386 | 316 |
| 930 | 3300049585 | Ga0501069_0017219 | Ga0501069_0017219_2624_3733 | 316 |
| 931 | 3300049586 | Ga0501070_0042303 | Ga0501070_0042303_2047_3156 | 316 |
| 932 | 3300049587 | Ga0501071_0009263 | Ga0501071_0009263_2024_3064 | 316 |
| 933 | 3300049591 | Ga0501075_0000301 | Ga0501075_0000301_5064_6104 | 316 |
| 934 | 3300049592 | Ga0501076_0000098 | Ga0501076_0000098_20241_21281 | 316 |
| 935 | 3300049593 | Ga0501077_0027943 | Ga0501077_0027943_1714_2754 | 316 |
| 936 | 3300049741 | Ga0501079_0000932 | Ga0501079_0000932_14643_15683 | 316 |
| 937 | 3300049742 | Ga0501080_0212429 | Ga0501080_0212429_40_1149 | 316 |
| 938 | 3300049824 | Ga0501045_0011716 | Ga0501045_0011716_2230_3270 | 316 |
| 939 | 3300049824 | Ga0501045_0039127 | Ga0501045_0039127_1286_2326 | 316 |
| 940 | 3300050508 | nmdc:mga09592_13246_c1 | nmdc:mga09592_13246_c1_3213_4259 | 316 |
| 941 | 3300050509 | nmdc:mga0qj67_13046_c1 | nmdc:mga0qj67_13046_c1_4982_5989 | 316 |
| 942 | 3300050509 | nmdc:mga0qj67_218332_c1 | nmdc:mga0qj67_218332_c1_221_1270 | 316 |
| 943 | 3300050510 | nmdc:mga06r32_27741_c1 | nmdc:mga06r32_27741_c1_924_1973 | 316 |
| 944 | 3300050511 | nmdc:mga08y16_18747_c1 | nmdc:mga08y16_18747_c1_3329_4375 | 316 |
| 945 | 3300054114 | Ga0501084_0008499 | Ga0501084_0008499_5324_6364 | 316 |
| 946 | 3300060353 | Ga0501082_0001136 | Ga0501082_0001136_7394_8434 | 316 |
| 947 | 3300061734 | Ga0530510_0000351 | Ga0530510_0000351_26588_27628 | 316 |
| 948 | 3300006846 | Ga0075430_100012241 | Ga0075430_1000122412 | 317 |
| 949 | 3300050509 | nmdc:mga0qj67_18450_c1 | nmdc:mga0qj67_18450_c1_1759_2766 | 317 |
| 950 | 3300003203 | JGI25406J46586_10022481 | JGI25406J46586_100224812 | 318 |
| 951 | 3300005345 | Ga0070692_10015262 | Ga0070692_100152623 | 318 |
| 952 | 3300005444 | Ga0070694_100044666 | Ga0070694_1000446664 | 318 |
| 953 | 3300005444 | Ga0070694_100097120 | Ga0070694_1000971203 | 318 |
| 954 | 3300005467 | Ga0070706_100072507 | Ga0070706_1000725074 | 318 |
| 955 | 3300005471 | Ga0070698_100045644 | Ga0070698_1000456443 | 318 |
| 956 | 3300005536 | Ga0070697_100003863 | Ga0070697_1000038633 | 318 |
| 957 | 3300005545 | Ga0070695_100000952 | Ga0070695_10000095213 | 318 |
| 958 | 3300005545 | Ga0070695_100123361 | Ga0070695_1001233612 | 318 |
| 959 | 3300005545 | Ga0070695_100165033 | Ga0070695_1001650332 | 318 |
| 960 | 3300005985 | Ga0081539_10000188 | Ga0081539_10000188132 | 318 |
| 961 | 3300006844 | Ga0075428_100007657 | Ga0075428_1000076573 | 318 |
| 962 | 3300006844 | Ga0075428_100073629 | Ga0075428_1000736293 | 318 |
| 963 | 3300006847 | Ga0075431_100047368 | Ga0075431_1000473683 | 318 |
| 964 | 3300006852 | Ga0075433_10069699 | Ga0075433_100696992 | 318 |
| 965 | 3300006914 | Ga0075436_100000090 | Ga0075436_10000009035 | 318 |
| 966 | 3300006914 | Ga0075436_100002022 | Ga0075436_10000202214 | 318 |
| 967 | 3300006914 | Ga0075436_100014350 | Ga0075436_1000143503 | 318 |
| 968 | 3300007076 | Ga0075435_100035388 | Ga0075435_1000353882 | 318 |
| 969 | 3300009147 | Ga0114129_10146982 | Ga0114129_101469823 | 318 |
| 970 | 3300025910 | Ga0207684_10136096 | Ga0207684_101360963 | 318 |
| 971 | 3300035118 | Ga0373954_0000389 | Ga0373954_0000389_14890_15900 | 318 |
| 972 | 3300035724 | Ga0373933_0169588 | Ga0373933_0169588_302_1312 | 318 |
| 973 | 3300036401 | Ga0373937_0001626 | Ga0373937_0001626_2025_3035 | 318 |
| 974 | 3300036401 | Ga0373937_0046927 | Ga0373937_0046927_2463_3473 | 318 |
| 975 | 3300046454 | Ga0495592_0000274 | Ga0495592_0000274_11582_12592 | 318 |
| 976 | 3300046463 | Ga0495653_0060544 | Ga0495653_0060544_1143_2153 | 318 |
| 977 | 3300046473 | Ga0495582_0049451 | Ga0495582_0049451_110_1120 | 318 |
| 978 | 3300046476 | Ga0495662_0006621 | Ga0495662_0006621_3595_4605 | 318 |
| 979 | 3300046511 | Ga0495608_0000280 | Ga0495608_0000280_11404_12414 | 318 |
| 980 | 3300046516 | Ga0495628_0000155 | Ga0495628_0000155_11337_12347 | 318 |
| 981 | 3300046517 | Ga0495630_0001456 | Ga0495630_0001456_4197_5207 | 318 |
| 982 | 3300046528 | Ga0495642_0018049 | Ga0495642_0018049_877_1884 | 318 |
| 983 | 3300046533 | Ga0495640_0000538 | Ga0495640_0000538_5900_6910 | 318 |
| 984 | 3300046535 | Ga0495586_0000293 | Ga0495586_0000293_21669_22679 | 318 |
| 985 | 3300046543 | Ga0495645_0023581 | Ga0495645_0023581_791_1801 | 318 |
| 986 | 3300046559 | Ga0495667_0018886 | Ga0495667_0018886_19_1029 | 318 |
| 987 | 3300046642 | Ga0495634_0006512 | Ga0495634_0006512_4656_5666 | 318 |
| 988 | 3300046663 | Ga0495635_0038509 | Ga0495635_0038509_448_1458 | 318 |
| 989 | 3300046678 | Ga0495599_0007055 | Ga0495599_0007055_4599_5609 | 318 |
| 990 | 3300046683 | Ga0495658_0007860 | Ga0495658_0007860_3890_4900 | 318 |
| 991 | 3300046684 | Ga0495669_0002344 | Ga0495669_0002344_4458_5465 | 318 |
| 992 | 3300046689 | Ga0495613_0016043 | Ga0495613_0016043_3853_4863 | 318 |
| 993 | 3300047317 | Ga0495604_0018583 | Ga0495604_0018583_4170_5180 | 318 |
| 994 | 3300047322 | Ga0495680_0000202 | Ga0495680_0000202_61437_62447 | 318 |
| 995 | 3300050507 | nmdc:mga05p37_116363_c1 | nmdc:mga05p37_116363_c1_1392_2399 | 318 |
| 996 | 3300050508 | nmdc:mga09592_312745_c1 | nmdc:mga09592_312745_c1_98_1189 | 318 |
| 997 | 3300050514 | nmdc:mga08x19_24601_c1 | nmdc:mga08x19_24601_c1_906_1913 | 318 |
| 998 | 3300050514 | nmdc:mga08x19_281_c1 | nmdc:mga08x19_281_c1_7539_8546 | 318 |
| 999 | 3300050514 | nmdc:mga08x19_6434_c1 | nmdc:mga08x19_6434_c1_2660_3667 | 318 |
| 1000 | 3300050515 | nmdc:mga0a205_48833_c1 | nmdc:mga0a205_48833_c1_1156_2166 | 318 |
| 1001 | 3300053077 | Ga0495601_0007232 | Ga0495601_0007232_847_1857 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v9y-assembly1.cif.gz_A | human aminoimidazole ribonucleotide synthetase | 0.9383 | 51 | 315 |
| 5vk4-assembly1.cif.gz_A | crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium | 0.9347 | 16 | 318 |
| 5vk4-assembly1.cif.gz_B | crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium | 0.9345 | 16 | 318 |
| 1cli-assembly2.cif.gz_C | x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution | 0.9199 | 3 | 317 |
| 3p4e-assembly1.cif.gz_A-2 | phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae | 0.9119 | 16 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54GJ2_634_814_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9507 | 155 | 316 | 3.90.650.10 |
| 5vk4B02 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9485 | 155 | 318 | 3.90.650.10 |
| af_I6Y4V6_182_356_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9475 | 156 | 316 | 3.90.650.10 |
| af_Q2FZI8_168_339_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.943 | 152 | 314 | 3.90.650.10 |
| af_P07244_618_801_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9402 | 154 | 317 | 3.90.650.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661E4Z0-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9946 | 197 | 318 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A352CA30-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9895 | 215 | 309 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A1Y1QT65-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9873 | 217 | 318 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A533BA74-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9868 | 211 | 318 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A1J8PN17-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9856 | 195 | 309 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar