F487858

General Info

Members Datasets Scaffolds Average Seq Length
1000 412 2000 50

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10994733|Ga0065707_109947331
Length 57
Sequence VIRKLKDGRYRLYSRKVDPKTGKHRNLGTFATRAEAEQHEREVQFFKRNPIRRNRPR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
256 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
257 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
258 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
259 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
397 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
398 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
399 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
402 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
412 2904456579 Variovorax sp. 2002 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.1
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.1
Nodule 0
Rhizoplane 4.2
Rhizosphere 87.8
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10994733 3300005295 Unclassified 540
2 MBSR1b_contig_338456 2162886012 Bacteria 827
3 JGI24750J21931_1027256 3300002070 Bacteria 826
4 JGI24744J21845_10095206 3300002077 Bacteria 548
5 JGI24033J26618_1069027 3300002155 Bacteria 529
6 JGI25152J39213_1019172 3300002773 Bacteria 1250
7 JGI25151J46595_10000484 3300003187 Bacteria 37639
8 JGI25406J46586_10029830 3300003203 Bacteria 2059
9 rootH1_10007256 3300003316 Bacteria 4144
10 rootL2_10015755 3300003322 Bacteria 8422
11 Ga0055540_1021179 3300003792 Bacteria 1696
12 Ga0055531_10003055 3300003794 Bacteria 10844
13 JGI25405J52794_10109991 3300003911 Bacteria 618
14 Ga0065712_10577272 3300005290 Unclassified 579
15 Ga0065715_10206904 3300005293 Bacteria 1333
16 Ga0070658_10252621 3300005327 Bacteria 1496
17 Ga0070658_10570166 3300005327 Bacteria 980
18 Ga0070676_10094306 3300005328 Bacteria 1839
19 Ga0070676_10682791 3300005328 Bacteria 748
20 Ga0070690_100228533 3300005330 Bacteria 1307
21 Ga0070690_100271419 3300005330 Bacteria 1207
22 Ga0070690_100279108 3300005330 Bacteria 1191
23 Ga0070690_100943718 3300005330 Bacteria 677
24 Ga0070670_100063631 3300005331 Bacteria 3166
25 Ga0070670_101732113 3300005331 Bacteria 575
26 Ga0070677_10145241 3300005333 Bacteria 1098
27 Ga0070677_10198623 3300005333 Bacteria 966
28 Ga0068869_101058695 3300005334 Bacteria 708
29 Ga0070666_10017070 3300005335 Bacteria 4650
30 Ga0070666_10080003 3300005335 Bacteria 2233
31 Ga0070666_10117782 3300005335 Bacteria 1840
32 Ga0070680_100050311 3300005336 Bacteria 3399
33 Ga0070680_101562954 3300005336 Unclassified 571
34 Ga0068868_100486493 3300005338 Bacteria 1079
35 Ga0068868_100520136 3300005338 Bacteria 1045
36 Ga0068868_101757975 3300005338 Unclassified 585
37 Ga0070660_100735479 3300005339 Bacteria 828
38 Ga0070689_100241042 3300005340 Bacteria 1489
39 Ga0070689_101195869 3300005340 Bacteria 682
40 Ga0070691_10006637 3300005341 Bacteria 5296
41 Ga0070661_100416845 3300005344 Bacteria 1064
42 Ga0070661_101352789 3300005344 Bacteria 598
43 Ga0070692_10547514 3300005345 Unclassified 757
44 Ga0070668_100068711 3300005347 Bacteria 2755
45 Ga0070668_100147431 3300005347 Bacteria 1900
46 Ga0070668_100201141 3300005347 Bacteria 1635
47 Ga0070668_100526947 3300005347 Bacteria 1026
48 Ga0070669_100025621 3300005353 Bacteria 4237
49 Ga0070669_100028534 3300005353 Bacteria 4019
50 Ga0070669_100056074 3300005353 Bacteria 2889
51 Ga0070669_100191036 3300005353 Bacteria 1606
52 Ga0070669_100266970 3300005353 Bacteria 1367
53 Ga0070669_100383217 3300005353 Bacteria 1147
54 Ga0070669_100454702 3300005353 Bacteria 1056
55 Ga0070669_100546528 3300005353 Unclassified 965
56 Ga0070669_100580727 3300005353 Bacteria 937
57 Ga0070675_100008877 3300005354 Bacteria 7815
58 Ga0070675_100852498 3300005354 Bacteria 834
59 Ga0070671_100007199 3300005355 Bacteria 8896
60 Ga0070671_100473828 3300005355 Bacteria 1075
61 Ga0070671_102068782 3300005355 Bacteria 507
62 Ga0070674_100053480 3300005356 Bacteria 2788
63 Ga0070674_100083251 3300005356 Bacteria 2290
64 Ga0070673_100134150 3300005364 Bacteria 2082
65 Ga0070673_100373951 3300005364 Bacteria 1269
66 Ga0070673_100707842 3300005364 Bacteria 925
67 Ga0070688_100157532 3300005365 Bacteria 1558
68 Ga0070688_100545382 3300005365 Bacteria 881
69 Ga0070688_100618256 3300005365 Bacteria 831
70 Ga0070659_100245852 3300005366 Bacteria 1482
71 Ga0070667_100249905 3300005367 Bacteria 1585
72 Ga0070667_100274433 3300005367 Bacteria 1512
73 Ga0070667_100364275 3300005367 Bacteria 1311
74 Ga0070667_100543611 3300005367 Bacteria 1067
75 Ga0070667_100917141 3300005367 Bacteria 816
76 Ga0070714_100300172 3300005435 Bacteria 1497
77 Ga0070713_100095458 3300005436 Bacteria 2565
78 Ga0070713_100595181 3300005436 Bacteria 1050
79 Ga0070713_101855732 3300005436 Bacteria 585
80 Ga0070701_10014472 3300005438 Unclassified 3619
81 Ga0070701_11142789 3300005438 Bacteria 550
82 Ga0070711_100251064 3300005439 Bacteria 1387
83 Ga0070711_100660922 3300005439 Bacteria 877
84 Ga0070711_101047815 3300005439 Unclassified 701
85 Ga0070700_100005110 3300005441 Bacteria 6924
86 Ga0070700_100036463 3300005441 Unclassified 2983
87 Ga0070700_100640945 3300005441 Bacteria 838
88 Ga0070700_100660453 3300005441 Unclassified 827
89 Ga0070708_100009658 3300005445 Bacteria 7783
90 Ga0070708_100065755 3300005445 Bacteria 3252
91 Ga0070708_100243226 3300005445 Bacteria 1690
92 Ga0070708_101507231 3300005445 Unclassified 626
93 Ga0070663_100024749 3300005455 Bacteria 4045
94 Ga0070678_100099594 3300005456 Bacteria 2249
95 Ga0070678_100133403 3300005456 Bacteria 1977
96 Ga0070678_100399299 3300005456 Bacteria 1194
97 Ga0070678_100431250 3300005456 Bacteria 1151
98 Ga0070678_100624045 3300005456 Unclassified 964
99 Ga0070678_101650415 3300005456 Bacteria 602
100 Ga0070678_102135062 3300005456 Bacteria 531
101 Ga0070662_100023503 3300005457 Bacteria 4234
102 Ga0070662_100062512 3300005457 Bacteria 2721
103 Ga0070681_10014706 3300005458 Bacteria 7783
104 Ga0068867_100022027 3300005459 Bacteria 4552
105 Ga0068867_100605111 3300005459 Bacteria 956
106 Ga0068867_101146814 3300005459 Bacteria 711
107 Ga0068867_101473396 3300005459 Unclassified 633
108 Ga0070685_10598206 3300005466 Bacteria 793
109 Ga0070706_100066477 3300005467 Bacteria 3335
110 Ga0070706_100081688 3300005467 Bacteria 2993
111 Ga0070706_100588244 3300005467 Unclassified 1034
112 Ga0070707_100286935 3300005468 Bacteria 1599
113 Ga0070707_100855090 3300005468 Bacteria 874
114 Ga0070698_100129636 3300005471 Bacteria 2478
115 Ga0070698_100289477 3300005471 Bacteria 1569
116 Ga0070698_100407253 3300005471 Unclassified 1294
117 Ga0070699_100655991 3300005518 Bacteria 958
118 Ga0070679_100023496 3300005530 Bacteria 6035
119 Ga0070684_100194804 3300005535 Bacteria 1845
120 Ga0070684_101139745 3300005535 Unclassified 733
121 Ga0070697_100015136 3300005536 Bacteria 6056
122 Ga0070697_100125531 3300005536 Bacteria 2149
123 Ga0070697_100234137 3300005536 Bacteria 1567
124 Ga0070672_100018857 3300005543 Bacteria 4997
125 Ga0070672_100022894 3300005543 Bacteria 4597
126 Ga0070672_100087727 3300005543 Bacteria 2504
127 Ga0070672_100116310 3300005543 Bacteria 2184
128 Ga0070672_100183923 3300005543 Bacteria 1742
129 Ga0070672_100910113 3300005543 Bacteria 777
130 Ga0070686_100066204 3300005544 Bacteria 2349
131 Ga0070686_100248599 3300005544 Bacteria 1298
132 Ga0070686_100568029 3300005544 Unclassified 889
133 Ga0070686_101288553 3300005544 Unclassified 610
134 Ga0070686_101764810 3300005544 Bacteria 526
135 Ga0070695_100014030 3300005545 Bacteria 4823
136 Ga0070695_100359679 3300005545 Bacteria 1093
137 Ga0070695_101275397 3300005545 Unclassified 606
138 Ga0070696_100806001 3300005546 Unclassified 773
139 Ga0070693_100543521 3300005547 Bacteria 830
140 Ga0070665_100238232 3300005548 Bacteria 1820
141 Ga0070704_101019314 3300005549 Bacteria 749
142 Ga0070704_101506468 3300005549 Bacteria 619
143 Ga0068855_100075847 3300005563 Bacteria 3904
144 Ga0068857_101570547 3300005577 Bacteria 642
145 Ga0068857_102007228 3300005577 Bacteria 567
146 Ga0068854_100261973 3300005578 Bacteria 1385
147 Ga0068854_101269865 3300005578 Unclassified 662
148 Ga0068856_100002367 3300005614 Bacteria 19393
149 Ga0068856_100849863 3300005614 Bacteria 932
150 Ga0070702_100021312 3300005615 Bacteria 3408
151 Ga0068852_100153006 3300005616 Bacteria 2147
152 Ga0068852_101249298 3300005616 Bacteria 764
153 Ga0068852_102364657 3300005616 Bacteria 552
154 Ga0068859_100141368 3300005617 Bacteria 2481
155 Ga0068859_100211100 3300005617 Bacteria 2028
156 Ga0068859_100989117 3300005617 Bacteria 924
157 Ga0068859_101082522 3300005617 Unclassified 881
158 Ga0068859_101484957 3300005617 Bacteria 748
159 Ga0068864_100101157 3300005618 Bacteria 2556
160 Ga0068864_102019601 3300005618 Bacteria 583
161 Ga0068866_10902499 3300005718 Bacteria 621
162 Ga0068861_100655083 3300005719 Bacteria 970
163 Ga0068861_101727827 3300005719 Unclassified 619
164 Ga0068851_10358363 3300005834 Bacteria 850
165 Ga0068870_10107141 3300005840 Bacteria 1589
166 Ga0068870_10411521 3300005840 Bacteria 882
167 Ga0068863_100205589 3300005841 Unclassified 1895
168 Ga0068863_100213207 3300005841 Bacteria 1859
169 Ga0068863_100263329 3300005841 Bacteria 1667
170 Ga0068863_100659517 3300005841 Bacteria 1038
171 Ga0068863_101053295 3300005841 Bacteria 817
172 Ga0068863_101115237 3300005841 Bacteria 794
173 Ga0068863_101250822 3300005841 Unclassified 749
174 Ga0068858_100100066 3300005842 Bacteria 2703
175 Ga0068858_100236835 3300005842 Bacteria 1731
176 Ga0068858_100300710 3300005842 Bacteria 1531
177 Ga0068858_100913507 3300005842 Bacteria 859
178 Ga0068858_101993280 3300005842 Bacteria 574
179 Ga0068860_100010465 3300005843 Bacteria 9170
180 Ga0068860_100027486 3300005843 Bacteria 5479
181 Ga0068860_100060564 3300005843 Bacteria 3597
182 Ga0068860_100090931 3300005843 Bacteria 2908
183 Ga0068860_100472009 3300005843 Bacteria 1250
184 Ga0068860_100738172 3300005843 Bacteria 996
185 Ga0068860_101490037 3300005843 Bacteria 698
186 Ga0068860_102401583 3300005843 Unclassified 547
187 Ga0068860_102433413 3300005843 Bacteria 543
188 Ga0068860_102666087 3300005843 Bacteria 518
189 Ga0068862_101006961 3300005844 Bacteria 824
190 Ga0068862_101347280 3300005844 Bacteria 716
191 Ga0068862_101453222 3300005844 Bacteria 690
192 Ga0068862_101500684 3300005844 Unclassified 679
193 Ga0068862_101508655 3300005844 Bacteria 678
194 Ga0068862_101760229 3300005844 Bacteria 628
195 Ga0068862_102315923 3300005844 Bacteria 549
196 Ga0081455_10040779 3300005937 Bacteria 4091
197 Ga0081455_10176555 3300005937 Bacteria 1621
198 Ga0081540_1038284 3300005983 Bacteria 2529
199 Ga0081540_1129863 3300005983 Bacteria 1031
200 Ga0081539_10000686 3300005985 Bacteria 67858
201 Ga0081539_10008399 3300005985 Bacteria 9008
202 Ga0081539_10053540 3300005985 Bacteria 2259
203 Ga0070717_10007254 3300006028 Bacteria 8219
204 Ga0070717_10134894 3300006028 Bacteria 2125
205 Ga0070717_10632645 3300006028 Bacteria 971
206 Ga0075365_10612111 3300006038 Bacteria 770
207 Ga0075368_10017753 3300006042 Bacteria 2666
208 Ga0075368_10285482 3300006042 Bacteria 710
209 Ga0075368_10558010 3300006042 Unclassified 515
210 Ga0075364_10287397 3300006051 Bacteria 1119
211 Ga0075432_10449900 3300006058 Unclassified 565
212 Ga0070715_10164101 3300006163 Bacteria 1100
213 Ga0070715_11063339 3300006163 Unclassified 508
214 Ga0070712_100098798 3300006175 Bacteria 2153
215 Ga0070712_100262243 3300006175 Bacteria 1385
216 Ga0075367_10018684 3300006178 Bacteria 3830
217 Ga0075367_10900327 3300006178 Bacteria 564
218 Ga0075366_10056144 3300006195 Bacteria 2339
219 Ga0075366_10070231 3300006195 Bacteria 2085
220 Ga0075366_10337020 3300006195 Bacteria 925
221 Ga0075366_10433292 3300006195 Bacteria 810
222 Ga0075366_10982278 3300006195 Bacteria 527
223 Ga0097621_100053906 3300006237 Bacteria 3278
224 Ga0097621_100381322 3300006237 Bacteria 1259
225 Ga0097621_101850692 3300006237 Bacteria 576
226 Ga0075370_10001245 3300006353 Bacteria 10832
227 Ga0075370_10002892 3300006353 Bacteria 8057
228 Ga0075370_10605050 3300006353 Bacteria 664
229 Ga0075370_10814031 3300006353 Bacteria 570
230 Ga0068871_100087636 3300006358 Bacteria 2588
231 Ga0068871_100653440 3300006358 Bacteria 960
232 Ga0068871_101678751 3300006358 Bacteria 602
233 Ga0068871_101751430 3300006358 Bacteria 590
234 Ga0075428_100002996 3300006844 Bacteria 18423
235 Ga0075428_100041098 3300006844 Bacteria 5086
236 Ga0075428_100054997 3300006844 Bacteria 4362
237 Ga0075428_100150077 3300006844 Bacteria 2532
238 Ga0075428_100226006 3300006844 Bacteria 2020
239 Ga0075428_100309129 3300006844 Bacteria 1699
240 Ga0075428_100435011 3300006844 Unclassified 1405
241 Ga0075428_100826262 3300006844 Bacteria 984
242 Ga0075428_101435260 3300006844 Unclassified 724
243 Ga0075428_102244687 3300006844 Bacteria 562
244 Ga0075430_100000297 3300006846 Bacteria 35046
245 Ga0075430_100048027 3300006846 Plasmid 3604
246 Ga0075430_100120273 3300006846 Bacteria 2189
247 Ga0075430_100258026 3300006846 Bacteria 1444
248 Ga0075430_101104339 3300006846 Bacteria 653
249 Ga0075431_100000562 3300006847 Bacteria 31301
250 Ga0075431_100061296 3300006847 Bacteria 3881
251 Ga0075431_100073806 3300006847 Plasmid 3520
252 Ga0075431_100167641 3300006847 Bacteria 2257
253 Ga0075431_101598764 3300006847 Bacteria 609
254 Ga0075431_101603483 3300006847 Bacteria 608
255 Ga0075433_10025688 3300006852 Bacteria 4980
256 Ga0075433_10035338 3300006852 Bacteria 4297
257 Ga0075433_10361892 3300006852 Bacteria 1281
258 Ga0075433_10378005 3300006852 Bacteria 1251
259 Ga0075433_10408641 3300006852 Bacteria 1198
260 Ga0075434_100162495 3300006871 Bacteria 2253
261 Ga0075434_100762317 3300006871 Bacteria 984
262 Ga0075434_100893053 3300006871 Bacteria 904
263 Ga0075434_100945678 3300006871 Bacteria 876
264 Ga0075434_101147399 3300006871 Bacteria 790
265 Ga0075434_102640061 3300006871 Unclassified 502
266 Ga0075429_100013948 3300006880 Bacteria 6965
267 Ga0075429_100116943 3300006880 Bacteria 2330
268 Ga0075429_100274424 3300006880 Bacteria 1476
269 Ga0075429_100561694 3300006880 Bacteria 1000
270 Ga0075429_100770565 3300006880 Unclassified 843
271 Ga0075429_100941219 3300006880 Bacteria 756
272 Ga0068865_100077597 3300006881 Bacteria 2374
273 Ga0068865_100824378 3300006881 Bacteria 802
274 Ga0075436_100000048 3300006914 Bacteria 72013
275 Ga0075436_100003306 3300006914 Bacteria 11033
276 Ga0075436_100346083 3300006914 Bacteria 1071
277 Ga0097620_100141363 3300006931 Bacteria 2481
278 Ga0097620_100211117 3300006931 Bacteria 2028
279 Ga0097620_100989107 3300006931 Bacteria 924
280 Ga0097620_101082528 3300006931 Unclassified 881
281 Ga0097620_101484672 3300006931 Bacteria 748
282 Ga0075435_100291505 3300007076 Bacteria 1394
283 Ga0075435_100478210 3300007076 Bacteria 1076
284 Ga0075435_100990868 3300007076 Bacteria 734
285 Ga0099794_10540447 3300007265 Bacteria 615
286 Ga0099795_10254159 3300007788 Bacteria 759
287 Ga0111539_10003803 3300009094 Bacteria 19856
288 Ga0111539_10212127 3300009094 Bacteria 2256
289 Ga0111539_10444155 3300009094 Bacteria 1510
290 Ga0111539_10663867 3300009094 Bacteria 1214
291 Ga0111539_10742130 3300009094 Bacteria 1143
292 Ga0111539_10825161 3300009094 Bacteria 1079
293 Ga0111539_11708708 3300009094 Bacteria 730
294 Ga0105245_10016807 3300009098 Bacteria 6389
295 Ga0105245_10305859 3300009098 Bacteria 1561
296 Ga0105245_10485511 3300009098 Bacteria 1249
297 Ga0105245_12396559 3300009098 Bacteria 581
298 Ga0105245_12701982 3300009098 Bacteria 549
299 Ga0105245_12892405 3300009098 Bacteria 532
300 Ga0105247_10500956 3300009101 Bacteria 885
301 Ga0105247_11229767 3300009101 Bacteria 598
302 Ga0105247_11346340 3300009101 Bacteria 575
303 Ga0114129_10049832 3300009147 Bacteria 5884
304 Ga0114129_10067866 3300009147 Bacteria 4972
305 Ga0114129_10126067 3300009147 Bacteria 3520
306 Ga0114129_10225730 3300009147 Bacteria 2524
307 Ga0114129_10259861 3300009147 Bacteria 2328
308 Ga0114129_10526958 3300009147 Bacteria 1540
309 Ga0114129_12728067 3300009147 Unclassified 588
310 Ga0114129_13367059 3300009147 Bacteria 515
311 Ga0105243_10014454 3300009148 Bacteria 5976
312 Ga0105243_10026499 3300009148 Bacteria 4437
313 Ga0105243_12077514 3300009148 Bacteria 603
314 Ga0105243_12082483 3300009148 Bacteria 603
315 Ga0105241_11137130 3300009174 Bacteria 737
316 Ga0105242_10038906 3300009176 Bacteria 3828
317 Ga0105242_10116558 3300009176 Bacteria 2285
318 Ga0105242_11237913 3300009176 Bacteria 767
319 Ga0105242_12385628 3300009176 Bacteria 576
320 Ga0105248_10000978 3300009177 Bacteria 31743
321 Ga0105248_10048871 3300009177 Bacteria 4745
322 Ga0105248_10326301 3300009177 Bacteria 1729
323 Ga0105248_10429968 3300009177 Unclassified 1487
324 Ga0105248_10782912 3300009177 Bacteria 1076
325 Ga0105248_10974400 3300009177 Bacteria 958
326 Ga0105248_12092536 3300009177 Bacteria 644
327 Ga0105248_12097646 3300009177 Bacteria 643
328 Ga0105248_12988271 3300009177 Bacteria 539
329 Ga0105237_10603937 3300009545 Bacteria 1104
330 Ga0105238_10161040 3300009551 Bacteria 2220
331 Ga0105249_10183790 3300009553 Bacteria 2036
332 Ga0105249_10250194 3300009553 Bacteria 1757
333 Ga0105249_10343521 3300009553 Bacteria 1510
334 Ga0105249_10600135 3300009553 Bacteria 1155
335 Ga0105249_10827774 3300009553 Bacteria 990
336 Ga0105249_11532698 3300009553 Bacteria 739
337 Ga0105249_12433340 3300009553 Bacteria 596
338 Ga0105249_13098791 3300009553 Bacteria 534
339 Ga0099796_10400121 3300010159 Unclassified 602
340 Ga0105239_10857050 3300010375 Bacteria 1042
341 Ga0105239_10937943 3300010375 Bacteria 994
342 Ga0105239_11578284 3300010375 Bacteria 759
343 Ga0105239_11897975 3300010375 Unclassified 691
344 Ga0105246_10454667 3300011119 Bacteria 1077
345 Ga0105246_11541842 3300011119 Bacteria 626
346 Ga0105246_12374157 3300011119 Bacteria 520
347 Ga0157347_1003590 3300012502 Bacteria 1399
348 Ga0157373_10717243 3300013100 Bacteria 733
349 Ga0157370_10314475 3300013104 Bacteria 1445
350 Ga0157370_11178410 3300013104 Bacteria 691
351 Ga0157369_10148922 3300013105 Bacteria 2474
352 Ga0157374_10306167 3300013296 Bacteria 1573
353 Ga0157374_11092213 3300013296 Bacteria 818
354 Ga0157378_10041610 3300013297 Bacteria 4076
355 Ga0157378_10442675 3300013297 Bacteria 1288
356 Ga0157378_10526958 3300013297 Bacteria 1184
357 Ga0157378_11551413 3300013297 Bacteria 707
358 Ga0163162_10122960 3300013306 Bacteria 2700
359 Ga0163162_10150452 3300013306 Bacteria 2445
360 Ga0163162_10294421 3300013306 Bacteria 1755
361 Ga0163162_10348096 3300013306 Bacteria 1614
362 Ga0163162_10445545 3300013306 Bacteria 1427
363 Ga0163162_10455868 3300013306 Bacteria 1410
364 Ga0163162_10766928 3300013306 Bacteria 1083
365 Ga0163162_11961664 3300013306 Bacteria 670
366 Ga0163162_12428977 3300013306 Bacteria 603
367 Ga0163162_12505264 3300013306 Unclassified 593
368 Ga0163162_12793503 3300013306 Bacteria 562
369 Ga0157372_10002768 3300013307 Bacteria 18948
370 Ga0157372_10683346 3300013307 Unclassified 1195
371 Ga0157372_11399715 3300013307 Bacteria 806
372 Ga0157375_10022857 3300013308 Bacteria 5761
373 Ga0157375_10110197 3300013308 Bacteria 2850
374 Ga0157375_10144580 3300013308 Bacteria 2508
375 Ga0157375_10245707 3300013308 Bacteria 1950
376 Ga0157375_10317514 3300013308 Bacteria 1722
377 Ga0157375_10869182 3300013308 Bacteria 1047
378 Ga0157375_11035859 3300013308 Unclassified 959
379 Ga0157375_11143070 3300013308 Bacteria 912
380 Ga0157375_11375409 3300013308 Bacteria 831
381 Ga0163163_10175456 3300014325 Bacteria 2190
382 Ga0163163_11485720 3300014325 Bacteria 739
383 Ga0163163_11703726 3300014325 Bacteria 691
384 Ga0163163_11931165 3300014325 Bacteria 650
385 Ga0163163_12572678 3300014325 Bacteria 567
386 Ga0163163_12723129 3300014325 Bacteria 551
387 Ga0157380_10025209 3300014326 Bacteria 4508
388 Ga0157380_10068998 3300014326 Bacteria 2851
389 Ga0157380_10101393 3300014326 Bacteria 2398
390 Ga0157380_10140326 3300014326 Bacteria 2075
391 Ga0157380_10180738 3300014326 Bacteria 1853
392 Ga0157380_10857875 3300014326 Bacteria 930
393 Ga0157380_12610690 3300014326 Bacteria 571
394 Ga0157380_13388817 3300014326 Bacteria 510
395 Ga0157380_13433207 3300014326 Unclassified 507
396 Ga0157377_10118094 3300014745 Bacteria 1603
397 Ga0157377_10255632 3300014745 Unclassified 1138
398 Ga0157379_10045664 3300014968 Bacteria 3910
399 Ga0157379_10081006 3300014968 Bacteria 2908
400 Ga0157379_10254625 3300014968 Bacteria 1594
401 Ga0157379_11170462 3300014968 Bacteria 739
402 Ga0157379_11725411 3300014968 Bacteria 614
403 Ga0157376_10162035 3300014969 Bacteria 2029
404 Ga0157376_10403586 3300014969 Bacteria 1322
405 Ga0157376_12176838 3300014969 Bacteria 593
406 Ga0182006_1102203 3300015261 Bacteria 1016
407 Ga0183362_10002 3300015683 Bacteria 1432711
408 Ga0163161_10088819 3300017792 Bacteria 2285
409 Ga0163161_10281335 3300017792 Bacteria 1305
410 Ga0163161_10384587 3300017792 Bacteria 1122
411 Ga0197907_10526560 3300020069 Bacteria 995
412 Ga0206356_10867906 3300020070 Bacteria 1480
413 Ga0213874_10071610 3300021377 Bacteria 1107
414 Ga0213876_10145889 3300021384 Bacteria 1258
415 Ga0213876_10255690 3300021384 Bacteria 931
416 Ga0224712_10088398 3300022467 Bacteria 1293
417 Ga0209677_100235 3300025253 Bacteria 38918
418 Ga0209129_1001758 3300025258 Bacteria 11609
419 Ga0209673_1012504 3300025273 Bacteria 3414
420 Ga0209025_1000207 3300025294 Bacteria 140774
421 Ga0209025_1049733 3300025294 Bacteria 1683
422 Ga0209050_1010376 3300025298 Bacteria 4600
423 Ga0209051_1004592 3300025303 Bacteria 8425
424 Ga0209257_1000309 3300025304 Bacteria 104166
425 Ga0209257_1008728 3300025304 Bacteria 5648
426 Ga0207682_10006548 3300025893 Bacteria 4688
427 Ga0207682_10059197 3300025893 Bacteria 1600
428 Ga0207682_10491350 3300025893 Bacteria 581
429 Ga0207642_10326106 3300025899 Bacteria 898
430 Ga0207710_10211224 3300025900 Bacteria 961
431 Ga0207688_10018514 3300025901 Bacteria 3789
432 Ga0207680_10081026 3300025903 Unclassified 2039
433 Ga0207680_10119535 3300025903 Bacteria 1721
434 Ga0207680_10135634 3300025903 Bacteria 1626
435 Ga0207680_10397025 3300025903 Bacteria 974
436 Ga0207680_11374845 3300025903 Unclassified 501
437 Ga0207647_10027276 3300025904 Bacteria 3724
438 Ga0207699_10261393 3300025906 Bacteria 1196
439 Ga0207645_10098987 3300025907 Bacteria 1880
440 Ga0207645_10820804 3300025907 Bacteria 632
441 Ga0207643_10025781 3300025908 Bacteria 3252
442 Ga0207705_10358314 3300025909 Bacteria 1125
443 Ga0207705_11121825 3300025909 Bacteria 605
444 Ga0207684_10028102 3300025910 Bacteria 4791
445 Ga0207684_10267868 3300025910 Archaea 1474
446 Ga0207654_10347875 3300025911 Bacteria 1020
447 Ga0207654_10817069 3300025911 Bacteria 674
448 Ga0207707_10006074 3300025912 Bacteria 10571
449 Ga0207693_10031692 3300025915 Bacteria 4177
450 Ga0207693_10244296 3300025915 Bacteria 1409
451 Ga0207663_10364217 3300025916 Bacteria 1097
452 Ga0207663_10503801 3300025916 Bacteria 941
453 Ga0207663_11025719 3300025916 Bacteria 662
454 Ga0207660_10037305 3300025917 Bacteria 3386
455 Ga0207660_10726247 3300025917 Bacteria 810
456 Ga0207662_10115571 3300025918 Bacteria 1677
457 Ga0207657_10119290 3300025919 Bacteria 2171
458 Ga0207657_10328488 3300025919 Bacteria 1208
459 Ga0207649_11361644 3300025920 Bacteria 561
460 Ga0207652_10017408 3300025921 Bacteria 5881
461 Ga0207646_10028357 3300025922 Bacteria 5097
462 Ga0207681_10023679 3300025923 Bacteria 3931
463 Ga0207681_10027124 3300025923 Bacteria 3701
464 Ga0207681_10032722 3300025923 Bacteria 3406
465 Ga0207681_10068654 3300025923 Bacteria 2463
466 Ga0207681_10603115 3300025923 Bacteria 907
467 Ga0207694_10732582 3300025924 Bacteria 834
468 Ga0207650_10119037 3300025925 Bacteria 2054
469 Ga0207659_10368074 3300025926 Bacteria 1196
470 Ga0207659_10605671 3300025926 Bacteria 934
471 Ga0207659_10664220 3300025926 Bacteria 891
472 Ga0207687_10050337 3300025927 Bacteria 2899
473 Ga0207687_10282788 3300025927 Bacteria 1330
474 Ga0207687_10564601 3300025927 Bacteria 956
475 Ga0207687_11170888 3300025927 Bacteria 661
476 Ga0207700_10047920 3300025928 Bacteria 3170
477 Ga0207700_11146932 3300025928 Bacteria 694
478 Ga0207664_10140250 3300025929 Bacteria 2044
479 Ga0207664_10160717 3300025929 Bacteria 1916
480 Ga0207644_10010350 3300025931 Bacteria 6147
481 Ga0207644_10375966 3300025931 Bacteria 1158
482 Ga0207644_10521447 3300025931 Bacteria 982
483 Ga0207644_11173795 3300025931 Bacteria 645
484 Ga0207644_11814184 3300025931 Bacteria 510
485 Ga0207690_10205525 3300025932 Bacteria 1498
486 Ga0207690_10303348 3300025932 Bacteria 1250
487 Ga0207706_10030331 3300025933 Bacteria 4824
488 Ga0207706_10590527 3300025933 Bacteria 954
489 Ga0207706_10646493 3300025933 Bacteria 906
490 Ga0207686_10329748 3300025934 Bacteria 1143
491 Ga0207709_10007568 3300025935 Bacteria 6033
492 Ga0207709_10012749 3300025935 Bacteria 4634
493 Ga0207709_10529393 3300025935 Bacteria 924
494 Ga0207670_10540360 3300025936 Unclassified 951
495 Ga0207670_11063361 3300025936 Bacteria 682
496 Ga0207669_10072705 3300025937 Bacteria 2166
497 Ga0207669_10408520 3300025937 Unclassified 1065
498 Ga0207669_11385989 3300025937 Bacteria 598
499 Ga0207669_11924492 3300025937 Bacteria 505
500 Ga0207704_11002366 3300025938 Bacteria 706
501 Ga0207704_11311757 3300025938 Unclassified 619
502 Ga0207691_10005645 3300025940 Bacteria 12094
503 Ga0207691_10038113 3300025940 Bacteria 4448
504 Ga0207691_10170356 3300025940 Bacteria 1907
505 Ga0207691_10186862 3300025940 Bacteria 1808
506 Ga0207691_10227997 3300025940 Bacteria 1614
507 Ga0207691_10254290 3300025940 Bacteria 1516
508 Ga0207691_11176717 3300025940 Bacteria 636
509 Ga0207711_10017825 3300025941 Bacteria 5899
510 Ga0207711_10137002 3300025941 Bacteria 2199
511 Ga0207711_10388284 3300025941 Bacteria 1296
512 Ga0207711_10543778 3300025941 Bacteria 1083
513 Ga0207711_11093126 3300025941 Unclassified 738
514 Ga0207711_12105225 3300025941 Bacteria 507
515 Ga0207689_10869382 3300025942 Bacteria 761
516 Ga0207679_11126327 3300025945 Unclassified 720
517 Ga0207667_10113680 3300025949 Bacteria 2791
518 Ga0207651_10059405 3300025960 Bacteria 2649
519 Ga0207651_10082857 3300025960 Bacteria 2317
520 Ga0207651_10255016 3300025960 Bacteria 1437
521 Ga0207651_10320874 3300025960 Bacteria 1295
522 Ga0207712_10052118 3300025961 Bacteria 2865
523 Ga0207712_11172740 3300025961 Bacteria 685
524 Ga0207712_11285943 3300025961 Bacteria 653
525 Ga0207668_10172206 3300025972 Bacteria 1699
526 Ga0207668_10595585 3300025972 Bacteria 962
527 Ga0207668_11701283 3300025972 Bacteria 569
528 Ga0207668_12154324 3300025972 Bacteria 502
529 Ga0207640_10074441 3300025981 Bacteria 2298
530 Ga0207658_10220305 3300025986 Unclassified 1596
531 Ga0207658_10264642 3300025986 Bacteria 1467
532 Ga0207658_10314760 3300025986 Bacteria 1353
533 Ga0207677_10268373 3300026023 Bacteria 1395
534 Ga0207677_10402575 3300026023 Bacteria 1161
535 Ga0207703_10107280 3300026035 Bacteria 2377
536 Ga0207703_10297123 3300026035 Bacteria 1472
537 Ga0207703_10849726 3300026035 Unclassified 873
538 Ga0207639_10077017 3300026041 Bacteria 2628
539 Ga0207678_10035317 3300026067 Bacteria 4352
540 Ga0207678_10102530 3300026067 Bacteria 2443
541 Ga0207678_10630701 3300026067 Bacteria 941
542 Ga0207678_10805635 3300026067 Bacteria 829
543 Ga0207678_10936749 3300026067 Bacteria 766
544 Ga0207678_11017370 3300026067 Unclassified 733
545 Ga0207708_10012698 3300026075 Bacteria 6280
546 Ga0207708_10078600 3300026075 Bacteria 2533
547 Ga0207708_10083293 3300026075 Bacteria 2459
548 Ga0207708_10818370 3300026075 Unclassified 803
549 Ga0207708_11396396 3300026075 Bacteria 614
550 Ga0207702_10028833 3300026078 Bacteria 4616
551 Ga0207702_10794843 3300026078 Bacteria 935
552 Ga0207641_10213323 3300026088 Bacteria 1786
553 Ga0207641_10330773 3300026088 Bacteria 1447
554 Ga0207641_10519622 3300026088 Unclassified 1158
555 Ga0207641_10583100 3300026088 Bacteria 1093
556 Ga0207641_11892253 3300026088 Unclassified 598
557 Ga0207648_10025520 3300026089 Bacteria 5263
558 Ga0207648_10489893 3300026089 Bacteria 1124
559 Ga0207648_10607278 3300026089 Bacteria 1009
560 Ga0207676_10608760 3300026095 Bacteria 1050
561 Ga0207676_10852327 3300026095 Bacteria 891
562 Ga0207674_10156695 3300026116 Bacteria 2233
563 Ga0207675_100055943 3300026118 Bacteria 3681
564 Ga0207675_100384694 3300026118 Bacteria 1380
565 Ga0207675_101335733 3300026118 Bacteria 737
566 Ga0207683_10036388 3300026121 Bacteria 4286
567 Ga0207683_10161872 3300026121 Bacteria 2023
568 Ga0207683_10177463 3300026121 Bacteria 1931
569 Ga0207683_10273330 3300026121 Bacteria 1544
570 Ga0207683_10368543 3300026121 Bacteria 1319
571 Ga0207683_10721464 3300026121 Bacteria 924
572 Ga0207698_10120187 3300026142 Bacteria 2222
573 Ga0207698_10617232 3300026142 Bacteria 1071
574 Ga0209995_1003727 3300027471 Bacteria 2431
575 Ga0209588_1204609 3300027671 Bacteria 614
576 Ga0209813_10010313 3300027866 Bacteria 2413
577 Ga0209813_10219096 3300027866 Bacteria 712
578 Ga0207428_10000053 3300027907 Bacteria 175238
579 Ga0207428_10654731 3300027907 Unclassified 754
580 Ga0207428_10719366 3300027907 Unclassified 713
581 Ga0207428_10828418 3300027907 Bacteria 656
582 Ga0207428_10929806 3300027907 Bacteria 613
583 Ga0268266_10209971 3300028379 Bacteria 1785
584 Ga0268266_10618441 3300028379 Bacteria 1041
585 Ga0268266_12180437 3300028379 Bacteria 526
586 Ga0268265_10035424 3300028380 Bacteria 3647
587 Ga0268265_10451431 3300028380 Bacteria 1201
588 Ga0268265_10829582 3300028380 Bacteria 903
589 Ga0268265_11345255 3300028380 Bacteria 715
590 Ga0268265_11348127 3300028380 Bacteria 714
591 Ga0268264_10029385 3300028381 Bacteria 4501
592 Ga0268264_10292442 3300028381 Bacteria 1530
593 Ga0268264_10418511 3300028381 Bacteria 1292
594 Ga0268264_10509069 3300028381 Bacteria 1175
595 Ga0268264_11090553 3300028381 Bacteria 807
596 Ga0268264_11096959 3300028381 Bacteria 804
597 Ga0268264_11114074 3300028381 Bacteria 798
598 Ga0268264_11385849 3300028381 Bacteria 714
599 Ga0268264_11924215 3300028381 Bacteria 601
600 Ga0268264_12401269 3300028381 Bacteria 533
601 Ga0265334_10249324 3300028573 Unclassified 611
602 Ga0307514_10493287 3300031649 Bacteria 585
603 Ga0307405_10087957 3300031731 Bacteria 2049
604 Ga0307413_12067217 3300031824 Bacteria 514
605 Ga0307412_10959065 3300031911 Unclassified 753
606 Ga0307412_11624238 3300031911 Unclassified 591
607 Ga0307416_100112376 3300032002 Bacteria 2404
608 Ga0307416_100899331 3300032002 Bacteria 985
609 Ga0307416_101970167 3300032002 Unclassified 687
610 Ga0307411_10155112 3300032005 Unclassified 1707
611 Ga0307415_100606046 3300032126 Bacteria 975
612 Ga0373948_0174648 3300034817 Bacteria 549
613 Ga0373926_0016559 3300035083 Bacteria 2524
614 Ga0373926_0076750 3300035083 Bacteria 1232
615 Ga0373934_0362845 3300035086 Bacteria 604
616 Ga0373944_0014885 3300035089 Bacteria 2176
617 Ga0373936_0103975 3300035113 Bacteria 1200
618 Ga0373945_0040185 3300035116 Bacteria 1688
619 Ga0373953_0165091 3300035117 Bacteria 952
620 Ga0373956_0029653 3300035119 Bacteria 2387
621 Ga0373956_0064096 3300035119 Bacteria 1668
622 Ga0373957_0477257 3300035120 Unclassified 541
623 Ga0373943_0029042 3300035170 Bacteria 2610
624 Ga0373943_0238336 3300035170 Bacteria 1019
625 Ga0373943_0734244 3300035170 Bacteria 586
626 Ga0373946_0008647 3300035171 Bacteria 3738
627 Ga0373946_0538304 3300035171 Bacteria 602
628 Ga0373946_0660125 3300035171 Bacteria 545
629 Ga0373955_0231517 3300035172 Bacteria 1105
630 Ga0373924_0065814 3300035410 Bacteria 1522
631 Ga0373924_0126012 3300035410 Bacteria 1113
632 Ga0373924_0273568 3300035410 Bacteria 749
633 Ga0373931_1173621 3300035691 Bacteria 525
634 Ga0373935_0058785 3300035692 Bacteria 2456
635 Ga0373935_0107673 3300035692 Bacteria 1846
636 Ga0373935_0229260 3300035692 Bacteria 1293
637 Ga0373935_0420046 3300035692 Bacteria 962
638 Ga0373927_0000745 3300035695 Bacteria 24875
639 Ga0373927_0031067 3300035695 Bacteria 3483
640 Ga0373927_0048800 3300035695 Bacteria 2738
641 Ga0373927_0107097 3300035695 Unclassified 1821
642 Ga0373927_0216269 3300035695 Bacteria 1259
643 Ga0373927_0457993 3300035695 Bacteria 842
644 Ga0373927_0886323 3300035695 Bacteria 589
645 Ga0373933_0110132 3300035724 Bacteria 1717
646 Ga0373933_0151024 3300035724 Bacteria 1471
647 Ga0373933_0159218 3300035724 Bacteria 1433
648 Ga0373947_0287865 3300035725 Bacteria 1093
649 Ga0373947_0314249 3300035725 Unclassified 1046
650 Ga0373947_0380203 3300035725 Bacteria 950
651 Ga0373937_0003972 3300036401 Bacteria 12513
652 Ga0373937_0038317 3300036401 Bacteria 4368
653 Ga0373937_0318527 3300036401 Bacteria 1471
654 Ga0373925_0073396 3300037068 Bacteria 2590
655 Ga0373925_0078104 3300037068 Bacteria 2513
656 Ga0373925_0627790 3300037068 Viruses 885
657 Ga0395900_0289276 3300037418 Bacteria 1628
658 Ga0395900_1578584 3300037418 Bacteria 568
659 Ga0395898_1814856 3300037466 Bacteria 531
660 Ga0395905_0045491 3300037471 Bacteria 4116
661 Ga0395905_0407087 3300037471 Bacteria 1255
662 Ga0395905_1256830 3300037471 Bacteria 644
663 Ga0395905_1373629 3300037471 Bacteria 610
664 Ga0436364_1290173 3300037853 Bacteria 585
665 Ga0436364_1518215 3300037853 Bacteria 646
666 Ga0395901_0057158 3300038443 Bacteria 4058
667 Ga0395901_0087161 3300038443 Bacteria 3264
668 Ga0395901_0142296 3300038443 Bacteria 2520
669 Ga0242420_033664 3300038996 Bacteria 959
670 Ga0436365_0134879 3300039437 Bacteria 1645
671 Ga0436365_1447406 3300039437 Bacteria 2455
672 Ga0436360_0493893 3300039438 Bacteria 720
673 Ga0436363_0324536 3300039450 Bacteria 596
674 Ga0436363_1452665 3300039450 Bacteria 1285
675 Ga0436362_0256650 3300039453 Bacteria 731
676 Ga0451791_0354109 3300041451 Bacteria 554
677 Ga0451798_0286785 3300041458 Unclassified 868
678 Ga0439431_0145952 3300041997 Bacteria 670
679 Ga0439442_018352 3300042002 Bacteria 1446
680 Ga0450910_094572 3300042147 Bacteria 532
681 Ga0451577_0102038 3300042876 Bacteria 2563
682 Ga0453683_0752228 3300044673 Bacteria 640
683 Ga0453684_0148248 3300044712 Bacteria 2792
684 Ga0453684_0150383 3300044712 Bacteria 2768
685 Ga0466957_0519172 3300044842 Bacteria 827
686 Ga0451576_0006018 3300045051 Bacteria 14993
687 Ga0466958_0106389 3300045836 Bacteria 1749
688 Ga0495592_0055127 3300046454 Bacteria 2942
689 Ga0495592_0154654 3300046454 Bacteria 1583
690 Ga0495592_0356782 3300046454 Unclassified 936
691 Ga0495592_0586083 3300046454 Bacteria 682
692 Ga0495603_0000225 3300046455 Bacteria 29424
693 Ga0495603_0761931 3300046455 Bacteria 553
694 Ga0495629_0429745 3300046459 Unclassified 896
695 Ga0495641_0018200 3300046461 Bacteria 3632
696 Ga0495653_0144478 3300046463 Bacteria 1669
697 Ga0495653_0888828 3300046463 Bacteria 531
698 Ga0495580_0050867 3300046472 Bacteria 2929
699 Ga0495580_0069757 3300046472 Bacteria 2456
700 Ga0495580_0073417 3300046472 Bacteria 2388
701 Ga0495580_0143417 3300046472 Bacteria 1656
702 Ga0495580_0263291 3300046472 Bacteria 1179
703 Ga0495580_1110696 3300046472 Bacteria 500
704 Ga0495582_0000775 3300046473 Bacteria 17677
705 Ga0495582_0027673 3300046473 Bacteria 3109
706 Ga0495582_0112906 3300046473 Bacteria 1527
707 Ga0495582_0226452 3300046473 Bacteria 1070
708 Ga0495639_0000335 3300046475 Bacteria 22677
709 Ga0495639_0018888 3300046475 Bacteria 3005
710 Ga0495639_0393728 3300046475 Bacteria 699
711 Ga0495639_0519304 3300046475 Unclassified 609
712 Ga0495662_0000156 3300046476 Bacteria 26864
713 Ga0495662_0001796 3300046476 Bacteria 10744
714 Ga0495664_0001370 3300046477 Bacteria 12868
715 Ga0495664_0786583 3300046477 Bacteria 560
716 Ga0495585_0162252 3300046492 Bacteria 1159
717 Ga0495594_0011773 3300046499 Bacteria 4546
718 Ga0495594_0576360 3300046499 Bacteria 638
719 Ga0495596_0262707 3300046500 Bacteria 670
720 Ga0495618_0002228 3300046514 Bacteria 12629
721 Ga0495618_0890784 3300046514 Bacteria 514
722 Ga0495628_0077863 3300046516 Bacteria 2579
723 Ga0495628_0124636 3300046516 Bacteria 1974
724 Ga0495630_0757073 3300046517 Bacteria 742
725 Ga0495632_0201313 3300046519 Bacteria 907
726 Ga0495637_0035899 3300046520 Bacteria 2163
727 Ga0495666_0499496 3300046526 Bacteria 544
728 Ga0495652_0244673 3300046529 Bacteria 1332
729 Ga0495652_0314420 3300046529 Bacteria 1134
730 Ga0495652_0350654 3300046529 Bacteria 1057
731 Ga0495665_0000188 3300046531 Bacteria 31814
732 Ga0495665_0025387 3300046531 Bacteria 3183
733 Ga0495665_0059796 3300046531 Bacteria 2012
734 Ga0495665_0353695 3300046531 Unclassified 748
735 Ga0495640_0002052 3300046533 Bacteria 16064
736 Ga0495640_0002363 3300046533 Bacteria 15117
737 Ga0495598_0226856 3300046537 Bacteria 684
738 Ga0495621_0050088 3300046539 Bacteria 1492
739 Ga0495621_0082265 3300046539 Bacteria 1202
740 Ga0495621_0406364 3300046539 Bacteria 578
741 Ga0495645_0010696 3300046543 Bacteria 6442
742 Ga0495645_0124094 3300046543 Bacteria 1816
743 Ga0495622_0023779 3300046557 Bacteria 2858
744 Ga0495633_0480252 3300046558 Bacteria 561
745 Ga0495667_0016346 3300046559 Bacteria 5015
746 Ga0495656_0018687 3300046615 Bacteria 2667
747 Ga0495668_0613645 3300046616 Bacteria 601
748 Ga0495634_0001338 3300046642 Bacteria 22465
749 Ga0495634_0016439 3300046642 Bacteria 5293
750 Ga0495635_0086537 3300046663 Bacteria 2144
751 Ga0495635_0200251 3300046663 Bacteria 1354
752 Ga0495659_0137752 3300046664 Bacteria 972
753 Ga0495659_0513304 3300046664 Unclassified 526
754 Ga0495588_0040602 3300046674 Bacteria 2374
755 Ga0495588_0138319 3300046674 Bacteria 1286
756 Ga0495657_0226820 3300046675 Bacteria 1131
757 Ga0495599_0127543 3300046678 Bacteria 1581
758 Ga0495599_0597109 3300046678 Bacteria 643
759 Ga0495599_0883756 3300046678 Bacteria 507
760 Ga0495646_0023052 3300046680 Bacteria 3921
761 Ga0495647_0005606 3300046681 Bacteria 4122
762 Ga0495647_0011024 3300046681 Bacteria 3089
763 Ga0495658_0000047 3300046683 Bacteria 59626
764 Ga0495658_0002559 3300046683 Bacteria 9145
765 Ga0495658_0054869 3300046683 Unclassified 2268
766 Ga0495658_0056409 3300046683 Bacteria 2240
767 Ga0495658_0659983 3300046683 Bacteria 670
768 Ga0495658_1111760 3300046683 Bacteria 504
769 Ga0495669_0004111 3300046684 Bacteria 5988
770 Ga0495613_0001031 3300046689 Bacteria 21255
771 Ga0495613_0074069 3300046689 Bacteria 2480
772 Ga0495624_0001259 3300046690 Bacteria 20006
773 Ga0495624_0821700 3300046690 Bacteria 549
774 Ga0495670_0101617 3300046691 Bacteria 1481
775 Ga0495589_0403562 3300046794 Bacteria 627
776 Ga0495600_0572728 3300046809 Bacteria 688
777 Ga0495636_0072610 3300047318 Bacteria 1471
778 Ga0495674_0015384 3300047319 Bacteria 7154
779 Ga0495674_1302157 3300047319 Bacteria 545
780 Ga0495676_0031581 3300047321 Bacteria 4477
781 Ga0495676_0129623 3300047321 Unclassified 1823
782 Ga0495680_0417707 3300047322 Bacteria 923
783 Ga0495680_0689915 3300047322 Bacteria 675
784 Ga0495680_1045545 3300047322 Unclassified 519
785 Ga0495677_0251916 3300047445 Bacteria 690
786 Ga0495685_104273 3300047447 Bacteria 935
787 Ga0495684_0005269 3300047471 Bacteria 10068
788 Ga0495684_0021610 3300047471 Bacteria 4955
789 Ga0495684_0531896 3300047471 Bacteria 803
790 Ga0495684_0583706 3300047471 Bacteria 756
791 Ga0495593_0062471 3300047673 Bacteria 1947
792 Ga0495614_0028249 3300048089 Bacteria 2417
793 Ga0496100_0174884 3300048903 Bacteria 1549
794 Ga0496100_0298202 3300048903 Bacteria 1206
795 Ga0496100_0568804 3300048903 Bacteria 878
796 Ga0496100_1498693 3300048903 Bacteria 533
797 Ga0496101_0078289 3300048904 Bacteria 2438
798 Ga0496101_0448302 3300048904 Bacteria 1018
799 Ga0496101_0744143 3300048904 Bacteria 774
800 Ga0496101_0838514 3300048904 Bacteria 724
801 Ga0496102_0142370 3300048905 Bacteria 2249
802 Ga0496102_0506647 3300048905 Bacteria 1129
803 Ga0496102_0729974 3300048905 Bacteria 913
804 Ga0496102_1080423 3300048905 Bacteria 722
805 Ga0496103_0148895 3300048906 Bacteria 1499
806 Ga0496103_0341871 3300048906 Bacteria 962
807 Ga0496103_0464171 3300048906 Bacteria 812
808 Ga0496104_0557165 3300048907 Bacteria 1057
809 Ga0496105_0644296 3300048908 Bacteria 818
810 Ga0496106_0056968 3300048909 Bacteria 2955
811 Ga0496106_0066843 3300048909 Bacteria 2739
812 Ga0496106_0538592 3300048909 Bacteria 937
813 Ga0496106_1402509 3300048909 Bacteria 540
814 Ga0496108_0067227 3300048911 Bacteria 3023
815 Ga0496109_1204942 3300048912 Bacteria 694
816 Ga0496109_1346987 3300048912 Bacteria 649
817 Ga0496109_1477773 3300048912 Bacteria 615
818 Ga0496110_0010022 3300048913 Bacteria 7689
819 Ga0496110_0043966 3300048913 Bacteria 3900
820 Ga0496110_0645463 3300048913 Bacteria 958
821 Ga0496110_0971459 3300048913 Bacteria 756
822 Ga0496111_0063817 3300048914 Bacteria 2671
823 Ga0496111_0104344 3300048914 Bacteria 2085
824 Ga0496112_0035225 3300048915 Bacteria 4874
825 Ga0496112_0155937 3300048915 Bacteria 2250
826 Ga0496112_0647605 3300048915 Bacteria 986
827 Ga0496112_1128870 3300048915 Unclassified 702
828 Ga0496113_0133794 3300048916 Bacteria 1947
829 Ga0496113_0692450 3300048916 Bacteria 814
830 Ga0496114_0507851 3300048917 Bacteria 1066
831 Ga0496114_0613451 3300048917 Bacteria 959
832 Ga0496114_1187201 3300048917 Bacteria 649
833 Ga0496116_0143263 3300048919 Bacteria 1340
834 Ga0496117_0113594 3300048920 Bacteria 1681
835 Ga0496118_0628568 3300048921 Bacteria 509
836 Ga0496121_0114182 3300048924 Bacteria 2053
837 Ga0496121_0236977 3300048924 Bacteria 1274
838 Ga0496124_0061615 3300048927 Bacteria 3144
839 Ga0501031_0028408 3300049568 Bacteria 3645
840 Ga0501031_0189979 3300049568 Bacteria 1341
841 Ga0501032_0017507 3300049569 Bacteria 5030
842 Ga0501032_0026773 3300049569 Bacteria 3963
843 Ga0501033_0043397 3300049570 Bacteria 3349
844 Ga0501033_0044598 3300049570 Bacteria 3300
845 Ga0501033_0148286 3300049570 Bacteria 1693
846 Ga0501034_0043551 3300049571 Bacteria 4542
847 Ga0501034_0305175 3300049571 Bacteria 1527
848 Ga0501036_0008707 3300049572 Bacteria 8323
849 Ga0501036_0240442 3300049572 Bacteria 1518
850 Ga0501037_0017167 3300049573 Bacteria 5327
851 Ga0501037_0476869 3300049573 Bacteria 848
852 Ga0501038_0052645 3300049574 Bacteria 3508
853 Ga0501038_0054637 3300049574 Bacteria 3434
854 Ga0501039_0020313 3300049575 Bacteria 5091
855 Ga0501039_0274768 3300049575 Bacteria 1324
856 Ga0501040_0044637 3300049576 Bacteria 3022
857 Ga0501042_0090178 3300049578 Bacteria 2200
858 Ga0501043_0009889 3300049579 Bacteria 7476
859 Ga0501043_0208069 3300049579 Bacteria 1516
860 Ga0501046_0006761 3300049580 Bacteria 10124
861 Ga0501046_0027006 3300049580 Bacteria 4687
862 Ga0501047_0341675 3300049581 Bacteria 1334
863 Ga0501047_0666979 3300049581 Bacteria 858
864 Ga0501048_0023383 3300049582 Bacteria 4516
865 Ga0501048_0287894 3300049582 Bacteria 1168
866 Ga0501067_0001716 3300049583 Bacteria 12039
867 Ga0501067_0023398 3300049583 Bacteria 3423
868 Ga0501067_0154126 3300049583 Bacteria 1280
869 Ga0501067_0442209 3300049583 Bacteria 726
870 Ga0501068_0081163 3300049584 Bacteria 1990
871 Ga0501068_0273518 3300049584 Bacteria 1078
872 Ga0501069_0022286 3300049585 Bacteria 3443
873 Ga0501069_0656600 3300049585 Bacteria 631
874 Ga0501070_0069313 3300049586 Bacteria 2919
875 Ga0501070_0126013 3300049586 Bacteria 2116
876 Ga0501071_0006875 3300049587 Bacteria 7414
877 Ga0501072_0012451 3300049588 Bacteria 6501
878 Ga0501073_0002916 3300049589 Bacteria 12838
879 Ga0501073_0020656 3300049589 Bacteria 4749
880 Ga0501073_0035187 3300049589 Bacteria 3561
881 Ga0501073_0089360 3300049589 Bacteria 2141
882 Ga0501073_1124392 3300049589 Bacteria 540
883 Ga0501074_0033662 3300049590 Bacteria 3713
884 Ga0501074_0192656 3300049590 Bacteria 1453
885 Ga0501074_0266542 3300049590 Bacteria 1217
886 Ga0501075_1064935 3300049591 Bacteria 614
887 Ga0501076_0083397 3300049592 Bacteria 2567
888 Ga0501076_0326231 3300049592 Bacteria 1259
889 Ga0501077_0078870 3300049593 Bacteria 2087
890 Ga0501079_0061421 3300049741 Bacteria 2899
891 Ga0501079_0970879 3300049741 Bacteria 669
892 Ga0501080_0024405 3300049742 Bacteria 5604
893 Ga0501080_1061370 3300049742 Bacteria 700
894 Ga0501083_0149522 3300049744 Bacteria 1529
895 Ga0501083_0417459 3300049744 Bacteria 873
896 Ga0501035_0125406 3300049822 Bacteria 2241
897 Ga0501035_1203857 3300049822 Bacteria 587
898 Ga0501044_0029153 3300049823 Bacteria 5820
899 Ga0501044_0202526 3300049823 Bacteria 1942
900 Ga0501045_0007776 3300049824 Bacteria 7455
901 nmdc:mga03683_2001_c1 3300050489 Bacteria 6230
902 nmdc:mga03n38_500506_c1 3300050490 Bacteria 682
903 nmdc:mga03n38_5703_c1 3300050490 Bacteria 4264
904 nmdc:mga00v17_219257_c1 3300050491 Bacteria 1231
905 nmdc:mga00v17_810472_c1 3300050491 Bacteria 596
906 nmdc:mga0yw44_568203_c1 3300050492 Bacteria 770
907 nmdc:mga0k408_103045_c1 3300050493 Bacteria 1683
908 nmdc:mga0k408_185446_c1 3300050493 Bacteria 1241
909 nmdc:mga0k408_840354_c1 3300050493 Bacteria 534
910 nmdc:mga0k408_9517_c1 3300050493 Bacteria 5242
911 nmdc:mga06z11_149204_c1 3300050494 Bacteria 1328
912 nmdc:mga06z11_1909_c1 3300050494 Bacteria 7859
913 nmdc:mga06z11_199934_c1 3300050494 Bacteria 1160
914 nmdc:mga06z11_220035_c1 3300050494 Bacteria 1109
915 nmdc:mga06z11_507620_c1 3300050494 Bacteria 731
916 nmdc:mga04h51_250382_c1 3300050495 Bacteria 710
917 nmdc:mga04h51_8056_c1 3300050495 Bacteria 2807
918 nmdc:mga07m45_2009_c2 3300050496 Bacteria 8624
919 nmdc:mga07m45_350422_c1 3300050496 Bacteria 858
920 nmdc:mga07m45_64817_c1 3300050496 Bacteria 2074
921 nmdc:mga05p37_122572_c1 3300050507 Bacteria 3193
922 nmdc:mga05p37_139257_c1 3300050507 Bacteria 2974
923 nmdc:mga05p37_510539_c1 3300050507 Bacteria 1377
924 nmdc:mga05p37_9223_c1 3300050507 Bacteria 11661
925 nmdc:mga09592_1033021_c1 3300050508 Bacteria 686
926 nmdc:mga09592_115241_c1 3300050508 Bacteria 2307
927 nmdc:mga09592_12588_c1 3300050508 Bacteria 6894
928 nmdc:mga09592_1541391_c1 3300050508 Unclassified 540
929 nmdc:mga09592_42827_c1 3300050508 Bacteria 3808
930 nmdc:mga09592_6053_c2 3300050508 Bacteria 8648
931 nmdc:mga0qj67_145043_c1 3300050509 Unclassified 1925
932 nmdc:mga0qj67_220953_c1 3300050509 Bacteria 1538
933 nmdc:mga0qj67_577_c1 3300050509 Bacteria 25003
934 nmdc:mga0qj67_612_c1 3300050509 Bacteria 24447
935 nmdc:mga06r32_132067_c1 3300050510 Unclassified 2470
936 nmdc:mga06r32_22944_c1 3300050510 Bacteria 5772
937 nmdc:mga06r32_28911_c1 3300050510 Bacteria 5189
938 nmdc:mga06r32_308_c1 3300050510 Bacteria 40566
939 nmdc:mga06r32_40537_c1 3300050510 Bacteria 4421
940 nmdc:mga06r32_894248_c1 3300050510 Bacteria 845
941 nmdc:mga06r32_949115_c1 3300050510 Bacteria 814
942 nmdc:mga08y16_1140178_c1 3300050511 Bacteria 753
943 nmdc:mga08y16_1246086_c1 3300050511 Unclassified 713
944 nmdc:mga08y16_305412_c1 3300050511 Bacteria 1639
945 nmdc:mga08y16_30_c1 3300050511 Bacteria 197110
946 nmdc:mga08y16_571963_c1 3300050511 Bacteria 1142
947 nmdc:mga0n895_1470163_c1 3300050512 Bacteria 648
948 nmdc:mga0n895_1573566_c1 3300050512 Bacteria 622
949 nmdc:mga0n895_161705_c1 3300050512 Bacteria 2271
950 nmdc:mga0n895_1788462_c1 3300050512 Bacteria 575
951 nmdc:mga0n895_1889794_c1 3300050512 Bacteria 556
952 nmdc:mga0n895_221328_c1 3300050512 Bacteria 1922
953 nmdc:mga0n895_233042_c1 3300050512 Bacteria 1869
954 nmdc:mga0rr50_1163024_c1 3300050513 Bacteria 656
955 nmdc:mga0rr50_781483_c1 3300050513 Archaea 815
956 nmdc:mga08x19_31335_c1 3300050514 Bacteria 3344
957 nmdc:mga08x19_3408_c1 3300050514 Bacteria 9482
958 nmdc:mga08x19_348_c1 3300050514 Bacteria 33504
959 nmdc:mga0a205_115751_c1 3300050515 Bacteria 2580
960 nmdc:mga0a205_133004_c1 3300050515 Bacteria 2388
961 nmdc:mga0a205_308457_c1 3300050515 Bacteria 1455
962 nmdc:mga0a205_446160_c1 3300050515 Bacteria 1154
963 nmdc:mga0a205_774226_c1 3300050515 Bacteria 808
964 nmdc:mga0sz30_121841_c1 3300050516 Bacteria 1146
965 nmdc:mga0sz30_501421_c1 3300050516 Bacteria 546
966 Ga0495601_0013178 3300053077 Bacteria 4971
967 Ga0495601_0130232 3300053077 Bacteria 1638
968 Ga0495601_0232425 3300053077 Bacteria 1204
969 Ga0495612_0000541 3300053078 Bacteria 15240
970 Ga0495655_0198634 3300053083 Bacteria 655
971 Ga0495595_0078082 3300053084 Bacteria 1574
972 Ga0495595_0629167 3300053084 Bacteria 549
973 Ga0495619_0002890 3300053085 Bacteria 11158
974 Ga0495619_0205949 3300053085 Bacteria 1362
975 Ga0495619_0839295 3300053085 Bacteria 620
976 Ga0495619_1115581 3300053085 Bacteria 524
977 Ga0500595_005625 3300053119 Bacteria 5448
978 Ga0500597_187682 3300053120 Bacteria 874
979 Ga0500597_394969 3300053120 Bacteria 527
980 Ga0500642_0005096 3300053130 Bacteria 4203
981 Ga0500589_152662 3300053147 Bacteria 938
982 Ga0500606_139940 3300053152 Bacteria 794
983 Ga0500636_0127938 3300053177 Bacteria 1418
984 Ga0500609_058010 3300053731 Bacteria 540
985 Ga0501084_0068343 3300054114 Bacteria 2974
986 Ga0501084_0101329 3300054114 Bacteria 2418
987 Ga0590071_078461 3300059421 Bacteria 819
988 Ga0587073_0175754 3300059492 Bacteria 625
989 Ga0587088_043072 3300059508 Bacteria 857
990 Ga0587113_004542 3300059625 Bacteria 1109
991 Ga0587115_046275 3300059626 Bacteria 694
992 Ga0587128_023211 3300059630 Bacteria 971
993 Ga0587075_153460 3300059644 Bacteria 500
994 Ga0587114_012899 3300059655 Bacteria 1067
995 Ga0587120_012229 3300059659 Bacteria 746
996 Ga0501082_0014635 3300060353 Bacteria 6758
997 Ga0501082_0150993 3300060353 Bacteria 2018
998 Ga0501082_1672751 3300060353 Bacteria 555
999 2904453252 2904449895 Bacteria 6927402
1000 2904459236 2904456579 Bacteria 6819253
1001 Ga0065707_10994733
1002 MBSR1b_contig_338456
1003 JGI24750J21931_1027256
1004 JGI24744J21845_10095206
1005 JGI24033J26618_1069027
1006 JGI25152J39213_1019172
1007 JGI25151J46595_10000484
1008 JGI25406J46586_10029830
1009 rootH1_10007256
1010 rootL2_10015755
1011 Ga0055540_1021179
1012 Ga0055531_10003055
1013 JGI25405J52794_10109991
1014 Ga0065712_10577272
1015 Ga0065715_10206904
1016 Ga0070658_10252621
1017 Ga0070658_10570166
1018 Ga0070676_10094306
1019 Ga0070676_10682791
1020 Ga0070690_100228533
1021 Ga0070690_100271419
1022 Ga0070690_100279108
1023 Ga0070690_100943718
1024 Ga0070670_100063631
1025 Ga0070670_101732113
1026 Ga0070677_10145241
1027 Ga0070677_10198623
1028 Ga0068869_101058695
1029 Ga0070666_10017070
1030 Ga0070666_10080003
1031 Ga0070666_10117782
1032 Ga0070680_100050311
1033 Ga0070680_101562954
1034 Ga0068868_100486493
1035 Ga0068868_100520136
1036 Ga0068868_101757975
1037 Ga0070660_100735479
1038 Ga0070689_100241042
1039 Ga0070689_101195869
1040 Ga0070691_10006637
1041 Ga0070661_100416845
1042 Ga0070661_101352789
1043 Ga0070692_10547514
1044 Ga0070668_100068711
1045 Ga0070668_100147431
1046 Ga0070668_100201141
1047 Ga0070668_100526947
1048 Ga0070669_100025621
1049 Ga0070669_100028534
1050 Ga0070669_100056074
1051 Ga0070669_100191036
1052 Ga0070669_100266970
1053 Ga0070669_100383217
1054 Ga0070669_100454702
1055 Ga0070669_100546528
1056 Ga0070669_100580727
1057 Ga0070675_100008877
1058 Ga0070675_100852498
1059 Ga0070671_100007199
1060 Ga0070671_100473828
1061 Ga0070671_102068782
1062 Ga0070674_100053480
1063 Ga0070674_100083251
1064 Ga0070673_100134150
1065 Ga0070673_100373951
1066 Ga0070673_100707842
1067 Ga0070688_100157532
1068 Ga0070688_100545382
1069 Ga0070688_100618256
1070 Ga0070659_100245852
1071 Ga0070667_100249905
1072 Ga0070667_100274433
1073 Ga0070667_100364275
1074 Ga0070667_100543611
1075 Ga0070667_100917141
1076 Ga0070714_100300172
1077 Ga0070713_100095458
1078 Ga0070713_100595181
1079 Ga0070713_101855732
1080 Ga0070701_10014472
1081 Ga0070701_11142789
1082 Ga0070711_100251064
1083 Ga0070711_100660922
1084 Ga0070711_101047815
1085 Ga0070700_100005110
1086 Ga0070700_100036463
1087 Ga0070700_100640945
1088 Ga0070700_100660453
1089 Ga0070708_100009658
1090 Ga0070708_100065755
1091 Ga0070708_100243226
1092 Ga0070708_101507231
1093 Ga0070663_100024749
1094 Ga0070678_100099594
1095 Ga0070678_100133403
1096 Ga0070678_100399299
1097 Ga0070678_100431250
1098 Ga0070678_100624045
1099 Ga0070678_101650415
1100 Ga0070678_102135062
1101 Ga0070662_100023503
1102 Ga0070662_100062512
1103 Ga0070681_10014706
1104 Ga0068867_100022027
1105 Ga0068867_100605111
1106 Ga0068867_101146814
1107 Ga0068867_101473396
1108 Ga0070685_10598206
1109 Ga0070706_100066477
1110 Ga0070706_100081688
1111 Ga0070706_100588244
1112 Ga0070707_100286935
1113 Ga0070707_100855090
1114 Ga0070698_100129636
1115 Ga0070698_100289477
1116 Ga0070698_100407253
1117 Ga0070699_100655991
1118 Ga0070679_100023496
1119 Ga0070684_100194804
1120 Ga0070684_101139745
1121 Ga0070697_100015136
1122 Ga0070697_100125531
1123 Ga0070697_100234137
1124 Ga0070672_100018857
1125 Ga0070672_100022894
1126 Ga0070672_100087727
1127 Ga0070672_100116310
1128 Ga0070672_100183923
1129 Ga0070672_100910113
1130 Ga0070686_100066204
1131 Ga0070686_100248599
1132 Ga0070686_100568029
1133 Ga0070686_101288553
1134 Ga0070686_101764810
1135 Ga0070695_100014030
1136 Ga0070695_100359679
1137 Ga0070695_101275397
1138 Ga0070696_100806001
1139 Ga0070693_100543521
1140 Ga0070665_100238232
1141 Ga0070704_101019314
1142 Ga0070704_101506468
1143 Ga0068855_100075847
1144 Ga0068857_101570547
1145 Ga0068857_102007228
1146 Ga0068854_100261973
1147 Ga0068854_101269865
1148 Ga0068856_100002367
1149 Ga0068856_100849863
1150 Ga0070702_100021312
1151 Ga0068852_100153006
1152 Ga0068852_101249298
1153 Ga0068852_102364657
1154 Ga0068859_100141368
1155 Ga0068859_100211100
1156 Ga0068859_100989117
1157 Ga0068859_101082522
1158 Ga0068859_101484957
1159 Ga0068864_100101157
1160 Ga0068864_102019601
1161 Ga0068866_10902499
1162 Ga0068861_100655083
1163 Ga0068861_101727827
1164 Ga0068851_10358363
1165 Ga0068870_10107141
1166 Ga0068870_10411521
1167 Ga0068863_100205589
1168 Ga0068863_100213207
1169 Ga0068863_100263329
1170 Ga0068863_100659517
1171 Ga0068863_101053295
1172 Ga0068863_101115237
1173 Ga0068863_101250822
1174 Ga0068858_100100066
1175 Ga0068858_100236835
1176 Ga0068858_100300710
1177 Ga0068858_100913507
1178 Ga0068858_101993280
1179 Ga0068860_100010465
1180 Ga0068860_100027486
1181 Ga0068860_100060564
1182 Ga0068860_100090931
1183 Ga0068860_100472009
1184 Ga0068860_100738172
1185 Ga0068860_101490037
1186 Ga0068860_102401583
1187 Ga0068860_102433413
1188 Ga0068860_102666087
1189 Ga0068862_101006961
1190 Ga0068862_101347280
1191 Ga0068862_101453222
1192 Ga0068862_101500684
1193 Ga0068862_101508655
1194 Ga0068862_101760229
1195 Ga0068862_102315923
1196 Ga0081455_10040779
1197 Ga0081455_10176555
1198 Ga0081540_1038284
1199 Ga0081540_1129863
1200 Ga0081539_10000686
1201 Ga0081539_10008399
1202 Ga0081539_10053540
1203 Ga0070717_10007254
1204 Ga0070717_10134894
1205 Ga0070717_10632645
1206 Ga0075365_10612111
1207 Ga0075368_10017753
1208 Ga0075368_10285482
1209 Ga0075368_10558010
1210 Ga0075364_10287397
1211 Ga0075432_10449900
1212 Ga0070715_10164101
1213 Ga0070715_11063339
1214 Ga0070712_100098798
1215 Ga0070712_100262243
1216 Ga0075367_10018684
1217 Ga0075367_10900327
1218 Ga0075366_10056144
1219 Ga0075366_10070231
1220 Ga0075366_10337020
1221 Ga0075366_10433292
1222 Ga0075366_10982278
1223 Ga0097621_100053906
1224 Ga0097621_100381322
1225 Ga0097621_101850692
1226 Ga0075370_10001245
1227 Ga0075370_10002892
1228 Ga0075370_10605050
1229 Ga0075370_10814031
1230 Ga0068871_100087636
1231 Ga0068871_100653440
1232 Ga0068871_101678751
1233 Ga0068871_101751430
1234 Ga0075428_100002996
1235 Ga0075428_100041098
1236 Ga0075428_100054997
1237 Ga0075428_100150077
1238 Ga0075428_100226006
1239 Ga0075428_100309129
1240 Ga0075428_100435011
1241 Ga0075428_100826262
1242 Ga0075428_101435260
1243 Ga0075428_102244687
1244 Ga0075430_100000297
1245 Ga0075430_100048027
1246 Ga0075430_100120273
1247 Ga0075430_100258026
1248 Ga0075430_101104339
1249 Ga0075431_100000562
1250 Ga0075431_100061296
1251 Ga0075431_100073806
1252 Ga0075431_100167641
1253 Ga0075431_101598764
1254 Ga0075431_101603483
1255 Ga0075433_10025688
1256 Ga0075433_10035338
1257 Ga0075433_10361892
1258 Ga0075433_10378005
1259 Ga0075433_10408641
1260 Ga0075434_100162495
1261 Ga0075434_100762317
1262 Ga0075434_100893053
1263 Ga0075434_100945678
1264 Ga0075434_101147399
1265 Ga0075434_102640061
1266 Ga0075429_100013948
1267 Ga0075429_100116943
1268 Ga0075429_100274424
1269 Ga0075429_100561694
1270 Ga0075429_100770565
1271 Ga0075429_100941219
1272 Ga0068865_100077597
1273 Ga0068865_100824378
1274 Ga0075436_100000048
1275 Ga0075436_100003306
1276 Ga0075436_100346083
1277 Ga0097620_100141363
1278 Ga0097620_100211117
1279 Ga0097620_100989107
1280 Ga0097620_101082528
1281 Ga0097620_101484672
1282 Ga0075435_100291505
1283 Ga0075435_100478210
1284 Ga0075435_100990868
1285 Ga0099794_10540447
1286 Ga0099795_10254159
1287 Ga0111539_10003803
1288 Ga0111539_10212127
1289 Ga0111539_10444155
1290 Ga0111539_10663867
1291 Ga0111539_10742130
1292 Ga0111539_10825161
1293 Ga0111539_11708708
1294 Ga0105245_10016807
1295 Ga0105245_10305859
1296 Ga0105245_10485511
1297 Ga0105245_12396559
1298 Ga0105245_12701982
1299 Ga0105245_12892405
1300 Ga0105247_10500956
1301 Ga0105247_11229767
1302 Ga0105247_11346340
1303 Ga0114129_10049832
1304 Ga0114129_10067866
1305 Ga0114129_10126067
1306 Ga0114129_10225730
1307 Ga0114129_10259861
1308 Ga0114129_10526958
1309 Ga0114129_12728067
1310 Ga0114129_13367059
1311 Ga0105243_10014454
1312 Ga0105243_10026499
1313 Ga0105243_12077514
1314 Ga0105243_12082483
1315 Ga0105241_11137130
1316 Ga0105242_10038906
1317 Ga0105242_10116558
1318 Ga0105242_11237913
1319 Ga0105242_12385628
1320 Ga0105248_10000978
1321 Ga0105248_10048871
1322 Ga0105248_10326301
1323 Ga0105248_10429968
1324 Ga0105248_10782912
1325 Ga0105248_10974400
1326 Ga0105248_12092536
1327 Ga0105248_12097646
1328 Ga0105248_12988271
1329 Ga0105237_10603937
1330 Ga0105238_10161040
1331 Ga0105249_10183790
1332 Ga0105249_10250194
1333 Ga0105249_10343521
1334 Ga0105249_10600135
1335 Ga0105249_10827774
1336 Ga0105249_11532698
1337 Ga0105249_12433340
1338 Ga0105249_13098791
1339 Ga0099796_10400121
1340 Ga0105239_10857050
1341 Ga0105239_10937943
1342 Ga0105239_11578284
1343 Ga0105239_11897975
1344 Ga0105246_10454667
1345 Ga0105246_11541842
1346 Ga0105246_12374157
1347 Ga0157347_1003590
1348 Ga0157373_10717243
1349 Ga0157370_10314475
1350 Ga0157370_11178410
1351 Ga0157369_10148922
1352 Ga0157374_10306167
1353 Ga0157374_11092213
1354 Ga0157378_10041610
1355 Ga0157378_10442675
1356 Ga0157378_10526958
1357 Ga0157378_11551413
1358 Ga0163162_10122960
1359 Ga0163162_10150452
1360 Ga0163162_10294421
1361 Ga0163162_10348096
1362 Ga0163162_10445545
1363 Ga0163162_10455868
1364 Ga0163162_10766928
1365 Ga0163162_11961664
1366 Ga0163162_12428977
1367 Ga0163162_12505264
1368 Ga0163162_12793503
1369 Ga0157372_10002768
1370 Ga0157372_10683346
1371 Ga0157372_11399715
1372 Ga0157375_10022857
1373 Ga0157375_10110197
1374 Ga0157375_10144580
1375 Ga0157375_10245707
1376 Ga0157375_10317514
1377 Ga0157375_10869182
1378 Ga0157375_11035859
1379 Ga0157375_11143070
1380 Ga0157375_11375409
1381 Ga0163163_10175456
1382 Ga0163163_11485720
1383 Ga0163163_11703726
1384 Ga0163163_11931165
1385 Ga0163163_12572678
1386 Ga0163163_12723129
1387 Ga0157380_10025209
1388 Ga0157380_10068998
1389 Ga0157380_10101393
1390 Ga0157380_10140326
1391 Ga0157380_10180738
1392 Ga0157380_10857875
1393 Ga0157380_12610690
1394 Ga0157380_13388817
1395 Ga0157380_13433207
1396 Ga0157377_10118094
1397 Ga0157377_10255632
1398 Ga0157379_10045664
1399 Ga0157379_10081006
1400 Ga0157379_10254625
1401 Ga0157379_11170462
1402 Ga0157379_11725411
1403 Ga0157376_10162035
1404 Ga0157376_10403586
1405 Ga0157376_12176838
1406 Ga0182006_1102203
1407 Ga0183362_10002
1408 Ga0163161_10088819
1409 Ga0163161_10281335
1410 Ga0163161_10384587
1411 Ga0197907_10526560
1412 Ga0206356_10867906
1413 Ga0213874_10071610
1414 Ga0213876_10145889
1415 Ga0213876_10255690
1416 Ga0224712_10088398
1417 Ga0209677_100235
1418 Ga0209129_1001758
1419 Ga0209673_1012504
1420 Ga0209025_1000207
1421 Ga0209025_1049733
1422 Ga0209050_1010376
1423 Ga0209051_1004592
1424 Ga0209257_1000309
1425 Ga0209257_1008728
1426 Ga0207682_10006548
1427 Ga0207682_10059197
1428 Ga0207682_10491350
1429 Ga0207642_10326106
1430 Ga0207710_10211224
1431 Ga0207688_10018514
1432 Ga0207680_10081026
1433 Ga0207680_10119535
1434 Ga0207680_10135634
1435 Ga0207680_10397025
1436 Ga0207680_11374845
1437 Ga0207647_10027276
1438 Ga0207699_10261393
1439 Ga0207645_10098987
1440 Ga0207645_10820804
1441 Ga0207643_10025781
1442 Ga0207705_10358314
1443 Ga0207705_11121825
1444 Ga0207684_10028102
1445 Ga0207684_10267868
1446 Ga0207654_10347875
1447 Ga0207654_10817069
1448 Ga0207707_10006074
1449 Ga0207693_10031692
1450 Ga0207693_10244296
1451 Ga0207663_10364217
1452 Ga0207663_10503801
1453 Ga0207663_11025719
1454 Ga0207660_10037305
1455 Ga0207660_10726247
1456 Ga0207662_10115571
1457 Ga0207657_10119290
1458 Ga0207657_10328488
1459 Ga0207649_11361644
1460 Ga0207652_10017408
1461 Ga0207646_10028357
1462 Ga0207681_10023679
1463 Ga0207681_10027124
1464 Ga0207681_10032722
1465 Ga0207681_10068654
1466 Ga0207681_10603115
1467 Ga0207694_10732582
1468 Ga0207650_10119037
1469 Ga0207659_10368074
1470 Ga0207659_10605671
1471 Ga0207659_10664220
1472 Ga0207687_10050337
1473 Ga0207687_10282788
1474 Ga0207687_10564601
1475 Ga0207687_11170888
1476 Ga0207700_10047920
1477 Ga0207700_11146932
1478 Ga0207664_10140250
1479 Ga0207664_10160717
1480 Ga0207644_10010350
1481 Ga0207644_10375966
1482 Ga0207644_10521447
1483 Ga0207644_11173795
1484 Ga0207644_11814184
1485 Ga0207690_10205525
1486 Ga0207690_10303348
1487 Ga0207706_10030331
1488 Ga0207706_10590527
1489 Ga0207706_10646493
1490 Ga0207686_10329748
1491 Ga0207709_10007568
1492 Ga0207709_10012749
1493 Ga0207709_10529393
1494 Ga0207670_10540360
1495 Ga0207670_11063361
1496 Ga0207669_10072705
1497 Ga0207669_10408520
1498 Ga0207669_11385989
1499 Ga0207669_11924492
1500 Ga0207704_11002366
1501 Ga0207704_11311757
1502 Ga0207691_10005645
1503 Ga0207691_10038113
1504 Ga0207691_10170356
1505 Ga0207691_10186862
1506 Ga0207691_10227997
1507 Ga0207691_10254290
1508 Ga0207691_11176717
1509 Ga0207711_10017825
1510 Ga0207711_10137002
1511 Ga0207711_10388284
1512 Ga0207711_10543778
1513 Ga0207711_11093126
1514 Ga0207711_12105225
1515 Ga0207689_10869382
1516 Ga0207679_11126327
1517 Ga0207667_10113680
1518 Ga0207651_10059405
1519 Ga0207651_10082857
1520 Ga0207651_10255016
1521 Ga0207651_10320874
1522 Ga0207712_10052118
1523 Ga0207712_11172740
1524 Ga0207712_11285943
1525 Ga0207668_10172206
1526 Ga0207668_10595585
1527 Ga0207668_11701283
1528 Ga0207668_12154324
1529 Ga0207640_10074441
1530 Ga0207658_10220305
1531 Ga0207658_10264642
1532 Ga0207658_10314760
1533 Ga0207677_10268373
1534 Ga0207677_10402575
1535 Ga0207703_10107280
1536 Ga0207703_10297123
1537 Ga0207703_10849726
1538 Ga0207639_10077017
1539 Ga0207678_10035317
1540 Ga0207678_10102530
1541 Ga0207678_10630701
1542 Ga0207678_10805635
1543 Ga0207678_10936749
1544 Ga0207678_11017370
1545 Ga0207708_10012698
1546 Ga0207708_10078600
1547 Ga0207708_10083293
1548 Ga0207708_10818370
1549 Ga0207708_11396396
1550 Ga0207702_10028833
1551 Ga0207702_10794843
1552 Ga0207641_10213323
1553 Ga0207641_10330773
1554 Ga0207641_10519622
1555 Ga0207641_10583100
1556 Ga0207641_11892253
1557 Ga0207648_10025520
1558 Ga0207648_10489893
1559 Ga0207648_10607278
1560 Ga0207676_10608760
1561 Ga0207676_10852327
1562 Ga0207674_10156695
1563 Ga0207675_100055943
1564 Ga0207675_100384694
1565 Ga0207675_101335733
1566 Ga0207683_10036388
1567 Ga0207683_10161872
1568 Ga0207683_10177463
1569 Ga0207683_10273330
1570 Ga0207683_10368543
1571 Ga0207683_10721464
1572 Ga0207698_10120187
1573 Ga0207698_10617232
1574 Ga0209995_1003727
1575 Ga0209588_1204609
1576 Ga0209813_10010313
1577 Ga0209813_10219096
1578 Ga0207428_10000053
1579 Ga0207428_10654731
1580 Ga0207428_10719366
1581 Ga0207428_10828418
1582 Ga0207428_10929806
1583 Ga0268266_10209971
1584 Ga0268266_10618441
1585 Ga0268266_12180437
1586 Ga0268265_10035424
1587 Ga0268265_10451431
1588 Ga0268265_10829582
1589 Ga0268265_11345255
1590 Ga0268265_11348127
1591 Ga0268264_10029385
1592 Ga0268264_10292442
1593 Ga0268264_10418511
1594 Ga0268264_10509069
1595 Ga0268264_11090553
1596 Ga0268264_11096959
1597 Ga0268264_11114074
1598 Ga0268264_11385849
1599 Ga0268264_11924215
1600 Ga0268264_12401269
1601 Ga0265334_10249324
1602 Ga0307514_10493287
1603 Ga0307405_10087957
1604 Ga0307413_12067217
1605 Ga0307412_10959065
1606 Ga0307412_11624238
1607 Ga0307416_100112376
1608 Ga0307416_100899331
1609 Ga0307416_101970167
1610 Ga0307411_10155112
1611 Ga0307415_100606046
1612 Ga0373948_0174648
1613 Ga0373926_0016559
1614 Ga0373926_0076750
1615 Ga0373934_0362845
1616 Ga0373944_0014885
1617 Ga0373936_0103975
1618 Ga0373945_0040185
1619 Ga0373953_0165091
1620 Ga0373956_0029653
1621 Ga0373956_0064096
1622 Ga0373957_0477257
1623 Ga0373943_0029042
1624 Ga0373943_0238336
1625 Ga0373943_0734244
1626 Ga0373946_0008647
1627 Ga0373946_0538304
1628 Ga0373946_0660125
1629 Ga0373955_0231517
1630 Ga0373924_0065814
1631 Ga0373924_0126012
1632 Ga0373924_0273568
1633 Ga0373931_1173621
1634 Ga0373935_0058785
1635 Ga0373935_0107673
1636 Ga0373935_0229260
1637 Ga0373935_0420046
1638 Ga0373927_0000745
1639 Ga0373927_0031067
1640 Ga0373927_0048800
1641 Ga0373927_0107097
1642 Ga0373927_0216269
1643 Ga0373927_0457993
1644 Ga0373927_0886323
1645 Ga0373933_0110132
1646 Ga0373933_0151024
1647 Ga0373933_0159218
1648 Ga0373947_0287865
1649 Ga0373947_0314249
1650 Ga0373947_0380203
1651 Ga0373937_0003972
1652 Ga0373937_0038317
1653 Ga0373937_0318527
1654 Ga0373925_0073396
1655 Ga0373925_0078104
1656 Ga0373925_0627790
1657 Ga0395900_0289276
1658 Ga0395900_1578584
1659 Ga0395898_1814856
1660 Ga0395905_0045491
1661 Ga0395905_0407087
1662 Ga0395905_1256830
1663 Ga0395905_1373629
1664 Ga0436364_1290173
1665 Ga0436364_1518215
1666 Ga0395901_0057158
1667 Ga0395901_0087161
1668 Ga0395901_0142296
1669 Ga0242420_033664
1670 Ga0436365_0134879
1671 Ga0436365_1447406
1672 Ga0436360_0493893
1673 Ga0436363_0324536
1674 Ga0436363_1452665
1675 Ga0436362_0256650
1676 Ga0451791_0354109
1677 Ga0451798_0286785
1678 Ga0439431_0145952
1679 Ga0439442_018352
1680 Ga0450910_094572
1681 Ga0451577_0102038
1682 Ga0453683_0752228
1683 Ga0453684_0148248
1684 Ga0453684_0150383
1685 Ga0466957_0519172
1686 Ga0451576_0006018
1687 Ga0466958_0106389
1688 Ga0495592_0055127
1689 Ga0495592_0154654
1690 Ga0495592_0356782
1691 Ga0495592_0586083
1692 Ga0495603_0000225
1693 Ga0495603_0761931
1694 Ga0495629_0429745
1695 Ga0495641_0018200
1696 Ga0495653_0144478
1697 Ga0495653_0888828
1698 Ga0495580_0050867
1699 Ga0495580_0069757
1700 Ga0495580_0073417
1701 Ga0495580_0143417
1702 Ga0495580_0263291
1703 Ga0495580_1110696
1704 Ga0495582_0000775
1705 Ga0495582_0027673
1706 Ga0495582_0112906
1707 Ga0495582_0226452
1708 Ga0495639_0000335
1709 Ga0495639_0018888
1710 Ga0495639_0393728
1711 Ga0495639_0519304
1712 Ga0495662_0000156
1713 Ga0495662_0001796
1714 Ga0495664_0001370
1715 Ga0495664_0786583
1716 Ga0495585_0162252
1717 Ga0495594_0011773
1718 Ga0495594_0576360
1719 Ga0495596_0262707
1720 Ga0495618_0002228
1721 Ga0495618_0890784
1722 Ga0495628_0077863
1723 Ga0495628_0124636
1724 Ga0495630_0757073
1725 Ga0495632_0201313
1726 Ga0495637_0035899
1727 Ga0495666_0499496
1728 Ga0495652_0244673
1729 Ga0495652_0314420
1730 Ga0495652_0350654
1731 Ga0495665_0000188
1732 Ga0495665_0025387
1733 Ga0495665_0059796
1734 Ga0495665_0353695
1735 Ga0495640_0002052
1736 Ga0495640_0002363
1737 Ga0495598_0226856
1738 Ga0495621_0050088
1739 Ga0495621_0082265
1740 Ga0495621_0406364
1741 Ga0495645_0010696
1742 Ga0495645_0124094
1743 Ga0495622_0023779
1744 Ga0495633_0480252
1745 Ga0495667_0016346
1746 Ga0495656_0018687
1747 Ga0495668_0613645
1748 Ga0495634_0001338
1749 Ga0495634_0016439
1750 Ga0495635_0086537
1751 Ga0495635_0200251
1752 Ga0495659_0137752
1753 Ga0495659_0513304
1754 Ga0495588_0040602
1755 Ga0495588_0138319
1756 Ga0495657_0226820
1757 Ga0495599_0127543
1758 Ga0495599_0597109
1759 Ga0495599_0883756
1760 Ga0495646_0023052
1761 Ga0495647_0005606
1762 Ga0495647_0011024
1763 Ga0495658_0000047
1764 Ga0495658_0002559
1765 Ga0495658_0054869
1766 Ga0495658_0056409
1767 Ga0495658_0659983
1768 Ga0495658_1111760
1769 Ga0495669_0004111
1770 Ga0495613_0001031
1771 Ga0495613_0074069
1772 Ga0495624_0001259
1773 Ga0495624_0821700
1774 Ga0495670_0101617
1775 Ga0495589_0403562
1776 Ga0495600_0572728
1777 Ga0495636_0072610
1778 Ga0495674_0015384
1779 Ga0495674_1302157
1780 Ga0495676_0031581
1781 Ga0495676_0129623
1782 Ga0495680_0417707
1783 Ga0495680_0689915
1784 Ga0495680_1045545
1785 Ga0495677_0251916
1786 Ga0495685_104273
1787 Ga0495684_0005269
1788 Ga0495684_0021610
1789 Ga0495684_0531896
1790 Ga0495684_0583706
1791 Ga0495593_0062471
1792 Ga0495614_0028249
1793 Ga0496100_0174884
1794 Ga0496100_0298202
1795 Ga0496100_0568804
1796 Ga0496100_1498693
1797 Ga0496101_0078289
1798 Ga0496101_0448302
1799 Ga0496101_0744143
1800 Ga0496101_0838514
1801 Ga0496102_0142370
1802 Ga0496102_0506647
1803 Ga0496102_0729974
1804 Ga0496102_1080423
1805 Ga0496103_0148895
1806 Ga0496103_0341871
1807 Ga0496103_0464171
1808 Ga0496104_0557165
1809 Ga0496105_0644296
1810 Ga0496106_0056968
1811 Ga0496106_0066843
1812 Ga0496106_0538592
1813 Ga0496106_1402509
1814 Ga0496108_0067227
1815 Ga0496109_1204942
1816 Ga0496109_1346987
1817 Ga0496109_1477773
1818 Ga0496110_0010022
1819 Ga0496110_0043966
1820 Ga0496110_0645463
1821 Ga0496110_0971459
1822 Ga0496111_0063817
1823 Ga0496111_0104344
1824 Ga0496112_0035225
1825 Ga0496112_0155937
1826 Ga0496112_0647605
1827 Ga0496112_1128870
1828 Ga0496113_0133794
1829 Ga0496113_0692450
1830 Ga0496114_0507851
1831 Ga0496114_0613451
1832 Ga0496114_1187201
1833 Ga0496116_0143263
1834 Ga0496117_0113594
1835 Ga0496118_0628568
1836 Ga0496121_0114182
1837 Ga0496121_0236977
1838 Ga0496124_0061615
1839 Ga0501031_0028408
1840 Ga0501031_0189979
1841 Ga0501032_0017507
1842 Ga0501032_0026773
1843 Ga0501033_0043397
1844 Ga0501033_0044598
1845 Ga0501033_0148286
1846 Ga0501034_0043551
1847 Ga0501034_0305175
1848 Ga0501036_0008707
1849 Ga0501036_0240442
1850 Ga0501037_0017167
1851 Ga0501037_0476869
1852 Ga0501038_0052645
1853 Ga0501038_0054637
1854 Ga0501039_0020313
1855 Ga0501039_0274768
1856 Ga0501040_0044637
1857 Ga0501042_0090178
1858 Ga0501043_0009889
1859 Ga0501043_0208069
1860 Ga0501046_0006761
1861 Ga0501046_0027006
1862 Ga0501047_0341675
1863 Ga0501047_0666979
1864 Ga0501048_0023383
1865 Ga0501048_0287894
1866 Ga0501067_0001716
1867 Ga0501067_0023398
1868 Ga0501067_0154126
1869 Ga0501067_0442209
1870 Ga0501068_0081163
1871 Ga0501068_0273518
1872 Ga0501069_0022286
1873 Ga0501069_0656600
1874 Ga0501070_0069313
1875 Ga0501070_0126013
1876 Ga0501071_0006875
1877 Ga0501072_0012451
1878 Ga0501073_0002916
1879 Ga0501073_0020656
1880 Ga0501073_0035187
1881 Ga0501073_0089360
1882 Ga0501073_1124392
1883 Ga0501074_0033662
1884 Ga0501074_0192656
1885 Ga0501074_0266542
1886 Ga0501075_1064935
1887 Ga0501076_0083397
1888 Ga0501076_0326231
1889 Ga0501077_0078870
1890 Ga0501079_0061421
1891 Ga0501079_0970879
1892 Ga0501080_0024405
1893 Ga0501080_1061370
1894 Ga0501083_0149522
1895 Ga0501083_0417459
1896 Ga0501035_0125406
1897 Ga0501035_1203857
1898 Ga0501044_0029153
1899 Ga0501044_0202526
1900 Ga0501045_0007776
1901 nmdc:mga03683_2001_c1
1902 nmdc:mga03n38_500506_c1
1903 nmdc:mga03n38_5703_c1
1904 nmdc:mga00v17_219257_c1
1905 nmdc:mga00v17_810472_c1
1906 nmdc:mga0yw44_568203_c1
1907 nmdc:mga0k408_103045_c1
1908 nmdc:mga0k408_185446_c1
1909 nmdc:mga0k408_840354_c1
1910 nmdc:mga0k408_9517_c1
1911 nmdc:mga06z11_149204_c1
1912 nmdc:mga06z11_1909_c1
1913 nmdc:mga06z11_199934_c1
1914 nmdc:mga06z11_220035_c1
1915 nmdc:mga06z11_507620_c1
1916 nmdc:mga04h51_250382_c1
1917 nmdc:mga04h51_8056_c1
1918 nmdc:mga07m45_2009_c2
1919 nmdc:mga07m45_350422_c1
1920 nmdc:mga07m45_64817_c1
1921 nmdc:mga05p37_122572_c1
1922 nmdc:mga05p37_139257_c1
1923 nmdc:mga05p37_510539_c1
1924 nmdc:mga05p37_9223_c1
1925 nmdc:mga09592_1033021_c1
1926 nmdc:mga09592_115241_c1
1927 nmdc:mga09592_12588_c1
1928 nmdc:mga09592_1541391_c1
1929 nmdc:mga09592_42827_c1
1930 nmdc:mga09592_6053_c2
1931 nmdc:mga0qj67_145043_c1
1932 nmdc:mga0qj67_220953_c1
1933 nmdc:mga0qj67_577_c1
1934 nmdc:mga0qj67_612_c1
1935 nmdc:mga06r32_132067_c1
1936 nmdc:mga06r32_22944_c1
1937 nmdc:mga06r32_28911_c1
1938 nmdc:mga06r32_308_c1
1939 nmdc:mga06r32_40537_c1
1940 nmdc:mga06r32_894248_c1
1941 nmdc:mga06r32_949115_c1
1942 nmdc:mga08y16_1140178_c1
1943 nmdc:mga08y16_1246086_c1
1944 nmdc:mga08y16_305412_c1
1945 nmdc:mga08y16_30_c1
1946 nmdc:mga08y16_571963_c1
1947 nmdc:mga0n895_1470163_c1
1948 nmdc:mga0n895_1573566_c1
1949 nmdc:mga0n895_161705_c1
1950 nmdc:mga0n895_1788462_c1
1951 nmdc:mga0n895_1889794_c1
1952 nmdc:mga0n895_221328_c1
1953 nmdc:mga0n895_233042_c1
1954 nmdc:mga0rr50_1163024_c1
1955 nmdc:mga0rr50_781483_c1
1956 nmdc:mga08x19_31335_c1
1957 nmdc:mga08x19_3408_c1
1958 nmdc:mga08x19_348_c1
1959 nmdc:mga0a205_115751_c1
1960 nmdc:mga0a205_133004_c1
1961 nmdc:mga0a205_308457_c1
1962 nmdc:mga0a205_446160_c1
1963 nmdc:mga0a205_774226_c1
1964 nmdc:mga0sz30_121841_c1
1965 nmdc:mga0sz30_501421_c1
1966 Ga0495601_0013178
1967 Ga0495601_0130232
1968 Ga0495601_0232425
1969 Ga0495612_0000541
1970 Ga0495655_0198634
1971 Ga0495595_0078082
1972 Ga0495595_0629167
1973 Ga0495619_0002890
1974 Ga0495619_0205949
1975 Ga0495619_0839295
1976 Ga0495619_1115581
1977 Ga0500595_005625
1978 Ga0500597_187682
1979 Ga0500597_394969
1980 Ga0500642_0005096
1981 Ga0500589_152662
1982 Ga0500606_139940
1983 Ga0500636_0127938
1984 Ga0500609_058010
1985 Ga0501084_0068343
1986 Ga0501084_0101329
1987 Ga0590071_078461
1988 Ga0587073_0175754
1989 Ga0587088_043072
1990 Ga0587113_004542
1991 Ga0587115_046275
1992 Ga0587128_023211
1993 Ga0587075_153460
1994 Ga0587114_012899
1995 Ga0587120_012229
1996 Ga0501082_0014635
1997 Ga0501082_0150993
1998 Ga0501082_1672751
1999 2904453252
2000 2904459236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bid-assembly4.cif.gz_G crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91 0.7788 1 44
1gcc-assembly1.cif.gz_A solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure 0.728 2 36
7wq5-assembly1.cif.gz_A crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6847 2 36
3gcc-assembly1.cif.gz_A solution structure of the gcc-box binding domain, nmr, 46 structures 0.6837 2 36
6l0w-assembly2.cif.gz_C structure of rld2 brx domain bound to lzy3 ccl motif 0.6825 1 34
ID Description Score Start End Superfamily
af_Q9AWS7_65_121_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8337 2 36 3.30.730.10
af_C0P9B0_100_150_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7966 2 36 3.30.730.10
af_A0A0R0FVZ4_228_287_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7893 2 36 3.30.730.10
af_K7KP57_178_237_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7834 2 36 3.30.730.10
af_A0A1D6KJ58_29_91_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7805 2 36 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A2V5YM63-F1-model_v4 Uncharacterized protein 1.016 1 39
AF-A0A6I6MUD1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.011 1 49
AF-A0A0Q8QM77-F1-model_v4 AP2/ERF domain-containing protein 1.01 1 48
AF-A0A2V6R6C1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.01 1 48
AF-A0A1Q4AJ78-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.009 1 48

Map