F487710

General Info

Members Datasets Scaffolds Average Seq Length
994 428 992 239

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100192188|Ga0070702_1001921881
Length 287
Sequence MVRLDDAGNWTGLWKAPHRCLHRDGNRSLPAQIFESADLPLIPRRPAAESVQDVFDIYTIIFLALAVFIFLRLRSVLGQRTGRERPPYDPYSARDVRGTTNDNVVRLPGRTAPDAVQKPVEAPEPAERWKGIAEPGSAIATGLEAIAAEDKGFDAKHFITGSRAAYEMIVLAFAEGDRRQLKNLLSREVYEGFDAAIRERETKGESIETRFVSIDKSEIVAAEMRGRMAHITVRFLSQLISVTRDRSGTVIEGNAEKVTDVTDVWTFARDVSSRDPNWKLVATEAGQ

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
133 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
153 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
236 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
248 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
254 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
255 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
256 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
257 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
258 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
271 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
272 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
273 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
278 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
288 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
289 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
292 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
316 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
319 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
327 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
336 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
363 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
364 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
365 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
366 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
396 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
410 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
413 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
419 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
420 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
421 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
422 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
427 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
428 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 1.21
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0.1
Rhizoplane 7.95
Rhizosphere 89.84
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000176 3300000041 Bacteria 11030
2 ARSoilYngRDRAFT_c00912 3300000042 Bacteria 2228
3 ARcpr5yngRDRAFT_c000045 3300000043 Bacteria 19814
4 ARSoilOldRDRAFT_c000265 3300000044 Bacteria 7493
5 ARSoilOldRDRAFT_c000599 3300000044 Bacteria 3910
6 ARCol0yngRDRAFT_1001185 3300000652 Bacteria 2205
7 JGI24741J21665_1005876 3300001915 Bacteria 2514
8 JGI24746J21847_1001040 3300001977 Bacteria 4353
9 JGI24740J21852_10021705 3300001979 Bacteria 2221
10 JGI24739J22299_10009366 3300001989 Bacteria 3650
11 JGI24737J22298_10000349 3300001990 Bacteria 15515
12 JGI24743J22301_10001914 3300001991 Bacteria 3020
13 JGI24750J21931_1000065 3300002070 Bacteria 15383
14 JGI24745J21846_1000050 3300002073 Bacteria 8168
15 JGI24748J21848_1000906 3300002074 Bacteria 3212
16 JGI24738J21930_10000803 3300002075 Bacteria 9022
17 JGI24035J26624_1000006 3300002126 Bacteria 14718
18 JGI24034J26672_10000266 3300002239 Bacteria 6898
19 JGI24742J22300_10000073 3300002244 Bacteria 14180
20 JGI24742J22300_10037906 3300002244 Bacteria 854
21 JGI26145J50221_1000700 3300003371 Bacteria 2758
22 Ga0065704_10084127 3300005289 Bacteria 3374
23 Ga0065704_10170228 3300005289 Bacteria 1296
24 Ga0065712_10000851 3300005290 Bacteria 16498
25 Ga0065715_10009479 3300005293 Bacteria 4398
26 Ga0065715_10116267 3300005293 Bacteria 2380
27 Ga0070658_10008449 3300005327 Bacteria 8280
28 Ga0070658_10023948 3300005327 Bacteria 4898
29 Ga0070658_10104725 3300005327 Bacteria 2341
30 Ga0070676_10000360 3300005328 Bacteria 20914
31 Ga0070676_10044695 3300005328 Bacteria 2579
32 Ga0070683_100003076 3300005329 Bacteria 13434
33 Ga0070683_100099828 3300005329 Bacteria 2732
34 Ga0070683_100162944 3300005329 Bacteria 2116
35 Ga0070683_100492435 3300005329 Bacteria 1171
36 Ga0070690_100009502 3300005330 Bacteria 5636
37 Ga0070690_100210654 3300005330 Bacteria 1357
38 Ga0070670_100000827 3300005331 Bacteria 24178
39 Ga0070670_100061527 3300005331 Bacteria 3223
40 Ga0070670_100156248 3300005331 Bacteria 1975
41 Ga0070677_10034861 3300005333 Bacteria 1947
42 Ga0068869_100000013 3300005334 Bacteria 73970
43 Ga0070666_10001254 3300005335 Bacteria 15354
44 Ga0070666_10024413 3300005335 Bacteria 3937
45 Ga0070666_10036624 3300005335 Bacteria 3258
46 Ga0070680_100002249 3300005336 Bacteria 14255
47 Ga0070680_100002907 3300005336 Bacteria 12726
48 Ga0070680_100006151 3300005336 Bacteria 9105
49 Ga0070680_100006824 3300005336 Bacteria 8701
50 Ga0070680_100088277 3300005336 Bacteria 2565
51 Ga0070680_100150823 3300005336 Bacteria 1951
52 Ga0070680_100160088 3300005336 Bacteria 1892
53 Ga0070682_100001195 3300005337 Bacteria 14796
54 Ga0070682_100028819 3300005337 Bacteria 3341
55 Ga0070682_100093427 3300005337 Bacteria 1972
56 Ga0068868_100043559 3300005338 Bacteria 3506
57 Ga0070660_100001856 3300005339 Bacteria 14539
58 Ga0070660_100014371 3300005339 Bacteria 5700
59 Ga0070660_100195236 3300005339 Bacteria 1640
60 Ga0070689_100000474 3300005340 Bacteria 23677
61 Ga0070689_100312406 3300005340 Bacteria 1310
62 Ga0070691_10000101 3300005341 Bacteria 25190
63 Ga0070687_100003845 3300005343 Bacteria 5901
64 Ga0070661_100001285 3300005344 Bacteria 17639
65 Ga0070692_10000014 3300005345 Bacteria 35936
66 Ga0070668_100000629 3300005347 Bacteria 23731
67 Ga0070668_100225429 3300005347 Bacteria 1548
68 Ga0070669_100000289 3300005353 Bacteria 39576
69 Ga0070669_100099770 3300005353 Bacteria 2189
70 Ga0070675_100000501 3300005354 Bacteria 26898
71 Ga0070675_100096691 3300005354 Bacteria 2481
72 Ga0070671_100000142 3300005355 Bacteria 46386
73 Ga0070671_100012637 3300005355 Bacteria 6804
74 Ga0070674_100000392 3300005356 Bacteria 21972
75 Ga0070674_100152054 3300005356 Bacteria 1747
76 Ga0070674_100156579 3300005356 Bacteria 1724
77 Ga0070673_100001752 3300005364 Bacteria 12936
78 Ga0070673_100003993 3300005364 Bacteria 9280
79 Ga0070673_100143366 3300005364 Bacteria 2017
80 Ga0070688_100024785 3300005365 Bacteria 3544
81 Ga0070688_100039337 3300005365 Bacteria 2893
82 Ga0070659_100001872 3300005366 Bacteria 15083
83 Ga0070659_100035555 3300005366 Bacteria 3879
84 Ga0070659_100236134 3300005366 Bacteria 1512
85 Ga0070667_100002667 3300005367 Bacteria 15448
86 Ga0070667_100029594 3300005367 Bacteria 4565
87 Ga0070667_100057194 3300005367 Bacteria 3295
88 Ga0070667_100372634 3300005367 Bacteria 1296
89 Ga0070703_10004137 3300005406 Bacteria 4091
90 Ga0070709_10115253 3300005434 Bacteria 1812
91 Ga0070709_10126242 3300005434 Bacteria 1741
92 Ga0070709_10152457 3300005434 Bacteria 1598
93 Ga0070714_100012391 3300005435 Bacteria 6807
94 Ga0070714_100083608 3300005435 Bacteria 2784
95 Ga0070714_100159502 3300005435 Bacteria 2040
96 Ga0070713_100000749 3300005436 Bacteria 20796
97 Ga0070713_100046678 3300005436 Bacteria 3555
98 Ga0070713_100592990 3300005436 Unclassified 1052
99 Ga0070710_10006342 3300005437 Bacteria 5676
100 Ga0070710_10010981 3300005437 Bacteria 4463
101 Ga0070710_10052551 3300005437 Bacteria 2292
102 Ga0070701_10000008 3300005438 Bacteria 53317
103 Ga0070701_10051052 3300005438 Bacteria 2144
104 Ga0070701_10231941 3300005438 Bacteria 1106
105 Ga0070711_100036981 3300005439 Bacteria 3273
106 Ga0070711_100125130 3300005439 Bacteria 1907
107 Ga0070711_100136679 3300005439 Bacteria 1833
108 Ga0070711_100275404 3300005439 Bacteria 1329
109 Ga0070705_100004263 3300005440 Bacteria 6978
110 Ga0070700_100000486 3300005441 Bacteria 19940
111 Ga0070694_100000463 3300005444 Bacteria 22164
112 Ga0070694_100079348 3300005444 Bacteria 2278
113 Ga0070663_100000944 3300005455 Bacteria 15811
114 Ga0070663_100659985 3300005455 Bacteria 885
115 Ga0070678_100004520 3300005456 Bacteria 7898
116 Ga0070678_100156523 3300005456 Bacteria 1841
117 Ga0070662_100004371 3300005457 Bacteria 8928
118 Ga0070681_10002062 3300005458 Bacteria 18223
119 Ga0070681_10004156 3300005458 Bacteria 13699
120 Ga0070681_10007607 3300005458 Bacteria 10591
121 Ga0070681_10056008 3300005458 Bacteria 3924
122 Ga0070681_10125487 3300005458 Bacteria 2499
123 Ga0070681_10127736 3300005458 Bacteria 2475
124 Ga0070681_10138950 3300005458 Bacteria 2359
125 Ga0070681_10302823 3300005458 Bacteria 1508
126 Ga0068867_100000303 3300005459 Bacteria 32425
127 Ga0068867_100458389 3300005459 Bacteria 1088
128 Ga0070685_10002009 3300005466 Bacteria 10543
129 Ga0070679_100005343 3300005530 Bacteria 11885
130 Ga0070679_100009550 3300005530 Bacteria 9176
131 Ga0070679_100026139 3300005530 Bacteria 5731
132 Ga0070679_100062681 3300005530 Bacteria 3707
133 Ga0070679_100067688 3300005530 Bacteria 3561
134 Ga0070679_100092785 3300005530 Bacteria 3006
135 Ga0070679_100266003 3300005530 Bacteria 1669
136 Ga0070679_100411166 3300005530 Bacteria 1298
137 Ga0070679_100413814 3300005530 Bacteria 1294
138 Ga0070684_100001817 3300005535 Bacteria 15613
139 Ga0070684_100041910 3300005535 Bacteria 3950
140 Ga0070684_100471021 3300005535 Bacteria 1162
141 Ga0070697_100029029 3300005536 Bacteria 4432
142 Ga0068853_100000726 3300005539 Bacteria 22782
143 Ga0070672_100000469 3300005543 Bacteria 23426
144 Ga0070672_100182207 3300005543 Bacteria 1751
145 Ga0070672_100278922 3300005543 Bacteria 1412
146 Ga0070686_100004236 3300005544 Bacteria 7898
147 Ga0070686_100086135 3300005544 Bacteria 2091
148 Ga0070686_100104167 3300005544 Bacteria 1921
149 Ga0070695_100003431 3300005545 Bacteria 9260
150 Ga0070695_100061785 3300005545 Bacteria 2431
151 Ga0070696_100030123 3300005546 Bacteria 3714
152 Ga0070696_100156869 3300005546 Bacteria 1674
153 Ga0070693_100000411 3300005547 Bacteria 19398
154 Ga0070693_100193276 3300005547 Bacteria 1317
155 Ga0070693_100216369 3300005547 Bacteria 1253
156 Ga0070665_100035465 3300005548 Bacteria 5015
157 Ga0070665_100067415 3300005548 Bacteria 3589
158 Ga0070665_100192052 3300005548 Bacteria 2043
159 Ga0070704_100001671 3300005549 Bacteria 12037
160 Ga0070704_100031993 3300005549 Bacteria 3543
161 Ga0070704_100238536 3300005549 Bacteria 1487
162 Ga0070704_100519222 3300005549 Bacteria 1036
163 Ga0068855_100028402 3300005563 Bacteria 6692
164 Ga0068855_100036036 3300005563 Bacteria 5890
165 Ga0068855_100074588 3300005563 Bacteria 3939
166 Ga0068855_100118700 3300005563 Bacteria 3029
167 Ga0068855_100282059 3300005563 Bacteria 1844
168 Ga0070664_100001745 3300005564 Bacteria 17407
169 Ga0070664_100112413 3300005564 Bacteria 2378
170 Ga0068857_100000307 3300005577 Bacteria 33926
171 Ga0068857_100257523 3300005577 Bacteria 1601
172 Ga0068854_100000761 3300005578 Bacteria 19144
173 Ga0068854_100023441 3300005578 Bacteria 4216
174 Ga0068854_100188576 3300005578 Bacteria 1614
175 Ga0068856_100003904 3300005614 Bacteria 14952
176 Ga0068856_100044864 3300005614 Bacteria 4351
177 Ga0068856_100058628 3300005614 Bacteria 3803
178 Ga0068856_100114373 3300005614 Bacteria 2697
179 Ga0068856_100129813 3300005614 Bacteria 2525
180 Ga0068856_100585502 3300005614 Bacteria 1137
181 Ga0070702_100001142 3300005615 Bacteria 10662
182 Ga0070702_100055057 3300005615 Bacteria 2292
183 Ga0070702_100192188 3300005615 Unclassified 1344
184 Ga0068852_100000151 3300005616 Bacteria 46414
185 Ga0068852_100060735 3300005616 Bacteria 3282
186 Ga0068852_100076862 3300005616 Bacteria 2949
187 Ga0068852_100273214 3300005616 Bacteria 1627
188 Ga0068852_100424644 3300005616 Bacteria 1312
189 Ga0068859_100039474 3300005617 Bacteria 4735
190 Ga0068859_100199900 3300005617 Bacteria 2083
191 Ga0068859_100266710 3300005617 Bacteria 1804
192 Ga0068864_100001020 3300005618 Bacteria 23442
193 Ga0068864_100025477 3300005618 Bacteria 4982
194 Ga0068864_100072770 3300005618 Bacteria 2996
195 Ga0068866_10000049 3300005718 Bacteria 45908
196 Ga0068861_100000471 3300005719 Bacteria 23427
197 Ga0068870_10001002 3300005840 Bacteria 11150
198 Ga0068870_10259385 3300005840 Bacteria 1081
199 Ga0068863_100000418 3300005841 Bacteria 43162
200 Ga0068863_100476300 3300005841 Bacteria 1227
201 Ga0068858_100002238 3300005842 Bacteria 19549
202 Ga0068858_100030576 3300005842 Bacteria 5001
203 Ga0068858_100142208 3300005842 Bacteria 2253
204 Ga0068860_100002578 3300005843 Bacteria 18969
205 Ga0068860_100106844 3300005843 Bacteria 2674
206 Ga0068860_100296224 3300005843 Bacteria 1584
207 Ga0068862_100001613 3300005844 Bacteria 20538
208 Ga0081455_10000002 3300005937 Bacteria 460472
209 Ga0081538_10006434 3300005981 Bacteria 10342
210 Ga0081540_1008868 3300005983 Bacteria 6982
211 Ga0070717_10001460 3300006028 Bacteria 16328
212 Ga0070717_10258285 3300006028 Bacteria 1541
213 Ga0075364_10132626 3300006051 Bacteria 1673
214 Ga0070715_10001906 3300006163 Bacteria 6267
215 Ga0070715_10036277 3300006163 Bacteria 2032
216 Ga0070715_10113475 3300006163 Bacteria 1282
217 Ga0070716_100021168 3300006173 Bacteria 3423
218 Ga0070716_100044339 3300006173 Bacteria 2491
219 Ga0070716_100546627 3300006173 Bacteria 863
220 Ga0070712_100036458 3300006175 Bacteria 3347
221 Ga0070712_100101908 3300006175 Bacteria 2125
222 Ga0070712_100157273 3300006175 Bacteria 1752
223 Ga0070712_100248395 3300006175 Bacteria 1420
224 Ga0075367_10135927 3300006178 Bacteria 1521
225 Ga0097621_100000012 3300006237 Bacteria 105108
226 Ga0097621_100038046 3300006237 Bacteria 3860
227 Ga0097621_100320179 3300006237 Bacteria 1373
228 Ga0075370_10120192 3300006353 Bacteria 1529
229 Ga0068871_100000611 3300006358 Bacteria 24571
230 Ga0068871_100011284 3300006358 Bacteria 6551
231 Ga0068871_100193103 3300006358 Bacteria 1755
232 Ga0075428_100000606 3300006844 Bacteria 36554
233 Ga0075430_100000332 3300006846 Bacteria 33904
234 Ga0075430_100236073 3300006846 Bacteria 1515
235 Ga0075431_100000032 3300006847 Bacteria 72293
236 Ga0075431_100028902 3300006847 Bacteria 5701
237 Ga0075431_100044521 3300006847 Bacteria 4578
238 Ga0075431_100340020 3300006847 Bacteria 1510
239 Ga0075433_10000487 3300006852 Bacteria 25890
240 Ga0075433_10007157 3300006852 Bacteria 8835
241 Ga0075434_100000193 3300006871 Bacteria 40605
242 Ga0075434_100000647 3300006871 Bacteria 26943
243 Ga0075434_100009281 3300006871 Bacteria 9166
244 Ga0075434_100163620 3300006871 Bacteria 2245
245 Ga0075429_100000451 3300006880 Bacteria 30628
246 Ga0075429_100008370 3300006880 Bacteria 9003
247 Ga0068865_100001539 3300006881 Bacteria 13451
248 Ga0068865_100010595 3300006881 Bacteria 5745
249 Ga0075436_100067544 3300006914 Bacteria 2470
250 Ga0075436_100124736 3300006914 Bacteria 1804
251 Ga0075436_100198928 3300006914 Bacteria 1419
252 Ga0097620_100039475 3300006931 Bacteria 4735
253 Ga0097620_100199918 3300006931 Bacteria 2083
254 Ga0097620_100266705 3300006931 Bacteria 1804
255 Ga0075435_100003880 3300007076 Bacteria 10208
256 Ga0075435_100356880 3300007076 Bacteria 1253
257 Ga0099795_10000764 3300007788 Bacteria 6306
258 Ga0105244_10039073 3300009036 Bacteria 2472
259 Ga0105240_10025356 3300009093 Bacteria 7794
260 Ga0105240_10070752 3300009093 Bacteria 4315
261 Ga0105240_10164390 3300009093 Bacteria 2633
262 Ga0105240_10187355 3300009093 Bacteria 2436
263 Ga0105240_10683975 3300009093 Bacteria 1121
264 Ga0111539_10000679 3300009094 Bacteria 44034
265 Ga0111539_10000925 3300009094 Bacteria 38387
266 Ga0111539_10001089 3300009094 Bacteria 35899
267 Ga0111539_10002056 3300009094 Bacteria 26910
268 Ga0105245_10000090 3300009098 Bacteria 90378
269 Ga0105245_10169095 3300009098 Bacteria 2080
270 Ga0105247_10002243 3300009101 Bacteria 13299
271 Ga0105247_10067006 3300009101 Bacteria 2236
272 Ga0114129_10000062 3300009147 Bacteria 96507
273 Ga0114129_10006668 3300009147 Bacteria 16397
274 Ga0114129_10006700 3300009147 Bacteria 16356
275 Ga0114129_10158612 3300009147 Bacteria 3093
276 Ga0105243_10003044 3300009148 Bacteria 13819
277 Ga0105243_10124867 3300009148 Bacteria 2175
278 Ga0105241_10071516 3300009174 Bacteria 2693
279 Ga0105242_10000491 3300009176 Bacteria 31233
280 Ga0105242_10027423 3300009176 Bacteria 4522
281 Ga0105242_10147453 3300009176 Bacteria 2048
282 Ga0105242_10153584 3300009176 Bacteria 2009
283 Ga0105242_10938996 3300009176 Bacteria 868
284 Ga0105248_10003797 3300009177 Bacteria 16742
285 Ga0105248_10004778 3300009177 Bacteria 14992
286 Ga0105248_10021356 3300009177 Bacteria 7175
287 Ga0105248_10200987 3300009177 Bacteria 2245
288 Ga0105248_10231848 3300009177 Bacteria 2078
289 Ga0105237_10004589 3300009545 Bacteria 15948
290 Ga0105237_10144669 3300009545 Bacteria 2372
291 Ga0105237_10439885 3300009545 Bacteria 1310
292 Ga0105238_10147753 3300009551 Bacteria 2327
293 Ga0105238_10159650 3300009551 Bacteria 2230
294 Ga0105238_10252634 3300009551 Bacteria 1742
295 Ga0105249_10001085 3300009553 Bacteria 24172
296 Ga0099796_10001065 3300010159 Bacteria 5228
297 Ga0105239_10028016 3300010375 Bacteria 6199
298 Ga0105239_10062647 3300010375 Bacteria 4082
299 Ga0105246_10000052 3300011119 Bacteria 46290
300 Ga0105246_10452631 3300011119 Bacteria 1079
301 Ga0157337_1000687 3300012483 Bacteria 1600
302 Ga0157341_1001502 3300012494 Bacteria 1423
303 Ga0157373_10065420 3300013100 Bacteria 2573
304 Ga0157373_10078404 3300013100 Bacteria 2329
305 Ga0157371_10003401 3300013102 Bacteria 14457
306 Ga0157371_10157646 3300013102 Bacteria 1621
307 Ga0157370_10036546 3300013104 Bacteria 4765
308 Ga0157370_10094541 3300013104 Bacteria 2804
309 Ga0157370_10146110 3300013104 Bacteria 2202
310 Ga0157370_10152946 3300013104 Bacteria 2147
311 Ga0157369_10003829 3300013105 Bacteria 17867
312 Ga0157369_10018011 3300013105 Bacteria 7924
313 Ga0157369_10118116 3300013105 Bacteria 2815
314 Ga0157369_10200279 3300013105 Bacteria 2096
315 Ga0157369_10401104 3300013105 Bacteria 1423
316 Ga0157369_10538490 3300013105 Bacteria 1207
317 Ga0157369_10933449 3300013105 Bacteria 889
318 Ga0157374_10001210 3300013296 Bacteria 22071
319 Ga0157374_10421034 3300013296 Bacteria 1334
320 Ga0157378_10002713 3300013297 Bacteria 15762
321 Ga0157378_10038308 3300013297 Bacteria 4248
322 Ga0157378_10160446 3300013297 Bacteria 2102
323 Ga0157378_10220471 3300013297 Bacteria 1803
324 Ga0163162_10000308 3300013306 Bacteria 45253
325 Ga0163162_10031670 3300013306 Bacteria 5245
326 Ga0163162_10100977 3300013306 Bacteria 2977
327 Ga0157372_10002370 3300013307 Bacteria 20397
328 Ga0157372_10084220 3300013307 Bacteria 3603
329 Ga0157372_10295438 3300013307 Bacteria 1884
330 Ga0157372_10312145 3300013307 Bacteria 1830
331 Ga0157375_10000414 3300013308 Bacteria 38778
332 Ga0157375_10074284 3300013308 Bacteria 3421
333 Ga0163163_10002008 3300014325 Bacteria 17189
334 Ga0163163_10002377 3300014325 Bacteria 15920
335 Ga0163163_10012546 3300014325 Bacteria 7728
336 Ga0163163_10873168 3300014325 Bacteria 963
337 Ga0157380_10000122 3300014326 Bacteria 43303
338 Ga0157380_10288493 3300014326 Bacteria 1505
339 Ga0157377_10000688 3300014745 Bacteria 13982
340 Ga0157379_10000261 3300014968 Bacteria 41455
341 Ga0157379_10073523 3300014968 Bacteria 3060
342 Ga0157379_10238046 3300014968 Bacteria 1651
343 Ga0157376_10002538 3300014969 Bacteria 12376
344 Ga0157376_10790483 3300014969 Bacteria 961
345 Ga0163161_10000199 3300017792 Bacteria 55004
346 Ga0163161_10033750 3300017792 Bacteria 3657
347 Ga0163161_10420833 3300017792 Bacteria 1075
348 Ga0197907_10366928 3300020069 Bacteria 1639
349 Ga0206356_11492982 3300020070 Bacteria 1240
350 Ga0206349_1289062 3300020075 Bacteria 982
351 Ga0206349_1903841 3300020075 Bacteria 1130
352 Ga0206355_1562117 3300020076 Bacteria 990
353 Ga0206350_10159323 3300020080 Bacteria 1255
354 Ga0206350_10981810 3300020080 Bacteria 1193
355 Ga0206353_10968937 3300020082 Bacteria 1789
356 Ga0206353_12065215 3300020082 Bacteria 1326
357 Ga0213876_10004643 3300021384 Bacteria 7654
358 Ga0224712_10075688 3300022467 Bacteria 1377
359 Ga0224712_10159689 3300022467 Bacteria 1005
360 Ga0207673_1000255 3300025290 Bacteria 5428
361 Ga0207697_10136950 3300025315 Bacteria 1060
362 Ga0207656_10061318 3300025321 Bacteria 1651
363 Ga0207682_10000042 3300025893 Bacteria 52333
364 Ga0207692_10006921 3300025898 Bacteria 4621
365 Ga0207692_10010391 3300025898 Bacteria 3921
366 Ga0207692_10099162 3300025898 Bacteria 1595
367 Ga0207642_10000065 3300025899 Bacteria 29318
368 Ga0207710_10000734 3300025900 Bacteria 18097
369 Ga0207710_10001358 3300025900 Bacteria 12296
370 Ga0207688_10000053 3300025901 Bacteria 41441
371 Ga0207680_10006073 3300025903 Bacteria 5815
372 Ga0207680_10018719 3300025903 Bacteria 3689
373 Ga0207647_10002478 3300025904 Bacteria 13980
374 Ga0207647_10062165 3300025904 Bacteria 2275
375 Ga0207647_10207656 3300025904 Bacteria 1132
376 Ga0207685_10048525 3300025905 Bacteria 1627
377 Ga0207685_10128141 3300025905 Bacteria 1123
378 Ga0207699_10375280 3300025906 Bacteria 1008
379 Ga0207645_10071014 3300025907 Bacteria 2228
380 Ga0207643_10000082 3300025908 Bacteria 62322
381 Ga0207643_10246779 3300025908 Bacteria 1099
382 Ga0207705_10049719 3300025909 Bacteria 3018
383 Ga0207705_10076009 3300025909 Bacteria 2441
384 Ga0207705_10082423 3300025909 Bacteria 2346
385 Ga0207705_10129060 3300025909 Bacteria 1880
386 Ga0207654_10004743 3300025911 Bacteria 6884
387 Ga0207654_10080821 3300025911 Bacteria 1956
388 Ga0207707_10017763 3300025912 Bacteria 6203
389 Ga0207707_10027709 3300025912 Bacteria 4955
390 Ga0207707_10054354 3300025912 Bacteria 3486
391 Ga0207707_10184357 3300025912 Bacteria 1821
392 Ga0207707_10273929 3300025912 Bacteria 1462
393 Ga0207707_10613850 3300025912 Bacteria 919
394 Ga0207695_10201924 3300025913 Bacteria 1902
395 Ga0207695_10366959 3300025913 Bacteria 1326
396 Ga0207671_10027981 3300025914 Bacteria 4213
397 Ga0207671_10084027 3300025914 Bacteria 2390
398 Ga0207693_10002221 3300025915 Bacteria 16903
399 Ga0207693_10002937 3300025915 Bacteria 14752
400 Ga0207693_10022497 3300025915 Bacteria 5009
401 Ga0207693_10090878 3300025915 Bacteria 2393
402 Ga0207693_10373000 3300025915 Bacteria 1116
403 Ga0207663_10143548 3300025916 Bacteria 1666
404 Ga0207663_10158452 3300025916 Bacteria 1595
405 Ga0207663_10167262 3300025916 Bacteria 1558
406 Ga0207660_10000083 3300025917 Bacteria 50279
407 Ga0207660_10055323 3300025917 Bacteria 2835
408 Ga0207660_10059620 3300025917 Bacteria 2740
409 Ga0207660_10060659 3300025917 Bacteria 2720
410 Ga0207660_10101559 3300025917 Bacteria 2149
411 Ga0207660_10234908 3300025917 Bacteria 1442
412 Ga0207657_10014898 3300025919 Bacteria 7564
413 Ga0207657_10022232 3300025919 Bacteria 5944
414 Ga0207657_10036176 3300025919 Bacteria 4421
415 Ga0207649_10000643 3300025920 Bacteria 23321
416 Ga0207649_10024908 3300025920 Bacteria 3483
417 Ga0207649_10074397 3300025920 Bacteria 2180
418 Ga0207649_10081876 3300025920 Bacteria 2091
419 Ga0207652_10000557 3300025921 Bacteria 37611
420 Ga0207652_10035660 3300025921 Bacteria 4200
421 Ga0207652_10199447 3300025921 Bacteria 1801
422 Ga0207652_10246694 3300025921 Bacteria 1610
423 Ga0207681_10000271 3300025923 Bacteria 38955
424 Ga0207694_10281115 3300025924 Bacteria 1367
425 Ga0207694_10282189 3300025924 Bacteria 1364
426 Ga0207650_10006111 3300025925 Bacteria 8203
427 Ga0207650_10048796 3300025925 Bacteria 3123
428 Ga0207650_10072156 3300025925 Bacteria 2598
429 Ga0207659_10000161 3300025926 Bacteria 39821
430 Ga0207659_10000460 3300025926 Bacteria 24451
431 Ga0207659_10084817 3300025926 Bacteria 2352
432 Ga0207659_10640818 3300025926 Bacteria 908
433 Ga0207687_10000063 3300025927 Bacteria 83105
434 Ga0207687_10013822 3300025927 Bacteria 5273
435 Ga0207687_10061716 3300025927 Bacteria 2648
436 Ga0207700_10004421 3300025928 Bacteria 8285
437 Ga0207700_10106154 3300025928 Bacteria 2251
438 Ga0207700_10321717 3300025928 Unclassified 1340
439 Ga0207664_10004485 3300025929 Bacteria 9460
440 Ga0207664_10063853 3300025929 Bacteria 2944
441 Ga0207664_10110426 3300025929 Bacteria 2286
442 Ga0207664_10123995 3300025929 Bacteria 2166
443 Ga0207644_10000591 3300025931 Bacteria 23144
444 Ga0207644_10003846 3300025931 Bacteria 9729
445 Ga0207644_10011436 3300025931 Bacteria 5872
446 Ga0207644_10015231 3300025931 Bacteria 5159
447 Ga0207644_10165940 3300025931 Bacteria 1720
448 Ga0207690_10000897 3300025932 Bacteria 19010
449 Ga0207690_10061152 3300025932 Bacteria 2559
450 Ga0207690_10063978 3300025932 Bacteria 2510
451 Ga0207690_10106094 3300025932 Bacteria 2015
452 Ga0207706_10054931 3300025933 Bacteria 3514
453 Ga0207706_10068324 3300025933 Bacteria 3127
454 Ga0207686_10000614 3300025934 Bacteria 22208
455 Ga0207686_10009933 3300025934 Bacteria 5173
456 Ga0207686_10038769 3300025934 Bacteria 2886
457 Ga0207686_10132324 3300025934 Bacteria 1712
458 Ga0207709_10000429 3300025935 Bacteria 40094
459 Ga0207709_10076700 3300025935 Bacteria 2140
460 Ga0207709_10131708 3300025935 Bacteria 1705
461 Ga0207670_10000485 3300025936 Bacteria 21952
462 Ga0207670_10044764 3300025936 Bacteria 2930
463 Ga0207670_10202010 3300025936 Bacteria 1511
464 Ga0207670_10392124 3300025936 Bacteria 1108
465 Ga0207669_10000019 3300025937 Bacteria 111630
466 Ga0207669_10062994 3300025937 Bacteria 2287
467 Ga0207704_10000552 3300025938 Bacteria 16651
468 Ga0207704_10013384 3300025938 Bacteria 4103
469 Ga0207665_10007282 3300025939 Bacteria 7321
470 Ga0207665_10015564 3300025939 Bacteria 4991
471 Ga0207665_10035016 3300025939 Bacteria 3331
472 Ga0207665_10074058 3300025939 Bacteria 2330
473 Ga0207665_10112739 3300025939 Bacteria 1912
474 Ga0207691_10043594 3300025940 Bacteria 4134
475 Ga0207691_10074325 3300025940 Bacteria 3066
476 Ga0207691_10432516 3300025940 Bacteria 1121
477 Ga0207711_10009466 3300025941 Bacteria 8129
478 Ga0207711_10025052 3300025941 Bacteria 5005
479 Ga0207711_10033759 3300025941 Bacteria 4331
480 Ga0207711_10154419 3300025941 Bacteria 2073
481 Ga0207689_10001364 3300025942 Bacteria 23406
482 Ga0207661_10000281 3300025944 Bacteria 32639
483 Ga0207661_10064885 3300025944 Bacteria 2962
484 Ga0207679_10000026 3300025945 Bacteria 200073
485 Ga0207667_10004064 3300025949 Bacteria 17974
486 Ga0207667_10079012 3300025949 Bacteria 3409
487 Ga0207667_10107081 3300025949 Bacteria 2883
488 Ga0207667_10266021 3300025949 Bacteria 1753
489 Ga0207651_10000101 3300025960 Bacteria 37898
490 Ga0207651_10013274 3300025960 Bacteria 4706
491 Ga0207651_10037796 3300025960 Bacteria 3165
492 Ga0207651_10508059 3300025960 Bacteria 1043
493 Ga0207712_10000908 3300025961 Bacteria 21454
494 Ga0207712_10031991 3300025961 Bacteria 3548
495 Ga0207668_10000726 3300025972 Bacteria 20155
496 Ga0207668_10275683 3300025972 Bacteria 1377
497 Ga0207640_10000596 3300025981 Bacteria 21479
498 Ga0207640_10078383 3300025981 Bacteria 2249
499 Ga0207640_10157223 3300025981 Bacteria 1677
500 Ga0207658_10003725 3300025986 Bacteria 10734
501 Ga0207677_10000651 3300026023 Bacteria 20869
502 Ga0207677_10073595 3300026023 Bacteria 2420
503 Ga0207677_10144649 3300026023 Bacteria 1825
504 Ga0207703_10001717 3300026035 Bacteria 19677
505 Ga0207703_10015632 3300026035 Bacteria 5919
506 Ga0207703_10020476 3300026035 Bacteria 5173
507 Ga0207639_10002467 3300026041 Bacteria 12402
508 Ga0207639_10060951 3300026041 Bacteria 2912
509 Ga0207639_10116586 3300026041 Bacteria 2187
510 Ga0207678_10014165 3300026067 Bacteria 7011
511 Ga0207678_10022132 3300026067 Bacteria 5569
512 Ga0207678_10402971 3300026067 Bacteria 1185
513 Ga0207702_10234555 3300026078 Bacteria 1716
514 Ga0207702_10502107 3300026078 Bacteria 1183
515 Ga0207702_10745543 3300026078 Bacteria 967
516 Ga0207641_10002162 3300026088 Bacteria 18511
517 Ga0207641_10332482 3300026088 Bacteria 1444
518 Ga0207648_10003986 3300026089 Bacteria 15325
519 Ga0207648_10098193 3300026089 Bacteria 2564
520 Ga0207676_10000563 3300026095 Bacteria 30791
521 Ga0207676_10030839 3300026095 Bacteria 4028
522 Ga0207674_10001207 3300026116 Bacteria 33673
523 Ga0207674_10054631 3300026116 Bacteria 4065
524 Ga0207674_10743219 3300026116 Bacteria 947
525 Ga0207675_101229104 3300026118 Bacteria 769
526 Ga0207683_10000324 3300026121 Bacteria 43461
527 Ga0207683_10001459 3300026121 Bacteria 21325
528 Ga0207683_10015259 3300026121 Bacteria 6538
529 Ga0207683_10461918 3300026121 Bacteria 1171
530 Ga0207698_10000634 3300026142 Bacteria 20408
531 Ga0209973_1004080 3300027252 Bacteria 1479
532 Ga0209995_1012542 3300027471 Bacteria 1383
533 Ga0209179_1000922 3300027512 Unclassified 3316
534 Ga0209982_1001520 3300027552 Bacteria 3183
535 Ga0210002_1004553 3300027617 Bacteria 2068
536 Ga0209971_1006277 3300027682 Bacteria 2813
537 Ga0209966_1001336 3300027695 Bacteria 4326
538 Ga0209813_10064996 3300027866 Bacteria 1173
539 Ga0207428_10000130 3300027907 Bacteria 104457
540 Ga0207428_10000180 3300027907 Bacteria 88557
541 Ga0207428_10000286 3300027907 Bacteria 68250
542 Ga0207428_10013177 3300027907 Bacteria 7238
543 Ga0207428_10209604 3300027907 Bacteria 1464
544 Ga0268266_10006553 3300028379 Bacteria 10645
545 Ga0268266_10018702 3300028379 Bacteria 5903
546 Ga0268266_10045032 3300028379 Bacteria 3773
547 Ga0268265_10008091 3300028380 Bacteria 7105
548 Ga0268265_10033423 3300028380 Bacteria 3739
549 Ga0268264_10003472 3300028381 Bacteria 13591
550 Ga0268264_10061668 3300028381 Bacteria 3146
551 Ga0268264_10099215 3300028381 Bacteria 2527
552 Ga0265337_1001317 3300028556 Bacteria 12368
553 Ga0265334_10020588 3300028573 Bacteria 2701
554 Ga0265338_10020386 3300028800 Bacteria 6975
555 Ga0265762_1002070 3300030760 Bacteria 3658
556 Ga0265325_10000011 3300031241 Bacteria 150631
557 Ga0265325_10169954 3300031241 Bacteria 1021
558 Ga0265339_10109301 3300031249 Bacteria 1432
559 Ga0265316_10037941 3300031344 Bacteria 3885
560 Ga0265316_10114806 3300031344 Bacteria 2037
561 Ga0265316_10230703 3300031344 Bacteria 1363
562 Ga0265316_10437309 3300031344 Bacteria 939
563 Ga0265313_10028584 3300031595 Bacteria 2895
564 Ga0265313_10062502 3300031595 Bacteria 1739
565 Ga0307508_10221054 3300031616 Bacteria 1494
566 Ga0265314_10046661 3300031711 Bacteria 3055
567 Ga0265314_10088533 3300031711 Bacteria 2021
568 Ga0265342_10000625 3300031712 Bacteria 37152
569 Ga0265342_10005956 3300031712 Bacteria 9174
570 Ga0307409_100720905 3300031995 Bacteria 998
571 Ga0373930_0003817 3300034816 Bacteria 2414
572 Ga0373930_0009997 3300034816 Bacteria 1686
573 Ga0373948_0001446 3300034817 Bacteria 3297
574 Ga0373948_0001993 3300034817 Bacteria 2943
575 Ga0373950_0000469 3300034818 Bacteria 4928
576 Ga0373958_0000037 3300034819 Bacteria 13403
577 Ga0373958_0020735 3300034819 Bacteria 1214
578 Ga0373938_0000190 3300034957 Bacteria 9113
579 Ga0373938_0009129 3300034957 Bacteria 1788
580 Ga0373938_0065615 3300034957 Bacteria 858
581 Ga0373926_0106659 3300035083 Bacteria 1050
582 Ga0373928_0000490 3300035084 Bacteria 7798
583 Ga0373929_0000503 3300035085 Bacteria 7457
584 Ga0373929_0085729 3300035085 Bacteria 774
585 Ga0373940_0000178 3300035088 Bacteria 8521
586 Ga0373940_0001969 3300035088 Bacteria 3878
587 Ga0373940_0006230 3300035088 Bacteria 2635
588 Ga0373944_0007842 3300035089 Bacteria 2871
589 Ga0373949_0001015 3300035090 Bacteria 8648
590 Ga0373949_0014010 3300035090 Bacteria 1783
591 Ga0373949_0035920 3300035090 Bacteria 1200
592 Ga0373951_0000165 3300035091 Bacteria 24248
593 Ga0373951_0007934 3300035091 Bacteria 2406
594 Ga0373952_0000676 3300035092 Bacteria 6045
595 Ga0373952_0004795 3300035092 Bacteria 2461
596 Ga0373923_0000996 3300035111 Bacteria 7664
597 Ga0373923_0055815 3300035111 Bacteria 1666
598 Ga0373932_0000221 3300035112 Bacteria 16961
599 Ga0373932_0011462 3300035112 Bacteria 2166
600 Ga0373939_0000178 3300035114 Bacteria 17639
601 Ga0373939_0000211 3300035114 Bacteria 16115
602 Ga0373941_0000085 3300035115 Bacteria 15179
603 Ga0373945_0017285 3300035116 Bacteria 2441
604 Ga0373945_0032699 3300035116 Bacteria 1844
605 Ga0373954_0009599 3300035118 Bacteria 4258
606 Ga0373954_0131830 3300035118 Bacteria 1217
607 Ga0373956_0034112 3300035119 Bacteria 2241
608 Ga0373956_0184022 3300035119 Bacteria 988
609 Ga0373957_0021944 3300035120 Bacteria 2271
610 Ga0373960_0002021 3300035121 Bacteria 4557
611 Ga0373960_0003781 3300035121 Bacteria 3441
612 Ga0373943_0029129 3300035170 Bacteria 2607
613 Ga0373943_0045435 3300035170 Bacteria 2140
614 Ga0373943_0098150 3300035170 Bacteria 1528
615 Ga0373943_0191361 3300035170 Unclassified 1129
616 Ga0373946_0009900 3300035171 Bacteria 3523
617 Ga0373955_0020162 3300035172 Bacteria 3347
618 Ga0373955_0037464 3300035172 Bacteria 2578
619 Ga0373955_0050566 3300035172 Bacteria 2261
620 Ga0373942_0000892 3300035207 Bacteria 8167
621 Ga0373942_0006884 3300035207 Bacteria 2627
622 Ga0373961_0001088 3300035241 Bacteria 8657
623 Ga0373961_0002998 3300035241 Bacteria 4261
624 Ga0373962_0000271 3300035242 Bacteria 11153
625 Ga0373962_0008443 3300035242 Bacteria 2534
626 Ga0373924_0025342 3300035410 Bacteria 2345
627 Ga0373931_0000854 3300035691 Bacteria 12844
628 Ga0373931_0002074 3300035691 Bacteria 8820
629 Ga0373931_0007900 3300035691 Bacteria 5031
630 Ga0373931_0049738 3300035691 Bacteria 2228
631 Ga0373935_0008929 3300035692 Bacteria 5998
632 Ga0373935_0050374 3300035692 Bacteria 2643
633 Ga0373935_0110958 3300035692 Bacteria 1820
634 Ga0373935_0138609 3300035692 Bacteria 1641
635 Ga0373927_0089079 3300035695 Bacteria 2004
636 Ga0373933_0004073 3300035724 Bacteria 8051
637 Ga0373933_0007699 3300035724 Bacteria 5882
638 Ga0373933_0046184 3300035724 Bacteria 2585
639 Ga0373947_0041566 3300035725 Bacteria 2741
640 Ga0373947_0159352 3300035725 Unclassified 1459
641 Ga0373947_0225739 3300035725 Bacteria 1232
642 Ga0373937_0077423 3300036401 Bacteria 3073
643 Ga0316582_0165993 3300036647 Bacteria 1497
644 Ga0373925_0011017 3300037068 Bacteria 6566
645 Ga0373925_0045167 3300037068 Bacteria 3272
646 Ga0373925_0047336 3300037068 Bacteria 3201
647 Ga0373925_0087073 3300037068 Bacteria 2384
648 Ga0395899_0038839 3300037312 Bacteria 3564
649 Ga0395899_0082520 3300037312 Bacteria 2338
650 Ga0395900_0014629 3300037418 Bacteria 8003
651 Ga0395900_0024394 3300037418 Bacteria 6193
652 Ga0395900_0050879 3300037418 Bacteria 4267
653 Ga0395900_0517648 3300037418 Bacteria 1141
654 Ga0395898_0009463 3300037466 Bacteria 10236
655 Ga0395898_0023981 3300037466 Bacteria 6157
656 Ga0395898_0030144 3300037466 Bacteria 5430
657 Ga0395898_0068066 3300037466 Bacteria 3446
658 Ga0395898_0132494 3300037466 Bacteria 2387
659 Ga0395901_0052014 3300038443 Bacteria 4258
660 Ga0395901_0180343 3300038443 Bacteria 2215
661 Ga0395901_0770549 3300038443 Bacteria 953
662 Ga0436360_0512340 3300039438 Bacteria 1707
663 Ga0436363_0863782 3300039450 Bacteria 5485
664 Ga0436362_0872704 3300039453 Bacteria 1076
665 Ga0439455_0060558 3300042012 Bacteria 1003
666 Ga0439464_0010927 3300042439 Bacteria 2400
667 Ga0439460_0002807 3300042461 Bacteria 4194
668 Ga0451577_0110064 3300042876 Bacteria 2464
669 Ga0466963_0267961 3300044694 Bacteria 1200
670 Ga0453684_0033092 3300044712 Bacteria 7214
671 Ga0466957_0050126 3300044842 Bacteria 2540
672 Ga0466967_0184085 3300045976 Bacteria 1972
673 Ga0466967_0217091 3300045976 Bacteria 1816
674 Ga0495617_008378 3300046452 Bacteria 3565
675 Ga0495592_0030221 3300046454 Bacteria 4098
676 Ga0495592_0088238 3300046454 Bacteria 2229
677 Ga0495603_0023238 3300046455 Bacteria 3753
678 Ga0495629_0022575 3300046459 Bacteria 4486
679 Ga0495629_0190023 3300046459 Bacteria 1421
680 Ga0495629_0191748 3300046459 Bacteria 1414
681 Ga0495641_0284007 3300046461 Unclassified 745
682 Ga0495651_0024567 3300046462 Bacteria 4687
683 Ga0495651_0067604 3300046462 Bacteria 2726
684 Ga0495651_0113179 3300046462 Bacteria 2003
685 Ga0495651_0217278 3300046462 Bacteria 1326
686 Ga0495653_0091209 3300046463 Bacteria 2228
687 Ga0495580_0012209 3300046472 Bacteria 6598
688 Ga0495580_0182157 3300046472 Bacteria 1450
689 Ga0495582_0105976 3300046473 Bacteria 1577
690 Ga0495605_0067466 3300046474 Bacteria 1697
691 Ga0495639_0009652 3300046475 Bacteria 4141
692 Ga0495662_0007526 3300046476 Bacteria 5378
693 Ga0495664_0020087 3300046477 Bacteria 3848
694 Ga0495664_0092243 3300046477 Bacteria 1821
695 Ga0495664_0259994 3300046477 Bacteria 1049
696 Ga0495584_0002387 3300046491 Bacteria 10658
697 Ga0495585_0006758 3300046492 Bacteria 7079
698 Ga0495594_0003274 3300046499 Bacteria 8388
699 Ga0495594_0134764 3300046499 Bacteria 1399
700 Ga0495607_0004095 3300046501 Bacteria 10894
701 Ga0495608_0004901 3300046511 Bacteria 9585
702 Ga0495608_0129443 3300046511 Bacteria 1616
703 Ga0495608_0159950 3300046511 Bacteria 1432
704 Ga0495608_0348362 3300046511 Bacteria 912
705 Ga0495608_0435981 3300046511 Bacteria 798
706 Ga0495618_0197332 3300046514 Bacteria 1274
707 Ga0495628_0000249 3300046516 Bacteria 47492
708 Ga0495628_0037161 3300046516 Bacteria 3905
709 Ga0495628_0291751 3300046516 Bacteria 1209
710 Ga0495630_0031426 3300046517 Bacteria 3953
711 Ga0495630_0042795 3300046517 Bacteria 3382
712 Ga0495644_0000563 3300046523 Bacteria 15597
713 Ga0495663_0071740 3300046525 Bacteria 1104
714 Ga0495666_0007295 3300046526 Bacteria 5545
715 Ga0495652_0027838 3300046529 Bacteria 4979
716 Ga0495652_0044789 3300046529 Bacteria 3808
717 Ga0495652_0046742 3300046529 Bacteria 3714
718 Ga0495652_0077412 3300046529 Bacteria 2757
719 Ga0495652_0278058 3300046529 Bacteria 1227
720 Ga0495665_0042064 3300046531 Bacteria 2432
721 Ga0495665_0069679 3300046531 Bacteria 1854
722 Ga0495640_0024501 3300046533 Bacteria 4388
723 Ga0495640_0043942 3300046533 Bacteria 3108
724 Ga0495640_0218567 3300046533 Bacteria 1202
725 Ga0495640_0263127 3300046533 Bacteria 1077
726 Ga0495586_0005125 3300046535 Bacteria 7014
727 Ga0495587_0027576 3300046536 Bacteria 3458
728 Ga0495598_0008777 3300046537 Bacteria 2365
729 Ga0495645_0001006 3300046543 Bacteria 19191
730 Ga0495645_0317106 3300046543 Bacteria 1013
731 Ga0495622_0009107 3300046557 Bacteria 4596
732 Ga0495633_0009862 3300046558 Bacteria 5248
733 Ga0495667_0015258 3300046559 Bacteria 5188
734 Ga0495667_0122831 3300046559 Unclassified 1676
735 Ga0495667_0127270 3300046559 Bacteria 1643
736 Ga0495656_0000123 3300046615 Bacteria 29630
737 Ga0495656_0032264 3300046615 Bacteria 2130
738 Ga0495634_0201777 3300046642 Bacteria 1235
739 Ga0495611_0031419 3300046648 Bacteria 2337
740 Ga0495635_0009801 3300046663 Bacteria 6696
741 Ga0495635_0017843 3300046663 Bacteria 4957
742 Ga0495635_0089336 3300046663 Bacteria 2108
743 Ga0495635_0110448 3300046663 Bacteria 1878
744 Ga0495659_0000648 3300046664 Bacteria 12635
745 Ga0495661_0164897 3300046665 Bacteria 1186
746 Ga0495588_0008051 3300046674 Bacteria 4817
747 Ga0495657_0057935 3300046675 Bacteria 2574
748 Ga0495657_0081193 3300046675 Bacteria 2097
749 Ga0495657_0192064 3300046675 Bacteria 1248
750 Ga0495599_0054244 3300046678 Bacteria 2511
751 Ga0495599_0083707 3300046678 Bacteria 1992
752 Ga0495599_0299090 3300046678 Bacteria 972
753 Ga0495623_0020953 3300046679 Bacteria 4224
754 Ga0495646_0023160 3300046680 Bacteria 3911
755 Ga0495646_0042236 3300046680 Bacteria 2799
756 Ga0495646_0185451 3300046680 Bacteria 1140
757 Ga0495647_0022026 3300046681 Bacteria 2300
758 Ga0495658_0070081 3300046683 Bacteria 2033
759 Ga0495669_0035712 3300046684 Bacteria 2195
760 Ga0495669_0097911 3300046684 Bacteria 1360
761 Ga0495624_0042350 3300046690 Bacteria 2909
762 Ga0495624_0111873 3300046690 Bacteria 1678
763 Ga0495670_0000220 3300046691 Bacteria 25973
764 Ga0495671_0152732 3300046692 Bacteria 1124
765 Ga0495589_0020366 3300046794 Bacteria 3392
766 Ga0495600_0002039 3300046809 Bacteria 11375
767 Ga0495600_0038138 3300046809 Bacteria 3126
768 Ga0495600_0118220 3300046809 Unclassified 1724
769 Ga0495581_0004313 3300047315 Bacteria 8208
770 Ga0495581_0204678 3300047315 Bacteria 1154
771 Ga0495604_0004173 3300047317 Bacteria 11457
772 Ga0495604_0010825 3300047317 Bacteria 7244
773 Ga0495604_0013909 3300047317 Bacteria 6418
774 Ga0495604_0038467 3300047317 Bacteria 3764
775 Ga0495604_0110806 3300047317 Bacteria 2002
776 Ga0495636_0173418 3300047318 Bacteria 976
777 Ga0495674_0024302 3300047319 Bacteria 5569
778 Ga0495674_0088560 3300047319 Bacteria 2647
779 Ga0495674_0099235 3300047319 Bacteria 2479
780 Ga0495674_0131761 3300047319 Bacteria 2106
781 Ga0495674_0191414 3300047319 Bacteria 1700
782 Ga0495676_0061723 3300047321 Bacteria 2930
783 Ga0495680_0034890 3300047322 Bacteria 4057
784 Ga0495680_0080206 3300047322 Bacteria 2466
785 Ga0495680_0448348 3300047322 Bacteria 883
786 Ga0495675_0242353 3300047444 Bacteria 1085
787 Ga0495684_0002684 3300047471 Bacteria 14089
788 Ga0495593_0149038 3300047673 Bacteria 1183
789 Ga0495593_0154193 3300047673 Bacteria 1161
790 Ga0495593_0219393 3300047673 Bacteria 954
791 Ga0495602_0011207 3300048088 Bacteria 9270
792 Ga0495602_0066131 3300048088 Bacteria 3116
793 Ga0495602_0076573 3300048088 Bacteria 2834
794 Ga0495614_0026352 3300048089 Bacteria 2505
795 Ga0496100_0001041 3300048903 Bacteria 13411
796 Ga0496100_0004355 3300048903 Bacteria 7497
797 Ga0496100_0058000 3300048903 Bacteria 2539
798 Ga0496100_0146317 3300048903 Bacteria 1680
799 Ga0496101_0000468 3300048904 Bacteria 25464
800 Ga0496101_0022852 3300048904 Bacteria 4312
801 Ga0496101_0062981 3300048904 Bacteria 2698
802 Ga0496101_0152271 3300048904 Bacteria 1769
803 Ga0496102_0006543 3300048905 Bacteria 9947
804 Ga0496102_0009433 3300048905 Bacteria 8383
805 Ga0496102_0014986 3300048905 Bacteria 6747
806 Ga0496102_0049095 3300048905 Bacteria 3838
807 Ga0496102_0085915 3300048905 Bacteria 2905
808 Ga0496102_0400534 3300048905 Bacteria 1290
809 Ga0496102_0404646 3300048905 Bacteria 1283
810 Ga0496102_0462804 3300048905 Bacteria 1189
811 Ga0496103_0004706 3300048906 Bacteria 8255
812 Ga0496103_0122185 3300048906 Unclassified 1659
813 Ga0496103_0312723 3300048906 Bacteria 1010
814 Ga0496104_0000239 3300048907 Bacteria 48386
815 Ga0496104_0002158 3300048907 Bacteria 17075
816 Ga0496104_0096042 3300048907 Bacteria 2835
817 Ga0496104_0152769 3300048907 Bacteria 2215
818 Ga0496104_0163840 3300048907 Bacteria 2132
819 Ga0496105_0000324 3300048908 Bacteria 31277
820 Ga0496105_0012329 3300048908 Bacteria 6768
821 Ga0496105_0036316 3300048908 Bacteria 4059
822 Ga0496105_0047936 3300048908 Bacteria 3526
823 Ga0496105_0522533 3300048908 Bacteria 929
824 Ga0496105_0547882 3300048908 Bacteria 903
825 Ga0496106_0022981 3300048909 Bacteria 4631
826 Ga0496106_0031663 3300048909 Bacteria 3941
827 Ga0496106_0067044 3300048909 Bacteria 2735
828 Ga0496106_0075506 3300048909 Bacteria 2582
829 Ga0496106_0079869 3300048909 Bacteria 2511
830 Ga0496106_0113829 3300048909 Bacteria 2109
831 Ga0496107_0000965 3300048910 Bacteria 17064
832 Ga0496107_0012402 3300048910 Bacteria 5948
833 Ga0496107_0045438 3300048910 Bacteria 3159
834 Ga0496107_0065092 3300048910 Unclassified 2642
835 Ga0496107_0258830 3300048910 Bacteria 1295
836 Ga0496108_0001543 3300048911 Bacteria 18244
837 Ga0496108_0001911 3300048911 Bacteria 16662
838 Ga0496108_0005663 3300048911 Bacteria 10116
839 Ga0496108_0026989 3300048911 Bacteria 4739
840 Ga0496108_0049695 3300048911 Bacteria 3508
841 Ga0496108_0122672 3300048911 Bacteria 2230
842 Ga0496108_0262208 3300048911 Bacteria 1504
843 Ga0496109_0000414 3300048912 Bacteria 37873
844 Ga0496109_0004282 3300048912 Bacteria 11922
845 Ga0496109_0032054 3300048912 Bacteria 4721
846 Ga0496109_0177843 3300048912 Bacteria 1998
847 Ga0496110_0008470 3300048913 Bacteria 8278
848 Ga0496110_0008902 3300048913 Bacteria 8092
849 Ga0496110_0013604 3300048913 Bacteria 6736
850 Ga0496110_0065165 3300048913 Bacteria 3221
851 Ga0496111_0001884 3300048914 Bacteria 12408
852 Ga0496111_0028377 3300048914 Bacteria 3966
853 Ga0496111_0085077 3300048914 Bacteria 2312
854 Ga0496111_0132403 3300048914 Bacteria 1846
855 Ga0496112_0020521 3300048915 Bacteria 6264
856 Ga0496112_0024544 3300048915 Bacteria 5775
857 Ga0496112_0073867 3300048915 Bacteria 3371
858 Ga0496112_0078691 3300048915 Bacteria 3260
859 Ga0496112_0137954 3300048915 Bacteria 2409
860 Ga0496112_0179269 3300048915 Bacteria 2082
861 Ga0496112_0251695 3300048915 Bacteria 1717
862 Ga0496113_0027002 3300048916 Bacteria 4111
863 Ga0496113_0030381 3300048916 Bacteria 3911
864 Ga0496113_0047579 3300048916 Bacteria 3187
865 Ga0496113_0088736 3300048916 Bacteria 2379
866 Ga0496114_0003058 3300048917 Bacteria 12813
867 Ga0496114_0013686 3300048917 Bacteria 6504
868 Ga0496114_0047654 3300048917 Bacteria 3564
869 Ga0496114_0083433 3300048917 Bacteria 2704
870 Ga0496115_0003980 3300048918 Bacteria 10658
871 Ga0496115_0021595 3300048918 Bacteria 4974
872 Ga0496115_0026545 3300048918 Bacteria 4521
873 Ga0496115_0055608 3300048918 Bacteria 3179
874 Ga0496126_0012762 3300048929 Bacteria 8587
875 Ga0496126_0031507 3300048929 Bacteria 5009
876 Ga0501032_0032946 3300049569 Bacteria 3551
877 Ga0501033_0045165 3300049570 Bacteria 3279
878 Ga0501034_0045067 3300049571 Bacteria 4458
879 Ga0501034_0083273 3300049571 Bacteria 3201
880 Ga0501034_0247642 3300049571 Bacteria 1727
881 Ga0501036_0078814 3300049572 Bacteria 2786
882 Ga0501036_0114523 3300049572 Bacteria 2279
883 Ga0501036_0261705 3300049572 Bacteria 1449
884 Ga0501037_0079639 3300049573 Bacteria 2378
885 Ga0501037_0095810 3300049573 Bacteria 2145
886 Ga0501038_0062312 3300049574 Bacteria 3187
887 Ga0501038_0114841 3300049574 Bacteria 2226
888 Ga0501039_0072917 3300049575 Bacteria 2668
889 Ga0501042_0034896 3300049578 Bacteria 3568
890 Ga0501043_0029465 3300049579 Bacteria 4312
891 Ga0501043_0048574 3300049579 Bacteria 3336
892 Ga0501043_0071429 3300049579 Bacteria 2726
893 Ga0501046_0033511 3300049580 Bacteria 4149
894 Ga0501046_0075628 3300049580 Bacteria 2610
895 Ga0501047_0011528 3300049581 Bacteria 8368
896 Ga0501047_0046098 3300049581 Bacteria 4214
897 Ga0501047_0051298 3300049581 Bacteria 3985
898 Ga0501047_0112358 3300049581 Bacteria 2606
899 Ga0501047_0114461 3300049581 Bacteria 2579
900 Ga0501069_0263236 3300049585 Bacteria 1007
901 Ga0501070_0003250 3300049586 Bacteria 14106
902 Ga0501070_0171230 3300049586 Bacteria 1788
903 Ga0501070_0238056 3300049586 Bacteria 1490
904 Ga0501071_0039005 3300049587 Bacteria 3397
905 Ga0501071_0195842 3300049587 Bacteria 1517
906 Ga0501072_0000327 3300049588 Bacteria 33913
907 Ga0501072_0080592 3300049588 Bacteria 2580
908 Ga0501073_0247978 3300049589 Bacteria 1229
909 Ga0501074_0140243 3300049590 Bacteria 1729
910 Ga0501074_0252901 3300049590 Bacteria 1253
911 Ga0501076_0009353 3300049592 Bacteria 7235
912 Ga0501076_0149669 3300049592 Bacteria 1899
913 Ga0501077_0025325 3300049593 Bacteria 3769
914 Ga0501077_0111132 3300049593 Unclassified 1737
915 Ga0501079_0046174 3300049741 Bacteria 3361
916 Ga0501080_0202684 3300049742 Bacteria 1821
917 Ga0501080_0807015 3300049742 Unclassified 823
918 Ga0501081_0018810 3300049743 Bacteria 4589
919 Ga0501035_0043376 3300049822 Bacteria 4053
920 Ga0501035_0127484 3300049822 Bacteria 2221
921 Ga0501044_0016958 3300049823 Bacteria 7815
922 Ga0501044_0069624 3300049823 Bacteria 3581
923 Ga0501044_0094920 3300049823 Bacteria 3006
924 Ga0501044_0321505 3300049823 Bacteria 1471
925 nmdc:mga00v17_68998_c1 3300050491 Bacteria 2186
926 nmdc:mga04h51_77702_c1 3300050495 Bacteria 1172
927 nmdc:mga07m45_66019_c1 3300050496 Bacteria 2055
928 nmdc:mga05p37_10573_c1 3300050507 Bacteria 10943
929 nmdc:mga05p37_56237_c1 3300050507 Bacteria 4843
930 nmdc:mga05p37_564_c1 3300050507 Bacteria 40786
931 nmdc:mga05p37_863_c1 3300050507 Bacteria 34108
932 nmdc:mga09592_1701_c1 3300050508 Bacteria 17738
933 nmdc:mga09592_7130_c1 3300050508 Bacteria 9087
934 nmdc:mga0qj67_110528_c1 3300050509 Bacteria 2218
935 nmdc:mga0qj67_11539_c1 3300050509 Bacteria 6622
936 nmdc:mga0qj67_245347_c1 3300050509 Bacteria 1453
937 nmdc:mga0qj67_2984_c1 3300050509 Bacteria 12144
938 nmdc:mga06r32_157181_c1 3300050510 Bacteria 2255
939 nmdc:mga06r32_191_c1 3300050510 Bacteria 49056
940 nmdc:mga06r32_40426_c1 3300050510 Bacteria 4427
941 nmdc:mga06r32_6584_c1 3300050510 Bacteria 10438
942 nmdc:mga08y16_13856_c1 3300050511 Bacteria 8486
943 nmdc:mga08y16_2133_c1 3300050511 Bacteria 20270
944 nmdc:mga08y16_3076_c1 3300050511 Bacteria 17248
945 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
946 nmdc:mga0n895_104046_c1 3300050512 Bacteria 2851
947 nmdc:mga0n895_141086_c1 3300050512 Bacteria 2438
948 nmdc:mga0n895_164171_c1 3300050512 Bacteria 2252
949 nmdc:mga0n895_335732_c1 3300050512 Bacteria 1531
950 nmdc:mga0n895_359762_c1 3300050512 Bacteria 1474
951 nmdc:mga0n895_427_c1 3300050512 Bacteria 28261
952 nmdc:mga0n895_55_c1 3300050512 Bacteria 66529
953 nmdc:mga0rr50_18205_c1 3300050513 Bacteria 4713
954 nmdc:mga08x19_312426_c1 3300050514 Bacteria 1093
955 nmdc:mga08x19_328919_c1 3300050514 Bacteria 1064
956 nmdc:mga08x19_502317_c1 3300050514 Bacteria 856
957 nmdc:mga0a205_172246_c1 3300050515 Bacteria 2060
958 nmdc:mga0a205_182379_c1 3300050515 Bacteria 1293
959 nmdc:mga0a205_2491_c1 3300050515 Bacteria 16230
960 nmdc:mga0a205_768_c4 3300050515 Bacteria 16460
961 Ga0495601_0001987 3300053077 Bacteria 11450
962 Ga0495601_0002541 3300053077 Bacteria 10366
963 Ga0495601_0136587 3300053077 Bacteria 1598
964 Ga0495612_0000243 3300053078 Bacteria 22586
965 Ga0495612_0004160 3300053078 Bacteria 5997
966 Ga0495612_0004394 3300053078 Bacteria 5846
967 Ga0495612_0036364 3300053078 Bacteria 1998
968 Ga0495612_0046566 3300053078 Bacteria 1776
969 Ga0495612_0075269 3300053078 Bacteria 1413
970 Ga0495612_0230998 3300053078 Bacteria 820
971 Ga0495595_0002469 3300053084 Bacteria 7232
972 Ga0495595_0003265 3300053084 Bacteria 6438
973 Ga0495595_0024157 3300053084 Bacteria 2682
974 Ga0495595_0051776 3300053084 Bacteria 1904
975 Ga0495619_0000139 3300053085 Bacteria 54165
976 Ga0495619_0000365 3300053085 Bacteria 31256
977 Ga0495619_0001830 3300053085 Bacteria 14136
978 Ga0495619_0049976 3300053085 Bacteria 2758
979 Ga0495619_0087833 3300053085 Bacteria 2102
980 Ga0500651_0082357 3300053093 Bacteria 1992
981 Ga0500566_0056682 3300053094 Bacteria 2227
982 Ga0500566_0203336 3300053094 Bacteria 998
983 Ga0500595_000001 3300053119 Bacteria 1088438
984 Ga0500597_030314 3300053120 Bacteria 2222
985 Ga0500588_0069003 3300053146 Bacteria 1154
986 Ga0500616_0000001 3300053153 Bacteria 1986011
987 Ga0500645_000109 3300053730 Bacteria 65892
988 Ga0501084_0268486 3300054114 Bacteria 1440
989 Ga0501084_0312396 3300054114 Bacteria 1327
990 Ga0501082_0042848 3300060353 Bacteria 3902
991 Ga0501082_0736449 3300060353 Bacteria 863
992 Ga0530510_0029878 3300061734 Bacteria 3913

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100340020 Ga0075431_1003400202 228
2 3300050509 nmdc:mga0qj67_110528_c1 nmdc:mga0qj67_110528_c1_1029_1736 228
3 3300050510 nmdc:mga06r32_157181_c1 nmdc:mga06r32_157181_c1_1287_1994 228
4 3300002244 JGI24742J22300_10037906 JGI24742J22300_100379061 229
5 3300005327 Ga0070658_10104725 Ga0070658_101047252 229
6 3300005336 Ga0070680_100006824 Ga0070680_1000068246 229
7 3300005356 Ga0070674_100152054 Ga0070674_1001520542 229
8 3300005435 Ga0070714_100083608 Ga0070714_1000836083 229
9 3300005436 Ga0070713_100046678 Ga0070713_1000466783 229
10 3300005437 Ga0070710_10052551 Ga0070710_100525511 229
11 3300005458 Ga0070681_10138950 Ga0070681_101389503 229
12 3300005530 Ga0070679_100026139 Ga0070679_1000261392 229
13 3300005530 Ga0070679_100411166 Ga0070679_1004111661 229
14 3300005536 Ga0070697_100029029 Ga0070697_1000290291 229
15 3300005549 Ga0070704_100519222 Ga0070704_1005192221 229
16 3300005563 Ga0068855_100028402 Ga0068855_1000284024 229
17 3300005563 Ga0068855_100282059 Ga0068855_1002820592 229
18 3300005578 Ga0068854_100023441 Ga0068854_1000234416 229
19 3300005614 Ga0068856_100044864 Ga0068856_1000448642 229
20 3300005615 Ga0070702_100055057 Ga0070702_1000550572 229
21 3300005616 Ga0068852_100273214 Ga0068852_1002732142 229
22 3300006028 Ga0070717_10258285 Ga0070717_102582851 229
23 3300006163 Ga0070715_10113475 Ga0070715_101134751 229
24 3300006175 Ga0070712_100101908 Ga0070712_1001019082 229
25 3300006914 Ga0075436_100124736 Ga0075436_1001247362 229
26 3300009093 Ga0105240_10025356 Ga0105240_100253566 229
27 3300009093 Ga0105240_10683975 Ga0105240_106839752 229
28 3300009098 Ga0105245_10169095 Ga0105245_101690952 229
29 3300009551 Ga0105238_10252634 Ga0105238_102526341 229
30 3300013100 Ga0157373_10065420 Ga0157373_100654203 229
31 3300013102 Ga0157371_10157646 Ga0157371_101576462 229
32 3300013104 Ga0157370_10036546 Ga0157370_100365466 229
33 3300013104 Ga0157370_10146110 Ga0157370_101461102 229
34 3300013105 Ga0157369_10933449 Ga0157369_109334491 229
35 3300013297 Ga0157378_10160446 Ga0157378_101604462 229
36 3300013308 Ga0157375_10074284 Ga0157375_100742843 229
37 3300014326 Ga0157380_10288493 Ga0157380_102884932 229
38 3300017792 Ga0163161_10033750 Ga0163161_100337502 229
39 3300020075 Ga0206349_1289062 Ga0206349_12890621 229
40 3300020076 Ga0206355_1562117 Ga0206355_15621171 229
41 3300022467 Ga0224712_10159689 Ga0224712_101596891 229
42 3300025898 Ga0207692_10010391 Ga0207692_100103912 229
43 3300025904 Ga0207647_10207656 Ga0207647_102076561 229
44 3300025905 Ga0207685_10128141 Ga0207685_101281411 229
45 3300025909 Ga0207705_10082423 Ga0207705_100824232 229
46 3300025909 Ga0207705_10129060 Ga0207705_101290602 229
47 3300025912 Ga0207707_10613850 Ga0207707_106138502 229
48 3300025915 Ga0207693_10090878 Ga0207693_100908781 229
49 3300025919 Ga0207657_10036176 Ga0207657_100361764 229
50 3300025921 Ga0207652_10246694 Ga0207652_102466942 229
51 3300025924 Ga0207694_10281115 Ga0207694_102811152 229
52 3300025928 Ga0207700_10106154 Ga0207700_101061542 229
53 3300025929 Ga0207664_10004485 Ga0207664_1000448512 229
54 3300025931 Ga0207644_10165940 Ga0207644_101659401 229
55 3300025932 Ga0207690_10061152 Ga0207690_100611523 229
56 3300025935 Ga0207709_10131708 Ga0207709_101317081 229
57 3300025939 Ga0207665_10074058 Ga0207665_100740581 229
58 3300025940 Ga0207691_10432516 Ga0207691_104325162 229
59 3300025960 Ga0207651_10508059 Ga0207651_105080591 229
60 3300026118 Ga0207675_101229104 Ga0207675_1012291041 229
61 3300026121 Ga0207683_10461918 Ga0207683_104619182 229
62 3300031616 Ga0307508_10221054 Ga0307508_102210542 229
63 3300037068 Ga0373925_0087073 Ga0373925_0087073_1218_1922 229
64 3300037312 Ga0395899_0082520 Ga0395899_0082520_1040_1744 229
65 3300037418 Ga0395900_0517648 Ga0395900_0517648_84_788 229
66 3300037466 Ga0395898_0068066 Ga0395898_0068066_1300_2004 229
67 3300038443 Ga0395901_0052014 Ga0395901_0052014_1644_2348 229
68 3300039450 Ga0436363_0863782 Ga0436363_0863782_4694_5398 229
69 3300046477 Ga0495664_0092243 Ga0495664_0092243_264_968 229
70 3300046529 Ga0495652_0278058 Ga0495652_0278058_99_803 229
71 3300046531 Ga0495665_0069679 Ga0495665_0069679_515_1219 229
72 3300046615 Ga0495656_0032264 Ga0495656_0032264_1010_1714 229
73 3300046678 Ga0495599_0299090 Ga0495599_0299090_156_860 229
74 3300046680 Ga0495646_0185451 Ga0495646_0185451_108_812 229
75 3300047319 Ga0495674_0191414 Ga0495674_0191414_351_1055 229
76 3300048904 Ga0496101_0062981 Ga0496101_0062981_156_860 229
77 3300048905 Ga0496102_0404646 Ga0496102_0404646_29_733 229
78 3300048909 Ga0496106_0113829 Ga0496106_0113829_709_1413 229
79 3300048910 Ga0496107_0258830 Ga0496107_0258830_434_1138 229
80 3300048915 Ga0496112_0179269 Ga0496112_0179269_1282_1986 229
81 3300048929 Ga0496126_0012762 Ga0496126_0012762_3500_4204 229
82 3300049569 Ga0501032_0032946 Ga0501032_0032946_761_1465 229
83 3300049570 Ga0501033_0045165 Ga0501033_0045165_1243_1947 229
84 3300049571 Ga0501034_0045067 Ga0501034_0045067_3163_3867 229
85 3300049572 Ga0501036_0078814 Ga0501036_0078814_637_1341 229
86 3300049572 Ga0501036_0261705 Ga0501036_0261705_93_797 229
87 3300049573 Ga0501037_0095810 Ga0501037_0095810_935_1639 229
88 3300049574 Ga0501038_0062312 Ga0501038_0062312_622_1326 229
89 3300049579 Ga0501043_0029465 Ga0501043_0029465_1690_2394 229
90 3300049579 Ga0501043_0048574 Ga0501043_0048574_2043_2747 229
91 3300049580 Ga0501046_0033511 Ga0501046_0033511_2525_3229 229
92 3300049580 Ga0501046_0075628 Ga0501046_0075628_1480_2184 229
93 3300049581 Ga0501047_0046098 Ga0501047_0046098_2760_3464 229
94 3300049581 Ga0501047_0112358 Ga0501047_0112358_1785_2489 229
95 3300049586 Ga0501070_0003250 Ga0501070_0003250_9217_9921 229
96 3300049586 Ga0501070_0238056 Ga0501070_0238056_345_1049 229
97 3300049590 Ga0501074_0140243 Ga0501074_0140243_446_1150 229
98 3300049590 Ga0501074_0252901 Ga0501074_0252901_320_1024 229
99 3300049822 Ga0501035_0043376 Ga0501035_0043376_1464_2168 229
100 3300049823 Ga0501044_0094920 Ga0501044_0094920_1373_2077 229
101 3300049823 Ga0501044_0321505 Ga0501044_0321505_457_1161 229
102 3300050491 nmdc:mga00v17_68998_c1 nmdc:mga00v17_68998_c1_701_1405 229
103 3300050512 nmdc:mga0n895_359762_c1 nmdc:mga0n895_359762_c1_438_1148 229
104 3300050514 nmdc:mga08x19_312426_c1 nmdc:mga08x19_312426_c1_47_751 229
105 3300053078 Ga0495612_0046566 Ga0495612_0046566_400_1104 229
106 3300053078 Ga0495612_0230998 Ga0495612_0230998_64_768 229
107 3300053084 Ga0495595_0051776 Ga0495595_0051776_246_950 229
108 3300005614 Ga0068856_100585502 Ga0068856_1005855021 230
109 3300005616 Ga0068852_100424644 Ga0068852_1004246443 230
110 3300009093 Ga0105240_10187355 Ga0105240_101873553 230
111 3300009545 Ga0105237_10439885 Ga0105237_104398852 230
112 3300013104 Ga0157370_10152946 Ga0157370_101529462 230
113 3300013105 Ga0157369_10003829 Ga0157369_100038297 230
114 3300013105 Ga0157369_10018011 Ga0157369_100180118 230
115 3300013307 Ga0157372_10084220 Ga0157372_100842202 230
116 3300020069 Ga0197907_10366928 Ga0197907_103669281 230
117 3300020070 Ga0206356_11492982 Ga0206356_114929822 230
118 3300020075 Ga0206349_1903841 Ga0206349_19038411 230
119 3300020080 Ga0206350_10159323 Ga0206350_101593231 230
120 3300020080 Ga0206350_10981810 Ga0206350_109818101 230
121 3300020082 Ga0206353_12065215 Ga0206353_120652151 230
122 3300022467 Ga0224712_10075688 Ga0224712_100756882 230
123 3300025904 Ga0207647_10062165 Ga0207647_100621652 230
124 3300025913 Ga0207695_10201924 Ga0207695_102019242 230
125 3300025914 Ga0207671_10084027 Ga0207671_100840274 230
126 3300025949 Ga0207667_10266021 Ga0207667_102660212 230
127 3300026067 Ga0207678_10402971 Ga0207678_104029711 230
128 3300026078 Ga0207702_10502107 Ga0207702_105021072 230
129 3300026116 Ga0207674_10743219 Ga0207674_107432192 230
130 3300037418 Ga0395900_0050879 Ga0395900_0050879_859_1566 230
131 3300037466 Ga0395898_0023981 Ga0395898_0023981_449_1156 230
132 3300038443 Ga0395901_0180343 Ga0395901_0180343_368_1075 230
133 3300039438 Ga0436360_0512340 Ga0436360_0512340_981_1688 230
134 3300045976 Ga0466967_0184085 Ga0466967_0184085_1185_1892 230
135 3300048929 Ga0496126_0031507 Ga0496126_0031507_1970_2677 230
136 3300006846 Ga0075430_100236073 Ga0075430_1002360732 231
137 3300006847 Ga0075431_100044521 Ga0075431_1000445214 231
138 3300048905 Ga0496102_0462804 Ga0496102_0462804_280_996 231
139 3300049572 Ga0501036_0114523 Ga0501036_0114523_1556_2263 231
140 3300049587 Ga0501071_0195842 Ga0501071_0195842_243_947 231
141 3300049588 Ga0501072_0000327 Ga0501072_0000327_8657_9358 231
142 3300050509 nmdc:mga0qj67_245347_c1 nmdc:mga0qj67_245347_c1_224_928 231
143 3300050510 nmdc:mga06r32_40426_c1 nmdc:mga06r32_40426_c1_1204_1908 231
144 3300054114 Ga0501084_0268486 Ga0501084_0268486_21_722 231
145 3300005434 Ga0070709_10126242 Ga0070709_101262422 232
146 3300005545 Ga0070695_100061785 Ga0070695_1000617852 232
147 3300005548 Ga0070665_100192052 Ga0070665_1001920521 232
148 3300005843 Ga0068860_100106844 Ga0068860_1001068442 232
149 3300006173 Ga0070716_100546627 Ga0070716_1005466271 232
150 3300006358 Ga0068871_100193103 Ga0068871_1001931032 232
151 3300006914 Ga0075436_100198928 Ga0075436_1001989282 232
152 3300009176 Ga0105242_10027423 Ga0105242_100274234 232
153 3300009177 Ga0105248_10021356 Ga0105248_100213562 232
154 3300013297 Ga0157378_10220471 Ga0157378_102204712 232
155 3300014968 Ga0157379_10238046 Ga0157379_102380461 232
156 3300017792 Ga0163161_10420833 Ga0163161_104208331 232
157 3300025931 Ga0207644_10003846 Ga0207644_1000384610 232
158 3300025934 Ga0207686_10009933 Ga0207686_100099334 232
159 3300025941 Ga0207711_10025052 Ga0207711_100250524 232
160 3300026088 Ga0207641_10332482 Ga0207641_103324822 232
161 3300028381 Ga0268264_10099215 Ga0268264_100992154 232
162 3300035088 Ga0373940_0006230 Ga0373940_0006230_591_1304 232
163 3300035090 Ga0373949_0014010 Ga0373949_0014010_421_1134 232
164 3300035121 Ga0373960_0003781 Ga0373960_0003781_1976_2689 232
165 3300035241 Ga0373961_0002998 Ga0373961_0002998_2114_2821 232
166 3300035691 Ga0373931_0007900 Ga0373931_0007900_1091_1804 232
167 3300035692 Ga0373935_0138609 Ga0373935_0138609_515_1222 232
168 3300035695 Ga0373927_0089079 Ga0373927_0089079_709_1416 232
169 3300035725 Ga0373947_0225739 Ga0373947_0225739_410_1117 232
170 3300048904 Ga0496101_0022852 Ga0496101_0022852_2427_3140 232
171 3300048905 Ga0496102_0049095 Ga0496102_0049095_1064_1777 232
172 3300048908 Ga0496105_0012329 Ga0496105_0012329_1695_2408 232
173 3300048909 Ga0496106_0031663 Ga0496106_0031663_1221_1934 232
174 3300048911 Ga0496108_0026989 Ga0496108_0026989_1559_2272 232
175 3300048912 Ga0496109_0032054 Ga0496109_0032054_2546_3259 232
176 3300048913 Ga0496110_0008902 Ga0496110_0008902_1238_1951 232
177 3300048914 Ga0496111_0001884 Ga0496111_0001884_918_1631 232
178 3300048915 Ga0496112_0078691 Ga0496112_0078691_75_788 232
179 3300048915 Ga0496112_0251695 Ga0496112_0251695_249_962 232
180 3300048916 Ga0496113_0030381 Ga0496113_0030381_1235_1948 232
181 3300048917 Ga0496114_0047654 Ga0496114_0047654_909_1622 232
182 3300048917 Ga0496114_0083433 Ga0496114_0083433_1583_2287 232
183 3300048918 Ga0496115_0021595 Ga0496115_0021595_3583_4296 232
184 3300050514 nmdc:mga08x19_328919_c1 nmdc:mga08x19_328919_c1_157_861 232
185 3300060353 Ga0501082_0736449 Ga0501082_0736449_132_833 232
186 3300005327 Ga0070658_10023948 Ga0070658_100239483 233
187 3300005328 Ga0070676_10044695 Ga0070676_100446952 233
188 3300005329 Ga0070683_100492435 Ga0070683_1004924351 233
189 3300005331 Ga0070670_100061527 Ga0070670_1000615275 233
190 3300005335 Ga0070666_10036624 Ga0070666_100366242 233
191 3300005336 Ga0070680_100006151 Ga0070680_10000615110 233
192 3300005337 Ga0070682_100028819 Ga0070682_1000288193 233
193 3300005353 Ga0070669_100099770 Ga0070669_1000997703 233
194 3300005364 Ga0070673_100003993 Ga0070673_1000039932 233
195 3300005364 Ga0070673_100143366 Ga0070673_1001433662 233
196 3300005434 Ga0070709_10115253 Ga0070709_101152532 233
197 3300005438 Ga0070701_10231941 Ga0070701_102319412 233
198 3300005439 Ga0070711_100136679 Ga0070711_1001366792 233
199 3300005455 Ga0070663_100659985 Ga0070663_1006599851 233
200 3300005458 Ga0070681_10004156 Ga0070681_1000415615 233
201 3300005530 Ga0070679_100092785 Ga0070679_1000927853 233
202 3300005543 Ga0070672_100182207 Ga0070672_1001822072 233
203 3300005548 Ga0070665_100067415 Ga0070665_1000674152 233
204 3300005549 Ga0070704_100238536 Ga0070704_1002385361 233
205 3300006051 Ga0075364_10132626 Ga0075364_101326261 233
206 3300006173 Ga0070716_100044339 Ga0070716_1000443393 233
207 3300006175 Ga0070712_100036458 Ga0070712_1000364582 233
208 3300006844 Ga0075428_100000606 Ga0075428_1000006068 233
209 3300006847 Ga0075431_100000032 Ga0075431_10000003246 233
210 3300006880 Ga0075429_100008370 Ga0075429_1000083709 233
211 3300006914 Ga0075436_100067544 Ga0075436_1000675441 233
212 3300007076 Ga0075435_100356880 Ga0075435_1003568802 233
213 3300007788 Ga0099795_10000764 Ga0099795_100007644 233
214 3300009094 Ga0111539_10001089 Ga0111539_100010899 233
215 3300009147 Ga0114129_10000062 Ga0114129_1000006231 233
216 3300009176 Ga0105242_10147453 Ga0105242_101474533 233
217 3300009177 Ga0105248_10200987 Ga0105248_102009871 233
218 3300010159 Ga0099796_10001065 Ga0099796_100010655 233
219 3300011119 Ga0105246_10452631 Ga0105246_104526311 233
220 3300013296 Ga0157374_10421034 Ga0157374_104210341 233
221 3300014325 Ga0163163_10012546 Ga0163163_100125469 233
222 3300021384 Ga0213876_10004643 Ga0213876_100046435 233
223 3300025900 Ga0207710_10000734 Ga0207710_1000073415 233
224 3300025903 Ga0207680_10006073 Ga0207680_100060734 233
225 3300025905 Ga0207685_10048525 Ga0207685_100485252 233
226 3300025906 Ga0207699_10375280 Ga0207699_103752802 233
227 3300025907 Ga0207645_10071014 Ga0207645_100710142 233
228 3300025909 Ga0207705_10076009 Ga0207705_100760093 233
229 3300025912 Ga0207707_10027709 Ga0207707_100277095 233
230 3300025915 Ga0207693_10022497 Ga0207693_100224976 233
231 3300025916 Ga0207663_10143548 Ga0207663_101435482 233
232 3300025917 Ga0207660_10059620 Ga0207660_100596202 233
233 3300025920 Ga0207649_10074397 Ga0207649_100743973 233
234 3300025920 Ga0207649_10081876 Ga0207649_100818762 233
235 3300025925 Ga0207650_10048796 Ga0207650_100487962 233
236 3300025926 Ga0207659_10084817 Ga0207659_100848173 233
237 3300025929 Ga0207664_10110426 Ga0207664_101104262 233
238 3300025936 Ga0207670_10392124 Ga0207670_103921241 233
239 3300025939 Ga0207665_10015564 Ga0207665_100155645 233
240 3300025940 Ga0207691_10074325 Ga0207691_100743252 233
241 3300025960 Ga0207651_10013274 Ga0207651_100132745 233
242 3300027512 Ga0209179_1000922 Ga0209179_10009222 233
243 3300027907 Ga0207428_10013177 Ga0207428_100131777 233
244 3300027907 Ga0207428_10209604 Ga0207428_102096042 233
245 3300028379 Ga0268266_10045032 Ga0268266_100450323 233
246 3300030760 Ga0265762_1002070 Ga0265762_10020703 233
247 3300035119 Ga0373956_0034112 Ga0373956_0034112_1403_2110 233
248 3300035170 Ga0373943_0098150 Ga0373943_0098150_112_819 233
249 3300035172 Ga0373955_0050566 Ga0373955_0050566_1528_2235 233
250 3300035410 Ga0373924_0025342 Ga0373924_0025342_776_1483 233
251 3300035724 Ga0373933_0007699 Ga0373933_0007699_1204_1911 233
252 3300037068 Ga0373925_0047336 Ga0373925_0047336_1248_1955 233
253 3300039453 Ga0436362_0872704 Ga0436362_0872704_160_867 233
254 3300046454 Ga0495592_0088238 Ga0495592_0088238_954_1661 233
255 3300046459 Ga0495629_0022575 Ga0495629_0022575_961_1668 233
256 3300046462 Ga0495651_0113179 Ga0495651_0113179_316_1023 233
257 3300046463 Ga0495653_0091209 Ga0495653_0091209_756_1463 233
258 3300046473 Ga0495582_0105976 Ga0495582_0105976_235_942 233
259 3300046511 Ga0495608_0159950 Ga0495608_0159950_277_984 233
260 3300046514 Ga0495618_0197332 Ga0495618_0197332_308_1015 233
261 3300046516 Ga0495628_0037161 Ga0495628_0037161_1390_2097 233
262 3300046529 Ga0495652_0044789 Ga0495652_0044789_2114_2821 233
263 3300046533 Ga0495640_0218567 Ga0495640_0218567_90_797 233
264 3300046536 Ga0495587_0027576 Ga0495587_0027576_1371_2078 233
265 3300046559 Ga0495667_0127270 Ga0495667_0127270_444_1151 233
266 3300046642 Ga0495634_0201777 Ga0495634_0201777_271_978 233
267 3300046675 Ga0495657_0192064 Ga0495657_0192064_368_1075 233
268 3300046678 Ga0495599_0054244 Ga0495599_0054244_1066_1773 233
269 3300046679 Ga0495623_0020953 Ga0495623_0020953_959_1666 233
270 3300046680 Ga0495646_0023160 Ga0495646_0023160_1860_2567 233
271 3300047317 Ga0495604_0013909 Ga0495604_0013909_1715_2422 233
272 3300047319 Ga0495674_0099235 Ga0495674_0099235_398_1105 233
273 3300047444 Ga0495675_0242353 Ga0495675_0242353_40_747 233
274 3300048088 Ga0495602_0066131 Ga0495602_0066131_1265_1972 233
275 3300048903 Ga0496100_0058000 Ga0496100_0058000_569_1276 233
276 3300048905 Ga0496102_0400534 Ga0496102_0400534_445_1152 233
277 3300048907 Ga0496104_0152769 Ga0496104_0152769_650_1390 233
278 3300048907 Ga0496104_0163840 Ga0496104_0163840_156_863 233
279 3300048908 Ga0496105_0522533 Ga0496105_0522533_201_908 233
280 3300048909 Ga0496106_0067044 Ga0496106_0067044_1051_1758 233
281 3300048911 Ga0496108_0262208 Ga0496108_0262208_589_1296 233
282 3300048912 Ga0496109_0177843 Ga0496109_0177843_591_1298 233
283 3300048914 Ga0496111_0132403 Ga0496111_0132403_108_815 233
284 3300048915 Ga0496112_0024544 Ga0496112_0024544_478_1185 233
285 3300048915 Ga0496112_0137954 Ga0496112_0137954_1656_2363 233
286 3300048916 Ga0496113_0088736 Ga0496113_0088736_438_1145 233
287 3300050507 nmdc:mga05p37_564_c1 nmdc:mga05p37_564_c1_13439_14146 233
288 3300050508 nmdc:mga09592_7130_c1 nmdc:mga09592_7130_c1_6868_7575 233
289 3300050509 nmdc:mga0qj67_11539_c1 nmdc:mga0qj67_11539_c1_4409_5116 233
290 3300050510 nmdc:mga06r32_191_c1 nmdc:mga06r32_191_c1_38769_39476 233
291 3300050511 nmdc:mga08y16_89_c1 nmdc:mga08y16_89_c1_64285_64992 233
292 3300050512 nmdc:mga0n895_141086_c1 nmdc:mga0n895_141086_c1_1317_2024 233
293 3300050515 nmdc:mga0a205_172246_c1 nmdc:mga0a205_172246_c1_642_1382 233
294 3300053077 Ga0495601_0136587 Ga0495601_0136587_739_1446 233
295 3300053078 Ga0495612_0036364 Ga0495612_0036364_910_1617 233
296 3300053084 Ga0495595_0024157 Ga0495595_0024157_1205_1912 233
297 3300053085 Ga0495619_0087833 Ga0495619_0087833_1276_1983 233
298 iso_pu_bacteria 2643221547 2643757999 233
299 3300005336 Ga0070680_100160088 Ga0070680_1001600882 234
300 3300005340 Ga0070689_100312406 Ga0070689_1003124061 234
301 3300005456 Ga0070678_100156523 Ga0070678_1001565232 234
302 3300005466 Ga0070685_10002009 Ga0070685_100020098 234
303 3300005530 Ga0070679_100062681 Ga0070679_1000626813 234
304 3300005544 Ga0070686_100104167 Ga0070686_1001041672 234
305 3300005547 Ga0070693_100216369 Ga0070693_1002163692 234
306 3300005618 Ga0068864_100072770 Ga0068864_1000727703 234
307 3300006028 Ga0070717_10001460 Ga0070717_100014605 234
308 3300006237 Ga0097621_100038046 Ga0097621_1000380464 234
309 3300025321 Ga0207656_10061318 Ga0207656_100613182 234
310 3300025915 Ga0207693_10002937 Ga0207693_100029374 234
311 3300025917 Ga0207660_10101559 Ga0207660_101015592 234
312 3300025925 Ga0207650_10072156 Ga0207650_100721562 234
313 3300025940 Ga0207691_10043594 Ga0207691_100435942 234
314 3300025944 Ga0207661_10064885 Ga0207661_100648851 234
315 3300026121 Ga0207683_10001459 Ga0207683_100014597 234
316 3300028379 Ga0268266_10006553 Ga0268266_100065538 234
317 3300031344 Ga0265316_10037941 Ga0265316_100379414 234
318 3300044694 Ga0466963_0267961 Ga0466963_0267961_238_984 234
319 3300045976 Ga0466967_0217091 Ga0466967_0217091_456_1202 234
320 3300049574 Ga0501038_0114841 Ga0501038_0114841_623_1435 234
321 3300049575 Ga0501039_0072917 Ga0501039_0072917_169_981 234
322 3300049579 Ga0501043_0071429 Ga0501043_0071429_30_842 234
323 3300049581 Ga0501047_0114461 Ga0501047_0114461_510_1322 234
324 3300049586 Ga0501070_0171230 Ga0501070_0171230_430_1242 234
325 3300049589 Ga0501073_0247978 Ga0501073_0247978_193_1005 234
326 3300005981 Ga0081538_10006434 Ga0081538_100064347 235
327 3300005983 Ga0081540_1008868 Ga0081540_10088685 235
328 3300009147 Ga0114129_10158612 Ga0114129_101586123 235
329 3300009176 Ga0105242_10938996 Ga0105242_109389962 235
330 3300014969 Ga0157376_10790483 Ga0157376_107904831 235
331 3300026023 Ga0207677_10073595 Ga0207677_100735952 235
332 3300031995 Ga0307409_100720905 Ga0307409_1007209051 235
333 3300050507 nmdc:mga05p37_56237_c1 nmdc:mga05p37_56237_c1_3735_4448 235
334 3300053120 Ga0500597_030314 Ga0500597_030314_566_1282 235
335 3300005458 Ga0070681_10302823 Ga0070681_103028232 236
336 3300005530 Ga0070679_100413814 Ga0070679_1004138142 236
337 3300031241 Ga0265325_10169954 Ga0265325_101699541 236
338 3300031344 Ga0265316_10114806 Ga0265316_101148062 236
339 3300031711 Ga0265314_10088533 Ga0265314_100885332 236
340 3300037312 Ga0395899_0038839 Ga0395899_0038839_1590_2327 236
341 3300037418 Ga0395900_0014629 Ga0395900_0014629_4492_5229 236
342 3300037418 Ga0395900_0024394 Ga0395900_0024394_2492_3229 236
343 3300037466 Ga0395898_0009463 Ga0395898_0009463_3989_4726 236
344 3300037466 Ga0395898_0030144 Ga0395898_0030144_2309_3046 236
345 3300037466 Ga0395898_0132494 Ga0395898_0132494_64_801 236
346 3300038443 Ga0395901_0770549 Ga0395901_0770549_195_932 236
347 3300046516 Ga0495628_0291751 Ga0495628_0291751_187_903 236
348 3300053078 Ga0495612_0075269 Ga0495612_0075269_94_810 236
349 3300053146 Ga0500588_0069003 Ga0500588_0069003_102_818 236
350 3300028556 Ga0265337_1001317 Ga0265337_100131715 237
351 3300031249 Ga0265339_10109301 Ga0265339_101093012 237
352 3300031344 Ga0265316_10230703 Ga0265316_102307032 237
353 3300035119 Ga0373956_0184022 Ga0373956_0184022_251_964 237
354 3300046462 Ga0495651_0217278 Ga0495651_0217278_314_1027 237
355 3300046543 Ga0495645_0317106 Ga0495645_0317106_262_975 237
356 3300049571 Ga0501034_0247642 Ga0501034_0247642_934_1650 237
357 3300050507 nmdc:mga05p37_10573_c1 nmdc:mga05p37_10573_c1_4136_4849 237
358 3300050513 nmdc:mga0rr50_18205_c1 nmdc:mga0rr50_18205_c1_1954_2667 237
359 3300053093 Ga0500651_0082357 Ga0500651_0082357_575_1291 237
360 3300053094 Ga0500566_0056682 Ga0500566_0056682_807_1523 237
361 3300053119 Ga0500595_000001 Ga0500595_000001_776332_777048 237
362 3300053153 Ga0500616_0000001 Ga0500616_0000001_1203475_1204191 237
363 3300053730 Ga0500645_000109 Ga0500645_000109_35370_36086 237
364 3300001915 JGI24741J21665_1005876 JGI24741J21665_10058762 238
365 3300001977 JGI24746J21847_1001040 JGI24746J21847_10010406 238
366 3300001979 JGI24740J21852_10021705 JGI24740J21852_100217052 238
367 3300001989 JGI24739J22299_10009366 JGI24739J22299_100093663 238
368 3300001990 JGI24737J22298_10000349 JGI24737J22298_100003495 238
369 3300001991 JGI24743J22301_10001914 JGI24743J22301_100019142 238
370 3300002070 JGI24750J21931_1000065 JGI24750J21931_10000653 238
371 3300002073 JGI24745J21846_1000050 JGI24745J21846_10000509 238
372 3300002074 JGI24748J21848_1000906 JGI24748J21848_10009062 238
373 3300002075 JGI24738J21930_10000803 JGI24738J21930_1000080312 238
374 3300002126 JGI24035J26624_1000006 JGI24035J26624_10000063 238
375 3300002239 JGI24034J26672_10000266 JGI24034J26672_100002666 238
376 3300002244 JGI24742J22300_10000073 JGI24742J22300_100000733 238
377 3300003371 JGI26145J50221_1000700 JGI26145J50221_10007002 238
378 3300005289 Ga0065704_10084127 Ga0065704_100841272 238
379 3300005289 Ga0065704_10170228 Ga0065704_101702282 238
380 3300005293 Ga0065715_10009479 Ga0065715_100094793 238
381 3300005327 Ga0070658_10008449 Ga0070658_100084493 238
382 3300005328 Ga0070676_10000360 Ga0070676_100003602 238
383 3300005329 Ga0070683_100003076 Ga0070683_10000307613 238
384 3300005330 Ga0070690_100210654 Ga0070690_1002106542 238
385 3300005331 Ga0070670_100000827 Ga0070670_10000082710 238
386 3300005333 Ga0070677_10034861 Ga0070677_100348612 238
387 3300005334 Ga0068869_100000013 Ga0068869_10000001315 238
388 3300005335 Ga0070666_10024413 Ga0070666_100244134 238
389 3300005336 Ga0070680_100002249 Ga0070680_10000224913 238
390 3300005336 Ga0070680_100002907 Ga0070680_1000029072 238
391 3300005336 Ga0070680_100088277 Ga0070680_1000882773 238
392 3300005337 Ga0070682_100001195 Ga0070682_10000119515 238
393 3300005337 Ga0070682_100093427 Ga0070682_1000934271 238
394 3300005338 Ga0068868_100043559 Ga0068868_1000435595 238
395 3300005339 Ga0070660_100001856 Ga0070660_10000185611 238
396 3300005339 Ga0070660_100014371 Ga0070660_1000143716 238
397 3300005339 Ga0070660_100195236 Ga0070660_1001952361 238
398 3300005340 Ga0070689_100000474 Ga0070689_1000004742 238
399 3300005341 Ga0070691_10000101 Ga0070691_1000010117 238
400 3300005343 Ga0070687_100003845 Ga0070687_1000038457 238
401 3300005344 Ga0070661_100001285 Ga0070661_1000012857 238
402 3300005345 Ga0070692_10000014 Ga0070692_1000001416 238
403 3300005347 Ga0070668_100000629 Ga0070668_10000062915 238
404 3300005353 Ga0070669_100000289 Ga0070669_10000028926 238
405 3300005354 Ga0070675_100000501 Ga0070675_10000050119 238
406 3300005355 Ga0070671_100000142 Ga0070671_1000001422 238
407 3300005355 Ga0070671_100012637 Ga0070671_1000126372 238
408 3300005356 Ga0070674_100000392 Ga0070674_1000003927 238
409 3300005356 Ga0070674_100156579 Ga0070674_1001565792 238
410 3300005364 Ga0070673_100001752 Ga0070673_10000175212 238
411 3300005365 Ga0070688_100024785 Ga0070688_1000247852 238
412 3300005366 Ga0070659_100001872 Ga0070659_10000187213 238
413 3300005366 Ga0070659_100236134 Ga0070659_1002361342 238
414 3300005367 Ga0070667_100002667 Ga0070667_1000026674 238
415 3300005367 Ga0070667_100057194 Ga0070667_1000571944 238
416 3300005367 Ga0070667_100372634 Ga0070667_1003726342 238
417 3300005406 Ga0070703_10004137 Ga0070703_100041372 238
418 3300005434 Ga0070709_10152457 Ga0070709_101524571 238
419 3300005435 Ga0070714_100012391 Ga0070714_1000123914 238
420 3300005435 Ga0070714_100159502 Ga0070714_1001595022 238
421 3300005436 Ga0070713_100592990 Ga0070713_1005929902 238
422 3300005437 Ga0070710_10006342 Ga0070710_100063426 238
423 3300005438 Ga0070701_10000008 Ga0070701_1000000835 238
424 3300005438 Ga0070701_10051052 Ga0070701_100510521 238
425 3300005439 Ga0070711_100125130 Ga0070711_1001251301 238
426 3300005440 Ga0070705_100004263 Ga0070705_10000426310 238
427 3300005441 Ga0070700_100000486 Ga0070700_10000048616 238
428 3300005444 Ga0070694_100000463 Ga0070694_1000004637 238
429 3300005444 Ga0070694_100079348 Ga0070694_1000793482 238
430 3300005455 Ga0070663_100000944 Ga0070663_10000094416 238
431 3300005456 Ga0070678_100004520 Ga0070678_1000045204 238
432 3300005457 Ga0070662_100004371 Ga0070662_10000437111 238
433 3300005458 Ga0070681_10002062 Ga0070681_1000206216 238
434 3300005458 Ga0070681_10007607 Ga0070681_100076073 238
435 3300005458 Ga0070681_10125487 Ga0070681_101254872 238
436 3300005459 Ga0068867_100000303 Ga0068867_10000030316 238
437 3300005459 Ga0068867_100458389 Ga0068867_1004583892 238
438 3300005530 Ga0070679_100005343 Ga0070679_10000534310 238
439 3300005530 Ga0070679_100009550 Ga0070679_10000955010 238
440 3300005530 Ga0070679_100067688 Ga0070679_1000676883 238
441 3300005535 Ga0070684_100001817 Ga0070684_1000018174 238
442 3300005535 Ga0070684_100471021 Ga0070684_1004710211 238
443 3300005539 Ga0068853_100000726 Ga0068853_10000072613 238
444 3300005543 Ga0070672_100000469 Ga0070672_10000046912 238
445 3300005544 Ga0070686_100004236 Ga0070686_1000042367 238
446 3300005544 Ga0070686_100086135 Ga0070686_1000861352 238
447 3300005545 Ga0070695_100003431 Ga0070695_1000034315 238
448 3300005546 Ga0070696_100030123 Ga0070696_1000301234 238
449 3300005546 Ga0070696_100156869 Ga0070696_1001568692 238
450 3300005547 Ga0070693_100000411 Ga0070693_1000004117 238
451 3300005548 Ga0070665_100035465 Ga0070665_1000354652 238
452 3300005549 Ga0070704_100001671 Ga0070704_10000167113 238
453 3300005563 Ga0068855_100074588 Ga0068855_1000745886 238
454 3300005563 Ga0068855_100118700 Ga0068855_1001187002 238
455 3300005564 Ga0070664_100001745 Ga0070664_10000174516 238
456 3300005564 Ga0070664_100112413 Ga0070664_1001124132 238
457 3300005577 Ga0068857_100000307 Ga0068857_1000003077 238
458 3300005577 Ga0068857_100257523 Ga0068857_1002575232 238
459 3300005578 Ga0068854_100000761 Ga0068854_10000076110 238
460 3300005578 Ga0068854_100188576 Ga0068854_1001885762 238
461 3300005614 Ga0068856_100003904 Ga0068856_10000390410 238
462 3300005614 Ga0068856_100114373 Ga0068856_1001143733 238
463 3300005615 Ga0070702_100001142 Ga0070702_10000114211 238
464 3300005616 Ga0068852_100000151 Ga0068852_10000015131 238
465 3300005616 Ga0068852_100060735 Ga0068852_1000607352 238
466 3300005616 Ga0068852_100076862 Ga0068852_1000768624 238
467 3300005617 Ga0068859_100199900 Ga0068859_1001999002 238
468 3300005617 Ga0068859_100266710 Ga0068859_1002667103 238
469 3300005618 Ga0068864_100001020 Ga0068864_10000102025 238
470 3300005618 Ga0068864_100025477 Ga0068864_1000254775 238
471 3300005718 Ga0068866_10000049 Ga0068866_1000004920 238
472 3300005719 Ga0068861_100000471 Ga0068861_10000047112 238
473 3300005840 Ga0068870_10001002 Ga0068870_100010029 238
474 3300005841 Ga0068863_100000418 Ga0068863_10000041816 238
475 3300005842 Ga0068858_100002238 Ga0068858_10000223817 238
476 3300005842 Ga0068858_100030576 Ga0068858_1000305764 238
477 3300005842 Ga0068858_100142208 Ga0068858_1001422082 238
478 3300005843 Ga0068860_100002578 Ga0068860_10000257817 238
479 3300005843 Ga0068860_100296224 Ga0068860_1002962242 238
480 3300005844 Ga0068862_100001613 Ga0068862_10000161316 238
481 3300006163 Ga0070715_10036277 Ga0070715_100362772 238
482 3300006175 Ga0070712_100157273 Ga0070712_1001572732 238
483 3300006178 Ga0075367_10135927 Ga0075367_101359271 238
484 3300006237 Ga0097621_100000012 Ga0097621_10000001219 238
485 3300006237 Ga0097621_100320179 Ga0097621_1003201792 238
486 3300006353 Ga0075370_10120192 Ga0075370_101201922 238
487 3300006358 Ga0068871_100000611 Ga0068871_10000061117 238
488 3300006846 Ga0075430_100000332 Ga0075430_10000033222 238
489 3300006847 Ga0075431_100028902 Ga0075431_1000289027 238
490 3300006852 Ga0075433_10000487 Ga0075433_1000048718 238
491 3300006871 Ga0075434_100000193 Ga0075434_10000019317 238
492 3300006871 Ga0075434_100000647 Ga0075434_10000064716 238
493 3300006871 Ga0075434_100163620 Ga0075434_1001636202 238
494 3300006880 Ga0075429_100000451 Ga0075429_10000045115 238
495 3300006881 Ga0068865_100001539 Ga0068865_1000015392 238
496 3300006931 Ga0097620_100199918 Ga0097620_1001999182 238
497 3300006931 Ga0097620_100266705 Ga0097620_1002667052 238
498 3300009036 Ga0105244_10039073 Ga0105244_100390733 238
499 3300009093 Ga0105240_10070752 Ga0105240_100707522 238
500 3300009094 Ga0111539_10000679 Ga0111539_1000067917 238
501 3300009094 Ga0111539_10000925 Ga0111539_100009258 238
502 3300009094 Ga0111539_10002056 Ga0111539_1000205614 238
503 3300009098 Ga0105245_10000090 Ga0105245_1000009051 238
504 3300009101 Ga0105247_10002243 Ga0105247_100022435 238
505 3300009101 Ga0105247_10067006 Ga0105247_100670062 238
506 3300009147 Ga0114129_10006700 Ga0114129_100067007 238
507 3300009148 Ga0105243_10003044 Ga0105243_100030442 238
508 3300009148 Ga0105243_10124867 Ga0105243_101248672 238
509 3300009176 Ga0105242_10000491 Ga0105242_1000049129 238
510 3300009176 Ga0105242_10153584 Ga0105242_101535842 238
511 3300009177 Ga0105248_10003797 Ga0105248_1000379715 238
512 3300009177 Ga0105248_10004778 Ga0105248_1000477818 238
513 3300009177 Ga0105248_10231848 Ga0105248_102318482 238
514 3300009545 Ga0105237_10004589 Ga0105237_100045894 238
515 3300009545 Ga0105237_10144669 Ga0105237_101446692 238
516 3300009551 Ga0105238_10159650 Ga0105238_101596502 238
517 3300009553 Ga0105249_10001085 Ga0105249_1000108513 238
518 3300010375 Ga0105239_10028016 Ga0105239_100280162 238
519 3300010375 Ga0105239_10062647 Ga0105239_100626473 238
520 3300011119 Ga0105246_10000052 Ga0105246_1000005211 238
521 3300012483 Ga0157337_1000687 Ga0157337_10006872 238
522 3300012494 Ga0157341_1001502 Ga0157341_10015022 238
523 3300013102 Ga0157371_10003401 Ga0157371_1000340112 238
524 3300013105 Ga0157369_10200279 Ga0157369_102002793 238
525 3300013105 Ga0157369_10538490 Ga0157369_105384902 238
526 3300013296 Ga0157374_10001210 Ga0157374_1000121016 238
527 3300013297 Ga0157378_10002713 Ga0157378_1000271313 238
528 3300013297 Ga0157378_10038308 Ga0157378_100383085 238
529 3300013306 Ga0163162_10000308 Ga0163162_1000030816 238
530 3300013306 Ga0163162_10031670 Ga0163162_100316704 238
531 3300013306 Ga0163162_10100977 Ga0163162_101009774 238
532 3300013307 Ga0157372_10002370 Ga0157372_1000237015 238
533 3300013307 Ga0157372_10312145 Ga0157372_103121452 238
534 3300013308 Ga0157375_10000414 Ga0157375_100004149 238
535 3300014325 Ga0163163_10002008 Ga0163163_100020089 238
536 3300014325 Ga0163163_10002377 Ga0163163_1000237715 238
537 3300014326 Ga0157380_10000122 Ga0157380_1000012217 238
538 3300014745 Ga0157377_10000688 Ga0157377_1000068814 238
539 3300014968 Ga0157379_10000261 Ga0157379_1000026132 238
540 3300014968 Ga0157379_10073523 Ga0157379_100735233 238
541 3300014969 Ga0157376_10002538 Ga0157376_1000253813 238
542 3300017792 Ga0163161_10000199 Ga0163161_1000019947 238
543 3300025290 Ga0207673_1000255 Ga0207673_10002555 238
544 3300025315 Ga0207697_10136950 Ga0207697_101369502 238
545 3300025893 Ga0207682_10000042 Ga0207682_1000004239 238
546 3300025899 Ga0207642_10000065 Ga0207642_1000006513 238
547 3300025900 Ga0207710_10001358 Ga0207710_1000135813 238
548 3300025901 Ga0207688_10000053 Ga0207688_1000005316 238
549 3300025903 Ga0207680_10018719 Ga0207680_100187192 238
550 3300025904 Ga0207647_10002478 Ga0207647_100024783 238
551 3300025908 Ga0207643_10000082 Ga0207643_1000008228 238
552 3300025909 Ga0207705_10049719 Ga0207705_100497192 238
553 3300025911 Ga0207654_10004743 Ga0207654_100047438 238
554 3300025912 Ga0207707_10017763 Ga0207707_100177634 238
555 3300025912 Ga0207707_10054354 Ga0207707_100543544 238
556 3300025912 Ga0207707_10184357 Ga0207707_101843572 238
557 3300025912 Ga0207707_10273929 Ga0207707_102739292 238
558 3300025913 Ga0207695_10366959 Ga0207695_103669592 238
559 3300025914 Ga0207671_10027981 Ga0207671_100279811 238
560 3300025915 Ga0207693_10373000 Ga0207693_103730001 238
561 3300025916 Ga0207663_10158452 Ga0207663_101584521 238
562 3300025916 Ga0207663_10167262 Ga0207663_101672622 238
563 3300025917 Ga0207660_10000083 Ga0207660_1000008337 238
564 3300025917 Ga0207660_10060659 Ga0207660_100606594 238
565 3300025919 Ga0207657_10014898 Ga0207657_1001489810 238
566 3300025919 Ga0207657_10022232 Ga0207657_100222323 238
567 3300025920 Ga0207649_10000643 Ga0207649_1000064312 238
568 3300025920 Ga0207649_10024908 Ga0207649_100249083 238
569 3300025921 Ga0207652_10000557 Ga0207652_1000055730 238
570 3300025921 Ga0207652_10035660 Ga0207652_100356604 238
571 3300025923 Ga0207681_10000271 Ga0207681_1000027133 238
572 3300025925 Ga0207650_10006111 Ga0207650_1000611111 238
573 3300025926 Ga0207659_10000161 Ga0207659_1000016131 238
574 3300025926 Ga0207659_10000460 Ga0207659_1000046016 238
575 3300025926 Ga0207659_10640818 Ga0207659_106408182 238
576 3300025927 Ga0207687_10000063 Ga0207687_1000006342 238
577 3300025927 Ga0207687_10061716 Ga0207687_100617162 238
578 3300025928 Ga0207700_10004421 Ga0207700_1000442110 238
579 3300025928 Ga0207700_10321717 Ga0207700_103217172 238
580 3300025929 Ga0207664_10123995 Ga0207664_101239953 238
581 3300025931 Ga0207644_10000591 Ga0207644_1000059120 238
582 3300025931 Ga0207644_10015231 Ga0207644_100152315 238
583 3300025932 Ga0207690_10000897 Ga0207690_1000089715 238
584 3300025932 Ga0207690_10063978 Ga0207690_100639784 238
585 3300025932 Ga0207690_10106094 Ga0207690_101060942 238
586 3300025933 Ga0207706_10054931 Ga0207706_100549312 238
587 3300025934 Ga0207686_10000614 Ga0207686_1000061416 238
588 3300025934 Ga0207686_10038769 Ga0207686_100387692 238
589 3300025935 Ga0207709_10000429 Ga0207709_1000042931 238
590 3300025936 Ga0207670_10000485 Ga0207670_1000048511 238
591 3300025936 Ga0207670_10044764 Ga0207670_100447642 238
592 3300025937 Ga0207669_10000019 Ga0207669_1000001914 238
593 3300025937 Ga0207669_10062994 Ga0207669_100629942 238
594 3300025938 Ga0207704_10000552 Ga0207704_100005525 238
595 3300025939 Ga0207665_10035016 Ga0207665_100350165 238
596 3300025941 Ga0207711_10009466 Ga0207711_1000946610 238
597 3300025941 Ga0207711_10154419 Ga0207711_101544192 238
598 3300025942 Ga0207689_10001364 Ga0207689_1000136424 238
599 3300025944 Ga0207661_10000281 Ga0207661_1000028117 238
600 3300025945 Ga0207679_10000026 Ga0207679_1000002617 238
601 3300025949 Ga0207667_10004064 Ga0207667_1000406414 238
602 3300025949 Ga0207667_10079012 Ga0207667_100790122 238
603 3300025960 Ga0207651_10000101 Ga0207651_1000010121 238
604 3300025961 Ga0207712_10000908 Ga0207712_1000090813 238
605 3300025972 Ga0207668_10000726 Ga0207668_100007269 238
606 3300025981 Ga0207640_10000596 Ga0207640_1000059613 238
607 3300025986 Ga0207658_10003725 Ga0207658_100037257 238
608 3300026023 Ga0207677_10000651 Ga0207677_1000065116 238
609 3300026035 Ga0207703_10001717 Ga0207703_1000171717 238
610 3300026035 Ga0207703_10020476 Ga0207703_100204764 238
611 3300026041 Ga0207639_10002467 Ga0207639_100024676 238
612 3300026041 Ga0207639_10116586 Ga0207639_101165863 238
613 3300026067 Ga0207678_10014165 Ga0207678_100141651 238
614 3300026078 Ga0207702_10234555 Ga0207702_102345552 238
615 3300026078 Ga0207702_10745543 Ga0207702_107455431 238
616 3300026088 Ga0207641_10002162 Ga0207641_1000216217 238
617 3300026089 Ga0207648_10003986 Ga0207648_100039865 238
618 3300026089 Ga0207648_10098193 Ga0207648_100981932 238
619 3300026095 Ga0207676_10000563 Ga0207676_1000056325 238
620 3300026095 Ga0207676_10030839 Ga0207676_100308394 238
621 3300026116 Ga0207674_10001207 Ga0207674_1000120731 238
622 3300026116 Ga0207674_10054631 Ga0207674_100546314 238
623 3300026121 Ga0207683_10000324 Ga0207683_1000032416 238
624 3300026121 Ga0207683_10015259 Ga0207683_100152594 238
625 3300026142 Ga0207698_10000634 Ga0207698_1000063412 238
626 3300027252 Ga0209973_1004080 Ga0209973_10040802 238
627 3300027471 Ga0209995_1012542 Ga0209995_10125422 238
628 3300027552 Ga0209982_1001520 Ga0209982_10015203 238
629 3300027617 Ga0210002_1004553 Ga0210002_10045532 238
630 3300027682 Ga0209971_1006277 Ga0209971_10062772 238
631 3300027695 Ga0209966_1001336 Ga0209966_10013364 238
632 3300027866 Ga0209813_10064996 Ga0209813_100649962 238
633 3300027907 Ga0207428_10000130 Ga0207428_1000013017 238
634 3300027907 Ga0207428_10000180 Ga0207428_1000018071 238
635 3300027907 Ga0207428_10000286 Ga0207428_100002865 238
636 3300028379 Ga0268266_10018702 Ga0268266_100187027 238
637 3300028380 Ga0268265_10008091 Ga0268265_100080914 238
638 3300028381 Ga0268264_10003472 Ga0268264_100034726 238
639 3300028381 Ga0268264_10061668 Ga0268264_100616683 238
640 3300028573 Ga0265334_10020588 Ga0265334_100205882 238
641 3300028800 Ga0265338_10020386 Ga0265338_100203868 238
642 3300031241 Ga0265325_10000011 Ga0265325_10000011105 238
643 3300031344 Ga0265316_10437309 Ga0265316_104373091 238
644 3300031595 Ga0265313_10028584 Ga0265313_100285844 238
645 3300031595 Ga0265313_10062502 Ga0265313_100625022 238
646 3300031711 Ga0265314_10046661 Ga0265314_100466614 238
647 3300031712 Ga0265342_10000625 Ga0265342_1000062510 238
648 3300031712 Ga0265342_10005956 Ga0265342_100059569 238
649 3300034816 Ga0373930_0003817 Ga0373930_0003817_1642_2358 238
650 3300034816 Ga0373930_0009997 Ga0373930_0009997_125_841 238
651 3300034817 Ga0373948_0001446 Ga0373948_0001446_305_1021 238
652 3300034817 Ga0373948_0001993 Ga0373948_0001993_2195_2911 238
653 3300034818 Ga0373950_0000469 Ga0373950_0000469_366_1082 238
654 3300034819 Ga0373958_0000037 Ga0373958_0000037_8434_9150 238
655 3300034819 Ga0373958_0020735 Ga0373958_0020735_182_898 238
656 3300034957 Ga0373938_0000190 Ga0373938_0000190_2667_3383 238
657 3300034957 Ga0373938_0009129 Ga0373938_0009129_771_1487 238
658 3300034957 Ga0373938_0065615 Ga0373938_0065615_58_774 238
659 3300035083 Ga0373926_0106659 Ga0373926_0106659_161_877 238
660 3300035084 Ga0373928_0000490 Ga0373928_0000490_1544_2260 238
661 3300035085 Ga0373929_0000503 Ga0373929_0000503_2660_3376 238
662 3300035085 Ga0373929_0085729 Ga0373929_0085729_17_733 238
663 3300035088 Ga0373940_0000178 Ga0373940_0000178_1159_1875 238
664 3300035088 Ga0373940_0001969 Ga0373940_0001969_3089_3805 238
665 3300035089 Ga0373944_0007842 Ga0373944_0007842_1095_1811 238
666 3300035090 Ga0373949_0001015 Ga0373949_0001015_4238_4954 238
667 3300035090 Ga0373949_0035920 Ga0373949_0035920_296_1012 238
668 3300035091 Ga0373951_0000165 Ga0373951_0000165_6000_6716 238
669 3300035091 Ga0373951_0007934 Ga0373951_0007934_57_773 238
670 3300035092 Ga0373952_0000676 Ga0373952_0000676_921_1637 238
671 3300035092 Ga0373952_0004795 Ga0373952_0004795_865_1581 238
672 3300035111 Ga0373923_0000996 Ga0373923_0000996_1568_2284 238
673 3300035111 Ga0373923_0055815 Ga0373923_0055815_613_1329 238
674 3300035112 Ga0373932_0000221 Ga0373932_0000221_6647_7363 238
675 3300035112 Ga0373932_0011462 Ga0373932_0011462_1149_1865 238
676 3300035114 Ga0373939_0000178 Ga0373939_0000178_9937_10653 238
677 3300035114 Ga0373939_0000211 Ga0373939_0000211_10598_11314 238
678 3300035115 Ga0373941_0000085 Ga0373941_0000085_9803_10519 238
679 3300035116 Ga0373945_0017285 Ga0373945_0017285_580_1296 238
680 3300035116 Ga0373945_0032699 Ga0373945_0032699_242_958 238
681 3300035118 Ga0373954_0009599 Ga0373954_0009599_203_919 238
682 3300035118 Ga0373954_0131830 Ga0373954_0131830_478_1194 238
683 3300035120 Ga0373957_0021944 Ga0373957_0021944_798_1514 238
684 3300035121 Ga0373960_0002021 Ga0373960_0002021_3206_3922 238
685 3300035170 Ga0373943_0029129 Ga0373943_0029129_1056_1772 238
686 3300035170 Ga0373943_0045435 Ga0373943_0045435_967_1683 238
687 3300035170 Ga0373943_0191361 Ga0373943_0191361_41_757 238
688 3300035171 Ga0373946_0009900 Ga0373946_0009900_2190_2906 238
689 3300035172 Ga0373955_0020162 Ga0373955_0020162_1480_2196 238
690 3300035207 Ga0373942_0000892 Ga0373942_0000892_2110_2826 238
691 3300035207 Ga0373942_0006884 Ga0373942_0006884_664_1380 238
692 3300035241 Ga0373961_0001088 Ga0373961_0001088_2663_3379 238
693 3300035242 Ga0373962_0000271 Ga0373962_0000271_1895_2611 238
694 3300035242 Ga0373962_0008443 Ga0373962_0008443_76_792 238
695 3300035691 Ga0373931_0000854 Ga0373931_0000854_11733_12449 238
696 3300035691 Ga0373931_0002074 Ga0373931_0002074_3696_4412 238
697 3300035691 Ga0373931_0049738 Ga0373931_0049738_657_1373 238
698 3300035692 Ga0373935_0008929 Ga0373935_0008929_3717_4433 238
699 3300035692 Ga0373935_0050374 Ga0373935_0050374_114_830 238
700 3300035692 Ga0373935_0110958 Ga0373935_0110958_398_1114 238
701 3300035724 Ga0373933_0004073 Ga0373933_0004073_6558_7274 238
702 3300035724 Ga0373933_0046184 Ga0373933_0046184_1052_1768 238
703 3300035725 Ga0373947_0041566 Ga0373947_0041566_114_830 238
704 3300035725 Ga0373947_0159352 Ga0373947_0159352_659_1375 238
705 3300036401 Ga0373937_0077423 Ga0373937_0077423_563_1279 238
706 3300037068 Ga0373925_0011017 Ga0373925_0011017_475_1191 238
707 3300037068 Ga0373925_0045167 Ga0373925_0045167_1741_2457 238
708 3300042012 Ga0439455_0060558 Ga0439455_0060558_215_931 238
709 3300042439 Ga0439464_0010927 Ga0439464_0010927_316_1032 238
710 3300042461 Ga0439460_0002807 Ga0439460_0002807_3177_3893 238
711 3300042876 Ga0451577_0110064 Ga0451577_0110064_998_1714 238
712 3300044712 Ga0453684_0033092 Ga0453684_0033092_657_1373 238
713 3300044842 Ga0466957_0050126 Ga0466957_0050126_314_1054 238
714 3300046452 Ga0495617_008378 Ga0495617_008378_48_764 238
715 3300046454 Ga0495592_0030221 Ga0495592_0030221_561_1277 238
716 3300046455 Ga0495603_0023238 Ga0495603_0023238_1782_2498 238
717 3300046459 Ga0495629_0190023 Ga0495629_0190023_665_1381 238
718 3300046459 Ga0495629_0191748 Ga0495629_0191748_278_994 238
719 3300046461 Ga0495641_0284007 Ga0495641_0284007_11_727 238
720 3300046462 Ga0495651_0024567 Ga0495651_0024567_3949_4665 238
721 3300046462 Ga0495651_0067604 Ga0495651_0067604_1884_2600 238
722 3300046472 Ga0495580_0012209 Ga0495580_0012209_2037_2753 238
723 3300046472 Ga0495580_0182157 Ga0495580_0182157_605_1321 238
724 3300046474 Ga0495605_0067466 Ga0495605_0067466_463_1179 238
725 3300046475 Ga0495639_0009652 Ga0495639_0009652_1432_2148 238
726 3300046476 Ga0495662_0007526 Ga0495662_0007526_3590_4306 238
727 3300046477 Ga0495664_0020087 Ga0495664_0020087_1174_1890 238
728 3300046477 Ga0495664_0259994 Ga0495664_0259994_10_726 238
729 3300046491 Ga0495584_0002387 Ga0495584_0002387_4416_5132 238
730 3300046492 Ga0495585_0006758 Ga0495585_0006758_5855_6571 238
731 3300046499 Ga0495594_0003274 Ga0495594_0003274_885_1601 238
732 3300046499 Ga0495594_0134764 Ga0495594_0134764_308_1024 238
733 3300046501 Ga0495607_0004095 Ga0495607_0004095_501_1217 238
734 3300046511 Ga0495608_0004901 Ga0495608_0004901_959_1675 238
735 3300046511 Ga0495608_0129443 Ga0495608_0129443_370_1086 238
736 3300046511 Ga0495608_0435981 Ga0495608_0435981_22_738 238
737 3300046516 Ga0495628_0000249 Ga0495628_0000249_8997_9713 238
738 3300046517 Ga0495630_0031426 Ga0495630_0031426_625_1341 238
739 3300046517 Ga0495630_0042795 Ga0495630_0042795_602_1318 238
740 3300046523 Ga0495644_0000563 Ga0495644_0000563_12381_13097 238
741 3300046525 Ga0495663_0071740 Ga0495663_0071740_348_1064 238
742 3300046526 Ga0495666_0007295 Ga0495666_0007295_3067_3783 238
743 3300046529 Ga0495652_0027838 Ga0495652_0027838_189_905 238
744 3300046529 Ga0495652_0046742 Ga0495652_0046742_1378_2094 238
745 3300046529 Ga0495652_0077412 Ga0495652_0077412_1027_1743 238
746 3300046531 Ga0495665_0042064 Ga0495665_0042064_1255_1971 238
747 3300046533 Ga0495640_0024501 Ga0495640_0024501_1910_2626 238
748 3300046533 Ga0495640_0043942 Ga0495640_0043942_834_1550 238
749 3300046533 Ga0495640_0263127 Ga0495640_0263127_196_912 238
750 3300046535 Ga0495586_0005125 Ga0495586_0005125_761_1477 238
751 3300046537 Ga0495598_0008777 Ga0495598_0008777_515_1231 238
752 3300046543 Ga0495645_0001006 Ga0495645_0001006_5457_6173 238
753 3300046557 Ga0495622_0009107 Ga0495622_0009107_389_1105 238
754 3300046558 Ga0495633_0009862 Ga0495633_0009862_499_1215 238
755 3300046559 Ga0495667_0015258 Ga0495667_0015258_957_1673 238
756 3300046559 Ga0495667_0122831 Ga0495667_0122831_407_1123 238
757 3300046615 Ga0495656_0000123 Ga0495656_0000123_15099_15815 238
758 3300046648 Ga0495611_0031419 Ga0495611_0031419_1141_1857 238
759 3300046663 Ga0495635_0009801 Ga0495635_0009801_674_1390 238
760 3300046663 Ga0495635_0017843 Ga0495635_0017843_1163_1879 238
761 3300046663 Ga0495635_0089336 Ga0495635_0089336_590_1306 238
762 3300046663 Ga0495635_0110448 Ga0495635_0110448_793_1509 238
763 3300046664 Ga0495659_0000648 Ga0495659_0000648_6141_6857 238
764 3300046665 Ga0495661_0164897 Ga0495661_0164897_218_934 238
765 3300046674 Ga0495588_0008051 Ga0495588_0008051_3639_4355 238
766 3300046675 Ga0495657_0057935 Ga0495657_0057935_1038_1754 238
767 3300046675 Ga0495657_0081193 Ga0495657_0081193_1099_1815 238
768 3300046678 Ga0495599_0083707 Ga0495599_0083707_1207_1923 238
769 3300046680 Ga0495646_0042236 Ga0495646_0042236_1214_1930 238
770 3300046681 Ga0495647_0022026 Ga0495647_0022026_1387_2103 238
771 3300046683 Ga0495658_0070081 Ga0495658_0070081_34_750 238
772 3300046684 Ga0495669_0035712 Ga0495669_0035712_558_1274 238
773 3300046684 Ga0495669_0097911 Ga0495669_0097911_383_1099 238
774 3300046690 Ga0495624_0042350 Ga0495624_0042350_605_1321 238
775 3300046690 Ga0495624_0111873 Ga0495624_0111873_929_1645 238
776 3300046691 Ga0495670_0000220 Ga0495670_0000220_3566_4282 238
777 3300046692 Ga0495671_0152732 Ga0495671_0152732_35_751 238
778 3300046794 Ga0495589_0020366 Ga0495589_0020366_675_1391 238
779 3300046809 Ga0495600_0002039 Ga0495600_0002039_5511_6227 238
780 3300046809 Ga0495600_0038138 Ga0495600_0038138_1723_2439 238
781 3300046809 Ga0495600_0118220 Ga0495600_0118220_637_1353 238
782 3300047315 Ga0495581_0004313 Ga0495581_0004313_6674_7390 238
783 3300047315 Ga0495581_0204678 Ga0495581_0204678_125_841 238
784 3300047317 Ga0495604_0004173 Ga0495604_0004173_2498_3214 238
785 3300047317 Ga0495604_0010825 Ga0495604_0010825_1378_2094 238
786 3300047317 Ga0495604_0038467 Ga0495604_0038467_820_1536 238
787 3300047318 Ga0495636_0173418 Ga0495636_0173418_211_927 238
788 3300047319 Ga0495674_0024302 Ga0495674_0024302_2688_3404 238
789 3300047319 Ga0495674_0088560 Ga0495674_0088560_1899_2615 238
790 3300047319 Ga0495674_0131761 Ga0495674_0131761_1065_1781 238
791 3300047321 Ga0495676_0061723 Ga0495676_0061723_570_1286 238
792 3300047322 Ga0495680_0034890 Ga0495680_0034890_1991_2707 238
793 3300047322 Ga0495680_0080206 Ga0495680_0080206_585_1301 238
794 3300047322 Ga0495680_0448348 Ga0495680_0448348_145_861 238
795 3300047471 Ga0495684_0002684 Ga0495684_0002684_4772_5488 238
796 3300047673 Ga0495593_0149038 Ga0495593_0149038_72_788 238
797 3300047673 Ga0495593_0154193 Ga0495593_0154193_435_1151 238
798 3300047673 Ga0495593_0219393 Ga0495593_0219393_29_745 238
799 3300048088 Ga0495602_0011207 Ga0495602_0011207_4378_5094 238
800 3300048088 Ga0495602_0076573 Ga0495602_0076573_219_935 238
801 3300048903 Ga0496100_0004355 Ga0496100_0004355_3575_4291 238
802 3300048903 Ga0496100_0146317 Ga0496100_0146317_160_876 238
803 3300048904 Ga0496101_0000468 Ga0496101_0000468_12320_13036 238
804 3300048904 Ga0496101_0152271 Ga0496101_0152271_159_875 238
805 3300048905 Ga0496102_0006543 Ga0496102_0006543_9164_9880 238
806 3300048905 Ga0496102_0009433 Ga0496102_0009433_4589_5305 238
807 3300048905 Ga0496102_0085915 Ga0496102_0085915_1284_2000 238
808 3300048906 Ga0496103_0004706 Ga0496103_0004706_4461_5177 238
809 3300048906 Ga0496103_0312723 Ga0496103_0312723_39_755 238
810 3300048907 Ga0496104_0000239 Ga0496104_0000239_6892_7608 238
811 3300048907 Ga0496104_0096042 Ga0496104_0096042_1047_1763 238
812 3300048908 Ga0496105_0000324 Ga0496105_0000324_28372_29088 238
813 3300048908 Ga0496105_0047936 Ga0496105_0047936_2558_3274 238
814 3300048908 Ga0496105_0547882 Ga0496105_0547882_76_792 238
815 3300048909 Ga0496106_0022981 Ga0496106_0022981_1534_2250 238
816 3300048909 Ga0496106_0075506 Ga0496106_0075506_729_1445 238
817 3300048910 Ga0496107_0000965 Ga0496107_0000965_7796_8512 238
818 3300048910 Ga0496107_0012402 Ga0496107_0012402_216_932 238
819 3300048910 Ga0496107_0045438 Ga0496107_0045438_1073_1789 238
820 3300048911 Ga0496108_0001543 Ga0496108_0001543_6053_6769 238
821 3300048911 Ga0496108_0005663 Ga0496108_0005663_4219_4935 238
822 3300048911 Ga0496108_0049695 Ga0496108_0049695_1636_2352 238
823 3300048911 Ga0496108_0122672 Ga0496108_0122672_1383_2099 238
824 3300048912 Ga0496109_0000414 Ga0496109_0000414_27145_27861 238
825 3300048912 Ga0496109_0004282 Ga0496109_0004282_6844_7560 238
826 3300048913 Ga0496110_0008470 Ga0496110_0008470_4219_4935 238
827 3300048913 Ga0496110_0013604 Ga0496110_0013604_2923_3639 238
828 3300048913 Ga0496110_0065165 Ga0496110_0065165_1481_2197 238
829 3300048914 Ga0496111_0028377 Ga0496111_0028377_996_1712 238
830 3300048914 Ga0496111_0085077 Ga0496111_0085077_1520_2236 238
831 3300048915 Ga0496112_0020521 Ga0496112_0020521_561_1277 238
832 3300048915 Ga0496112_0073867 Ga0496112_0073867_269_985 238
833 3300048916 Ga0496113_0027002 Ga0496113_0027002_1590_2306 238
834 3300048916 Ga0496113_0047579 Ga0496113_0047579_557_1273 238
835 3300048917 Ga0496114_0003058 Ga0496114_0003058_11439_12155 238
836 3300048917 Ga0496114_0013686 Ga0496114_0013686_2764_3480 238
837 3300048918 Ga0496115_0003980 Ga0496115_0003980_6301_7017 238
838 3300048918 Ga0496115_0026545 Ga0496115_0026545_2759_3475 238
839 3300049581 Ga0501047_0051298 Ga0501047_0051298_1275_2000 238
840 3300049592 Ga0501076_0149669 Ga0501076_0149669_69_785 238
841 3300049593 Ga0501077_0025325 Ga0501077_0025325_427_1143 238
842 3300049823 Ga0501044_0016958 Ga0501044_0016958_5832_6557 238
843 3300050495 nmdc:mga04h51_77702_c1 nmdc:mga04h51_77702_c1_205_921 238
844 3300050496 nmdc:mga07m45_66019_c1 nmdc:mga07m45_66019_c1_262_978 238
845 3300050507 nmdc:mga05p37_863_c1 nmdc:mga05p37_863_c1_22269_22985 238
846 3300050508 nmdc:mga09592_1701_c1 nmdc:mga09592_1701_c1_11124_11840 238
847 3300050509 nmdc:mga0qj67_2984_c1 nmdc:mga0qj67_2984_c1_11220_11936 238
848 3300050510 nmdc:mga06r32_6584_c1 nmdc:mga06r32_6584_c1_5481_6197 238
849 3300050511 nmdc:mga08y16_13856_c1 nmdc:mga08y16_13856_c1_3068_3784 238
850 3300050511 nmdc:mga08y16_2133_c1 nmdc:mga08y16_2133_c1_10046_10762 238
851 3300050511 nmdc:mga08y16_3076_c1 nmdc:mga08y16_3076_c1_13326_14042 238
852 3300050512 nmdc:mga0n895_104046_c1 nmdc:mga0n895_104046_c1_995_1711 238
853 3300050512 nmdc:mga0n895_164171_c1 nmdc:mga0n895_164171_c1_988_1704 238
854 3300050512 nmdc:mga0n895_335732_c1 nmdc:mga0n895_335732_c1_786_1502 238
855 3300050512 nmdc:mga0n895_427_c1 nmdc:mga0n895_427_c1_15199_15915 238
856 3300050512 nmdc:mga0n895_55_c1 nmdc:mga0n895_55_c1_41465_42181 238
857 3300050514 nmdc:mga08x19_502317_c1 nmdc:mga08x19_502317_c1_76_792 238
858 3300050515 nmdc:mga0a205_182379_c1 nmdc:mga0a205_182379_c1_489_1205 238
859 3300050515 nmdc:mga0a205_2491_c1 nmdc:mga0a205_2491_c1_4268_4984 238
860 3300050515 nmdc:mga0a205_768_c4 nmdc:mga0a205_768_c4_13335_14051 238
861 3300053077 Ga0495601_0001987 Ga0495601_0001987_2698_3414 238
862 3300053077 Ga0495601_0002541 Ga0495601_0002541_1771_2487 238
863 3300053078 Ga0495612_0000243 Ga0495612_0000243_7226_7942 238
864 3300053078 Ga0495612_0004160 Ga0495612_0004160_4978_5694 238
865 3300053078 Ga0495612_0004394 Ga0495612_0004394_4248_4964 238
866 3300053084 Ga0495595_0002469 Ga0495595_0002469_2108_2824 238
867 3300053084 Ga0495595_0003265 Ga0495595_0003265_4985_5701 238
868 3300053085 Ga0495619_0000139 Ga0495619_0000139_40269_40985 238
869 3300053085 Ga0495619_0000365 Ga0495619_0000365_308_1024 238
870 3300053085 Ga0495619_0001830 Ga0495619_0001830_6270_6986 238
871 3300053085 Ga0495619_0049976 Ga0495619_0049976_1622_2338 238
872 3300053094 Ga0500566_0203336 Ga0500566_0203336_268_984 238
873 3300054114 Ga0501084_0312396 Ga0501084_0312396_149_865 238
874 iso_pu_bacteria 8006973647 8006976192 238
875 3300009174 Ga0105241_10071516 Ga0105241_100715164 242
876 3300009551 Ga0105238_10147753 Ga0105238_101477534 242
877 3300013307 Ga0157372_10295438 Ga0157372_102954382 242
878 3300049578 Ga0501042_0034896 Ga0501042_0034896_857_1591 242
879 3300049587 Ga0501071_0039005 Ga0501071_0039005_1430_2164 242
880 3300049588 Ga0501072_0080592 Ga0501072_0080592_419_1153 242
881 3300049592 Ga0501076_0009353 Ga0501076_0009353_6042_6776 242
882 3300049593 Ga0501077_0111132 Ga0501077_0111132_455_1189 242
883 3300049741 Ga0501079_0046174 Ga0501079_0046174_1900_2634 242
884 3300049742 Ga0501080_0807015 Ga0501080_0807015_16_750 242
885 3300049743 Ga0501081_0018810 Ga0501081_0018810_2935_3669 242
886 3300060353 Ga0501082_0042848 Ga0501082_0042848_101_835 242
887 3300061734 Ga0530510_0029878 Ga0530510_0029878_1277_2011 242
888 3300005329 Ga0070683_100099828 Ga0070683_1000998282 243
889 3300005336 Ga0070680_100150823 Ga0070680_1001508232 243
890 3300005439 Ga0070711_100275404 Ga0070711_1002754042 243
891 3300005458 Ga0070681_10127736 Ga0070681_101277363 243
892 3300005535 Ga0070684_100041910 Ga0070684_1000419102 243
893 3300005547 Ga0070693_100193276 Ga0070693_1001932762 243
894 3300009093 Ga0105240_10164390 Ga0105240_101643902 243
895 3300013100 Ga0157373_10078404 Ga0157373_100784042 243
896 3300013104 Ga0157370_10094541 Ga0157370_100945412 243
897 3300013105 Ga0157369_10118116 Ga0157369_101181162 243
898 3300020082 Ga0206353_10968937 Ga0206353_109689372 243
899 3300025898 Ga0207692_10099162 Ga0207692_100991622 243
900 3300025915 Ga0207693_10002221 Ga0207693_1000222110 243
901 3300025917 Ga0207660_10234908 Ga0207660_102349082 243
902 3300025924 Ga0207694_10282189 Ga0207694_102821892 243
903 3300025939 Ga0207665_10112739 Ga0207665_101127393 243
904 3300025949 Ga0207667_10107081 Ga0207667_101070813 243
905 3300025981 Ga0207640_10157223 Ga0207640_101572232 243
906 3300000043 ARcpr5yngRDRAFT_c000045 ARcpr5yngRDRAFT_0000453 245
907 3300005330 Ga0070690_100009502 Ga0070690_1000095027 245
908 3300005366 Ga0070659_100035555 Ga0070659_1000355552 245
909 3300005549 Ga0070704_100031993 Ga0070704_1000319934 245
910 3300005841 Ga0068863_100476300 Ga0068863_1004763002 245
911 3300014325 Ga0163163_10873168 Ga0163163_108731681 245
912 3300005331 Ga0070670_100156248 Ga0070670_1001562483 246
913 3300048903 Ga0496100_0001041 Ga0496100_0001041_2604_3353 247
914 3300048905 Ga0496102_0014986 Ga0496102_0014986_5824_6573 247
915 3300048906 Ga0496103_0122185 Ga0496103_0122185_768_1517 247
916 3300048907 Ga0496104_0002158 Ga0496104_0002158_9341_10090 247
917 3300048908 Ga0496105_0036316 Ga0496105_0036316_3084_3833 247
918 3300048909 Ga0496106_0079869 Ga0496106_0079869_1041_1790 247
919 3300048910 Ga0496107_0065092 Ga0496107_0065092_1050_1799 247
920 3300048911 Ga0496108_0001911 Ga0496108_0001911_7810_8559 247
921 3300048918 Ga0496115_0055608 Ga0496115_0055608_1328_2077 247
922 3300049585 Ga0501069_0263236 Ga0501069_0263236_197_946 247
923 3300005329 Ga0070683_100162944 Ga0070683_1001629442 248
924 3300005530 Ga0070679_100266003 Ga0070679_1002660032 248
925 3300005563 Ga0068855_100036036 Ga0068855_1000360362 248
926 3300025921 Ga0207652_10199447 Ga0207652_101994472 248
927 3300005335 Ga0070666_10001254 Ga0070666_1000125413 251
928 3300005347 Ga0070668_100225429 Ga0070668_1002254292 251
929 3300005365 Ga0070688_100039337 Ga0070688_1000393373 251
930 3300005367 Ga0070667_100029594 Ga0070667_1000295944 251
931 3300005436 Ga0070713_100000749 Ga0070713_10000074913 251
932 3300005617 Ga0068859_100039474 Ga0068859_1000394744 251
933 3300006163 Ga0070715_10001906 Ga0070715_100019068 251
934 3300006358 Ga0068871_100011284 Ga0068871_1000112847 251
935 3300006881 Ga0068865_100010595 Ga0068865_1000105952 251
936 3300006931 Ga0097620_100039475 Ga0097620_1000394754 251
937 3300025927 Ga0207687_10013822 Ga0207687_100138224 251
938 3300025929 Ga0207664_10063853 Ga0207664_100638532 251
939 3300025935 Ga0207709_10076700 Ga0207709_100767002 251
940 3300025936 Ga0207670_10202010 Ga0207670_102020102 251
941 3300025938 Ga0207704_10013384 Ga0207704_100133844 251
942 3300025941 Ga0207711_10033759 Ga0207711_100337594 251
943 3300025960 Ga0207651_10037796 Ga0207651_100377962 251
944 3300025972 Ga0207668_10275683 Ga0207668_102756832 251
945 3300026035 Ga0207703_10015632 Ga0207703_100156327 251
946 3300026041 Ga0207639_10060951 Ga0207639_100609512 251
947 3300026067 Ga0207678_10022132 Ga0207678_100221324 251
948 3300035172 Ga0373955_0037464 Ga0373955_0037464_566_1351 251
949 3300046511 Ga0495608_0348362 Ga0495608_0348362_31_816 251
950 3300047317 Ga0495604_0110806 Ga0495604_0110806_15_800 251
951 3300005437 Ga0070710_10010981 Ga0070710_100109814 252
952 3300005439 Ga0070711_100036981 Ga0070711_1000369812 252
953 3300005543 Ga0070672_100278922 Ga0070672_1002789221 252
954 3300005614 Ga0068856_100129813 Ga0068856_1001298133 252
955 3300006173 Ga0070716_100021168 Ga0070716_1000211683 252
956 3300006175 Ga0070712_100248395 Ga0070712_1002483951 252
957 3300025898 Ga0207692_10006921 Ga0207692_100069214 252
958 3300025911 Ga0207654_10080821 Ga0207654_100808213 252
959 3300025931 Ga0207644_10011436 Ga0207644_100114362 252
960 3300025934 Ga0207686_10132324 Ga0207686_101323242 252
961 3300025939 Ga0207665_10007282 Ga0207665_100072827 252
962 3300026023 Ga0207677_10144649 Ga0207677_101446491 252
963 3300049571 Ga0501034_0083273 Ga0501034_0083273_683_1480 252
964 3300036647 Ga0316582_0165993 Ga0316582_0165993_517_1287 256
965 3300049573 Ga0501037_0079639 Ga0501037_0079639_959_1756 261
966 3300049581 Ga0501047_0011528 Ga0501047_0011528_4339_5136 261
967 3300049742 Ga0501080_0202684 Ga0501080_0202684_1011_1808 261
968 3300049822 Ga0501035_0127484 Ga0501035_0127484_471_1268 261
969 3300049823 Ga0501044_0069624 Ga0501044_0069624_699_1496 261
970 3300005840 Ga0068870_10259385 Ga0068870_102593851 264
971 3300006852 Ga0075433_10007157 Ga0075433_100071572 264
972 3300006871 Ga0075434_100009281 Ga0075434_1000092813 264
973 3300007076 Ga0075435_100003880 Ga0075435_1000038806 264
974 3300009147 Ga0114129_10006668 Ga0114129_1000666821 264
975 3300025908 Ga0207643_10246779 Ga0207643_102467792 264
976 3300005614 Ga0068856_100058628 Ga0068856_1000586285 273
977 3300005615 Ga0070702_100192188 Ga0070702_1001921881 273
978 3300048089 Ga0495614_0026352 Ga0495614_0026352_330_1154 273
979 3300005937 Ga0081455_10000002 Ga0081455_10000002273 283
980 3300025933 Ga0207706_10068324 Ga0207706_100683245 288
981 3300000041 ARcpr5oldR_c000176 ARcpr5oldR_0001763 290
982 3300000042 ARSoilYngRDRAFT_c00912 ARSoilYngRDRAFT_009123 290
983 3300000044 ARSoilOldRDRAFT_c000265 ARSoilOldRDRAFT_0002653 290
984 3300000044 ARSoilOldRDRAFT_c000599 ARSoilOldRDRAFT_0005994 290
985 3300000652 ARCol0yngRDRAFT_1001185 ARCol0yngRDRAFT_10011853 290
986 3300005290 Ga0065712_10000851 Ga0065712_100008513 290
987 3300005293 Ga0065715_10116267 Ga0065715_101162673 290
988 3300005354 Ga0070675_100096691 Ga0070675_1000966913 290
989 3300005458 Ga0070681_10056008 Ga0070681_100560084 290
990 3300013105 Ga0157369_10401104 Ga0157369_104011042 290
991 3300025917 Ga0207660_10055323 Ga0207660_100553234 290
992 3300025961 Ga0207712_10031991 Ga0207712_100319914 290
993 3300025981 Ga0207640_10078383 Ga0207640_100783832 290
994 3300028380 Ga0268265_10033423 Ga0268265_100334233 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04280

Tim44

Tim44-like domain

139

285

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cw9-assembly1.cif.gz_A crystal structure of human tim44 c-terminal domain 0.864 141 289
7qh6-assembly1.cif.gz_d cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 1 0.8505 144 288
7qh7-assembly1.cif.gz_d cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 4 0.8469 144 290
6nu3-assembly1.cif.gz_d structural insights into unique features of the human mitochondrial ribosome recycling 0.839 142 290
8scx-assembly1.cif.gz_C cryo-em structure of the core tim23 complex from s. cerevisiae 0.8293 140 290
ID Description Score Start End Superfamily
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9129 142 287 3.10.450.240
af_O02161_236_422_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9023 141 287 3.10.450.240
af_Q8GXP7_158_313_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.852 142 287 3.10.450.240
2cw9A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8458 143 289 3.10.450.240
af_A0A1D6ILC0_91_266_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8445 141 288 3.10.450.240
ID Description Score Start End GO Terms
AF-A0A522WFA1-F1-model_v4 Tim44 domain-containing protein 0.9903 164 290
AF-A0A4R5XK26-F1-model_v4 deleted 0.9894 155 290
AF-A0A520HWE3-F1-model_v4 Tim44 domain-containing protein 0.9846 162 289
AF-D5RNY5-F1-model_v4 Tim44-like domain protein 0.9842 135 289 GO:0005840
GO:1990904
AF-A0A434EZN2-F1-model_v4 Calcium-binding protein 0.9842 191 288

Feature Viewer

pLDDT pTM Quality
73.08 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map