F487710
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 994 | 428 | 992 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300005615|Ga0070702_100192188|Ga0070702_1001921881 |
| Length | 287 |
| Sequence | MVRLDDAGNWTGLWKAPHRCLHRDGNRSLPAQIFESADLPLIPRRPAAESVQDVFDIYTIIFLALAVFIFLRLRSVLGQRTGRERPPYDPYSARDVRGTTNDNVVRLPGRTAPDAVQKPVEAPEPAERWKGIAEPGSAIATGLEAIAAEDKGFDAKHFITGSRAAYEMIVLAFAEGDRRQLKNLLSREVYEGFDAAIRERETKGESIETRFVSIDKSEIVAAEMRGRMAHITVRFLSQLISVTRDRSGTVIEGNAEKVTDVTDVWTFARDVSSRDPNWKLVATEAGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 133 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 153 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 266 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 273 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 277 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 278 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 281 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 283 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 284 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 287 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 288 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 289 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 292 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 378 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 405 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 419 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 421 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 428 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.59 |
| Metatranscriptomes | 1.21 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.51 |
| Nodule | 0.1 |
| Rhizoplane | 7.95 |
| Rhizosphere | 89.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000176 | 3300000041 | Bacteria | 11030 |
| 2 | ARSoilYngRDRAFT_c00912 | 3300000042 | Bacteria | 2228 |
| 3 | ARcpr5yngRDRAFT_c000045 | 3300000043 | Bacteria | 19814 |
| 4 | ARSoilOldRDRAFT_c000265 | 3300000044 | Bacteria | 7493 |
| 5 | ARSoilOldRDRAFT_c000599 | 3300000044 | Bacteria | 3910 |
| 6 | ARCol0yngRDRAFT_1001185 | 3300000652 | Bacteria | 2205 |
| 7 | JGI24741J21665_1005876 | 3300001915 | Bacteria | 2514 |
| 8 | JGI24746J21847_1001040 | 3300001977 | Bacteria | 4353 |
| 9 | JGI24740J21852_10021705 | 3300001979 | Bacteria | 2221 |
| 10 | JGI24739J22299_10009366 | 3300001989 | Bacteria | 3650 |
| 11 | JGI24737J22298_10000349 | 3300001990 | Bacteria | 15515 |
| 12 | JGI24743J22301_10001914 | 3300001991 | Bacteria | 3020 |
| 13 | JGI24750J21931_1000065 | 3300002070 | Bacteria | 15383 |
| 14 | JGI24745J21846_1000050 | 3300002073 | Bacteria | 8168 |
| 15 | JGI24748J21848_1000906 | 3300002074 | Bacteria | 3212 |
| 16 | JGI24738J21930_10000803 | 3300002075 | Bacteria | 9022 |
| 17 | JGI24035J26624_1000006 | 3300002126 | Bacteria | 14718 |
| 18 | JGI24034J26672_10000266 | 3300002239 | Bacteria | 6898 |
| 19 | JGI24742J22300_10000073 | 3300002244 | Bacteria | 14180 |
| 20 | JGI24742J22300_10037906 | 3300002244 | Bacteria | 854 |
| 21 | JGI26145J50221_1000700 | 3300003371 | Bacteria | 2758 |
| 22 | Ga0065704_10084127 | 3300005289 | Bacteria | 3374 |
| 23 | Ga0065704_10170228 | 3300005289 | Bacteria | 1296 |
| 24 | Ga0065712_10000851 | 3300005290 | Bacteria | 16498 |
| 25 | Ga0065715_10009479 | 3300005293 | Bacteria | 4398 |
| 26 | Ga0065715_10116267 | 3300005293 | Bacteria | 2380 |
| 27 | Ga0070658_10008449 | 3300005327 | Bacteria | 8280 |
| 28 | Ga0070658_10023948 | 3300005327 | Bacteria | 4898 |
| 29 | Ga0070658_10104725 | 3300005327 | Bacteria | 2341 |
| 30 | Ga0070676_10000360 | 3300005328 | Bacteria | 20914 |
| 31 | Ga0070676_10044695 | 3300005328 | Bacteria | 2579 |
| 32 | Ga0070683_100003076 | 3300005329 | Bacteria | 13434 |
| 33 | Ga0070683_100099828 | 3300005329 | Bacteria | 2732 |
| 34 | Ga0070683_100162944 | 3300005329 | Bacteria | 2116 |
| 35 | Ga0070683_100492435 | 3300005329 | Bacteria | 1171 |
| 36 | Ga0070690_100009502 | 3300005330 | Bacteria | 5636 |
| 37 | Ga0070690_100210654 | 3300005330 | Bacteria | 1357 |
| 38 | Ga0070670_100000827 | 3300005331 | Bacteria | 24178 |
| 39 | Ga0070670_100061527 | 3300005331 | Bacteria | 3223 |
| 40 | Ga0070670_100156248 | 3300005331 | Bacteria | 1975 |
| 41 | Ga0070677_10034861 | 3300005333 | Bacteria | 1947 |
| 42 | Ga0068869_100000013 | 3300005334 | Bacteria | 73970 |
| 43 | Ga0070666_10001254 | 3300005335 | Bacteria | 15354 |
| 44 | Ga0070666_10024413 | 3300005335 | Bacteria | 3937 |
| 45 | Ga0070666_10036624 | 3300005335 | Bacteria | 3258 |
| 46 | Ga0070680_100002249 | 3300005336 | Bacteria | 14255 |
| 47 | Ga0070680_100002907 | 3300005336 | Bacteria | 12726 |
| 48 | Ga0070680_100006151 | 3300005336 | Bacteria | 9105 |
| 49 | Ga0070680_100006824 | 3300005336 | Bacteria | 8701 |
| 50 | Ga0070680_100088277 | 3300005336 | Bacteria | 2565 |
| 51 | Ga0070680_100150823 | 3300005336 | Bacteria | 1951 |
| 52 | Ga0070680_100160088 | 3300005336 | Bacteria | 1892 |
| 53 | Ga0070682_100001195 | 3300005337 | Bacteria | 14796 |
| 54 | Ga0070682_100028819 | 3300005337 | Bacteria | 3341 |
| 55 | Ga0070682_100093427 | 3300005337 | Bacteria | 1972 |
| 56 | Ga0068868_100043559 | 3300005338 | Bacteria | 3506 |
| 57 | Ga0070660_100001856 | 3300005339 | Bacteria | 14539 |
| 58 | Ga0070660_100014371 | 3300005339 | Bacteria | 5700 |
| 59 | Ga0070660_100195236 | 3300005339 | Bacteria | 1640 |
| 60 | Ga0070689_100000474 | 3300005340 | Bacteria | 23677 |
| 61 | Ga0070689_100312406 | 3300005340 | Bacteria | 1310 |
| 62 | Ga0070691_10000101 | 3300005341 | Bacteria | 25190 |
| 63 | Ga0070687_100003845 | 3300005343 | Bacteria | 5901 |
| 64 | Ga0070661_100001285 | 3300005344 | Bacteria | 17639 |
| 65 | Ga0070692_10000014 | 3300005345 | Bacteria | 35936 |
| 66 | Ga0070668_100000629 | 3300005347 | Bacteria | 23731 |
| 67 | Ga0070668_100225429 | 3300005347 | Bacteria | 1548 |
| 68 | Ga0070669_100000289 | 3300005353 | Bacteria | 39576 |
| 69 | Ga0070669_100099770 | 3300005353 | Bacteria | 2189 |
| 70 | Ga0070675_100000501 | 3300005354 | Bacteria | 26898 |
| 71 | Ga0070675_100096691 | 3300005354 | Bacteria | 2481 |
| 72 | Ga0070671_100000142 | 3300005355 | Bacteria | 46386 |
| 73 | Ga0070671_100012637 | 3300005355 | Bacteria | 6804 |
| 74 | Ga0070674_100000392 | 3300005356 | Bacteria | 21972 |
| 75 | Ga0070674_100152054 | 3300005356 | Bacteria | 1747 |
| 76 | Ga0070674_100156579 | 3300005356 | Bacteria | 1724 |
| 77 | Ga0070673_100001752 | 3300005364 | Bacteria | 12936 |
| 78 | Ga0070673_100003993 | 3300005364 | Bacteria | 9280 |
| 79 | Ga0070673_100143366 | 3300005364 | Bacteria | 2017 |
| 80 | Ga0070688_100024785 | 3300005365 | Bacteria | 3544 |
| 81 | Ga0070688_100039337 | 3300005365 | Bacteria | 2893 |
| 82 | Ga0070659_100001872 | 3300005366 | Bacteria | 15083 |
| 83 | Ga0070659_100035555 | 3300005366 | Bacteria | 3879 |
| 84 | Ga0070659_100236134 | 3300005366 | Bacteria | 1512 |
| 85 | Ga0070667_100002667 | 3300005367 | Bacteria | 15448 |
| 86 | Ga0070667_100029594 | 3300005367 | Bacteria | 4565 |
| 87 | Ga0070667_100057194 | 3300005367 | Bacteria | 3295 |
| 88 | Ga0070667_100372634 | 3300005367 | Bacteria | 1296 |
| 89 | Ga0070703_10004137 | 3300005406 | Bacteria | 4091 |
| 90 | Ga0070709_10115253 | 3300005434 | Bacteria | 1812 |
| 91 | Ga0070709_10126242 | 3300005434 | Bacteria | 1741 |
| 92 | Ga0070709_10152457 | 3300005434 | Bacteria | 1598 |
| 93 | Ga0070714_100012391 | 3300005435 | Bacteria | 6807 |
| 94 | Ga0070714_100083608 | 3300005435 | Bacteria | 2784 |
| 95 | Ga0070714_100159502 | 3300005435 | Bacteria | 2040 |
| 96 | Ga0070713_100000749 | 3300005436 | Bacteria | 20796 |
| 97 | Ga0070713_100046678 | 3300005436 | Bacteria | 3555 |
| 98 | Ga0070713_100592990 | 3300005436 | Unclassified | 1052 |
| 99 | Ga0070710_10006342 | 3300005437 | Bacteria | 5676 |
| 100 | Ga0070710_10010981 | 3300005437 | Bacteria | 4463 |
| 101 | Ga0070710_10052551 | 3300005437 | Bacteria | 2292 |
| 102 | Ga0070701_10000008 | 3300005438 | Bacteria | 53317 |
| 103 | Ga0070701_10051052 | 3300005438 | Bacteria | 2144 |
| 104 | Ga0070701_10231941 | 3300005438 | Bacteria | 1106 |
| 105 | Ga0070711_100036981 | 3300005439 | Bacteria | 3273 |
| 106 | Ga0070711_100125130 | 3300005439 | Bacteria | 1907 |
| 107 | Ga0070711_100136679 | 3300005439 | Bacteria | 1833 |
| 108 | Ga0070711_100275404 | 3300005439 | Bacteria | 1329 |
| 109 | Ga0070705_100004263 | 3300005440 | Bacteria | 6978 |
| 110 | Ga0070700_100000486 | 3300005441 | Bacteria | 19940 |
| 111 | Ga0070694_100000463 | 3300005444 | Bacteria | 22164 |
| 112 | Ga0070694_100079348 | 3300005444 | Bacteria | 2278 |
| 113 | Ga0070663_100000944 | 3300005455 | Bacteria | 15811 |
| 114 | Ga0070663_100659985 | 3300005455 | Bacteria | 885 |
| 115 | Ga0070678_100004520 | 3300005456 | Bacteria | 7898 |
| 116 | Ga0070678_100156523 | 3300005456 | Bacteria | 1841 |
| 117 | Ga0070662_100004371 | 3300005457 | Bacteria | 8928 |
| 118 | Ga0070681_10002062 | 3300005458 | Bacteria | 18223 |
| 119 | Ga0070681_10004156 | 3300005458 | Bacteria | 13699 |
| 120 | Ga0070681_10007607 | 3300005458 | Bacteria | 10591 |
| 121 | Ga0070681_10056008 | 3300005458 | Bacteria | 3924 |
| 122 | Ga0070681_10125487 | 3300005458 | Bacteria | 2499 |
| 123 | Ga0070681_10127736 | 3300005458 | Bacteria | 2475 |
| 124 | Ga0070681_10138950 | 3300005458 | Bacteria | 2359 |
| 125 | Ga0070681_10302823 | 3300005458 | Bacteria | 1508 |
| 126 | Ga0068867_100000303 | 3300005459 | Bacteria | 32425 |
| 127 | Ga0068867_100458389 | 3300005459 | Bacteria | 1088 |
| 128 | Ga0070685_10002009 | 3300005466 | Bacteria | 10543 |
| 129 | Ga0070679_100005343 | 3300005530 | Bacteria | 11885 |
| 130 | Ga0070679_100009550 | 3300005530 | Bacteria | 9176 |
| 131 | Ga0070679_100026139 | 3300005530 | Bacteria | 5731 |
| 132 | Ga0070679_100062681 | 3300005530 | Bacteria | 3707 |
| 133 | Ga0070679_100067688 | 3300005530 | Bacteria | 3561 |
| 134 | Ga0070679_100092785 | 3300005530 | Bacteria | 3006 |
| 135 | Ga0070679_100266003 | 3300005530 | Bacteria | 1669 |
| 136 | Ga0070679_100411166 | 3300005530 | Bacteria | 1298 |
| 137 | Ga0070679_100413814 | 3300005530 | Bacteria | 1294 |
| 138 | Ga0070684_100001817 | 3300005535 | Bacteria | 15613 |
| 139 | Ga0070684_100041910 | 3300005535 | Bacteria | 3950 |
| 140 | Ga0070684_100471021 | 3300005535 | Bacteria | 1162 |
| 141 | Ga0070697_100029029 | 3300005536 | Bacteria | 4432 |
| 142 | Ga0068853_100000726 | 3300005539 | Bacteria | 22782 |
| 143 | Ga0070672_100000469 | 3300005543 | Bacteria | 23426 |
| 144 | Ga0070672_100182207 | 3300005543 | Bacteria | 1751 |
| 145 | Ga0070672_100278922 | 3300005543 | Bacteria | 1412 |
| 146 | Ga0070686_100004236 | 3300005544 | Bacteria | 7898 |
| 147 | Ga0070686_100086135 | 3300005544 | Bacteria | 2091 |
| 148 | Ga0070686_100104167 | 3300005544 | Bacteria | 1921 |
| 149 | Ga0070695_100003431 | 3300005545 | Bacteria | 9260 |
| 150 | Ga0070695_100061785 | 3300005545 | Bacteria | 2431 |
| 151 | Ga0070696_100030123 | 3300005546 | Bacteria | 3714 |
| 152 | Ga0070696_100156869 | 3300005546 | Bacteria | 1674 |
| 153 | Ga0070693_100000411 | 3300005547 | Bacteria | 19398 |
| 154 | Ga0070693_100193276 | 3300005547 | Bacteria | 1317 |
| 155 | Ga0070693_100216369 | 3300005547 | Bacteria | 1253 |
| 156 | Ga0070665_100035465 | 3300005548 | Bacteria | 5015 |
| 157 | Ga0070665_100067415 | 3300005548 | Bacteria | 3589 |
| 158 | Ga0070665_100192052 | 3300005548 | Bacteria | 2043 |
| 159 | Ga0070704_100001671 | 3300005549 | Bacteria | 12037 |
| 160 | Ga0070704_100031993 | 3300005549 | Bacteria | 3543 |
| 161 | Ga0070704_100238536 | 3300005549 | Bacteria | 1487 |
| 162 | Ga0070704_100519222 | 3300005549 | Bacteria | 1036 |
| 163 | Ga0068855_100028402 | 3300005563 | Bacteria | 6692 |
| 164 | Ga0068855_100036036 | 3300005563 | Bacteria | 5890 |
| 165 | Ga0068855_100074588 | 3300005563 | Bacteria | 3939 |
| 166 | Ga0068855_100118700 | 3300005563 | Bacteria | 3029 |
| 167 | Ga0068855_100282059 | 3300005563 | Bacteria | 1844 |
| 168 | Ga0070664_100001745 | 3300005564 | Bacteria | 17407 |
| 169 | Ga0070664_100112413 | 3300005564 | Bacteria | 2378 |
| 170 | Ga0068857_100000307 | 3300005577 | Bacteria | 33926 |
| 171 | Ga0068857_100257523 | 3300005577 | Bacteria | 1601 |
| 172 | Ga0068854_100000761 | 3300005578 | Bacteria | 19144 |
| 173 | Ga0068854_100023441 | 3300005578 | Bacteria | 4216 |
| 174 | Ga0068854_100188576 | 3300005578 | Bacteria | 1614 |
| 175 | Ga0068856_100003904 | 3300005614 | Bacteria | 14952 |
| 176 | Ga0068856_100044864 | 3300005614 | Bacteria | 4351 |
| 177 | Ga0068856_100058628 | 3300005614 | Bacteria | 3803 |
| 178 | Ga0068856_100114373 | 3300005614 | Bacteria | 2697 |
| 179 | Ga0068856_100129813 | 3300005614 | Bacteria | 2525 |
| 180 | Ga0068856_100585502 | 3300005614 | Bacteria | 1137 |
| 181 | Ga0070702_100001142 | 3300005615 | Bacteria | 10662 |
| 182 | Ga0070702_100055057 | 3300005615 | Bacteria | 2292 |
| 183 | Ga0070702_100192188 | 3300005615 | Unclassified | 1344 |
| 184 | Ga0068852_100000151 | 3300005616 | Bacteria | 46414 |
| 185 | Ga0068852_100060735 | 3300005616 | Bacteria | 3282 |
| 186 | Ga0068852_100076862 | 3300005616 | Bacteria | 2949 |
| 187 | Ga0068852_100273214 | 3300005616 | Bacteria | 1627 |
| 188 | Ga0068852_100424644 | 3300005616 | Bacteria | 1312 |
| 189 | Ga0068859_100039474 | 3300005617 | Bacteria | 4735 |
| 190 | Ga0068859_100199900 | 3300005617 | Bacteria | 2083 |
| 191 | Ga0068859_100266710 | 3300005617 | Bacteria | 1804 |
| 192 | Ga0068864_100001020 | 3300005618 | Bacteria | 23442 |
| 193 | Ga0068864_100025477 | 3300005618 | Bacteria | 4982 |
| 194 | Ga0068864_100072770 | 3300005618 | Bacteria | 2996 |
| 195 | Ga0068866_10000049 | 3300005718 | Bacteria | 45908 |
| 196 | Ga0068861_100000471 | 3300005719 | Bacteria | 23427 |
| 197 | Ga0068870_10001002 | 3300005840 | Bacteria | 11150 |
| 198 | Ga0068870_10259385 | 3300005840 | Bacteria | 1081 |
| 199 | Ga0068863_100000418 | 3300005841 | Bacteria | 43162 |
| 200 | Ga0068863_100476300 | 3300005841 | Bacteria | 1227 |
| 201 | Ga0068858_100002238 | 3300005842 | Bacteria | 19549 |
| 202 | Ga0068858_100030576 | 3300005842 | Bacteria | 5001 |
| 203 | Ga0068858_100142208 | 3300005842 | Bacteria | 2253 |
| 204 | Ga0068860_100002578 | 3300005843 | Bacteria | 18969 |
| 205 | Ga0068860_100106844 | 3300005843 | Bacteria | 2674 |
| 206 | Ga0068860_100296224 | 3300005843 | Bacteria | 1584 |
| 207 | Ga0068862_100001613 | 3300005844 | Bacteria | 20538 |
| 208 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 209 | Ga0081538_10006434 | 3300005981 | Bacteria | 10342 |
| 210 | Ga0081540_1008868 | 3300005983 | Bacteria | 6982 |
| 211 | Ga0070717_10001460 | 3300006028 | Bacteria | 16328 |
| 212 | Ga0070717_10258285 | 3300006028 | Bacteria | 1541 |
| 213 | Ga0075364_10132626 | 3300006051 | Bacteria | 1673 |
| 214 | Ga0070715_10001906 | 3300006163 | Bacteria | 6267 |
| 215 | Ga0070715_10036277 | 3300006163 | Bacteria | 2032 |
| 216 | Ga0070715_10113475 | 3300006163 | Bacteria | 1282 |
| 217 | Ga0070716_100021168 | 3300006173 | Bacteria | 3423 |
| 218 | Ga0070716_100044339 | 3300006173 | Bacteria | 2491 |
| 219 | Ga0070716_100546627 | 3300006173 | Bacteria | 863 |
| 220 | Ga0070712_100036458 | 3300006175 | Bacteria | 3347 |
| 221 | Ga0070712_100101908 | 3300006175 | Bacteria | 2125 |
| 222 | Ga0070712_100157273 | 3300006175 | Bacteria | 1752 |
| 223 | Ga0070712_100248395 | 3300006175 | Bacteria | 1420 |
| 224 | Ga0075367_10135927 | 3300006178 | Bacteria | 1521 |
| 225 | Ga0097621_100000012 | 3300006237 | Bacteria | 105108 |
| 226 | Ga0097621_100038046 | 3300006237 | Bacteria | 3860 |
| 227 | Ga0097621_100320179 | 3300006237 | Bacteria | 1373 |
| 228 | Ga0075370_10120192 | 3300006353 | Bacteria | 1529 |
| 229 | Ga0068871_100000611 | 3300006358 | Bacteria | 24571 |
| 230 | Ga0068871_100011284 | 3300006358 | Bacteria | 6551 |
| 231 | Ga0068871_100193103 | 3300006358 | Bacteria | 1755 |
| 232 | Ga0075428_100000606 | 3300006844 | Bacteria | 36554 |
| 233 | Ga0075430_100000332 | 3300006846 | Bacteria | 33904 |
| 234 | Ga0075430_100236073 | 3300006846 | Bacteria | 1515 |
| 235 | Ga0075431_100000032 | 3300006847 | Bacteria | 72293 |
| 236 | Ga0075431_100028902 | 3300006847 | Bacteria | 5701 |
| 237 | Ga0075431_100044521 | 3300006847 | Bacteria | 4578 |
| 238 | Ga0075431_100340020 | 3300006847 | Bacteria | 1510 |
| 239 | Ga0075433_10000487 | 3300006852 | Bacteria | 25890 |
| 240 | Ga0075433_10007157 | 3300006852 | Bacteria | 8835 |
| 241 | Ga0075434_100000193 | 3300006871 | Bacteria | 40605 |
| 242 | Ga0075434_100000647 | 3300006871 | Bacteria | 26943 |
| 243 | Ga0075434_100009281 | 3300006871 | Bacteria | 9166 |
| 244 | Ga0075434_100163620 | 3300006871 | Bacteria | 2245 |
| 245 | Ga0075429_100000451 | 3300006880 | Bacteria | 30628 |
| 246 | Ga0075429_100008370 | 3300006880 | Bacteria | 9003 |
| 247 | Ga0068865_100001539 | 3300006881 | Bacteria | 13451 |
| 248 | Ga0068865_100010595 | 3300006881 | Bacteria | 5745 |
| 249 | Ga0075436_100067544 | 3300006914 | Bacteria | 2470 |
| 250 | Ga0075436_100124736 | 3300006914 | Bacteria | 1804 |
| 251 | Ga0075436_100198928 | 3300006914 | Bacteria | 1419 |
| 252 | Ga0097620_100039475 | 3300006931 | Bacteria | 4735 |
| 253 | Ga0097620_100199918 | 3300006931 | Bacteria | 2083 |
| 254 | Ga0097620_100266705 | 3300006931 | Bacteria | 1804 |
| 255 | Ga0075435_100003880 | 3300007076 | Bacteria | 10208 |
| 256 | Ga0075435_100356880 | 3300007076 | Bacteria | 1253 |
| 257 | Ga0099795_10000764 | 3300007788 | Bacteria | 6306 |
| 258 | Ga0105244_10039073 | 3300009036 | Bacteria | 2472 |
| 259 | Ga0105240_10025356 | 3300009093 | Bacteria | 7794 |
| 260 | Ga0105240_10070752 | 3300009093 | Bacteria | 4315 |
| 261 | Ga0105240_10164390 | 3300009093 | Bacteria | 2633 |
| 262 | Ga0105240_10187355 | 3300009093 | Bacteria | 2436 |
| 263 | Ga0105240_10683975 | 3300009093 | Bacteria | 1121 |
| 264 | Ga0111539_10000679 | 3300009094 | Bacteria | 44034 |
| 265 | Ga0111539_10000925 | 3300009094 | Bacteria | 38387 |
| 266 | Ga0111539_10001089 | 3300009094 | Bacteria | 35899 |
| 267 | Ga0111539_10002056 | 3300009094 | Bacteria | 26910 |
| 268 | Ga0105245_10000090 | 3300009098 | Bacteria | 90378 |
| 269 | Ga0105245_10169095 | 3300009098 | Bacteria | 2080 |
| 270 | Ga0105247_10002243 | 3300009101 | Bacteria | 13299 |
| 271 | Ga0105247_10067006 | 3300009101 | Bacteria | 2236 |
| 272 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 273 | Ga0114129_10006668 | 3300009147 | Bacteria | 16397 |
| 274 | Ga0114129_10006700 | 3300009147 | Bacteria | 16356 |
| 275 | Ga0114129_10158612 | 3300009147 | Bacteria | 3093 |
| 276 | Ga0105243_10003044 | 3300009148 | Bacteria | 13819 |
| 277 | Ga0105243_10124867 | 3300009148 | Bacteria | 2175 |
| 278 | Ga0105241_10071516 | 3300009174 | Bacteria | 2693 |
| 279 | Ga0105242_10000491 | 3300009176 | Bacteria | 31233 |
| 280 | Ga0105242_10027423 | 3300009176 | Bacteria | 4522 |
| 281 | Ga0105242_10147453 | 3300009176 | Bacteria | 2048 |
| 282 | Ga0105242_10153584 | 3300009176 | Bacteria | 2009 |
| 283 | Ga0105242_10938996 | 3300009176 | Bacteria | 868 |
| 284 | Ga0105248_10003797 | 3300009177 | Bacteria | 16742 |
| 285 | Ga0105248_10004778 | 3300009177 | Bacteria | 14992 |
| 286 | Ga0105248_10021356 | 3300009177 | Bacteria | 7175 |
| 287 | Ga0105248_10200987 | 3300009177 | Bacteria | 2245 |
| 288 | Ga0105248_10231848 | 3300009177 | Bacteria | 2078 |
| 289 | Ga0105237_10004589 | 3300009545 | Bacteria | 15948 |
| 290 | Ga0105237_10144669 | 3300009545 | Bacteria | 2372 |
| 291 | Ga0105237_10439885 | 3300009545 | Bacteria | 1310 |
| 292 | Ga0105238_10147753 | 3300009551 | Bacteria | 2327 |
| 293 | Ga0105238_10159650 | 3300009551 | Bacteria | 2230 |
| 294 | Ga0105238_10252634 | 3300009551 | Bacteria | 1742 |
| 295 | Ga0105249_10001085 | 3300009553 | Bacteria | 24172 |
| 296 | Ga0099796_10001065 | 3300010159 | Bacteria | 5228 |
| 297 | Ga0105239_10028016 | 3300010375 | Bacteria | 6199 |
| 298 | Ga0105239_10062647 | 3300010375 | Bacteria | 4082 |
| 299 | Ga0105246_10000052 | 3300011119 | Bacteria | 46290 |
| 300 | Ga0105246_10452631 | 3300011119 | Bacteria | 1079 |
| 301 | Ga0157337_1000687 | 3300012483 | Bacteria | 1600 |
| 302 | Ga0157341_1001502 | 3300012494 | Bacteria | 1423 |
| 303 | Ga0157373_10065420 | 3300013100 | Bacteria | 2573 |
| 304 | Ga0157373_10078404 | 3300013100 | Bacteria | 2329 |
| 305 | Ga0157371_10003401 | 3300013102 | Bacteria | 14457 |
| 306 | Ga0157371_10157646 | 3300013102 | Bacteria | 1621 |
| 307 | Ga0157370_10036546 | 3300013104 | Bacteria | 4765 |
| 308 | Ga0157370_10094541 | 3300013104 | Bacteria | 2804 |
| 309 | Ga0157370_10146110 | 3300013104 | Bacteria | 2202 |
| 310 | Ga0157370_10152946 | 3300013104 | Bacteria | 2147 |
| 311 | Ga0157369_10003829 | 3300013105 | Bacteria | 17867 |
| 312 | Ga0157369_10018011 | 3300013105 | Bacteria | 7924 |
| 313 | Ga0157369_10118116 | 3300013105 | Bacteria | 2815 |
| 314 | Ga0157369_10200279 | 3300013105 | Bacteria | 2096 |
| 315 | Ga0157369_10401104 | 3300013105 | Bacteria | 1423 |
| 316 | Ga0157369_10538490 | 3300013105 | Bacteria | 1207 |
| 317 | Ga0157369_10933449 | 3300013105 | Bacteria | 889 |
| 318 | Ga0157374_10001210 | 3300013296 | Bacteria | 22071 |
| 319 | Ga0157374_10421034 | 3300013296 | Bacteria | 1334 |
| 320 | Ga0157378_10002713 | 3300013297 | Bacteria | 15762 |
| 321 | Ga0157378_10038308 | 3300013297 | Bacteria | 4248 |
| 322 | Ga0157378_10160446 | 3300013297 | Bacteria | 2102 |
| 323 | Ga0157378_10220471 | 3300013297 | Bacteria | 1803 |
| 324 | Ga0163162_10000308 | 3300013306 | Bacteria | 45253 |
| 325 | Ga0163162_10031670 | 3300013306 | Bacteria | 5245 |
| 326 | Ga0163162_10100977 | 3300013306 | Bacteria | 2977 |
| 327 | Ga0157372_10002370 | 3300013307 | Bacteria | 20397 |
| 328 | Ga0157372_10084220 | 3300013307 | Bacteria | 3603 |
| 329 | Ga0157372_10295438 | 3300013307 | Bacteria | 1884 |
| 330 | Ga0157372_10312145 | 3300013307 | Bacteria | 1830 |
| 331 | Ga0157375_10000414 | 3300013308 | Bacteria | 38778 |
| 332 | Ga0157375_10074284 | 3300013308 | Bacteria | 3421 |
| 333 | Ga0163163_10002008 | 3300014325 | Bacteria | 17189 |
| 334 | Ga0163163_10002377 | 3300014325 | Bacteria | 15920 |
| 335 | Ga0163163_10012546 | 3300014325 | Bacteria | 7728 |
| 336 | Ga0163163_10873168 | 3300014325 | Bacteria | 963 |
| 337 | Ga0157380_10000122 | 3300014326 | Bacteria | 43303 |
| 338 | Ga0157380_10288493 | 3300014326 | Bacteria | 1505 |
| 339 | Ga0157377_10000688 | 3300014745 | Bacteria | 13982 |
| 340 | Ga0157379_10000261 | 3300014968 | Bacteria | 41455 |
| 341 | Ga0157379_10073523 | 3300014968 | Bacteria | 3060 |
| 342 | Ga0157379_10238046 | 3300014968 | Bacteria | 1651 |
| 343 | Ga0157376_10002538 | 3300014969 | Bacteria | 12376 |
| 344 | Ga0157376_10790483 | 3300014969 | Bacteria | 961 |
| 345 | Ga0163161_10000199 | 3300017792 | Bacteria | 55004 |
| 346 | Ga0163161_10033750 | 3300017792 | Bacteria | 3657 |
| 347 | Ga0163161_10420833 | 3300017792 | Bacteria | 1075 |
| 348 | Ga0197907_10366928 | 3300020069 | Bacteria | 1639 |
| 349 | Ga0206356_11492982 | 3300020070 | Bacteria | 1240 |
| 350 | Ga0206349_1289062 | 3300020075 | Bacteria | 982 |
| 351 | Ga0206349_1903841 | 3300020075 | Bacteria | 1130 |
| 352 | Ga0206355_1562117 | 3300020076 | Bacteria | 990 |
| 353 | Ga0206350_10159323 | 3300020080 | Bacteria | 1255 |
| 354 | Ga0206350_10981810 | 3300020080 | Bacteria | 1193 |
| 355 | Ga0206353_10968937 | 3300020082 | Bacteria | 1789 |
| 356 | Ga0206353_12065215 | 3300020082 | Bacteria | 1326 |
| 357 | Ga0213876_10004643 | 3300021384 | Bacteria | 7654 |
| 358 | Ga0224712_10075688 | 3300022467 | Bacteria | 1377 |
| 359 | Ga0224712_10159689 | 3300022467 | Bacteria | 1005 |
| 360 | Ga0207673_1000255 | 3300025290 | Bacteria | 5428 |
| 361 | Ga0207697_10136950 | 3300025315 | Bacteria | 1060 |
| 362 | Ga0207656_10061318 | 3300025321 | Bacteria | 1651 |
| 363 | Ga0207682_10000042 | 3300025893 | Bacteria | 52333 |
| 364 | Ga0207692_10006921 | 3300025898 | Bacteria | 4621 |
| 365 | Ga0207692_10010391 | 3300025898 | Bacteria | 3921 |
| 366 | Ga0207692_10099162 | 3300025898 | Bacteria | 1595 |
| 367 | Ga0207642_10000065 | 3300025899 | Bacteria | 29318 |
| 368 | Ga0207710_10000734 | 3300025900 | Bacteria | 18097 |
| 369 | Ga0207710_10001358 | 3300025900 | Bacteria | 12296 |
| 370 | Ga0207688_10000053 | 3300025901 | Bacteria | 41441 |
| 371 | Ga0207680_10006073 | 3300025903 | Bacteria | 5815 |
| 372 | Ga0207680_10018719 | 3300025903 | Bacteria | 3689 |
| 373 | Ga0207647_10002478 | 3300025904 | Bacteria | 13980 |
| 374 | Ga0207647_10062165 | 3300025904 | Bacteria | 2275 |
| 375 | Ga0207647_10207656 | 3300025904 | Bacteria | 1132 |
| 376 | Ga0207685_10048525 | 3300025905 | Bacteria | 1627 |
| 377 | Ga0207685_10128141 | 3300025905 | Bacteria | 1123 |
| 378 | Ga0207699_10375280 | 3300025906 | Bacteria | 1008 |
| 379 | Ga0207645_10071014 | 3300025907 | Bacteria | 2228 |
| 380 | Ga0207643_10000082 | 3300025908 | Bacteria | 62322 |
| 381 | Ga0207643_10246779 | 3300025908 | Bacteria | 1099 |
| 382 | Ga0207705_10049719 | 3300025909 | Bacteria | 3018 |
| 383 | Ga0207705_10076009 | 3300025909 | Bacteria | 2441 |
| 384 | Ga0207705_10082423 | 3300025909 | Bacteria | 2346 |
| 385 | Ga0207705_10129060 | 3300025909 | Bacteria | 1880 |
| 386 | Ga0207654_10004743 | 3300025911 | Bacteria | 6884 |
| 387 | Ga0207654_10080821 | 3300025911 | Bacteria | 1956 |
| 388 | Ga0207707_10017763 | 3300025912 | Bacteria | 6203 |
| 389 | Ga0207707_10027709 | 3300025912 | Bacteria | 4955 |
| 390 | Ga0207707_10054354 | 3300025912 | Bacteria | 3486 |
| 391 | Ga0207707_10184357 | 3300025912 | Bacteria | 1821 |
| 392 | Ga0207707_10273929 | 3300025912 | Bacteria | 1462 |
| 393 | Ga0207707_10613850 | 3300025912 | Bacteria | 919 |
| 394 | Ga0207695_10201924 | 3300025913 | Bacteria | 1902 |
| 395 | Ga0207695_10366959 | 3300025913 | Bacteria | 1326 |
| 396 | Ga0207671_10027981 | 3300025914 | Bacteria | 4213 |
| 397 | Ga0207671_10084027 | 3300025914 | Bacteria | 2390 |
| 398 | Ga0207693_10002221 | 3300025915 | Bacteria | 16903 |
| 399 | Ga0207693_10002937 | 3300025915 | Bacteria | 14752 |
| 400 | Ga0207693_10022497 | 3300025915 | Bacteria | 5009 |
| 401 | Ga0207693_10090878 | 3300025915 | Bacteria | 2393 |
| 402 | Ga0207693_10373000 | 3300025915 | Bacteria | 1116 |
| 403 | Ga0207663_10143548 | 3300025916 | Bacteria | 1666 |
| 404 | Ga0207663_10158452 | 3300025916 | Bacteria | 1595 |
| 405 | Ga0207663_10167262 | 3300025916 | Bacteria | 1558 |
| 406 | Ga0207660_10000083 | 3300025917 | Bacteria | 50279 |
| 407 | Ga0207660_10055323 | 3300025917 | Bacteria | 2835 |
| 408 | Ga0207660_10059620 | 3300025917 | Bacteria | 2740 |
| 409 | Ga0207660_10060659 | 3300025917 | Bacteria | 2720 |
| 410 | Ga0207660_10101559 | 3300025917 | Bacteria | 2149 |
| 411 | Ga0207660_10234908 | 3300025917 | Bacteria | 1442 |
| 412 | Ga0207657_10014898 | 3300025919 | Bacteria | 7564 |
| 413 | Ga0207657_10022232 | 3300025919 | Bacteria | 5944 |
| 414 | Ga0207657_10036176 | 3300025919 | Bacteria | 4421 |
| 415 | Ga0207649_10000643 | 3300025920 | Bacteria | 23321 |
| 416 | Ga0207649_10024908 | 3300025920 | Bacteria | 3483 |
| 417 | Ga0207649_10074397 | 3300025920 | Bacteria | 2180 |
| 418 | Ga0207649_10081876 | 3300025920 | Bacteria | 2091 |
| 419 | Ga0207652_10000557 | 3300025921 | Bacteria | 37611 |
| 420 | Ga0207652_10035660 | 3300025921 | Bacteria | 4200 |
| 421 | Ga0207652_10199447 | 3300025921 | Bacteria | 1801 |
| 422 | Ga0207652_10246694 | 3300025921 | Bacteria | 1610 |
| 423 | Ga0207681_10000271 | 3300025923 | Bacteria | 38955 |
| 424 | Ga0207694_10281115 | 3300025924 | Bacteria | 1367 |
| 425 | Ga0207694_10282189 | 3300025924 | Bacteria | 1364 |
| 426 | Ga0207650_10006111 | 3300025925 | Bacteria | 8203 |
| 427 | Ga0207650_10048796 | 3300025925 | Bacteria | 3123 |
| 428 | Ga0207650_10072156 | 3300025925 | Bacteria | 2598 |
| 429 | Ga0207659_10000161 | 3300025926 | Bacteria | 39821 |
| 430 | Ga0207659_10000460 | 3300025926 | Bacteria | 24451 |
| 431 | Ga0207659_10084817 | 3300025926 | Bacteria | 2352 |
| 432 | Ga0207659_10640818 | 3300025926 | Bacteria | 908 |
| 433 | Ga0207687_10000063 | 3300025927 | Bacteria | 83105 |
| 434 | Ga0207687_10013822 | 3300025927 | Bacteria | 5273 |
| 435 | Ga0207687_10061716 | 3300025927 | Bacteria | 2648 |
| 436 | Ga0207700_10004421 | 3300025928 | Bacteria | 8285 |
| 437 | Ga0207700_10106154 | 3300025928 | Bacteria | 2251 |
| 438 | Ga0207700_10321717 | 3300025928 | Unclassified | 1340 |
| 439 | Ga0207664_10004485 | 3300025929 | Bacteria | 9460 |
| 440 | Ga0207664_10063853 | 3300025929 | Bacteria | 2944 |
| 441 | Ga0207664_10110426 | 3300025929 | Bacteria | 2286 |
| 442 | Ga0207664_10123995 | 3300025929 | Bacteria | 2166 |
| 443 | Ga0207644_10000591 | 3300025931 | Bacteria | 23144 |
| 444 | Ga0207644_10003846 | 3300025931 | Bacteria | 9729 |
| 445 | Ga0207644_10011436 | 3300025931 | Bacteria | 5872 |
| 446 | Ga0207644_10015231 | 3300025931 | Bacteria | 5159 |
| 447 | Ga0207644_10165940 | 3300025931 | Bacteria | 1720 |
| 448 | Ga0207690_10000897 | 3300025932 | Bacteria | 19010 |
| 449 | Ga0207690_10061152 | 3300025932 | Bacteria | 2559 |
| 450 | Ga0207690_10063978 | 3300025932 | Bacteria | 2510 |
| 451 | Ga0207690_10106094 | 3300025932 | Bacteria | 2015 |
| 452 | Ga0207706_10054931 | 3300025933 | Bacteria | 3514 |
| 453 | Ga0207706_10068324 | 3300025933 | Bacteria | 3127 |
| 454 | Ga0207686_10000614 | 3300025934 | Bacteria | 22208 |
| 455 | Ga0207686_10009933 | 3300025934 | Bacteria | 5173 |
| 456 | Ga0207686_10038769 | 3300025934 | Bacteria | 2886 |
| 457 | Ga0207686_10132324 | 3300025934 | Bacteria | 1712 |
| 458 | Ga0207709_10000429 | 3300025935 | Bacteria | 40094 |
| 459 | Ga0207709_10076700 | 3300025935 | Bacteria | 2140 |
| 460 | Ga0207709_10131708 | 3300025935 | Bacteria | 1705 |
| 461 | Ga0207670_10000485 | 3300025936 | Bacteria | 21952 |
| 462 | Ga0207670_10044764 | 3300025936 | Bacteria | 2930 |
| 463 | Ga0207670_10202010 | 3300025936 | Bacteria | 1511 |
| 464 | Ga0207670_10392124 | 3300025936 | Bacteria | 1108 |
| 465 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 466 | Ga0207669_10062994 | 3300025937 | Bacteria | 2287 |
| 467 | Ga0207704_10000552 | 3300025938 | Bacteria | 16651 |
| 468 | Ga0207704_10013384 | 3300025938 | Bacteria | 4103 |
| 469 | Ga0207665_10007282 | 3300025939 | Bacteria | 7321 |
| 470 | Ga0207665_10015564 | 3300025939 | Bacteria | 4991 |
| 471 | Ga0207665_10035016 | 3300025939 | Bacteria | 3331 |
| 472 | Ga0207665_10074058 | 3300025939 | Bacteria | 2330 |
| 473 | Ga0207665_10112739 | 3300025939 | Bacteria | 1912 |
| 474 | Ga0207691_10043594 | 3300025940 | Bacteria | 4134 |
| 475 | Ga0207691_10074325 | 3300025940 | Bacteria | 3066 |
| 476 | Ga0207691_10432516 | 3300025940 | Bacteria | 1121 |
| 477 | Ga0207711_10009466 | 3300025941 | Bacteria | 8129 |
| 478 | Ga0207711_10025052 | 3300025941 | Bacteria | 5005 |
| 479 | Ga0207711_10033759 | 3300025941 | Bacteria | 4331 |
| 480 | Ga0207711_10154419 | 3300025941 | Bacteria | 2073 |
| 481 | Ga0207689_10001364 | 3300025942 | Bacteria | 23406 |
| 482 | Ga0207661_10000281 | 3300025944 | Bacteria | 32639 |
| 483 | Ga0207661_10064885 | 3300025944 | Bacteria | 2962 |
| 484 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 485 | Ga0207667_10004064 | 3300025949 | Bacteria | 17974 |
| 486 | Ga0207667_10079012 | 3300025949 | Bacteria | 3409 |
| 487 | Ga0207667_10107081 | 3300025949 | Bacteria | 2883 |
| 488 | Ga0207667_10266021 | 3300025949 | Bacteria | 1753 |
| 489 | Ga0207651_10000101 | 3300025960 | Bacteria | 37898 |
| 490 | Ga0207651_10013274 | 3300025960 | Bacteria | 4706 |
| 491 | Ga0207651_10037796 | 3300025960 | Bacteria | 3165 |
| 492 | Ga0207651_10508059 | 3300025960 | Bacteria | 1043 |
| 493 | Ga0207712_10000908 | 3300025961 | Bacteria | 21454 |
| 494 | Ga0207712_10031991 | 3300025961 | Bacteria | 3548 |
| 495 | Ga0207668_10000726 | 3300025972 | Bacteria | 20155 |
| 496 | Ga0207668_10275683 | 3300025972 | Bacteria | 1377 |
| 497 | Ga0207640_10000596 | 3300025981 | Bacteria | 21479 |
| 498 | Ga0207640_10078383 | 3300025981 | Bacteria | 2249 |
| 499 | Ga0207640_10157223 | 3300025981 | Bacteria | 1677 |
| 500 | Ga0207658_10003725 | 3300025986 | Bacteria | 10734 |
| 501 | Ga0207677_10000651 | 3300026023 | Bacteria | 20869 |
| 502 | Ga0207677_10073595 | 3300026023 | Bacteria | 2420 |
| 503 | Ga0207677_10144649 | 3300026023 | Bacteria | 1825 |
| 504 | Ga0207703_10001717 | 3300026035 | Bacteria | 19677 |
| 505 | Ga0207703_10015632 | 3300026035 | Bacteria | 5919 |
| 506 | Ga0207703_10020476 | 3300026035 | Bacteria | 5173 |
| 507 | Ga0207639_10002467 | 3300026041 | Bacteria | 12402 |
| 508 | Ga0207639_10060951 | 3300026041 | Bacteria | 2912 |
| 509 | Ga0207639_10116586 | 3300026041 | Bacteria | 2187 |
| 510 | Ga0207678_10014165 | 3300026067 | Bacteria | 7011 |
| 511 | Ga0207678_10022132 | 3300026067 | Bacteria | 5569 |
| 512 | Ga0207678_10402971 | 3300026067 | Bacteria | 1185 |
| 513 | Ga0207702_10234555 | 3300026078 | Bacteria | 1716 |
| 514 | Ga0207702_10502107 | 3300026078 | Bacteria | 1183 |
| 515 | Ga0207702_10745543 | 3300026078 | Bacteria | 967 |
| 516 | Ga0207641_10002162 | 3300026088 | Bacteria | 18511 |
| 517 | Ga0207641_10332482 | 3300026088 | Bacteria | 1444 |
| 518 | Ga0207648_10003986 | 3300026089 | Bacteria | 15325 |
| 519 | Ga0207648_10098193 | 3300026089 | Bacteria | 2564 |
| 520 | Ga0207676_10000563 | 3300026095 | Bacteria | 30791 |
| 521 | Ga0207676_10030839 | 3300026095 | Bacteria | 4028 |
| 522 | Ga0207674_10001207 | 3300026116 | Bacteria | 33673 |
| 523 | Ga0207674_10054631 | 3300026116 | Bacteria | 4065 |
| 524 | Ga0207674_10743219 | 3300026116 | Bacteria | 947 |
| 525 | Ga0207675_101229104 | 3300026118 | Bacteria | 769 |
| 526 | Ga0207683_10000324 | 3300026121 | Bacteria | 43461 |
| 527 | Ga0207683_10001459 | 3300026121 | Bacteria | 21325 |
| 528 | Ga0207683_10015259 | 3300026121 | Bacteria | 6538 |
| 529 | Ga0207683_10461918 | 3300026121 | Bacteria | 1171 |
| 530 | Ga0207698_10000634 | 3300026142 | Bacteria | 20408 |
| 531 | Ga0209973_1004080 | 3300027252 | Bacteria | 1479 |
| 532 | Ga0209995_1012542 | 3300027471 | Bacteria | 1383 |
| 533 | Ga0209179_1000922 | 3300027512 | Unclassified | 3316 |
| 534 | Ga0209982_1001520 | 3300027552 | Bacteria | 3183 |
| 535 | Ga0210002_1004553 | 3300027617 | Bacteria | 2068 |
| 536 | Ga0209971_1006277 | 3300027682 | Bacteria | 2813 |
| 537 | Ga0209966_1001336 | 3300027695 | Bacteria | 4326 |
| 538 | Ga0209813_10064996 | 3300027866 | Bacteria | 1173 |
| 539 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 540 | Ga0207428_10000180 | 3300027907 | Bacteria | 88557 |
| 541 | Ga0207428_10000286 | 3300027907 | Bacteria | 68250 |
| 542 | Ga0207428_10013177 | 3300027907 | Bacteria | 7238 |
| 543 | Ga0207428_10209604 | 3300027907 | Bacteria | 1464 |
| 544 | Ga0268266_10006553 | 3300028379 | Bacteria | 10645 |
| 545 | Ga0268266_10018702 | 3300028379 | Bacteria | 5903 |
| 546 | Ga0268266_10045032 | 3300028379 | Bacteria | 3773 |
| 547 | Ga0268265_10008091 | 3300028380 | Bacteria | 7105 |
| 548 | Ga0268265_10033423 | 3300028380 | Bacteria | 3739 |
| 549 | Ga0268264_10003472 | 3300028381 | Bacteria | 13591 |
| 550 | Ga0268264_10061668 | 3300028381 | Bacteria | 3146 |
| 551 | Ga0268264_10099215 | 3300028381 | Bacteria | 2527 |
| 552 | Ga0265337_1001317 | 3300028556 | Bacteria | 12368 |
| 553 | Ga0265334_10020588 | 3300028573 | Bacteria | 2701 |
| 554 | Ga0265338_10020386 | 3300028800 | Bacteria | 6975 |
| 555 | Ga0265762_1002070 | 3300030760 | Bacteria | 3658 |
| 556 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 557 | Ga0265325_10169954 | 3300031241 | Bacteria | 1021 |
| 558 | Ga0265339_10109301 | 3300031249 | Bacteria | 1432 |
| 559 | Ga0265316_10037941 | 3300031344 | Bacteria | 3885 |
| 560 | Ga0265316_10114806 | 3300031344 | Bacteria | 2037 |
| 561 | Ga0265316_10230703 | 3300031344 | Bacteria | 1363 |
| 562 | Ga0265316_10437309 | 3300031344 | Bacteria | 939 |
| 563 | Ga0265313_10028584 | 3300031595 | Bacteria | 2895 |
| 564 | Ga0265313_10062502 | 3300031595 | Bacteria | 1739 |
| 565 | Ga0307508_10221054 | 3300031616 | Bacteria | 1494 |
| 566 | Ga0265314_10046661 | 3300031711 | Bacteria | 3055 |
| 567 | Ga0265314_10088533 | 3300031711 | Bacteria | 2021 |
| 568 | Ga0265342_10000625 | 3300031712 | Bacteria | 37152 |
| 569 | Ga0265342_10005956 | 3300031712 | Bacteria | 9174 |
| 570 | Ga0307409_100720905 | 3300031995 | Bacteria | 998 |
| 571 | Ga0373930_0003817 | 3300034816 | Bacteria | 2414 |
| 572 | Ga0373930_0009997 | 3300034816 | Bacteria | 1686 |
| 573 | Ga0373948_0001446 | 3300034817 | Bacteria | 3297 |
| 574 | Ga0373948_0001993 | 3300034817 | Bacteria | 2943 |
| 575 | Ga0373950_0000469 | 3300034818 | Bacteria | 4928 |
| 576 | Ga0373958_0000037 | 3300034819 | Bacteria | 13403 |
| 577 | Ga0373958_0020735 | 3300034819 | Bacteria | 1214 |
| 578 | Ga0373938_0000190 | 3300034957 | Bacteria | 9113 |
| 579 | Ga0373938_0009129 | 3300034957 | Bacteria | 1788 |
| 580 | Ga0373938_0065615 | 3300034957 | Bacteria | 858 |
| 581 | Ga0373926_0106659 | 3300035083 | Bacteria | 1050 |
| 582 | Ga0373928_0000490 | 3300035084 | Bacteria | 7798 |
| 583 | Ga0373929_0000503 | 3300035085 | Bacteria | 7457 |
| 584 | Ga0373929_0085729 | 3300035085 | Bacteria | 774 |
| 585 | Ga0373940_0000178 | 3300035088 | Bacteria | 8521 |
| 586 | Ga0373940_0001969 | 3300035088 | Bacteria | 3878 |
| 587 | Ga0373940_0006230 | 3300035088 | Bacteria | 2635 |
| 588 | Ga0373944_0007842 | 3300035089 | Bacteria | 2871 |
| 589 | Ga0373949_0001015 | 3300035090 | Bacteria | 8648 |
| 590 | Ga0373949_0014010 | 3300035090 | Bacteria | 1783 |
| 591 | Ga0373949_0035920 | 3300035090 | Bacteria | 1200 |
| 592 | Ga0373951_0000165 | 3300035091 | Bacteria | 24248 |
| 593 | Ga0373951_0007934 | 3300035091 | Bacteria | 2406 |
| 594 | Ga0373952_0000676 | 3300035092 | Bacteria | 6045 |
| 595 | Ga0373952_0004795 | 3300035092 | Bacteria | 2461 |
| 596 | Ga0373923_0000996 | 3300035111 | Bacteria | 7664 |
| 597 | Ga0373923_0055815 | 3300035111 | Bacteria | 1666 |
| 598 | Ga0373932_0000221 | 3300035112 | Bacteria | 16961 |
| 599 | Ga0373932_0011462 | 3300035112 | Bacteria | 2166 |
| 600 | Ga0373939_0000178 | 3300035114 | Bacteria | 17639 |
| 601 | Ga0373939_0000211 | 3300035114 | Bacteria | 16115 |
| 602 | Ga0373941_0000085 | 3300035115 | Bacteria | 15179 |
| 603 | Ga0373945_0017285 | 3300035116 | Bacteria | 2441 |
| 604 | Ga0373945_0032699 | 3300035116 | Bacteria | 1844 |
| 605 | Ga0373954_0009599 | 3300035118 | Bacteria | 4258 |
| 606 | Ga0373954_0131830 | 3300035118 | Bacteria | 1217 |
| 607 | Ga0373956_0034112 | 3300035119 | Bacteria | 2241 |
| 608 | Ga0373956_0184022 | 3300035119 | Bacteria | 988 |
| 609 | Ga0373957_0021944 | 3300035120 | Bacteria | 2271 |
| 610 | Ga0373960_0002021 | 3300035121 | Bacteria | 4557 |
| 611 | Ga0373960_0003781 | 3300035121 | Bacteria | 3441 |
| 612 | Ga0373943_0029129 | 3300035170 | Bacteria | 2607 |
| 613 | Ga0373943_0045435 | 3300035170 | Bacteria | 2140 |
| 614 | Ga0373943_0098150 | 3300035170 | Bacteria | 1528 |
| 615 | Ga0373943_0191361 | 3300035170 | Unclassified | 1129 |
| 616 | Ga0373946_0009900 | 3300035171 | Bacteria | 3523 |
| 617 | Ga0373955_0020162 | 3300035172 | Bacteria | 3347 |
| 618 | Ga0373955_0037464 | 3300035172 | Bacteria | 2578 |
| 619 | Ga0373955_0050566 | 3300035172 | Bacteria | 2261 |
| 620 | Ga0373942_0000892 | 3300035207 | Bacteria | 8167 |
| 621 | Ga0373942_0006884 | 3300035207 | Bacteria | 2627 |
| 622 | Ga0373961_0001088 | 3300035241 | Bacteria | 8657 |
| 623 | Ga0373961_0002998 | 3300035241 | Bacteria | 4261 |
| 624 | Ga0373962_0000271 | 3300035242 | Bacteria | 11153 |
| 625 | Ga0373962_0008443 | 3300035242 | Bacteria | 2534 |
| 626 | Ga0373924_0025342 | 3300035410 | Bacteria | 2345 |
| 627 | Ga0373931_0000854 | 3300035691 | Bacteria | 12844 |
| 628 | Ga0373931_0002074 | 3300035691 | Bacteria | 8820 |
| 629 | Ga0373931_0007900 | 3300035691 | Bacteria | 5031 |
| 630 | Ga0373931_0049738 | 3300035691 | Bacteria | 2228 |
| 631 | Ga0373935_0008929 | 3300035692 | Bacteria | 5998 |
| 632 | Ga0373935_0050374 | 3300035692 | Bacteria | 2643 |
| 633 | Ga0373935_0110958 | 3300035692 | Bacteria | 1820 |
| 634 | Ga0373935_0138609 | 3300035692 | Bacteria | 1641 |
| 635 | Ga0373927_0089079 | 3300035695 | Bacteria | 2004 |
| 636 | Ga0373933_0004073 | 3300035724 | Bacteria | 8051 |
| 637 | Ga0373933_0007699 | 3300035724 | Bacteria | 5882 |
| 638 | Ga0373933_0046184 | 3300035724 | Bacteria | 2585 |
| 639 | Ga0373947_0041566 | 3300035725 | Bacteria | 2741 |
| 640 | Ga0373947_0159352 | 3300035725 | Unclassified | 1459 |
| 641 | Ga0373947_0225739 | 3300035725 | Bacteria | 1232 |
| 642 | Ga0373937_0077423 | 3300036401 | Bacteria | 3073 |
| 643 | Ga0316582_0165993 | 3300036647 | Bacteria | 1497 |
| 644 | Ga0373925_0011017 | 3300037068 | Bacteria | 6566 |
| 645 | Ga0373925_0045167 | 3300037068 | Bacteria | 3272 |
| 646 | Ga0373925_0047336 | 3300037068 | Bacteria | 3201 |
| 647 | Ga0373925_0087073 | 3300037068 | Bacteria | 2384 |
| 648 | Ga0395899_0038839 | 3300037312 | Bacteria | 3564 |
| 649 | Ga0395899_0082520 | 3300037312 | Bacteria | 2338 |
| 650 | Ga0395900_0014629 | 3300037418 | Bacteria | 8003 |
| 651 | Ga0395900_0024394 | 3300037418 | Bacteria | 6193 |
| 652 | Ga0395900_0050879 | 3300037418 | Bacteria | 4267 |
| 653 | Ga0395900_0517648 | 3300037418 | Bacteria | 1141 |
| 654 | Ga0395898_0009463 | 3300037466 | Bacteria | 10236 |
| 655 | Ga0395898_0023981 | 3300037466 | Bacteria | 6157 |
| 656 | Ga0395898_0030144 | 3300037466 | Bacteria | 5430 |
| 657 | Ga0395898_0068066 | 3300037466 | Bacteria | 3446 |
| 658 | Ga0395898_0132494 | 3300037466 | Bacteria | 2387 |
| 659 | Ga0395901_0052014 | 3300038443 | Bacteria | 4258 |
| 660 | Ga0395901_0180343 | 3300038443 | Bacteria | 2215 |
| 661 | Ga0395901_0770549 | 3300038443 | Bacteria | 953 |
| 662 | Ga0436360_0512340 | 3300039438 | Bacteria | 1707 |
| 663 | Ga0436363_0863782 | 3300039450 | Bacteria | 5485 |
| 664 | Ga0436362_0872704 | 3300039453 | Bacteria | 1076 |
| 665 | Ga0439455_0060558 | 3300042012 | Bacteria | 1003 |
| 666 | Ga0439464_0010927 | 3300042439 | Bacteria | 2400 |
| 667 | Ga0439460_0002807 | 3300042461 | Bacteria | 4194 |
| 668 | Ga0451577_0110064 | 3300042876 | Bacteria | 2464 |
| 669 | Ga0466963_0267961 | 3300044694 | Bacteria | 1200 |
| 670 | Ga0453684_0033092 | 3300044712 | Bacteria | 7214 |
| 671 | Ga0466957_0050126 | 3300044842 | Bacteria | 2540 |
| 672 | Ga0466967_0184085 | 3300045976 | Bacteria | 1972 |
| 673 | Ga0466967_0217091 | 3300045976 | Bacteria | 1816 |
| 674 | Ga0495617_008378 | 3300046452 | Bacteria | 3565 |
| 675 | Ga0495592_0030221 | 3300046454 | Bacteria | 4098 |
| 676 | Ga0495592_0088238 | 3300046454 | Bacteria | 2229 |
| 677 | Ga0495603_0023238 | 3300046455 | Bacteria | 3753 |
| 678 | Ga0495629_0022575 | 3300046459 | Bacteria | 4486 |
| 679 | Ga0495629_0190023 | 3300046459 | Bacteria | 1421 |
| 680 | Ga0495629_0191748 | 3300046459 | Bacteria | 1414 |
| 681 | Ga0495641_0284007 | 3300046461 | Unclassified | 745 |
| 682 | Ga0495651_0024567 | 3300046462 | Bacteria | 4687 |
| 683 | Ga0495651_0067604 | 3300046462 | Bacteria | 2726 |
| 684 | Ga0495651_0113179 | 3300046462 | Bacteria | 2003 |
| 685 | Ga0495651_0217278 | 3300046462 | Bacteria | 1326 |
| 686 | Ga0495653_0091209 | 3300046463 | Bacteria | 2228 |
| 687 | Ga0495580_0012209 | 3300046472 | Bacteria | 6598 |
| 688 | Ga0495580_0182157 | 3300046472 | Bacteria | 1450 |
| 689 | Ga0495582_0105976 | 3300046473 | Bacteria | 1577 |
| 690 | Ga0495605_0067466 | 3300046474 | Bacteria | 1697 |
| 691 | Ga0495639_0009652 | 3300046475 | Bacteria | 4141 |
| 692 | Ga0495662_0007526 | 3300046476 | Bacteria | 5378 |
| 693 | Ga0495664_0020087 | 3300046477 | Bacteria | 3848 |
| 694 | Ga0495664_0092243 | 3300046477 | Bacteria | 1821 |
| 695 | Ga0495664_0259994 | 3300046477 | Bacteria | 1049 |
| 696 | Ga0495584_0002387 | 3300046491 | Bacteria | 10658 |
| 697 | Ga0495585_0006758 | 3300046492 | Bacteria | 7079 |
| 698 | Ga0495594_0003274 | 3300046499 | Bacteria | 8388 |
| 699 | Ga0495594_0134764 | 3300046499 | Bacteria | 1399 |
| 700 | Ga0495607_0004095 | 3300046501 | Bacteria | 10894 |
| 701 | Ga0495608_0004901 | 3300046511 | Bacteria | 9585 |
| 702 | Ga0495608_0129443 | 3300046511 | Bacteria | 1616 |
| 703 | Ga0495608_0159950 | 3300046511 | Bacteria | 1432 |
| 704 | Ga0495608_0348362 | 3300046511 | Bacteria | 912 |
| 705 | Ga0495608_0435981 | 3300046511 | Bacteria | 798 |
| 706 | Ga0495618_0197332 | 3300046514 | Bacteria | 1274 |
| 707 | Ga0495628_0000249 | 3300046516 | Bacteria | 47492 |
| 708 | Ga0495628_0037161 | 3300046516 | Bacteria | 3905 |
| 709 | Ga0495628_0291751 | 3300046516 | Bacteria | 1209 |
| 710 | Ga0495630_0031426 | 3300046517 | Bacteria | 3953 |
| 711 | Ga0495630_0042795 | 3300046517 | Bacteria | 3382 |
| 712 | Ga0495644_0000563 | 3300046523 | Bacteria | 15597 |
| 713 | Ga0495663_0071740 | 3300046525 | Bacteria | 1104 |
| 714 | Ga0495666_0007295 | 3300046526 | Bacteria | 5545 |
| 715 | Ga0495652_0027838 | 3300046529 | Bacteria | 4979 |
| 716 | Ga0495652_0044789 | 3300046529 | Bacteria | 3808 |
| 717 | Ga0495652_0046742 | 3300046529 | Bacteria | 3714 |
| 718 | Ga0495652_0077412 | 3300046529 | Bacteria | 2757 |
| 719 | Ga0495652_0278058 | 3300046529 | Bacteria | 1227 |
| 720 | Ga0495665_0042064 | 3300046531 | Bacteria | 2432 |
| 721 | Ga0495665_0069679 | 3300046531 | Bacteria | 1854 |
| 722 | Ga0495640_0024501 | 3300046533 | Bacteria | 4388 |
| 723 | Ga0495640_0043942 | 3300046533 | Bacteria | 3108 |
| 724 | Ga0495640_0218567 | 3300046533 | Bacteria | 1202 |
| 725 | Ga0495640_0263127 | 3300046533 | Bacteria | 1077 |
| 726 | Ga0495586_0005125 | 3300046535 | Bacteria | 7014 |
| 727 | Ga0495587_0027576 | 3300046536 | Bacteria | 3458 |
| 728 | Ga0495598_0008777 | 3300046537 | Bacteria | 2365 |
| 729 | Ga0495645_0001006 | 3300046543 | Bacteria | 19191 |
| 730 | Ga0495645_0317106 | 3300046543 | Bacteria | 1013 |
| 731 | Ga0495622_0009107 | 3300046557 | Bacteria | 4596 |
| 732 | Ga0495633_0009862 | 3300046558 | Bacteria | 5248 |
| 733 | Ga0495667_0015258 | 3300046559 | Bacteria | 5188 |
| 734 | Ga0495667_0122831 | 3300046559 | Unclassified | 1676 |
| 735 | Ga0495667_0127270 | 3300046559 | Bacteria | 1643 |
| 736 | Ga0495656_0000123 | 3300046615 | Bacteria | 29630 |
| 737 | Ga0495656_0032264 | 3300046615 | Bacteria | 2130 |
| 738 | Ga0495634_0201777 | 3300046642 | Bacteria | 1235 |
| 739 | Ga0495611_0031419 | 3300046648 | Bacteria | 2337 |
| 740 | Ga0495635_0009801 | 3300046663 | Bacteria | 6696 |
| 741 | Ga0495635_0017843 | 3300046663 | Bacteria | 4957 |
| 742 | Ga0495635_0089336 | 3300046663 | Bacteria | 2108 |
| 743 | Ga0495635_0110448 | 3300046663 | Bacteria | 1878 |
| 744 | Ga0495659_0000648 | 3300046664 | Bacteria | 12635 |
| 745 | Ga0495661_0164897 | 3300046665 | Bacteria | 1186 |
| 746 | Ga0495588_0008051 | 3300046674 | Bacteria | 4817 |
| 747 | Ga0495657_0057935 | 3300046675 | Bacteria | 2574 |
| 748 | Ga0495657_0081193 | 3300046675 | Bacteria | 2097 |
| 749 | Ga0495657_0192064 | 3300046675 | Bacteria | 1248 |
| 750 | Ga0495599_0054244 | 3300046678 | Bacteria | 2511 |
| 751 | Ga0495599_0083707 | 3300046678 | Bacteria | 1992 |
| 752 | Ga0495599_0299090 | 3300046678 | Bacteria | 972 |
| 753 | Ga0495623_0020953 | 3300046679 | Bacteria | 4224 |
| 754 | Ga0495646_0023160 | 3300046680 | Bacteria | 3911 |
| 755 | Ga0495646_0042236 | 3300046680 | Bacteria | 2799 |
| 756 | Ga0495646_0185451 | 3300046680 | Bacteria | 1140 |
| 757 | Ga0495647_0022026 | 3300046681 | Bacteria | 2300 |
| 758 | Ga0495658_0070081 | 3300046683 | Bacteria | 2033 |
| 759 | Ga0495669_0035712 | 3300046684 | Bacteria | 2195 |
| 760 | Ga0495669_0097911 | 3300046684 | Bacteria | 1360 |
| 761 | Ga0495624_0042350 | 3300046690 | Bacteria | 2909 |
| 762 | Ga0495624_0111873 | 3300046690 | Bacteria | 1678 |
| 763 | Ga0495670_0000220 | 3300046691 | Bacteria | 25973 |
| 764 | Ga0495671_0152732 | 3300046692 | Bacteria | 1124 |
| 765 | Ga0495589_0020366 | 3300046794 | Bacteria | 3392 |
| 766 | Ga0495600_0002039 | 3300046809 | Bacteria | 11375 |
| 767 | Ga0495600_0038138 | 3300046809 | Bacteria | 3126 |
| 768 | Ga0495600_0118220 | 3300046809 | Unclassified | 1724 |
| 769 | Ga0495581_0004313 | 3300047315 | Bacteria | 8208 |
| 770 | Ga0495581_0204678 | 3300047315 | Bacteria | 1154 |
| 771 | Ga0495604_0004173 | 3300047317 | Bacteria | 11457 |
| 772 | Ga0495604_0010825 | 3300047317 | Bacteria | 7244 |
| 773 | Ga0495604_0013909 | 3300047317 | Bacteria | 6418 |
| 774 | Ga0495604_0038467 | 3300047317 | Bacteria | 3764 |
| 775 | Ga0495604_0110806 | 3300047317 | Bacteria | 2002 |
| 776 | Ga0495636_0173418 | 3300047318 | Bacteria | 976 |
| 777 | Ga0495674_0024302 | 3300047319 | Bacteria | 5569 |
| 778 | Ga0495674_0088560 | 3300047319 | Bacteria | 2647 |
| 779 | Ga0495674_0099235 | 3300047319 | Bacteria | 2479 |
| 780 | Ga0495674_0131761 | 3300047319 | Bacteria | 2106 |
| 781 | Ga0495674_0191414 | 3300047319 | Bacteria | 1700 |
| 782 | Ga0495676_0061723 | 3300047321 | Bacteria | 2930 |
| 783 | Ga0495680_0034890 | 3300047322 | Bacteria | 4057 |
| 784 | Ga0495680_0080206 | 3300047322 | Bacteria | 2466 |
| 785 | Ga0495680_0448348 | 3300047322 | Bacteria | 883 |
| 786 | Ga0495675_0242353 | 3300047444 | Bacteria | 1085 |
| 787 | Ga0495684_0002684 | 3300047471 | Bacteria | 14089 |
| 788 | Ga0495593_0149038 | 3300047673 | Bacteria | 1183 |
| 789 | Ga0495593_0154193 | 3300047673 | Bacteria | 1161 |
| 790 | Ga0495593_0219393 | 3300047673 | Bacteria | 954 |
| 791 | Ga0495602_0011207 | 3300048088 | Bacteria | 9270 |
| 792 | Ga0495602_0066131 | 3300048088 | Bacteria | 3116 |
| 793 | Ga0495602_0076573 | 3300048088 | Bacteria | 2834 |
| 794 | Ga0495614_0026352 | 3300048089 | Bacteria | 2505 |
| 795 | Ga0496100_0001041 | 3300048903 | Bacteria | 13411 |
| 796 | Ga0496100_0004355 | 3300048903 | Bacteria | 7497 |
| 797 | Ga0496100_0058000 | 3300048903 | Bacteria | 2539 |
| 798 | Ga0496100_0146317 | 3300048903 | Bacteria | 1680 |
| 799 | Ga0496101_0000468 | 3300048904 | Bacteria | 25464 |
| 800 | Ga0496101_0022852 | 3300048904 | Bacteria | 4312 |
| 801 | Ga0496101_0062981 | 3300048904 | Bacteria | 2698 |
| 802 | Ga0496101_0152271 | 3300048904 | Bacteria | 1769 |
| 803 | Ga0496102_0006543 | 3300048905 | Bacteria | 9947 |
| 804 | Ga0496102_0009433 | 3300048905 | Bacteria | 8383 |
| 805 | Ga0496102_0014986 | 3300048905 | Bacteria | 6747 |
| 806 | Ga0496102_0049095 | 3300048905 | Bacteria | 3838 |
| 807 | Ga0496102_0085915 | 3300048905 | Bacteria | 2905 |
| 808 | Ga0496102_0400534 | 3300048905 | Bacteria | 1290 |
| 809 | Ga0496102_0404646 | 3300048905 | Bacteria | 1283 |
| 810 | Ga0496102_0462804 | 3300048905 | Bacteria | 1189 |
| 811 | Ga0496103_0004706 | 3300048906 | Bacteria | 8255 |
| 812 | Ga0496103_0122185 | 3300048906 | Unclassified | 1659 |
| 813 | Ga0496103_0312723 | 3300048906 | Bacteria | 1010 |
| 814 | Ga0496104_0000239 | 3300048907 | Bacteria | 48386 |
| 815 | Ga0496104_0002158 | 3300048907 | Bacteria | 17075 |
| 816 | Ga0496104_0096042 | 3300048907 | Bacteria | 2835 |
| 817 | Ga0496104_0152769 | 3300048907 | Bacteria | 2215 |
| 818 | Ga0496104_0163840 | 3300048907 | Bacteria | 2132 |
| 819 | Ga0496105_0000324 | 3300048908 | Bacteria | 31277 |
| 820 | Ga0496105_0012329 | 3300048908 | Bacteria | 6768 |
| 821 | Ga0496105_0036316 | 3300048908 | Bacteria | 4059 |
| 822 | Ga0496105_0047936 | 3300048908 | Bacteria | 3526 |
| 823 | Ga0496105_0522533 | 3300048908 | Bacteria | 929 |
| 824 | Ga0496105_0547882 | 3300048908 | Bacteria | 903 |
| 825 | Ga0496106_0022981 | 3300048909 | Bacteria | 4631 |
| 826 | Ga0496106_0031663 | 3300048909 | Bacteria | 3941 |
| 827 | Ga0496106_0067044 | 3300048909 | Bacteria | 2735 |
| 828 | Ga0496106_0075506 | 3300048909 | Bacteria | 2582 |
| 829 | Ga0496106_0079869 | 3300048909 | Bacteria | 2511 |
| 830 | Ga0496106_0113829 | 3300048909 | Bacteria | 2109 |
| 831 | Ga0496107_0000965 | 3300048910 | Bacteria | 17064 |
| 832 | Ga0496107_0012402 | 3300048910 | Bacteria | 5948 |
| 833 | Ga0496107_0045438 | 3300048910 | Bacteria | 3159 |
| 834 | Ga0496107_0065092 | 3300048910 | Unclassified | 2642 |
| 835 | Ga0496107_0258830 | 3300048910 | Bacteria | 1295 |
| 836 | Ga0496108_0001543 | 3300048911 | Bacteria | 18244 |
| 837 | Ga0496108_0001911 | 3300048911 | Bacteria | 16662 |
| 838 | Ga0496108_0005663 | 3300048911 | Bacteria | 10116 |
| 839 | Ga0496108_0026989 | 3300048911 | Bacteria | 4739 |
| 840 | Ga0496108_0049695 | 3300048911 | Bacteria | 3508 |
| 841 | Ga0496108_0122672 | 3300048911 | Bacteria | 2230 |
| 842 | Ga0496108_0262208 | 3300048911 | Bacteria | 1504 |
| 843 | Ga0496109_0000414 | 3300048912 | Bacteria | 37873 |
| 844 | Ga0496109_0004282 | 3300048912 | Bacteria | 11922 |
| 845 | Ga0496109_0032054 | 3300048912 | Bacteria | 4721 |
| 846 | Ga0496109_0177843 | 3300048912 | Bacteria | 1998 |
| 847 | Ga0496110_0008470 | 3300048913 | Bacteria | 8278 |
| 848 | Ga0496110_0008902 | 3300048913 | Bacteria | 8092 |
| 849 | Ga0496110_0013604 | 3300048913 | Bacteria | 6736 |
| 850 | Ga0496110_0065165 | 3300048913 | Bacteria | 3221 |
| 851 | Ga0496111_0001884 | 3300048914 | Bacteria | 12408 |
| 852 | Ga0496111_0028377 | 3300048914 | Bacteria | 3966 |
| 853 | Ga0496111_0085077 | 3300048914 | Bacteria | 2312 |
| 854 | Ga0496111_0132403 | 3300048914 | Bacteria | 1846 |
| 855 | Ga0496112_0020521 | 3300048915 | Bacteria | 6264 |
| 856 | Ga0496112_0024544 | 3300048915 | Bacteria | 5775 |
| 857 | Ga0496112_0073867 | 3300048915 | Bacteria | 3371 |
| 858 | Ga0496112_0078691 | 3300048915 | Bacteria | 3260 |
| 859 | Ga0496112_0137954 | 3300048915 | Bacteria | 2409 |
| 860 | Ga0496112_0179269 | 3300048915 | Bacteria | 2082 |
| 861 | Ga0496112_0251695 | 3300048915 | Bacteria | 1717 |
| 862 | Ga0496113_0027002 | 3300048916 | Bacteria | 4111 |
| 863 | Ga0496113_0030381 | 3300048916 | Bacteria | 3911 |
| 864 | Ga0496113_0047579 | 3300048916 | Bacteria | 3187 |
| 865 | Ga0496113_0088736 | 3300048916 | Bacteria | 2379 |
| 866 | Ga0496114_0003058 | 3300048917 | Bacteria | 12813 |
| 867 | Ga0496114_0013686 | 3300048917 | Bacteria | 6504 |
| 868 | Ga0496114_0047654 | 3300048917 | Bacteria | 3564 |
| 869 | Ga0496114_0083433 | 3300048917 | Bacteria | 2704 |
| 870 | Ga0496115_0003980 | 3300048918 | Bacteria | 10658 |
| 871 | Ga0496115_0021595 | 3300048918 | Bacteria | 4974 |
| 872 | Ga0496115_0026545 | 3300048918 | Bacteria | 4521 |
| 873 | Ga0496115_0055608 | 3300048918 | Bacteria | 3179 |
| 874 | Ga0496126_0012762 | 3300048929 | Bacteria | 8587 |
| 875 | Ga0496126_0031507 | 3300048929 | Bacteria | 5009 |
| 876 | Ga0501032_0032946 | 3300049569 | Bacteria | 3551 |
| 877 | Ga0501033_0045165 | 3300049570 | Bacteria | 3279 |
| 878 | Ga0501034_0045067 | 3300049571 | Bacteria | 4458 |
| 879 | Ga0501034_0083273 | 3300049571 | Bacteria | 3201 |
| 880 | Ga0501034_0247642 | 3300049571 | Bacteria | 1727 |
| 881 | Ga0501036_0078814 | 3300049572 | Bacteria | 2786 |
| 882 | Ga0501036_0114523 | 3300049572 | Bacteria | 2279 |
| 883 | Ga0501036_0261705 | 3300049572 | Bacteria | 1449 |
| 884 | Ga0501037_0079639 | 3300049573 | Bacteria | 2378 |
| 885 | Ga0501037_0095810 | 3300049573 | Bacteria | 2145 |
| 886 | Ga0501038_0062312 | 3300049574 | Bacteria | 3187 |
| 887 | Ga0501038_0114841 | 3300049574 | Bacteria | 2226 |
| 888 | Ga0501039_0072917 | 3300049575 | Bacteria | 2668 |
| 889 | Ga0501042_0034896 | 3300049578 | Bacteria | 3568 |
| 890 | Ga0501043_0029465 | 3300049579 | Bacteria | 4312 |
| 891 | Ga0501043_0048574 | 3300049579 | Bacteria | 3336 |
| 892 | Ga0501043_0071429 | 3300049579 | Bacteria | 2726 |
| 893 | Ga0501046_0033511 | 3300049580 | Bacteria | 4149 |
| 894 | Ga0501046_0075628 | 3300049580 | Bacteria | 2610 |
| 895 | Ga0501047_0011528 | 3300049581 | Bacteria | 8368 |
| 896 | Ga0501047_0046098 | 3300049581 | Bacteria | 4214 |
| 897 | Ga0501047_0051298 | 3300049581 | Bacteria | 3985 |
| 898 | Ga0501047_0112358 | 3300049581 | Bacteria | 2606 |
| 899 | Ga0501047_0114461 | 3300049581 | Bacteria | 2579 |
| 900 | Ga0501069_0263236 | 3300049585 | Bacteria | 1007 |
| 901 | Ga0501070_0003250 | 3300049586 | Bacteria | 14106 |
| 902 | Ga0501070_0171230 | 3300049586 | Bacteria | 1788 |
| 903 | Ga0501070_0238056 | 3300049586 | Bacteria | 1490 |
| 904 | Ga0501071_0039005 | 3300049587 | Bacteria | 3397 |
| 905 | Ga0501071_0195842 | 3300049587 | Bacteria | 1517 |
| 906 | Ga0501072_0000327 | 3300049588 | Bacteria | 33913 |
| 907 | Ga0501072_0080592 | 3300049588 | Bacteria | 2580 |
| 908 | Ga0501073_0247978 | 3300049589 | Bacteria | 1229 |
| 909 | Ga0501074_0140243 | 3300049590 | Bacteria | 1729 |
| 910 | Ga0501074_0252901 | 3300049590 | Bacteria | 1253 |
| 911 | Ga0501076_0009353 | 3300049592 | Bacteria | 7235 |
| 912 | Ga0501076_0149669 | 3300049592 | Bacteria | 1899 |
| 913 | Ga0501077_0025325 | 3300049593 | Bacteria | 3769 |
| 914 | Ga0501077_0111132 | 3300049593 | Unclassified | 1737 |
| 915 | Ga0501079_0046174 | 3300049741 | Bacteria | 3361 |
| 916 | Ga0501080_0202684 | 3300049742 | Bacteria | 1821 |
| 917 | Ga0501080_0807015 | 3300049742 | Unclassified | 823 |
| 918 | Ga0501081_0018810 | 3300049743 | Bacteria | 4589 |
| 919 | Ga0501035_0043376 | 3300049822 | Bacteria | 4053 |
| 920 | Ga0501035_0127484 | 3300049822 | Bacteria | 2221 |
| 921 | Ga0501044_0016958 | 3300049823 | Bacteria | 7815 |
| 922 | Ga0501044_0069624 | 3300049823 | Bacteria | 3581 |
| 923 | Ga0501044_0094920 | 3300049823 | Bacteria | 3006 |
| 924 | Ga0501044_0321505 | 3300049823 | Bacteria | 1471 |
| 925 | nmdc:mga00v17_68998_c1 | 3300050491 | Bacteria | 2186 |
| 926 | nmdc:mga04h51_77702_c1 | 3300050495 | Bacteria | 1172 |
| 927 | nmdc:mga07m45_66019_c1 | 3300050496 | Bacteria | 2055 |
| 928 | nmdc:mga05p37_10573_c1 | 3300050507 | Bacteria | 10943 |
| 929 | nmdc:mga05p37_56237_c1 | 3300050507 | Bacteria | 4843 |
| 930 | nmdc:mga05p37_564_c1 | 3300050507 | Bacteria | 40786 |
| 931 | nmdc:mga05p37_863_c1 | 3300050507 | Bacteria | 34108 |
| 932 | nmdc:mga09592_1701_c1 | 3300050508 | Bacteria | 17738 |
| 933 | nmdc:mga09592_7130_c1 | 3300050508 | Bacteria | 9087 |
| 934 | nmdc:mga0qj67_110528_c1 | 3300050509 | Bacteria | 2218 |
| 935 | nmdc:mga0qj67_11539_c1 | 3300050509 | Bacteria | 6622 |
| 936 | nmdc:mga0qj67_245347_c1 | 3300050509 | Bacteria | 1453 |
| 937 | nmdc:mga0qj67_2984_c1 | 3300050509 | Bacteria | 12144 |
| 938 | nmdc:mga06r32_157181_c1 | 3300050510 | Bacteria | 2255 |
| 939 | nmdc:mga06r32_191_c1 | 3300050510 | Bacteria | 49056 |
| 940 | nmdc:mga06r32_40426_c1 | 3300050510 | Bacteria | 4427 |
| 941 | nmdc:mga06r32_6584_c1 | 3300050510 | Bacteria | 10438 |
| 942 | nmdc:mga08y16_13856_c1 | 3300050511 | Bacteria | 8486 |
| 943 | nmdc:mga08y16_2133_c1 | 3300050511 | Bacteria | 20270 |
| 944 | nmdc:mga08y16_3076_c1 | 3300050511 | Bacteria | 17248 |
| 945 | nmdc:mga08y16_89_c1 | 3300050511 | Bacteria | 76793 |
| 946 | nmdc:mga0n895_104046_c1 | 3300050512 | Bacteria | 2851 |
| 947 | nmdc:mga0n895_141086_c1 | 3300050512 | Bacteria | 2438 |
| 948 | nmdc:mga0n895_164171_c1 | 3300050512 | Bacteria | 2252 |
| 949 | nmdc:mga0n895_335732_c1 | 3300050512 | Bacteria | 1531 |
| 950 | nmdc:mga0n895_359762_c1 | 3300050512 | Bacteria | 1474 |
| 951 | nmdc:mga0n895_427_c1 | 3300050512 | Bacteria | 28261 |
| 952 | nmdc:mga0n895_55_c1 | 3300050512 | Bacteria | 66529 |
| 953 | nmdc:mga0rr50_18205_c1 | 3300050513 | Bacteria | 4713 |
| 954 | nmdc:mga08x19_312426_c1 | 3300050514 | Bacteria | 1093 |
| 955 | nmdc:mga08x19_328919_c1 | 3300050514 | Bacteria | 1064 |
| 956 | nmdc:mga08x19_502317_c1 | 3300050514 | Bacteria | 856 |
| 957 | nmdc:mga0a205_172246_c1 | 3300050515 | Bacteria | 2060 |
| 958 | nmdc:mga0a205_182379_c1 | 3300050515 | Bacteria | 1293 |
| 959 | nmdc:mga0a205_2491_c1 | 3300050515 | Bacteria | 16230 |
| 960 | nmdc:mga0a205_768_c4 | 3300050515 | Bacteria | 16460 |
| 961 | Ga0495601_0001987 | 3300053077 | Bacteria | 11450 |
| 962 | Ga0495601_0002541 | 3300053077 | Bacteria | 10366 |
| 963 | Ga0495601_0136587 | 3300053077 | Bacteria | 1598 |
| 964 | Ga0495612_0000243 | 3300053078 | Bacteria | 22586 |
| 965 | Ga0495612_0004160 | 3300053078 | Bacteria | 5997 |
| 966 | Ga0495612_0004394 | 3300053078 | Bacteria | 5846 |
| 967 | Ga0495612_0036364 | 3300053078 | Bacteria | 1998 |
| 968 | Ga0495612_0046566 | 3300053078 | Bacteria | 1776 |
| 969 | Ga0495612_0075269 | 3300053078 | Bacteria | 1413 |
| 970 | Ga0495612_0230998 | 3300053078 | Bacteria | 820 |
| 971 | Ga0495595_0002469 | 3300053084 | Bacteria | 7232 |
| 972 | Ga0495595_0003265 | 3300053084 | Bacteria | 6438 |
| 973 | Ga0495595_0024157 | 3300053084 | Bacteria | 2682 |
| 974 | Ga0495595_0051776 | 3300053084 | Bacteria | 1904 |
| 975 | Ga0495619_0000139 | 3300053085 | Bacteria | 54165 |
| 976 | Ga0495619_0000365 | 3300053085 | Bacteria | 31256 |
| 977 | Ga0495619_0001830 | 3300053085 | Bacteria | 14136 |
| 978 | Ga0495619_0049976 | 3300053085 | Bacteria | 2758 |
| 979 | Ga0495619_0087833 | 3300053085 | Bacteria | 2102 |
| 980 | Ga0500651_0082357 | 3300053093 | Bacteria | 1992 |
| 981 | Ga0500566_0056682 | 3300053094 | Bacteria | 2227 |
| 982 | Ga0500566_0203336 | 3300053094 | Bacteria | 998 |
| 983 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 984 | Ga0500597_030314 | 3300053120 | Bacteria | 2222 |
| 985 | Ga0500588_0069003 | 3300053146 | Bacteria | 1154 |
| 986 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 987 | Ga0500645_000109 | 3300053730 | Bacteria | 65892 |
| 988 | Ga0501084_0268486 | 3300054114 | Bacteria | 1440 |
| 989 | Ga0501084_0312396 | 3300054114 | Bacteria | 1327 |
| 990 | Ga0501082_0042848 | 3300060353 | Bacteria | 3902 |
| 991 | Ga0501082_0736449 | 3300060353 | Bacteria | 863 |
| 992 | Ga0530510_0029878 | 3300061734 | Bacteria | 3913 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100340020 | Ga0075431_1003400202 | 228 |
| 2 | 3300050509 | nmdc:mga0qj67_110528_c1 | nmdc:mga0qj67_110528_c1_1029_1736 | 228 |
| 3 | 3300050510 | nmdc:mga06r32_157181_c1 | nmdc:mga06r32_157181_c1_1287_1994 | 228 |
| 4 | 3300002244 | JGI24742J22300_10037906 | JGI24742J22300_100379061 | 229 |
| 5 | 3300005327 | Ga0070658_10104725 | Ga0070658_101047252 | 229 |
| 6 | 3300005336 | Ga0070680_100006824 | Ga0070680_1000068246 | 229 |
| 7 | 3300005356 | Ga0070674_100152054 | Ga0070674_1001520542 | 229 |
| 8 | 3300005435 | Ga0070714_100083608 | Ga0070714_1000836083 | 229 |
| 9 | 3300005436 | Ga0070713_100046678 | Ga0070713_1000466783 | 229 |
| 10 | 3300005437 | Ga0070710_10052551 | Ga0070710_100525511 | 229 |
| 11 | 3300005458 | Ga0070681_10138950 | Ga0070681_101389503 | 229 |
| 12 | 3300005530 | Ga0070679_100026139 | Ga0070679_1000261392 | 229 |
| 13 | 3300005530 | Ga0070679_100411166 | Ga0070679_1004111661 | 229 |
| 14 | 3300005536 | Ga0070697_100029029 | Ga0070697_1000290291 | 229 |
| 15 | 3300005549 | Ga0070704_100519222 | Ga0070704_1005192221 | 229 |
| 16 | 3300005563 | Ga0068855_100028402 | Ga0068855_1000284024 | 229 |
| 17 | 3300005563 | Ga0068855_100282059 | Ga0068855_1002820592 | 229 |
| 18 | 3300005578 | Ga0068854_100023441 | Ga0068854_1000234416 | 229 |
| 19 | 3300005614 | Ga0068856_100044864 | Ga0068856_1000448642 | 229 |
| 20 | 3300005615 | Ga0070702_100055057 | Ga0070702_1000550572 | 229 |
| 21 | 3300005616 | Ga0068852_100273214 | Ga0068852_1002732142 | 229 |
| 22 | 3300006028 | Ga0070717_10258285 | Ga0070717_102582851 | 229 |
| 23 | 3300006163 | Ga0070715_10113475 | Ga0070715_101134751 | 229 |
| 24 | 3300006175 | Ga0070712_100101908 | Ga0070712_1001019082 | 229 |
| 25 | 3300006914 | Ga0075436_100124736 | Ga0075436_1001247362 | 229 |
| 26 | 3300009093 | Ga0105240_10025356 | Ga0105240_100253566 | 229 |
| 27 | 3300009093 | Ga0105240_10683975 | Ga0105240_106839752 | 229 |
| 28 | 3300009098 | Ga0105245_10169095 | Ga0105245_101690952 | 229 |
| 29 | 3300009551 | Ga0105238_10252634 | Ga0105238_102526341 | 229 |
| 30 | 3300013100 | Ga0157373_10065420 | Ga0157373_100654203 | 229 |
| 31 | 3300013102 | Ga0157371_10157646 | Ga0157371_101576462 | 229 |
| 32 | 3300013104 | Ga0157370_10036546 | Ga0157370_100365466 | 229 |
| 33 | 3300013104 | Ga0157370_10146110 | Ga0157370_101461102 | 229 |
| 34 | 3300013105 | Ga0157369_10933449 | Ga0157369_109334491 | 229 |
| 35 | 3300013297 | Ga0157378_10160446 | Ga0157378_101604462 | 229 |
| 36 | 3300013308 | Ga0157375_10074284 | Ga0157375_100742843 | 229 |
| 37 | 3300014326 | Ga0157380_10288493 | Ga0157380_102884932 | 229 |
| 38 | 3300017792 | Ga0163161_10033750 | Ga0163161_100337502 | 229 |
| 39 | 3300020075 | Ga0206349_1289062 | Ga0206349_12890621 | 229 |
| 40 | 3300020076 | Ga0206355_1562117 | Ga0206355_15621171 | 229 |
| 41 | 3300022467 | Ga0224712_10159689 | Ga0224712_101596891 | 229 |
| 42 | 3300025898 | Ga0207692_10010391 | Ga0207692_100103912 | 229 |
| 43 | 3300025904 | Ga0207647_10207656 | Ga0207647_102076561 | 229 |
| 44 | 3300025905 | Ga0207685_10128141 | Ga0207685_101281411 | 229 |
| 45 | 3300025909 | Ga0207705_10082423 | Ga0207705_100824232 | 229 |
| 46 | 3300025909 | Ga0207705_10129060 | Ga0207705_101290602 | 229 |
| 47 | 3300025912 | Ga0207707_10613850 | Ga0207707_106138502 | 229 |
| 48 | 3300025915 | Ga0207693_10090878 | Ga0207693_100908781 | 229 |
| 49 | 3300025919 | Ga0207657_10036176 | Ga0207657_100361764 | 229 |
| 50 | 3300025921 | Ga0207652_10246694 | Ga0207652_102466942 | 229 |
| 51 | 3300025924 | Ga0207694_10281115 | Ga0207694_102811152 | 229 |
| 52 | 3300025928 | Ga0207700_10106154 | Ga0207700_101061542 | 229 |
| 53 | 3300025929 | Ga0207664_10004485 | Ga0207664_1000448512 | 229 |
| 54 | 3300025931 | Ga0207644_10165940 | Ga0207644_101659401 | 229 |
| 55 | 3300025932 | Ga0207690_10061152 | Ga0207690_100611523 | 229 |
| 56 | 3300025935 | Ga0207709_10131708 | Ga0207709_101317081 | 229 |
| 57 | 3300025939 | Ga0207665_10074058 | Ga0207665_100740581 | 229 |
| 58 | 3300025940 | Ga0207691_10432516 | Ga0207691_104325162 | 229 |
| 59 | 3300025960 | Ga0207651_10508059 | Ga0207651_105080591 | 229 |
| 60 | 3300026118 | Ga0207675_101229104 | Ga0207675_1012291041 | 229 |
| 61 | 3300026121 | Ga0207683_10461918 | Ga0207683_104619182 | 229 |
| 62 | 3300031616 | Ga0307508_10221054 | Ga0307508_102210542 | 229 |
| 63 | 3300037068 | Ga0373925_0087073 | Ga0373925_0087073_1218_1922 | 229 |
| 64 | 3300037312 | Ga0395899_0082520 | Ga0395899_0082520_1040_1744 | 229 |
| 65 | 3300037418 | Ga0395900_0517648 | Ga0395900_0517648_84_788 | 229 |
| 66 | 3300037466 | Ga0395898_0068066 | Ga0395898_0068066_1300_2004 | 229 |
| 67 | 3300038443 | Ga0395901_0052014 | Ga0395901_0052014_1644_2348 | 229 |
| 68 | 3300039450 | Ga0436363_0863782 | Ga0436363_0863782_4694_5398 | 229 |
| 69 | 3300046477 | Ga0495664_0092243 | Ga0495664_0092243_264_968 | 229 |
| 70 | 3300046529 | Ga0495652_0278058 | Ga0495652_0278058_99_803 | 229 |
| 71 | 3300046531 | Ga0495665_0069679 | Ga0495665_0069679_515_1219 | 229 |
| 72 | 3300046615 | Ga0495656_0032264 | Ga0495656_0032264_1010_1714 | 229 |
| 73 | 3300046678 | Ga0495599_0299090 | Ga0495599_0299090_156_860 | 229 |
| 74 | 3300046680 | Ga0495646_0185451 | Ga0495646_0185451_108_812 | 229 |
| 75 | 3300047319 | Ga0495674_0191414 | Ga0495674_0191414_351_1055 | 229 |
| 76 | 3300048904 | Ga0496101_0062981 | Ga0496101_0062981_156_860 | 229 |
| 77 | 3300048905 | Ga0496102_0404646 | Ga0496102_0404646_29_733 | 229 |
| 78 | 3300048909 | Ga0496106_0113829 | Ga0496106_0113829_709_1413 | 229 |
| 79 | 3300048910 | Ga0496107_0258830 | Ga0496107_0258830_434_1138 | 229 |
| 80 | 3300048915 | Ga0496112_0179269 | Ga0496112_0179269_1282_1986 | 229 |
| 81 | 3300048929 | Ga0496126_0012762 | Ga0496126_0012762_3500_4204 | 229 |
| 82 | 3300049569 | Ga0501032_0032946 | Ga0501032_0032946_761_1465 | 229 |
| 83 | 3300049570 | Ga0501033_0045165 | Ga0501033_0045165_1243_1947 | 229 |
| 84 | 3300049571 | Ga0501034_0045067 | Ga0501034_0045067_3163_3867 | 229 |
| 85 | 3300049572 | Ga0501036_0078814 | Ga0501036_0078814_637_1341 | 229 |
| 86 | 3300049572 | Ga0501036_0261705 | Ga0501036_0261705_93_797 | 229 |
| 87 | 3300049573 | Ga0501037_0095810 | Ga0501037_0095810_935_1639 | 229 |
| 88 | 3300049574 | Ga0501038_0062312 | Ga0501038_0062312_622_1326 | 229 |
| 89 | 3300049579 | Ga0501043_0029465 | Ga0501043_0029465_1690_2394 | 229 |
| 90 | 3300049579 | Ga0501043_0048574 | Ga0501043_0048574_2043_2747 | 229 |
| 91 | 3300049580 | Ga0501046_0033511 | Ga0501046_0033511_2525_3229 | 229 |
| 92 | 3300049580 | Ga0501046_0075628 | Ga0501046_0075628_1480_2184 | 229 |
| 93 | 3300049581 | Ga0501047_0046098 | Ga0501047_0046098_2760_3464 | 229 |
| 94 | 3300049581 | Ga0501047_0112358 | Ga0501047_0112358_1785_2489 | 229 |
| 95 | 3300049586 | Ga0501070_0003250 | Ga0501070_0003250_9217_9921 | 229 |
| 96 | 3300049586 | Ga0501070_0238056 | Ga0501070_0238056_345_1049 | 229 |
| 97 | 3300049590 | Ga0501074_0140243 | Ga0501074_0140243_446_1150 | 229 |
| 98 | 3300049590 | Ga0501074_0252901 | Ga0501074_0252901_320_1024 | 229 |
| 99 | 3300049822 | Ga0501035_0043376 | Ga0501035_0043376_1464_2168 | 229 |
| 100 | 3300049823 | Ga0501044_0094920 | Ga0501044_0094920_1373_2077 | 229 |
| 101 | 3300049823 | Ga0501044_0321505 | Ga0501044_0321505_457_1161 | 229 |
| 102 | 3300050491 | nmdc:mga00v17_68998_c1 | nmdc:mga00v17_68998_c1_701_1405 | 229 |
| 103 | 3300050512 | nmdc:mga0n895_359762_c1 | nmdc:mga0n895_359762_c1_438_1148 | 229 |
| 104 | 3300050514 | nmdc:mga08x19_312426_c1 | nmdc:mga08x19_312426_c1_47_751 | 229 |
| 105 | 3300053078 | Ga0495612_0046566 | Ga0495612_0046566_400_1104 | 229 |
| 106 | 3300053078 | Ga0495612_0230998 | Ga0495612_0230998_64_768 | 229 |
| 107 | 3300053084 | Ga0495595_0051776 | Ga0495595_0051776_246_950 | 229 |
| 108 | 3300005614 | Ga0068856_100585502 | Ga0068856_1005855021 | 230 |
| 109 | 3300005616 | Ga0068852_100424644 | Ga0068852_1004246443 | 230 |
| 110 | 3300009093 | Ga0105240_10187355 | Ga0105240_101873553 | 230 |
| 111 | 3300009545 | Ga0105237_10439885 | Ga0105237_104398852 | 230 |
| 112 | 3300013104 | Ga0157370_10152946 | Ga0157370_101529462 | 230 |
| 113 | 3300013105 | Ga0157369_10003829 | Ga0157369_100038297 | 230 |
| 114 | 3300013105 | Ga0157369_10018011 | Ga0157369_100180118 | 230 |
| 115 | 3300013307 | Ga0157372_10084220 | Ga0157372_100842202 | 230 |
| 116 | 3300020069 | Ga0197907_10366928 | Ga0197907_103669281 | 230 |
| 117 | 3300020070 | Ga0206356_11492982 | Ga0206356_114929822 | 230 |
| 118 | 3300020075 | Ga0206349_1903841 | Ga0206349_19038411 | 230 |
| 119 | 3300020080 | Ga0206350_10159323 | Ga0206350_101593231 | 230 |
| 120 | 3300020080 | Ga0206350_10981810 | Ga0206350_109818101 | 230 |
| 121 | 3300020082 | Ga0206353_12065215 | Ga0206353_120652151 | 230 |
| 122 | 3300022467 | Ga0224712_10075688 | Ga0224712_100756882 | 230 |
| 123 | 3300025904 | Ga0207647_10062165 | Ga0207647_100621652 | 230 |
| 124 | 3300025913 | Ga0207695_10201924 | Ga0207695_102019242 | 230 |
| 125 | 3300025914 | Ga0207671_10084027 | Ga0207671_100840274 | 230 |
| 126 | 3300025949 | Ga0207667_10266021 | Ga0207667_102660212 | 230 |
| 127 | 3300026067 | Ga0207678_10402971 | Ga0207678_104029711 | 230 |
| 128 | 3300026078 | Ga0207702_10502107 | Ga0207702_105021072 | 230 |
| 129 | 3300026116 | Ga0207674_10743219 | Ga0207674_107432192 | 230 |
| 130 | 3300037418 | Ga0395900_0050879 | Ga0395900_0050879_859_1566 | 230 |
| 131 | 3300037466 | Ga0395898_0023981 | Ga0395898_0023981_449_1156 | 230 |
| 132 | 3300038443 | Ga0395901_0180343 | Ga0395901_0180343_368_1075 | 230 |
| 133 | 3300039438 | Ga0436360_0512340 | Ga0436360_0512340_981_1688 | 230 |
| 134 | 3300045976 | Ga0466967_0184085 | Ga0466967_0184085_1185_1892 | 230 |
| 135 | 3300048929 | Ga0496126_0031507 | Ga0496126_0031507_1970_2677 | 230 |
| 136 | 3300006846 | Ga0075430_100236073 | Ga0075430_1002360732 | 231 |
| 137 | 3300006847 | Ga0075431_100044521 | Ga0075431_1000445214 | 231 |
| 138 | 3300048905 | Ga0496102_0462804 | Ga0496102_0462804_280_996 | 231 |
| 139 | 3300049572 | Ga0501036_0114523 | Ga0501036_0114523_1556_2263 | 231 |
| 140 | 3300049587 | Ga0501071_0195842 | Ga0501071_0195842_243_947 | 231 |
| 141 | 3300049588 | Ga0501072_0000327 | Ga0501072_0000327_8657_9358 | 231 |
| 142 | 3300050509 | nmdc:mga0qj67_245347_c1 | nmdc:mga0qj67_245347_c1_224_928 | 231 |
| 143 | 3300050510 | nmdc:mga06r32_40426_c1 | nmdc:mga06r32_40426_c1_1204_1908 | 231 |
| 144 | 3300054114 | Ga0501084_0268486 | Ga0501084_0268486_21_722 | 231 |
| 145 | 3300005434 | Ga0070709_10126242 | Ga0070709_101262422 | 232 |
| 146 | 3300005545 | Ga0070695_100061785 | Ga0070695_1000617852 | 232 |
| 147 | 3300005548 | Ga0070665_100192052 | Ga0070665_1001920521 | 232 |
| 148 | 3300005843 | Ga0068860_100106844 | Ga0068860_1001068442 | 232 |
| 149 | 3300006173 | Ga0070716_100546627 | Ga0070716_1005466271 | 232 |
| 150 | 3300006358 | Ga0068871_100193103 | Ga0068871_1001931032 | 232 |
| 151 | 3300006914 | Ga0075436_100198928 | Ga0075436_1001989282 | 232 |
| 152 | 3300009176 | Ga0105242_10027423 | Ga0105242_100274234 | 232 |
| 153 | 3300009177 | Ga0105248_10021356 | Ga0105248_100213562 | 232 |
| 154 | 3300013297 | Ga0157378_10220471 | Ga0157378_102204712 | 232 |
| 155 | 3300014968 | Ga0157379_10238046 | Ga0157379_102380461 | 232 |
| 156 | 3300017792 | Ga0163161_10420833 | Ga0163161_104208331 | 232 |
| 157 | 3300025931 | Ga0207644_10003846 | Ga0207644_1000384610 | 232 |
| 158 | 3300025934 | Ga0207686_10009933 | Ga0207686_100099334 | 232 |
| 159 | 3300025941 | Ga0207711_10025052 | Ga0207711_100250524 | 232 |
| 160 | 3300026088 | Ga0207641_10332482 | Ga0207641_103324822 | 232 |
| 161 | 3300028381 | Ga0268264_10099215 | Ga0268264_100992154 | 232 |
| 162 | 3300035088 | Ga0373940_0006230 | Ga0373940_0006230_591_1304 | 232 |
| 163 | 3300035090 | Ga0373949_0014010 | Ga0373949_0014010_421_1134 | 232 |
| 164 | 3300035121 | Ga0373960_0003781 | Ga0373960_0003781_1976_2689 | 232 |
| 165 | 3300035241 | Ga0373961_0002998 | Ga0373961_0002998_2114_2821 | 232 |
| 166 | 3300035691 | Ga0373931_0007900 | Ga0373931_0007900_1091_1804 | 232 |
| 167 | 3300035692 | Ga0373935_0138609 | Ga0373935_0138609_515_1222 | 232 |
| 168 | 3300035695 | Ga0373927_0089079 | Ga0373927_0089079_709_1416 | 232 |
| 169 | 3300035725 | Ga0373947_0225739 | Ga0373947_0225739_410_1117 | 232 |
| 170 | 3300048904 | Ga0496101_0022852 | Ga0496101_0022852_2427_3140 | 232 |
| 171 | 3300048905 | Ga0496102_0049095 | Ga0496102_0049095_1064_1777 | 232 |
| 172 | 3300048908 | Ga0496105_0012329 | Ga0496105_0012329_1695_2408 | 232 |
| 173 | 3300048909 | Ga0496106_0031663 | Ga0496106_0031663_1221_1934 | 232 |
| 174 | 3300048911 | Ga0496108_0026989 | Ga0496108_0026989_1559_2272 | 232 |
| 175 | 3300048912 | Ga0496109_0032054 | Ga0496109_0032054_2546_3259 | 232 |
| 176 | 3300048913 | Ga0496110_0008902 | Ga0496110_0008902_1238_1951 | 232 |
| 177 | 3300048914 | Ga0496111_0001884 | Ga0496111_0001884_918_1631 | 232 |
| 178 | 3300048915 | Ga0496112_0078691 | Ga0496112_0078691_75_788 | 232 |
| 179 | 3300048915 | Ga0496112_0251695 | Ga0496112_0251695_249_962 | 232 |
| 180 | 3300048916 | Ga0496113_0030381 | Ga0496113_0030381_1235_1948 | 232 |
| 181 | 3300048917 | Ga0496114_0047654 | Ga0496114_0047654_909_1622 | 232 |
| 182 | 3300048917 | Ga0496114_0083433 | Ga0496114_0083433_1583_2287 | 232 |
| 183 | 3300048918 | Ga0496115_0021595 | Ga0496115_0021595_3583_4296 | 232 |
| 184 | 3300050514 | nmdc:mga08x19_328919_c1 | nmdc:mga08x19_328919_c1_157_861 | 232 |
| 185 | 3300060353 | Ga0501082_0736449 | Ga0501082_0736449_132_833 | 232 |
| 186 | 3300005327 | Ga0070658_10023948 | Ga0070658_100239483 | 233 |
| 187 | 3300005328 | Ga0070676_10044695 | Ga0070676_100446952 | 233 |
| 188 | 3300005329 | Ga0070683_100492435 | Ga0070683_1004924351 | 233 |
| 189 | 3300005331 | Ga0070670_100061527 | Ga0070670_1000615275 | 233 |
| 190 | 3300005335 | Ga0070666_10036624 | Ga0070666_100366242 | 233 |
| 191 | 3300005336 | Ga0070680_100006151 | Ga0070680_10000615110 | 233 |
| 192 | 3300005337 | Ga0070682_100028819 | Ga0070682_1000288193 | 233 |
| 193 | 3300005353 | Ga0070669_100099770 | Ga0070669_1000997703 | 233 |
| 194 | 3300005364 | Ga0070673_100003993 | Ga0070673_1000039932 | 233 |
| 195 | 3300005364 | Ga0070673_100143366 | Ga0070673_1001433662 | 233 |
| 196 | 3300005434 | Ga0070709_10115253 | Ga0070709_101152532 | 233 |
| 197 | 3300005438 | Ga0070701_10231941 | Ga0070701_102319412 | 233 |
| 198 | 3300005439 | Ga0070711_100136679 | Ga0070711_1001366792 | 233 |
| 199 | 3300005455 | Ga0070663_100659985 | Ga0070663_1006599851 | 233 |
| 200 | 3300005458 | Ga0070681_10004156 | Ga0070681_1000415615 | 233 |
| 201 | 3300005530 | Ga0070679_100092785 | Ga0070679_1000927853 | 233 |
| 202 | 3300005543 | Ga0070672_100182207 | Ga0070672_1001822072 | 233 |
| 203 | 3300005548 | Ga0070665_100067415 | Ga0070665_1000674152 | 233 |
| 204 | 3300005549 | Ga0070704_100238536 | Ga0070704_1002385361 | 233 |
| 205 | 3300006051 | Ga0075364_10132626 | Ga0075364_101326261 | 233 |
| 206 | 3300006173 | Ga0070716_100044339 | Ga0070716_1000443393 | 233 |
| 207 | 3300006175 | Ga0070712_100036458 | Ga0070712_1000364582 | 233 |
| 208 | 3300006844 | Ga0075428_100000606 | Ga0075428_1000006068 | 233 |
| 209 | 3300006847 | Ga0075431_100000032 | Ga0075431_10000003246 | 233 |
| 210 | 3300006880 | Ga0075429_100008370 | Ga0075429_1000083709 | 233 |
| 211 | 3300006914 | Ga0075436_100067544 | Ga0075436_1000675441 | 233 |
| 212 | 3300007076 | Ga0075435_100356880 | Ga0075435_1003568802 | 233 |
| 213 | 3300007788 | Ga0099795_10000764 | Ga0099795_100007644 | 233 |
| 214 | 3300009094 | Ga0111539_10001089 | Ga0111539_100010899 | 233 |
| 215 | 3300009147 | Ga0114129_10000062 | Ga0114129_1000006231 | 233 |
| 216 | 3300009176 | Ga0105242_10147453 | Ga0105242_101474533 | 233 |
| 217 | 3300009177 | Ga0105248_10200987 | Ga0105248_102009871 | 233 |
| 218 | 3300010159 | Ga0099796_10001065 | Ga0099796_100010655 | 233 |
| 219 | 3300011119 | Ga0105246_10452631 | Ga0105246_104526311 | 233 |
| 220 | 3300013296 | Ga0157374_10421034 | Ga0157374_104210341 | 233 |
| 221 | 3300014325 | Ga0163163_10012546 | Ga0163163_100125469 | 233 |
| 222 | 3300021384 | Ga0213876_10004643 | Ga0213876_100046435 | 233 |
| 223 | 3300025900 | Ga0207710_10000734 | Ga0207710_1000073415 | 233 |
| 224 | 3300025903 | Ga0207680_10006073 | Ga0207680_100060734 | 233 |
| 225 | 3300025905 | Ga0207685_10048525 | Ga0207685_100485252 | 233 |
| 226 | 3300025906 | Ga0207699_10375280 | Ga0207699_103752802 | 233 |
| 227 | 3300025907 | Ga0207645_10071014 | Ga0207645_100710142 | 233 |
| 228 | 3300025909 | Ga0207705_10076009 | Ga0207705_100760093 | 233 |
| 229 | 3300025912 | Ga0207707_10027709 | Ga0207707_100277095 | 233 |
| 230 | 3300025915 | Ga0207693_10022497 | Ga0207693_100224976 | 233 |
| 231 | 3300025916 | Ga0207663_10143548 | Ga0207663_101435482 | 233 |
| 232 | 3300025917 | Ga0207660_10059620 | Ga0207660_100596202 | 233 |
| 233 | 3300025920 | Ga0207649_10074397 | Ga0207649_100743973 | 233 |
| 234 | 3300025920 | Ga0207649_10081876 | Ga0207649_100818762 | 233 |
| 235 | 3300025925 | Ga0207650_10048796 | Ga0207650_100487962 | 233 |
| 236 | 3300025926 | Ga0207659_10084817 | Ga0207659_100848173 | 233 |
| 237 | 3300025929 | Ga0207664_10110426 | Ga0207664_101104262 | 233 |
| 238 | 3300025936 | Ga0207670_10392124 | Ga0207670_103921241 | 233 |
| 239 | 3300025939 | Ga0207665_10015564 | Ga0207665_100155645 | 233 |
| 240 | 3300025940 | Ga0207691_10074325 | Ga0207691_100743252 | 233 |
| 241 | 3300025960 | Ga0207651_10013274 | Ga0207651_100132745 | 233 |
| 242 | 3300027512 | Ga0209179_1000922 | Ga0209179_10009222 | 233 |
| 243 | 3300027907 | Ga0207428_10013177 | Ga0207428_100131777 | 233 |
| 244 | 3300027907 | Ga0207428_10209604 | Ga0207428_102096042 | 233 |
| 245 | 3300028379 | Ga0268266_10045032 | Ga0268266_100450323 | 233 |
| 246 | 3300030760 | Ga0265762_1002070 | Ga0265762_10020703 | 233 |
| 247 | 3300035119 | Ga0373956_0034112 | Ga0373956_0034112_1403_2110 | 233 |
| 248 | 3300035170 | Ga0373943_0098150 | Ga0373943_0098150_112_819 | 233 |
| 249 | 3300035172 | Ga0373955_0050566 | Ga0373955_0050566_1528_2235 | 233 |
| 250 | 3300035410 | Ga0373924_0025342 | Ga0373924_0025342_776_1483 | 233 |
| 251 | 3300035724 | Ga0373933_0007699 | Ga0373933_0007699_1204_1911 | 233 |
| 252 | 3300037068 | Ga0373925_0047336 | Ga0373925_0047336_1248_1955 | 233 |
| 253 | 3300039453 | Ga0436362_0872704 | Ga0436362_0872704_160_867 | 233 |
| 254 | 3300046454 | Ga0495592_0088238 | Ga0495592_0088238_954_1661 | 233 |
| 255 | 3300046459 | Ga0495629_0022575 | Ga0495629_0022575_961_1668 | 233 |
| 256 | 3300046462 | Ga0495651_0113179 | Ga0495651_0113179_316_1023 | 233 |
| 257 | 3300046463 | Ga0495653_0091209 | Ga0495653_0091209_756_1463 | 233 |
| 258 | 3300046473 | Ga0495582_0105976 | Ga0495582_0105976_235_942 | 233 |
| 259 | 3300046511 | Ga0495608_0159950 | Ga0495608_0159950_277_984 | 233 |
| 260 | 3300046514 | Ga0495618_0197332 | Ga0495618_0197332_308_1015 | 233 |
| 261 | 3300046516 | Ga0495628_0037161 | Ga0495628_0037161_1390_2097 | 233 |
| 262 | 3300046529 | Ga0495652_0044789 | Ga0495652_0044789_2114_2821 | 233 |
| 263 | 3300046533 | Ga0495640_0218567 | Ga0495640_0218567_90_797 | 233 |
| 264 | 3300046536 | Ga0495587_0027576 | Ga0495587_0027576_1371_2078 | 233 |
| 265 | 3300046559 | Ga0495667_0127270 | Ga0495667_0127270_444_1151 | 233 |
| 266 | 3300046642 | Ga0495634_0201777 | Ga0495634_0201777_271_978 | 233 |
| 267 | 3300046675 | Ga0495657_0192064 | Ga0495657_0192064_368_1075 | 233 |
| 268 | 3300046678 | Ga0495599_0054244 | Ga0495599_0054244_1066_1773 | 233 |
| 269 | 3300046679 | Ga0495623_0020953 | Ga0495623_0020953_959_1666 | 233 |
| 270 | 3300046680 | Ga0495646_0023160 | Ga0495646_0023160_1860_2567 | 233 |
| 271 | 3300047317 | Ga0495604_0013909 | Ga0495604_0013909_1715_2422 | 233 |
| 272 | 3300047319 | Ga0495674_0099235 | Ga0495674_0099235_398_1105 | 233 |
| 273 | 3300047444 | Ga0495675_0242353 | Ga0495675_0242353_40_747 | 233 |
| 274 | 3300048088 | Ga0495602_0066131 | Ga0495602_0066131_1265_1972 | 233 |
| 275 | 3300048903 | Ga0496100_0058000 | Ga0496100_0058000_569_1276 | 233 |
| 276 | 3300048905 | Ga0496102_0400534 | Ga0496102_0400534_445_1152 | 233 |
| 277 | 3300048907 | Ga0496104_0152769 | Ga0496104_0152769_650_1390 | 233 |
| 278 | 3300048907 | Ga0496104_0163840 | Ga0496104_0163840_156_863 | 233 |
| 279 | 3300048908 | Ga0496105_0522533 | Ga0496105_0522533_201_908 | 233 |
| 280 | 3300048909 | Ga0496106_0067044 | Ga0496106_0067044_1051_1758 | 233 |
| 281 | 3300048911 | Ga0496108_0262208 | Ga0496108_0262208_589_1296 | 233 |
| 282 | 3300048912 | Ga0496109_0177843 | Ga0496109_0177843_591_1298 | 233 |
| 283 | 3300048914 | Ga0496111_0132403 | Ga0496111_0132403_108_815 | 233 |
| 284 | 3300048915 | Ga0496112_0024544 | Ga0496112_0024544_478_1185 | 233 |
| 285 | 3300048915 | Ga0496112_0137954 | Ga0496112_0137954_1656_2363 | 233 |
| 286 | 3300048916 | Ga0496113_0088736 | Ga0496113_0088736_438_1145 | 233 |
| 287 | 3300050507 | nmdc:mga05p37_564_c1 | nmdc:mga05p37_564_c1_13439_14146 | 233 |
| 288 | 3300050508 | nmdc:mga09592_7130_c1 | nmdc:mga09592_7130_c1_6868_7575 | 233 |
| 289 | 3300050509 | nmdc:mga0qj67_11539_c1 | nmdc:mga0qj67_11539_c1_4409_5116 | 233 |
| 290 | 3300050510 | nmdc:mga06r32_191_c1 | nmdc:mga06r32_191_c1_38769_39476 | 233 |
| 291 | 3300050511 | nmdc:mga08y16_89_c1 | nmdc:mga08y16_89_c1_64285_64992 | 233 |
| 292 | 3300050512 | nmdc:mga0n895_141086_c1 | nmdc:mga0n895_141086_c1_1317_2024 | 233 |
| 293 | 3300050515 | nmdc:mga0a205_172246_c1 | nmdc:mga0a205_172246_c1_642_1382 | 233 |
| 294 | 3300053077 | Ga0495601_0136587 | Ga0495601_0136587_739_1446 | 233 |
| 295 | 3300053078 | Ga0495612_0036364 | Ga0495612_0036364_910_1617 | 233 |
| 296 | 3300053084 | Ga0495595_0024157 | Ga0495595_0024157_1205_1912 | 233 |
| 297 | 3300053085 | Ga0495619_0087833 | Ga0495619_0087833_1276_1983 | 233 |
| 298 | iso_pu_bacteria | 2643221547 | 2643757999 | 233 |
| 299 | 3300005336 | Ga0070680_100160088 | Ga0070680_1001600882 | 234 |
| 300 | 3300005340 | Ga0070689_100312406 | Ga0070689_1003124061 | 234 |
| 301 | 3300005456 | Ga0070678_100156523 | Ga0070678_1001565232 | 234 |
| 302 | 3300005466 | Ga0070685_10002009 | Ga0070685_100020098 | 234 |
| 303 | 3300005530 | Ga0070679_100062681 | Ga0070679_1000626813 | 234 |
| 304 | 3300005544 | Ga0070686_100104167 | Ga0070686_1001041672 | 234 |
| 305 | 3300005547 | Ga0070693_100216369 | Ga0070693_1002163692 | 234 |
| 306 | 3300005618 | Ga0068864_100072770 | Ga0068864_1000727703 | 234 |
| 307 | 3300006028 | Ga0070717_10001460 | Ga0070717_100014605 | 234 |
| 308 | 3300006237 | Ga0097621_100038046 | Ga0097621_1000380464 | 234 |
| 309 | 3300025321 | Ga0207656_10061318 | Ga0207656_100613182 | 234 |
| 310 | 3300025915 | Ga0207693_10002937 | Ga0207693_100029374 | 234 |
| 311 | 3300025917 | Ga0207660_10101559 | Ga0207660_101015592 | 234 |
| 312 | 3300025925 | Ga0207650_10072156 | Ga0207650_100721562 | 234 |
| 313 | 3300025940 | Ga0207691_10043594 | Ga0207691_100435942 | 234 |
| 314 | 3300025944 | Ga0207661_10064885 | Ga0207661_100648851 | 234 |
| 315 | 3300026121 | Ga0207683_10001459 | Ga0207683_100014597 | 234 |
| 316 | 3300028379 | Ga0268266_10006553 | Ga0268266_100065538 | 234 |
| 317 | 3300031344 | Ga0265316_10037941 | Ga0265316_100379414 | 234 |
| 318 | 3300044694 | Ga0466963_0267961 | Ga0466963_0267961_238_984 | 234 |
| 319 | 3300045976 | Ga0466967_0217091 | Ga0466967_0217091_456_1202 | 234 |
| 320 | 3300049574 | Ga0501038_0114841 | Ga0501038_0114841_623_1435 | 234 |
| 321 | 3300049575 | Ga0501039_0072917 | Ga0501039_0072917_169_981 | 234 |
| 322 | 3300049579 | Ga0501043_0071429 | Ga0501043_0071429_30_842 | 234 |
| 323 | 3300049581 | Ga0501047_0114461 | Ga0501047_0114461_510_1322 | 234 |
| 324 | 3300049586 | Ga0501070_0171230 | Ga0501070_0171230_430_1242 | 234 |
| 325 | 3300049589 | Ga0501073_0247978 | Ga0501073_0247978_193_1005 | 234 |
| 326 | 3300005981 | Ga0081538_10006434 | Ga0081538_100064347 | 235 |
| 327 | 3300005983 | Ga0081540_1008868 | Ga0081540_10088685 | 235 |
| 328 | 3300009147 | Ga0114129_10158612 | Ga0114129_101586123 | 235 |
| 329 | 3300009176 | Ga0105242_10938996 | Ga0105242_109389962 | 235 |
| 330 | 3300014969 | Ga0157376_10790483 | Ga0157376_107904831 | 235 |
| 331 | 3300026023 | Ga0207677_10073595 | Ga0207677_100735952 | 235 |
| 332 | 3300031995 | Ga0307409_100720905 | Ga0307409_1007209051 | 235 |
| 333 | 3300050507 | nmdc:mga05p37_56237_c1 | nmdc:mga05p37_56237_c1_3735_4448 | 235 |
| 334 | 3300053120 | Ga0500597_030314 | Ga0500597_030314_566_1282 | 235 |
| 335 | 3300005458 | Ga0070681_10302823 | Ga0070681_103028232 | 236 |
| 336 | 3300005530 | Ga0070679_100413814 | Ga0070679_1004138142 | 236 |
| 337 | 3300031241 | Ga0265325_10169954 | Ga0265325_101699541 | 236 |
| 338 | 3300031344 | Ga0265316_10114806 | Ga0265316_101148062 | 236 |
| 339 | 3300031711 | Ga0265314_10088533 | Ga0265314_100885332 | 236 |
| 340 | 3300037312 | Ga0395899_0038839 | Ga0395899_0038839_1590_2327 | 236 |
| 341 | 3300037418 | Ga0395900_0014629 | Ga0395900_0014629_4492_5229 | 236 |
| 342 | 3300037418 | Ga0395900_0024394 | Ga0395900_0024394_2492_3229 | 236 |
| 343 | 3300037466 | Ga0395898_0009463 | Ga0395898_0009463_3989_4726 | 236 |
| 344 | 3300037466 | Ga0395898_0030144 | Ga0395898_0030144_2309_3046 | 236 |
| 345 | 3300037466 | Ga0395898_0132494 | Ga0395898_0132494_64_801 | 236 |
| 346 | 3300038443 | Ga0395901_0770549 | Ga0395901_0770549_195_932 | 236 |
| 347 | 3300046516 | Ga0495628_0291751 | Ga0495628_0291751_187_903 | 236 |
| 348 | 3300053078 | Ga0495612_0075269 | Ga0495612_0075269_94_810 | 236 |
| 349 | 3300053146 | Ga0500588_0069003 | Ga0500588_0069003_102_818 | 236 |
| 350 | 3300028556 | Ga0265337_1001317 | Ga0265337_100131715 | 237 |
| 351 | 3300031249 | Ga0265339_10109301 | Ga0265339_101093012 | 237 |
| 352 | 3300031344 | Ga0265316_10230703 | Ga0265316_102307032 | 237 |
| 353 | 3300035119 | Ga0373956_0184022 | Ga0373956_0184022_251_964 | 237 |
| 354 | 3300046462 | Ga0495651_0217278 | Ga0495651_0217278_314_1027 | 237 |
| 355 | 3300046543 | Ga0495645_0317106 | Ga0495645_0317106_262_975 | 237 |
| 356 | 3300049571 | Ga0501034_0247642 | Ga0501034_0247642_934_1650 | 237 |
| 357 | 3300050507 | nmdc:mga05p37_10573_c1 | nmdc:mga05p37_10573_c1_4136_4849 | 237 |
| 358 | 3300050513 | nmdc:mga0rr50_18205_c1 | nmdc:mga0rr50_18205_c1_1954_2667 | 237 |
| 359 | 3300053093 | Ga0500651_0082357 | Ga0500651_0082357_575_1291 | 237 |
| 360 | 3300053094 | Ga0500566_0056682 | Ga0500566_0056682_807_1523 | 237 |
| 361 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_776332_777048 | 237 |
| 362 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1203475_1204191 | 237 |
| 363 | 3300053730 | Ga0500645_000109 | Ga0500645_000109_35370_36086 | 237 |
| 364 | 3300001915 | JGI24741J21665_1005876 | JGI24741J21665_10058762 | 238 |
| 365 | 3300001977 | JGI24746J21847_1001040 | JGI24746J21847_10010406 | 238 |
| 366 | 3300001979 | JGI24740J21852_10021705 | JGI24740J21852_100217052 | 238 |
| 367 | 3300001989 | JGI24739J22299_10009366 | JGI24739J22299_100093663 | 238 |
| 368 | 3300001990 | JGI24737J22298_10000349 | JGI24737J22298_100003495 | 238 |
| 369 | 3300001991 | JGI24743J22301_10001914 | JGI24743J22301_100019142 | 238 |
| 370 | 3300002070 | JGI24750J21931_1000065 | JGI24750J21931_10000653 | 238 |
| 371 | 3300002073 | JGI24745J21846_1000050 | JGI24745J21846_10000509 | 238 |
| 372 | 3300002074 | JGI24748J21848_1000906 | JGI24748J21848_10009062 | 238 |
| 373 | 3300002075 | JGI24738J21930_10000803 | JGI24738J21930_1000080312 | 238 |
| 374 | 3300002126 | JGI24035J26624_1000006 | JGI24035J26624_10000063 | 238 |
| 375 | 3300002239 | JGI24034J26672_10000266 | JGI24034J26672_100002666 | 238 |
| 376 | 3300002244 | JGI24742J22300_10000073 | JGI24742J22300_100000733 | 238 |
| 377 | 3300003371 | JGI26145J50221_1000700 | JGI26145J50221_10007002 | 238 |
| 378 | 3300005289 | Ga0065704_10084127 | Ga0065704_100841272 | 238 |
| 379 | 3300005289 | Ga0065704_10170228 | Ga0065704_101702282 | 238 |
| 380 | 3300005293 | Ga0065715_10009479 | Ga0065715_100094793 | 238 |
| 381 | 3300005327 | Ga0070658_10008449 | Ga0070658_100084493 | 238 |
| 382 | 3300005328 | Ga0070676_10000360 | Ga0070676_100003602 | 238 |
| 383 | 3300005329 | Ga0070683_100003076 | Ga0070683_10000307613 | 238 |
| 384 | 3300005330 | Ga0070690_100210654 | Ga0070690_1002106542 | 238 |
| 385 | 3300005331 | Ga0070670_100000827 | Ga0070670_10000082710 | 238 |
| 386 | 3300005333 | Ga0070677_10034861 | Ga0070677_100348612 | 238 |
| 387 | 3300005334 | Ga0068869_100000013 | Ga0068869_10000001315 | 238 |
| 388 | 3300005335 | Ga0070666_10024413 | Ga0070666_100244134 | 238 |
| 389 | 3300005336 | Ga0070680_100002249 | Ga0070680_10000224913 | 238 |
| 390 | 3300005336 | Ga0070680_100002907 | Ga0070680_1000029072 | 238 |
| 391 | 3300005336 | Ga0070680_100088277 | Ga0070680_1000882773 | 238 |
| 392 | 3300005337 | Ga0070682_100001195 | Ga0070682_10000119515 | 238 |
| 393 | 3300005337 | Ga0070682_100093427 | Ga0070682_1000934271 | 238 |
| 394 | 3300005338 | Ga0068868_100043559 | Ga0068868_1000435595 | 238 |
| 395 | 3300005339 | Ga0070660_100001856 | Ga0070660_10000185611 | 238 |
| 396 | 3300005339 | Ga0070660_100014371 | Ga0070660_1000143716 | 238 |
| 397 | 3300005339 | Ga0070660_100195236 | Ga0070660_1001952361 | 238 |
| 398 | 3300005340 | Ga0070689_100000474 | Ga0070689_1000004742 | 238 |
| 399 | 3300005341 | Ga0070691_10000101 | Ga0070691_1000010117 | 238 |
| 400 | 3300005343 | Ga0070687_100003845 | Ga0070687_1000038457 | 238 |
| 401 | 3300005344 | Ga0070661_100001285 | Ga0070661_1000012857 | 238 |
| 402 | 3300005345 | Ga0070692_10000014 | Ga0070692_1000001416 | 238 |
| 403 | 3300005347 | Ga0070668_100000629 | Ga0070668_10000062915 | 238 |
| 404 | 3300005353 | Ga0070669_100000289 | Ga0070669_10000028926 | 238 |
| 405 | 3300005354 | Ga0070675_100000501 | Ga0070675_10000050119 | 238 |
| 406 | 3300005355 | Ga0070671_100000142 | Ga0070671_1000001422 | 238 |
| 407 | 3300005355 | Ga0070671_100012637 | Ga0070671_1000126372 | 238 |
| 408 | 3300005356 | Ga0070674_100000392 | Ga0070674_1000003927 | 238 |
| 409 | 3300005356 | Ga0070674_100156579 | Ga0070674_1001565792 | 238 |
| 410 | 3300005364 | Ga0070673_100001752 | Ga0070673_10000175212 | 238 |
| 411 | 3300005365 | Ga0070688_100024785 | Ga0070688_1000247852 | 238 |
| 412 | 3300005366 | Ga0070659_100001872 | Ga0070659_10000187213 | 238 |
| 413 | 3300005366 | Ga0070659_100236134 | Ga0070659_1002361342 | 238 |
| 414 | 3300005367 | Ga0070667_100002667 | Ga0070667_1000026674 | 238 |
| 415 | 3300005367 | Ga0070667_100057194 | Ga0070667_1000571944 | 238 |
| 416 | 3300005367 | Ga0070667_100372634 | Ga0070667_1003726342 | 238 |
| 417 | 3300005406 | Ga0070703_10004137 | Ga0070703_100041372 | 238 |
| 418 | 3300005434 | Ga0070709_10152457 | Ga0070709_101524571 | 238 |
| 419 | 3300005435 | Ga0070714_100012391 | Ga0070714_1000123914 | 238 |
| 420 | 3300005435 | Ga0070714_100159502 | Ga0070714_1001595022 | 238 |
| 421 | 3300005436 | Ga0070713_100592990 | Ga0070713_1005929902 | 238 |
| 422 | 3300005437 | Ga0070710_10006342 | Ga0070710_100063426 | 238 |
| 423 | 3300005438 | Ga0070701_10000008 | Ga0070701_1000000835 | 238 |
| 424 | 3300005438 | Ga0070701_10051052 | Ga0070701_100510521 | 238 |
| 425 | 3300005439 | Ga0070711_100125130 | Ga0070711_1001251301 | 238 |
| 426 | 3300005440 | Ga0070705_100004263 | Ga0070705_10000426310 | 238 |
| 427 | 3300005441 | Ga0070700_100000486 | Ga0070700_10000048616 | 238 |
| 428 | 3300005444 | Ga0070694_100000463 | Ga0070694_1000004637 | 238 |
| 429 | 3300005444 | Ga0070694_100079348 | Ga0070694_1000793482 | 238 |
| 430 | 3300005455 | Ga0070663_100000944 | Ga0070663_10000094416 | 238 |
| 431 | 3300005456 | Ga0070678_100004520 | Ga0070678_1000045204 | 238 |
| 432 | 3300005457 | Ga0070662_100004371 | Ga0070662_10000437111 | 238 |
| 433 | 3300005458 | Ga0070681_10002062 | Ga0070681_1000206216 | 238 |
| 434 | 3300005458 | Ga0070681_10007607 | Ga0070681_100076073 | 238 |
| 435 | 3300005458 | Ga0070681_10125487 | Ga0070681_101254872 | 238 |
| 436 | 3300005459 | Ga0068867_100000303 | Ga0068867_10000030316 | 238 |
| 437 | 3300005459 | Ga0068867_100458389 | Ga0068867_1004583892 | 238 |
| 438 | 3300005530 | Ga0070679_100005343 | Ga0070679_10000534310 | 238 |
| 439 | 3300005530 | Ga0070679_100009550 | Ga0070679_10000955010 | 238 |
| 440 | 3300005530 | Ga0070679_100067688 | Ga0070679_1000676883 | 238 |
| 441 | 3300005535 | Ga0070684_100001817 | Ga0070684_1000018174 | 238 |
| 442 | 3300005535 | Ga0070684_100471021 | Ga0070684_1004710211 | 238 |
| 443 | 3300005539 | Ga0068853_100000726 | Ga0068853_10000072613 | 238 |
| 444 | 3300005543 | Ga0070672_100000469 | Ga0070672_10000046912 | 238 |
| 445 | 3300005544 | Ga0070686_100004236 | Ga0070686_1000042367 | 238 |
| 446 | 3300005544 | Ga0070686_100086135 | Ga0070686_1000861352 | 238 |
| 447 | 3300005545 | Ga0070695_100003431 | Ga0070695_1000034315 | 238 |
| 448 | 3300005546 | Ga0070696_100030123 | Ga0070696_1000301234 | 238 |
| 449 | 3300005546 | Ga0070696_100156869 | Ga0070696_1001568692 | 238 |
| 450 | 3300005547 | Ga0070693_100000411 | Ga0070693_1000004117 | 238 |
| 451 | 3300005548 | Ga0070665_100035465 | Ga0070665_1000354652 | 238 |
| 452 | 3300005549 | Ga0070704_100001671 | Ga0070704_10000167113 | 238 |
| 453 | 3300005563 | Ga0068855_100074588 | Ga0068855_1000745886 | 238 |
| 454 | 3300005563 | Ga0068855_100118700 | Ga0068855_1001187002 | 238 |
| 455 | 3300005564 | Ga0070664_100001745 | Ga0070664_10000174516 | 238 |
| 456 | 3300005564 | Ga0070664_100112413 | Ga0070664_1001124132 | 238 |
| 457 | 3300005577 | Ga0068857_100000307 | Ga0068857_1000003077 | 238 |
| 458 | 3300005577 | Ga0068857_100257523 | Ga0068857_1002575232 | 238 |
| 459 | 3300005578 | Ga0068854_100000761 | Ga0068854_10000076110 | 238 |
| 460 | 3300005578 | Ga0068854_100188576 | Ga0068854_1001885762 | 238 |
| 461 | 3300005614 | Ga0068856_100003904 | Ga0068856_10000390410 | 238 |
| 462 | 3300005614 | Ga0068856_100114373 | Ga0068856_1001143733 | 238 |
| 463 | 3300005615 | Ga0070702_100001142 | Ga0070702_10000114211 | 238 |
| 464 | 3300005616 | Ga0068852_100000151 | Ga0068852_10000015131 | 238 |
| 465 | 3300005616 | Ga0068852_100060735 | Ga0068852_1000607352 | 238 |
| 466 | 3300005616 | Ga0068852_100076862 | Ga0068852_1000768624 | 238 |
| 467 | 3300005617 | Ga0068859_100199900 | Ga0068859_1001999002 | 238 |
| 468 | 3300005617 | Ga0068859_100266710 | Ga0068859_1002667103 | 238 |
| 469 | 3300005618 | Ga0068864_100001020 | Ga0068864_10000102025 | 238 |
| 470 | 3300005618 | Ga0068864_100025477 | Ga0068864_1000254775 | 238 |
| 471 | 3300005718 | Ga0068866_10000049 | Ga0068866_1000004920 | 238 |
| 472 | 3300005719 | Ga0068861_100000471 | Ga0068861_10000047112 | 238 |
| 473 | 3300005840 | Ga0068870_10001002 | Ga0068870_100010029 | 238 |
| 474 | 3300005841 | Ga0068863_100000418 | Ga0068863_10000041816 | 238 |
| 475 | 3300005842 | Ga0068858_100002238 | Ga0068858_10000223817 | 238 |
| 476 | 3300005842 | Ga0068858_100030576 | Ga0068858_1000305764 | 238 |
| 477 | 3300005842 | Ga0068858_100142208 | Ga0068858_1001422082 | 238 |
| 478 | 3300005843 | Ga0068860_100002578 | Ga0068860_10000257817 | 238 |
| 479 | 3300005843 | Ga0068860_100296224 | Ga0068860_1002962242 | 238 |
| 480 | 3300005844 | Ga0068862_100001613 | Ga0068862_10000161316 | 238 |
| 481 | 3300006163 | Ga0070715_10036277 | Ga0070715_100362772 | 238 |
| 482 | 3300006175 | Ga0070712_100157273 | Ga0070712_1001572732 | 238 |
| 483 | 3300006178 | Ga0075367_10135927 | Ga0075367_101359271 | 238 |
| 484 | 3300006237 | Ga0097621_100000012 | Ga0097621_10000001219 | 238 |
| 485 | 3300006237 | Ga0097621_100320179 | Ga0097621_1003201792 | 238 |
| 486 | 3300006353 | Ga0075370_10120192 | Ga0075370_101201922 | 238 |
| 487 | 3300006358 | Ga0068871_100000611 | Ga0068871_10000061117 | 238 |
| 488 | 3300006846 | Ga0075430_100000332 | Ga0075430_10000033222 | 238 |
| 489 | 3300006847 | Ga0075431_100028902 | Ga0075431_1000289027 | 238 |
| 490 | 3300006852 | Ga0075433_10000487 | Ga0075433_1000048718 | 238 |
| 491 | 3300006871 | Ga0075434_100000193 | Ga0075434_10000019317 | 238 |
| 492 | 3300006871 | Ga0075434_100000647 | Ga0075434_10000064716 | 238 |
| 493 | 3300006871 | Ga0075434_100163620 | Ga0075434_1001636202 | 238 |
| 494 | 3300006880 | Ga0075429_100000451 | Ga0075429_10000045115 | 238 |
| 495 | 3300006881 | Ga0068865_100001539 | Ga0068865_1000015392 | 238 |
| 496 | 3300006931 | Ga0097620_100199918 | Ga0097620_1001999182 | 238 |
| 497 | 3300006931 | Ga0097620_100266705 | Ga0097620_1002667052 | 238 |
| 498 | 3300009036 | Ga0105244_10039073 | Ga0105244_100390733 | 238 |
| 499 | 3300009093 | Ga0105240_10070752 | Ga0105240_100707522 | 238 |
| 500 | 3300009094 | Ga0111539_10000679 | Ga0111539_1000067917 | 238 |
| 501 | 3300009094 | Ga0111539_10000925 | Ga0111539_100009258 | 238 |
| 502 | 3300009094 | Ga0111539_10002056 | Ga0111539_1000205614 | 238 |
| 503 | 3300009098 | Ga0105245_10000090 | Ga0105245_1000009051 | 238 |
| 504 | 3300009101 | Ga0105247_10002243 | Ga0105247_100022435 | 238 |
| 505 | 3300009101 | Ga0105247_10067006 | Ga0105247_100670062 | 238 |
| 506 | 3300009147 | Ga0114129_10006700 | Ga0114129_100067007 | 238 |
| 507 | 3300009148 | Ga0105243_10003044 | Ga0105243_100030442 | 238 |
| 508 | 3300009148 | Ga0105243_10124867 | Ga0105243_101248672 | 238 |
| 509 | 3300009176 | Ga0105242_10000491 | Ga0105242_1000049129 | 238 |
| 510 | 3300009176 | Ga0105242_10153584 | Ga0105242_101535842 | 238 |
| 511 | 3300009177 | Ga0105248_10003797 | Ga0105248_1000379715 | 238 |
| 512 | 3300009177 | Ga0105248_10004778 | Ga0105248_1000477818 | 238 |
| 513 | 3300009177 | Ga0105248_10231848 | Ga0105248_102318482 | 238 |
| 514 | 3300009545 | Ga0105237_10004589 | Ga0105237_100045894 | 238 |
| 515 | 3300009545 | Ga0105237_10144669 | Ga0105237_101446692 | 238 |
| 516 | 3300009551 | Ga0105238_10159650 | Ga0105238_101596502 | 238 |
| 517 | 3300009553 | Ga0105249_10001085 | Ga0105249_1000108513 | 238 |
| 518 | 3300010375 | Ga0105239_10028016 | Ga0105239_100280162 | 238 |
| 519 | 3300010375 | Ga0105239_10062647 | Ga0105239_100626473 | 238 |
| 520 | 3300011119 | Ga0105246_10000052 | Ga0105246_1000005211 | 238 |
| 521 | 3300012483 | Ga0157337_1000687 | Ga0157337_10006872 | 238 |
| 522 | 3300012494 | Ga0157341_1001502 | Ga0157341_10015022 | 238 |
| 523 | 3300013102 | Ga0157371_10003401 | Ga0157371_1000340112 | 238 |
| 524 | 3300013105 | Ga0157369_10200279 | Ga0157369_102002793 | 238 |
| 525 | 3300013105 | Ga0157369_10538490 | Ga0157369_105384902 | 238 |
| 526 | 3300013296 | Ga0157374_10001210 | Ga0157374_1000121016 | 238 |
| 527 | 3300013297 | Ga0157378_10002713 | Ga0157378_1000271313 | 238 |
| 528 | 3300013297 | Ga0157378_10038308 | Ga0157378_100383085 | 238 |
| 529 | 3300013306 | Ga0163162_10000308 | Ga0163162_1000030816 | 238 |
| 530 | 3300013306 | Ga0163162_10031670 | Ga0163162_100316704 | 238 |
| 531 | 3300013306 | Ga0163162_10100977 | Ga0163162_101009774 | 238 |
| 532 | 3300013307 | Ga0157372_10002370 | Ga0157372_1000237015 | 238 |
| 533 | 3300013307 | Ga0157372_10312145 | Ga0157372_103121452 | 238 |
| 534 | 3300013308 | Ga0157375_10000414 | Ga0157375_100004149 | 238 |
| 535 | 3300014325 | Ga0163163_10002008 | Ga0163163_100020089 | 238 |
| 536 | 3300014325 | Ga0163163_10002377 | Ga0163163_1000237715 | 238 |
| 537 | 3300014326 | Ga0157380_10000122 | Ga0157380_1000012217 | 238 |
| 538 | 3300014745 | Ga0157377_10000688 | Ga0157377_1000068814 | 238 |
| 539 | 3300014968 | Ga0157379_10000261 | Ga0157379_1000026132 | 238 |
| 540 | 3300014968 | Ga0157379_10073523 | Ga0157379_100735233 | 238 |
| 541 | 3300014969 | Ga0157376_10002538 | Ga0157376_1000253813 | 238 |
| 542 | 3300017792 | Ga0163161_10000199 | Ga0163161_1000019947 | 238 |
| 543 | 3300025290 | Ga0207673_1000255 | Ga0207673_10002555 | 238 |
| 544 | 3300025315 | Ga0207697_10136950 | Ga0207697_101369502 | 238 |
| 545 | 3300025893 | Ga0207682_10000042 | Ga0207682_1000004239 | 238 |
| 546 | 3300025899 | Ga0207642_10000065 | Ga0207642_1000006513 | 238 |
| 547 | 3300025900 | Ga0207710_10001358 | Ga0207710_1000135813 | 238 |
| 548 | 3300025901 | Ga0207688_10000053 | Ga0207688_1000005316 | 238 |
| 549 | 3300025903 | Ga0207680_10018719 | Ga0207680_100187192 | 238 |
| 550 | 3300025904 | Ga0207647_10002478 | Ga0207647_100024783 | 238 |
| 551 | 3300025908 | Ga0207643_10000082 | Ga0207643_1000008228 | 238 |
| 552 | 3300025909 | Ga0207705_10049719 | Ga0207705_100497192 | 238 |
| 553 | 3300025911 | Ga0207654_10004743 | Ga0207654_100047438 | 238 |
| 554 | 3300025912 | Ga0207707_10017763 | Ga0207707_100177634 | 238 |
| 555 | 3300025912 | Ga0207707_10054354 | Ga0207707_100543544 | 238 |
| 556 | 3300025912 | Ga0207707_10184357 | Ga0207707_101843572 | 238 |
| 557 | 3300025912 | Ga0207707_10273929 | Ga0207707_102739292 | 238 |
| 558 | 3300025913 | Ga0207695_10366959 | Ga0207695_103669592 | 238 |
| 559 | 3300025914 | Ga0207671_10027981 | Ga0207671_100279811 | 238 |
| 560 | 3300025915 | Ga0207693_10373000 | Ga0207693_103730001 | 238 |
| 561 | 3300025916 | Ga0207663_10158452 | Ga0207663_101584521 | 238 |
| 562 | 3300025916 | Ga0207663_10167262 | Ga0207663_101672622 | 238 |
| 563 | 3300025917 | Ga0207660_10000083 | Ga0207660_1000008337 | 238 |
| 564 | 3300025917 | Ga0207660_10060659 | Ga0207660_100606594 | 238 |
| 565 | 3300025919 | Ga0207657_10014898 | Ga0207657_1001489810 | 238 |
| 566 | 3300025919 | Ga0207657_10022232 | Ga0207657_100222323 | 238 |
| 567 | 3300025920 | Ga0207649_10000643 | Ga0207649_1000064312 | 238 |
| 568 | 3300025920 | Ga0207649_10024908 | Ga0207649_100249083 | 238 |
| 569 | 3300025921 | Ga0207652_10000557 | Ga0207652_1000055730 | 238 |
| 570 | 3300025921 | Ga0207652_10035660 | Ga0207652_100356604 | 238 |
| 571 | 3300025923 | Ga0207681_10000271 | Ga0207681_1000027133 | 238 |
| 572 | 3300025925 | Ga0207650_10006111 | Ga0207650_1000611111 | 238 |
| 573 | 3300025926 | Ga0207659_10000161 | Ga0207659_1000016131 | 238 |
| 574 | 3300025926 | Ga0207659_10000460 | Ga0207659_1000046016 | 238 |
| 575 | 3300025926 | Ga0207659_10640818 | Ga0207659_106408182 | 238 |
| 576 | 3300025927 | Ga0207687_10000063 | Ga0207687_1000006342 | 238 |
| 577 | 3300025927 | Ga0207687_10061716 | Ga0207687_100617162 | 238 |
| 578 | 3300025928 | Ga0207700_10004421 | Ga0207700_1000442110 | 238 |
| 579 | 3300025928 | Ga0207700_10321717 | Ga0207700_103217172 | 238 |
| 580 | 3300025929 | Ga0207664_10123995 | Ga0207664_101239953 | 238 |
| 581 | 3300025931 | Ga0207644_10000591 | Ga0207644_1000059120 | 238 |
| 582 | 3300025931 | Ga0207644_10015231 | Ga0207644_100152315 | 238 |
| 583 | 3300025932 | Ga0207690_10000897 | Ga0207690_1000089715 | 238 |
| 584 | 3300025932 | Ga0207690_10063978 | Ga0207690_100639784 | 238 |
| 585 | 3300025932 | Ga0207690_10106094 | Ga0207690_101060942 | 238 |
| 586 | 3300025933 | Ga0207706_10054931 | Ga0207706_100549312 | 238 |
| 587 | 3300025934 | Ga0207686_10000614 | Ga0207686_1000061416 | 238 |
| 588 | 3300025934 | Ga0207686_10038769 | Ga0207686_100387692 | 238 |
| 589 | 3300025935 | Ga0207709_10000429 | Ga0207709_1000042931 | 238 |
| 590 | 3300025936 | Ga0207670_10000485 | Ga0207670_1000048511 | 238 |
| 591 | 3300025936 | Ga0207670_10044764 | Ga0207670_100447642 | 238 |
| 592 | 3300025937 | Ga0207669_10000019 | Ga0207669_1000001914 | 238 |
| 593 | 3300025937 | Ga0207669_10062994 | Ga0207669_100629942 | 238 |
| 594 | 3300025938 | Ga0207704_10000552 | Ga0207704_100005525 | 238 |
| 595 | 3300025939 | Ga0207665_10035016 | Ga0207665_100350165 | 238 |
| 596 | 3300025941 | Ga0207711_10009466 | Ga0207711_1000946610 | 238 |
| 597 | 3300025941 | Ga0207711_10154419 | Ga0207711_101544192 | 238 |
| 598 | 3300025942 | Ga0207689_10001364 | Ga0207689_1000136424 | 238 |
| 599 | 3300025944 | Ga0207661_10000281 | Ga0207661_1000028117 | 238 |
| 600 | 3300025945 | Ga0207679_10000026 | Ga0207679_1000002617 | 238 |
| 601 | 3300025949 | Ga0207667_10004064 | Ga0207667_1000406414 | 238 |
| 602 | 3300025949 | Ga0207667_10079012 | Ga0207667_100790122 | 238 |
| 603 | 3300025960 | Ga0207651_10000101 | Ga0207651_1000010121 | 238 |
| 604 | 3300025961 | Ga0207712_10000908 | Ga0207712_1000090813 | 238 |
| 605 | 3300025972 | Ga0207668_10000726 | Ga0207668_100007269 | 238 |
| 606 | 3300025981 | Ga0207640_10000596 | Ga0207640_1000059613 | 238 |
| 607 | 3300025986 | Ga0207658_10003725 | Ga0207658_100037257 | 238 |
| 608 | 3300026023 | Ga0207677_10000651 | Ga0207677_1000065116 | 238 |
| 609 | 3300026035 | Ga0207703_10001717 | Ga0207703_1000171717 | 238 |
| 610 | 3300026035 | Ga0207703_10020476 | Ga0207703_100204764 | 238 |
| 611 | 3300026041 | Ga0207639_10002467 | Ga0207639_100024676 | 238 |
| 612 | 3300026041 | Ga0207639_10116586 | Ga0207639_101165863 | 238 |
| 613 | 3300026067 | Ga0207678_10014165 | Ga0207678_100141651 | 238 |
| 614 | 3300026078 | Ga0207702_10234555 | Ga0207702_102345552 | 238 |
| 615 | 3300026078 | Ga0207702_10745543 | Ga0207702_107455431 | 238 |
| 616 | 3300026088 | Ga0207641_10002162 | Ga0207641_1000216217 | 238 |
| 617 | 3300026089 | Ga0207648_10003986 | Ga0207648_100039865 | 238 |
| 618 | 3300026089 | Ga0207648_10098193 | Ga0207648_100981932 | 238 |
| 619 | 3300026095 | Ga0207676_10000563 | Ga0207676_1000056325 | 238 |
| 620 | 3300026095 | Ga0207676_10030839 | Ga0207676_100308394 | 238 |
| 621 | 3300026116 | Ga0207674_10001207 | Ga0207674_1000120731 | 238 |
| 622 | 3300026116 | Ga0207674_10054631 | Ga0207674_100546314 | 238 |
| 623 | 3300026121 | Ga0207683_10000324 | Ga0207683_1000032416 | 238 |
| 624 | 3300026121 | Ga0207683_10015259 | Ga0207683_100152594 | 238 |
| 625 | 3300026142 | Ga0207698_10000634 | Ga0207698_1000063412 | 238 |
| 626 | 3300027252 | Ga0209973_1004080 | Ga0209973_10040802 | 238 |
| 627 | 3300027471 | Ga0209995_1012542 | Ga0209995_10125422 | 238 |
| 628 | 3300027552 | Ga0209982_1001520 | Ga0209982_10015203 | 238 |
| 629 | 3300027617 | Ga0210002_1004553 | Ga0210002_10045532 | 238 |
| 630 | 3300027682 | Ga0209971_1006277 | Ga0209971_10062772 | 238 |
| 631 | 3300027695 | Ga0209966_1001336 | Ga0209966_10013364 | 238 |
| 632 | 3300027866 | Ga0209813_10064996 | Ga0209813_100649962 | 238 |
| 633 | 3300027907 | Ga0207428_10000130 | Ga0207428_1000013017 | 238 |
| 634 | 3300027907 | Ga0207428_10000180 | Ga0207428_1000018071 | 238 |
| 635 | 3300027907 | Ga0207428_10000286 | Ga0207428_100002865 | 238 |
| 636 | 3300028379 | Ga0268266_10018702 | Ga0268266_100187027 | 238 |
| 637 | 3300028380 | Ga0268265_10008091 | Ga0268265_100080914 | 238 |
| 638 | 3300028381 | Ga0268264_10003472 | Ga0268264_100034726 | 238 |
| 639 | 3300028381 | Ga0268264_10061668 | Ga0268264_100616683 | 238 |
| 640 | 3300028573 | Ga0265334_10020588 | Ga0265334_100205882 | 238 |
| 641 | 3300028800 | Ga0265338_10020386 | Ga0265338_100203868 | 238 |
| 642 | 3300031241 | Ga0265325_10000011 | Ga0265325_10000011105 | 238 |
| 643 | 3300031344 | Ga0265316_10437309 | Ga0265316_104373091 | 238 |
| 644 | 3300031595 | Ga0265313_10028584 | Ga0265313_100285844 | 238 |
| 645 | 3300031595 | Ga0265313_10062502 | Ga0265313_100625022 | 238 |
| 646 | 3300031711 | Ga0265314_10046661 | Ga0265314_100466614 | 238 |
| 647 | 3300031712 | Ga0265342_10000625 | Ga0265342_1000062510 | 238 |
| 648 | 3300031712 | Ga0265342_10005956 | Ga0265342_100059569 | 238 |
| 649 | 3300034816 | Ga0373930_0003817 | Ga0373930_0003817_1642_2358 | 238 |
| 650 | 3300034816 | Ga0373930_0009997 | Ga0373930_0009997_125_841 | 238 |
| 651 | 3300034817 | Ga0373948_0001446 | Ga0373948_0001446_305_1021 | 238 |
| 652 | 3300034817 | Ga0373948_0001993 | Ga0373948_0001993_2195_2911 | 238 |
| 653 | 3300034818 | Ga0373950_0000469 | Ga0373950_0000469_366_1082 | 238 |
| 654 | 3300034819 | Ga0373958_0000037 | Ga0373958_0000037_8434_9150 | 238 |
| 655 | 3300034819 | Ga0373958_0020735 | Ga0373958_0020735_182_898 | 238 |
| 656 | 3300034957 | Ga0373938_0000190 | Ga0373938_0000190_2667_3383 | 238 |
| 657 | 3300034957 | Ga0373938_0009129 | Ga0373938_0009129_771_1487 | 238 |
| 658 | 3300034957 | Ga0373938_0065615 | Ga0373938_0065615_58_774 | 238 |
| 659 | 3300035083 | Ga0373926_0106659 | Ga0373926_0106659_161_877 | 238 |
| 660 | 3300035084 | Ga0373928_0000490 | Ga0373928_0000490_1544_2260 | 238 |
| 661 | 3300035085 | Ga0373929_0000503 | Ga0373929_0000503_2660_3376 | 238 |
| 662 | 3300035085 | Ga0373929_0085729 | Ga0373929_0085729_17_733 | 238 |
| 663 | 3300035088 | Ga0373940_0000178 | Ga0373940_0000178_1159_1875 | 238 |
| 664 | 3300035088 | Ga0373940_0001969 | Ga0373940_0001969_3089_3805 | 238 |
| 665 | 3300035089 | Ga0373944_0007842 | Ga0373944_0007842_1095_1811 | 238 |
| 666 | 3300035090 | Ga0373949_0001015 | Ga0373949_0001015_4238_4954 | 238 |
| 667 | 3300035090 | Ga0373949_0035920 | Ga0373949_0035920_296_1012 | 238 |
| 668 | 3300035091 | Ga0373951_0000165 | Ga0373951_0000165_6000_6716 | 238 |
| 669 | 3300035091 | Ga0373951_0007934 | Ga0373951_0007934_57_773 | 238 |
| 670 | 3300035092 | Ga0373952_0000676 | Ga0373952_0000676_921_1637 | 238 |
| 671 | 3300035092 | Ga0373952_0004795 | Ga0373952_0004795_865_1581 | 238 |
| 672 | 3300035111 | Ga0373923_0000996 | Ga0373923_0000996_1568_2284 | 238 |
| 673 | 3300035111 | Ga0373923_0055815 | Ga0373923_0055815_613_1329 | 238 |
| 674 | 3300035112 | Ga0373932_0000221 | Ga0373932_0000221_6647_7363 | 238 |
| 675 | 3300035112 | Ga0373932_0011462 | Ga0373932_0011462_1149_1865 | 238 |
| 676 | 3300035114 | Ga0373939_0000178 | Ga0373939_0000178_9937_10653 | 238 |
| 677 | 3300035114 | Ga0373939_0000211 | Ga0373939_0000211_10598_11314 | 238 |
| 678 | 3300035115 | Ga0373941_0000085 | Ga0373941_0000085_9803_10519 | 238 |
| 679 | 3300035116 | Ga0373945_0017285 | Ga0373945_0017285_580_1296 | 238 |
| 680 | 3300035116 | Ga0373945_0032699 | Ga0373945_0032699_242_958 | 238 |
| 681 | 3300035118 | Ga0373954_0009599 | Ga0373954_0009599_203_919 | 238 |
| 682 | 3300035118 | Ga0373954_0131830 | Ga0373954_0131830_478_1194 | 238 |
| 683 | 3300035120 | Ga0373957_0021944 | Ga0373957_0021944_798_1514 | 238 |
| 684 | 3300035121 | Ga0373960_0002021 | Ga0373960_0002021_3206_3922 | 238 |
| 685 | 3300035170 | Ga0373943_0029129 | Ga0373943_0029129_1056_1772 | 238 |
| 686 | 3300035170 | Ga0373943_0045435 | Ga0373943_0045435_967_1683 | 238 |
| 687 | 3300035170 | Ga0373943_0191361 | Ga0373943_0191361_41_757 | 238 |
| 688 | 3300035171 | Ga0373946_0009900 | Ga0373946_0009900_2190_2906 | 238 |
| 689 | 3300035172 | Ga0373955_0020162 | Ga0373955_0020162_1480_2196 | 238 |
| 690 | 3300035207 | Ga0373942_0000892 | Ga0373942_0000892_2110_2826 | 238 |
| 691 | 3300035207 | Ga0373942_0006884 | Ga0373942_0006884_664_1380 | 238 |
| 692 | 3300035241 | Ga0373961_0001088 | Ga0373961_0001088_2663_3379 | 238 |
| 693 | 3300035242 | Ga0373962_0000271 | Ga0373962_0000271_1895_2611 | 238 |
| 694 | 3300035242 | Ga0373962_0008443 | Ga0373962_0008443_76_792 | 238 |
| 695 | 3300035691 | Ga0373931_0000854 | Ga0373931_0000854_11733_12449 | 238 |
| 696 | 3300035691 | Ga0373931_0002074 | Ga0373931_0002074_3696_4412 | 238 |
| 697 | 3300035691 | Ga0373931_0049738 | Ga0373931_0049738_657_1373 | 238 |
| 698 | 3300035692 | Ga0373935_0008929 | Ga0373935_0008929_3717_4433 | 238 |
| 699 | 3300035692 | Ga0373935_0050374 | Ga0373935_0050374_114_830 | 238 |
| 700 | 3300035692 | Ga0373935_0110958 | Ga0373935_0110958_398_1114 | 238 |
| 701 | 3300035724 | Ga0373933_0004073 | Ga0373933_0004073_6558_7274 | 238 |
| 702 | 3300035724 | Ga0373933_0046184 | Ga0373933_0046184_1052_1768 | 238 |
| 703 | 3300035725 | Ga0373947_0041566 | Ga0373947_0041566_114_830 | 238 |
| 704 | 3300035725 | Ga0373947_0159352 | Ga0373947_0159352_659_1375 | 238 |
| 705 | 3300036401 | Ga0373937_0077423 | Ga0373937_0077423_563_1279 | 238 |
| 706 | 3300037068 | Ga0373925_0011017 | Ga0373925_0011017_475_1191 | 238 |
| 707 | 3300037068 | Ga0373925_0045167 | Ga0373925_0045167_1741_2457 | 238 |
| 708 | 3300042012 | Ga0439455_0060558 | Ga0439455_0060558_215_931 | 238 |
| 709 | 3300042439 | Ga0439464_0010927 | Ga0439464_0010927_316_1032 | 238 |
| 710 | 3300042461 | Ga0439460_0002807 | Ga0439460_0002807_3177_3893 | 238 |
| 711 | 3300042876 | Ga0451577_0110064 | Ga0451577_0110064_998_1714 | 238 |
| 712 | 3300044712 | Ga0453684_0033092 | Ga0453684_0033092_657_1373 | 238 |
| 713 | 3300044842 | Ga0466957_0050126 | Ga0466957_0050126_314_1054 | 238 |
| 714 | 3300046452 | Ga0495617_008378 | Ga0495617_008378_48_764 | 238 |
| 715 | 3300046454 | Ga0495592_0030221 | Ga0495592_0030221_561_1277 | 238 |
| 716 | 3300046455 | Ga0495603_0023238 | Ga0495603_0023238_1782_2498 | 238 |
| 717 | 3300046459 | Ga0495629_0190023 | Ga0495629_0190023_665_1381 | 238 |
| 718 | 3300046459 | Ga0495629_0191748 | Ga0495629_0191748_278_994 | 238 |
| 719 | 3300046461 | Ga0495641_0284007 | Ga0495641_0284007_11_727 | 238 |
| 720 | 3300046462 | Ga0495651_0024567 | Ga0495651_0024567_3949_4665 | 238 |
| 721 | 3300046462 | Ga0495651_0067604 | Ga0495651_0067604_1884_2600 | 238 |
| 722 | 3300046472 | Ga0495580_0012209 | Ga0495580_0012209_2037_2753 | 238 |
| 723 | 3300046472 | Ga0495580_0182157 | Ga0495580_0182157_605_1321 | 238 |
| 724 | 3300046474 | Ga0495605_0067466 | Ga0495605_0067466_463_1179 | 238 |
| 725 | 3300046475 | Ga0495639_0009652 | Ga0495639_0009652_1432_2148 | 238 |
| 726 | 3300046476 | Ga0495662_0007526 | Ga0495662_0007526_3590_4306 | 238 |
| 727 | 3300046477 | Ga0495664_0020087 | Ga0495664_0020087_1174_1890 | 238 |
| 728 | 3300046477 | Ga0495664_0259994 | Ga0495664_0259994_10_726 | 238 |
| 729 | 3300046491 | Ga0495584_0002387 | Ga0495584_0002387_4416_5132 | 238 |
| 730 | 3300046492 | Ga0495585_0006758 | Ga0495585_0006758_5855_6571 | 238 |
| 731 | 3300046499 | Ga0495594_0003274 | Ga0495594_0003274_885_1601 | 238 |
| 732 | 3300046499 | Ga0495594_0134764 | Ga0495594_0134764_308_1024 | 238 |
| 733 | 3300046501 | Ga0495607_0004095 | Ga0495607_0004095_501_1217 | 238 |
| 734 | 3300046511 | Ga0495608_0004901 | Ga0495608_0004901_959_1675 | 238 |
| 735 | 3300046511 | Ga0495608_0129443 | Ga0495608_0129443_370_1086 | 238 |
| 736 | 3300046511 | Ga0495608_0435981 | Ga0495608_0435981_22_738 | 238 |
| 737 | 3300046516 | Ga0495628_0000249 | Ga0495628_0000249_8997_9713 | 238 |
| 738 | 3300046517 | Ga0495630_0031426 | Ga0495630_0031426_625_1341 | 238 |
| 739 | 3300046517 | Ga0495630_0042795 | Ga0495630_0042795_602_1318 | 238 |
| 740 | 3300046523 | Ga0495644_0000563 | Ga0495644_0000563_12381_13097 | 238 |
| 741 | 3300046525 | Ga0495663_0071740 | Ga0495663_0071740_348_1064 | 238 |
| 742 | 3300046526 | Ga0495666_0007295 | Ga0495666_0007295_3067_3783 | 238 |
| 743 | 3300046529 | Ga0495652_0027838 | Ga0495652_0027838_189_905 | 238 |
| 744 | 3300046529 | Ga0495652_0046742 | Ga0495652_0046742_1378_2094 | 238 |
| 745 | 3300046529 | Ga0495652_0077412 | Ga0495652_0077412_1027_1743 | 238 |
| 746 | 3300046531 | Ga0495665_0042064 | Ga0495665_0042064_1255_1971 | 238 |
| 747 | 3300046533 | Ga0495640_0024501 | Ga0495640_0024501_1910_2626 | 238 |
| 748 | 3300046533 | Ga0495640_0043942 | Ga0495640_0043942_834_1550 | 238 |
| 749 | 3300046533 | Ga0495640_0263127 | Ga0495640_0263127_196_912 | 238 |
| 750 | 3300046535 | Ga0495586_0005125 | Ga0495586_0005125_761_1477 | 238 |
| 751 | 3300046537 | Ga0495598_0008777 | Ga0495598_0008777_515_1231 | 238 |
| 752 | 3300046543 | Ga0495645_0001006 | Ga0495645_0001006_5457_6173 | 238 |
| 753 | 3300046557 | Ga0495622_0009107 | Ga0495622_0009107_389_1105 | 238 |
| 754 | 3300046558 | Ga0495633_0009862 | Ga0495633_0009862_499_1215 | 238 |
| 755 | 3300046559 | Ga0495667_0015258 | Ga0495667_0015258_957_1673 | 238 |
| 756 | 3300046559 | Ga0495667_0122831 | Ga0495667_0122831_407_1123 | 238 |
| 757 | 3300046615 | Ga0495656_0000123 | Ga0495656_0000123_15099_15815 | 238 |
| 758 | 3300046648 | Ga0495611_0031419 | Ga0495611_0031419_1141_1857 | 238 |
| 759 | 3300046663 | Ga0495635_0009801 | Ga0495635_0009801_674_1390 | 238 |
| 760 | 3300046663 | Ga0495635_0017843 | Ga0495635_0017843_1163_1879 | 238 |
| 761 | 3300046663 | Ga0495635_0089336 | Ga0495635_0089336_590_1306 | 238 |
| 762 | 3300046663 | Ga0495635_0110448 | Ga0495635_0110448_793_1509 | 238 |
| 763 | 3300046664 | Ga0495659_0000648 | Ga0495659_0000648_6141_6857 | 238 |
| 764 | 3300046665 | Ga0495661_0164897 | Ga0495661_0164897_218_934 | 238 |
| 765 | 3300046674 | Ga0495588_0008051 | Ga0495588_0008051_3639_4355 | 238 |
| 766 | 3300046675 | Ga0495657_0057935 | Ga0495657_0057935_1038_1754 | 238 |
| 767 | 3300046675 | Ga0495657_0081193 | Ga0495657_0081193_1099_1815 | 238 |
| 768 | 3300046678 | Ga0495599_0083707 | Ga0495599_0083707_1207_1923 | 238 |
| 769 | 3300046680 | Ga0495646_0042236 | Ga0495646_0042236_1214_1930 | 238 |
| 770 | 3300046681 | Ga0495647_0022026 | Ga0495647_0022026_1387_2103 | 238 |
| 771 | 3300046683 | Ga0495658_0070081 | Ga0495658_0070081_34_750 | 238 |
| 772 | 3300046684 | Ga0495669_0035712 | Ga0495669_0035712_558_1274 | 238 |
| 773 | 3300046684 | Ga0495669_0097911 | Ga0495669_0097911_383_1099 | 238 |
| 774 | 3300046690 | Ga0495624_0042350 | Ga0495624_0042350_605_1321 | 238 |
| 775 | 3300046690 | Ga0495624_0111873 | Ga0495624_0111873_929_1645 | 238 |
| 776 | 3300046691 | Ga0495670_0000220 | Ga0495670_0000220_3566_4282 | 238 |
| 777 | 3300046692 | Ga0495671_0152732 | Ga0495671_0152732_35_751 | 238 |
| 778 | 3300046794 | Ga0495589_0020366 | Ga0495589_0020366_675_1391 | 238 |
| 779 | 3300046809 | Ga0495600_0002039 | Ga0495600_0002039_5511_6227 | 238 |
| 780 | 3300046809 | Ga0495600_0038138 | Ga0495600_0038138_1723_2439 | 238 |
| 781 | 3300046809 | Ga0495600_0118220 | Ga0495600_0118220_637_1353 | 238 |
| 782 | 3300047315 | Ga0495581_0004313 | Ga0495581_0004313_6674_7390 | 238 |
| 783 | 3300047315 | Ga0495581_0204678 | Ga0495581_0204678_125_841 | 238 |
| 784 | 3300047317 | Ga0495604_0004173 | Ga0495604_0004173_2498_3214 | 238 |
| 785 | 3300047317 | Ga0495604_0010825 | Ga0495604_0010825_1378_2094 | 238 |
| 786 | 3300047317 | Ga0495604_0038467 | Ga0495604_0038467_820_1536 | 238 |
| 787 | 3300047318 | Ga0495636_0173418 | Ga0495636_0173418_211_927 | 238 |
| 788 | 3300047319 | Ga0495674_0024302 | Ga0495674_0024302_2688_3404 | 238 |
| 789 | 3300047319 | Ga0495674_0088560 | Ga0495674_0088560_1899_2615 | 238 |
| 790 | 3300047319 | Ga0495674_0131761 | Ga0495674_0131761_1065_1781 | 238 |
| 791 | 3300047321 | Ga0495676_0061723 | Ga0495676_0061723_570_1286 | 238 |
| 792 | 3300047322 | Ga0495680_0034890 | Ga0495680_0034890_1991_2707 | 238 |
| 793 | 3300047322 | Ga0495680_0080206 | Ga0495680_0080206_585_1301 | 238 |
| 794 | 3300047322 | Ga0495680_0448348 | Ga0495680_0448348_145_861 | 238 |
| 795 | 3300047471 | Ga0495684_0002684 | Ga0495684_0002684_4772_5488 | 238 |
| 796 | 3300047673 | Ga0495593_0149038 | Ga0495593_0149038_72_788 | 238 |
| 797 | 3300047673 | Ga0495593_0154193 | Ga0495593_0154193_435_1151 | 238 |
| 798 | 3300047673 | Ga0495593_0219393 | Ga0495593_0219393_29_745 | 238 |
| 799 | 3300048088 | Ga0495602_0011207 | Ga0495602_0011207_4378_5094 | 238 |
| 800 | 3300048088 | Ga0495602_0076573 | Ga0495602_0076573_219_935 | 238 |
| 801 | 3300048903 | Ga0496100_0004355 | Ga0496100_0004355_3575_4291 | 238 |
| 802 | 3300048903 | Ga0496100_0146317 | Ga0496100_0146317_160_876 | 238 |
| 803 | 3300048904 | Ga0496101_0000468 | Ga0496101_0000468_12320_13036 | 238 |
| 804 | 3300048904 | Ga0496101_0152271 | Ga0496101_0152271_159_875 | 238 |
| 805 | 3300048905 | Ga0496102_0006543 | Ga0496102_0006543_9164_9880 | 238 |
| 806 | 3300048905 | Ga0496102_0009433 | Ga0496102_0009433_4589_5305 | 238 |
| 807 | 3300048905 | Ga0496102_0085915 | Ga0496102_0085915_1284_2000 | 238 |
| 808 | 3300048906 | Ga0496103_0004706 | Ga0496103_0004706_4461_5177 | 238 |
| 809 | 3300048906 | Ga0496103_0312723 | Ga0496103_0312723_39_755 | 238 |
| 810 | 3300048907 | Ga0496104_0000239 | Ga0496104_0000239_6892_7608 | 238 |
| 811 | 3300048907 | Ga0496104_0096042 | Ga0496104_0096042_1047_1763 | 238 |
| 812 | 3300048908 | Ga0496105_0000324 | Ga0496105_0000324_28372_29088 | 238 |
| 813 | 3300048908 | Ga0496105_0047936 | Ga0496105_0047936_2558_3274 | 238 |
| 814 | 3300048908 | Ga0496105_0547882 | Ga0496105_0547882_76_792 | 238 |
| 815 | 3300048909 | Ga0496106_0022981 | Ga0496106_0022981_1534_2250 | 238 |
| 816 | 3300048909 | Ga0496106_0075506 | Ga0496106_0075506_729_1445 | 238 |
| 817 | 3300048910 | Ga0496107_0000965 | Ga0496107_0000965_7796_8512 | 238 |
| 818 | 3300048910 | Ga0496107_0012402 | Ga0496107_0012402_216_932 | 238 |
| 819 | 3300048910 | Ga0496107_0045438 | Ga0496107_0045438_1073_1789 | 238 |
| 820 | 3300048911 | Ga0496108_0001543 | Ga0496108_0001543_6053_6769 | 238 |
| 821 | 3300048911 | Ga0496108_0005663 | Ga0496108_0005663_4219_4935 | 238 |
| 822 | 3300048911 | Ga0496108_0049695 | Ga0496108_0049695_1636_2352 | 238 |
| 823 | 3300048911 | Ga0496108_0122672 | Ga0496108_0122672_1383_2099 | 238 |
| 824 | 3300048912 | Ga0496109_0000414 | Ga0496109_0000414_27145_27861 | 238 |
| 825 | 3300048912 | Ga0496109_0004282 | Ga0496109_0004282_6844_7560 | 238 |
| 826 | 3300048913 | Ga0496110_0008470 | Ga0496110_0008470_4219_4935 | 238 |
| 827 | 3300048913 | Ga0496110_0013604 | Ga0496110_0013604_2923_3639 | 238 |
| 828 | 3300048913 | Ga0496110_0065165 | Ga0496110_0065165_1481_2197 | 238 |
| 829 | 3300048914 | Ga0496111_0028377 | Ga0496111_0028377_996_1712 | 238 |
| 830 | 3300048914 | Ga0496111_0085077 | Ga0496111_0085077_1520_2236 | 238 |
| 831 | 3300048915 | Ga0496112_0020521 | Ga0496112_0020521_561_1277 | 238 |
| 832 | 3300048915 | Ga0496112_0073867 | Ga0496112_0073867_269_985 | 238 |
| 833 | 3300048916 | Ga0496113_0027002 | Ga0496113_0027002_1590_2306 | 238 |
| 834 | 3300048916 | Ga0496113_0047579 | Ga0496113_0047579_557_1273 | 238 |
| 835 | 3300048917 | Ga0496114_0003058 | Ga0496114_0003058_11439_12155 | 238 |
| 836 | 3300048917 | Ga0496114_0013686 | Ga0496114_0013686_2764_3480 | 238 |
| 837 | 3300048918 | Ga0496115_0003980 | Ga0496115_0003980_6301_7017 | 238 |
| 838 | 3300048918 | Ga0496115_0026545 | Ga0496115_0026545_2759_3475 | 238 |
| 839 | 3300049581 | Ga0501047_0051298 | Ga0501047_0051298_1275_2000 | 238 |
| 840 | 3300049592 | Ga0501076_0149669 | Ga0501076_0149669_69_785 | 238 |
| 841 | 3300049593 | Ga0501077_0025325 | Ga0501077_0025325_427_1143 | 238 |
| 842 | 3300049823 | Ga0501044_0016958 | Ga0501044_0016958_5832_6557 | 238 |
| 843 | 3300050495 | nmdc:mga04h51_77702_c1 | nmdc:mga04h51_77702_c1_205_921 | 238 |
| 844 | 3300050496 | nmdc:mga07m45_66019_c1 | nmdc:mga07m45_66019_c1_262_978 | 238 |
| 845 | 3300050507 | nmdc:mga05p37_863_c1 | nmdc:mga05p37_863_c1_22269_22985 | 238 |
| 846 | 3300050508 | nmdc:mga09592_1701_c1 | nmdc:mga09592_1701_c1_11124_11840 | 238 |
| 847 | 3300050509 | nmdc:mga0qj67_2984_c1 | nmdc:mga0qj67_2984_c1_11220_11936 | 238 |
| 848 | 3300050510 | nmdc:mga06r32_6584_c1 | nmdc:mga06r32_6584_c1_5481_6197 | 238 |
| 849 | 3300050511 | nmdc:mga08y16_13856_c1 | nmdc:mga08y16_13856_c1_3068_3784 | 238 |
| 850 | 3300050511 | nmdc:mga08y16_2133_c1 | nmdc:mga08y16_2133_c1_10046_10762 | 238 |
| 851 | 3300050511 | nmdc:mga08y16_3076_c1 | nmdc:mga08y16_3076_c1_13326_14042 | 238 |
| 852 | 3300050512 | nmdc:mga0n895_104046_c1 | nmdc:mga0n895_104046_c1_995_1711 | 238 |
| 853 | 3300050512 | nmdc:mga0n895_164171_c1 | nmdc:mga0n895_164171_c1_988_1704 | 238 |
| 854 | 3300050512 | nmdc:mga0n895_335732_c1 | nmdc:mga0n895_335732_c1_786_1502 | 238 |
| 855 | 3300050512 | nmdc:mga0n895_427_c1 | nmdc:mga0n895_427_c1_15199_15915 | 238 |
| 856 | 3300050512 | nmdc:mga0n895_55_c1 | nmdc:mga0n895_55_c1_41465_42181 | 238 |
| 857 | 3300050514 | nmdc:mga08x19_502317_c1 | nmdc:mga08x19_502317_c1_76_792 | 238 |
| 858 | 3300050515 | nmdc:mga0a205_182379_c1 | nmdc:mga0a205_182379_c1_489_1205 | 238 |
| 859 | 3300050515 | nmdc:mga0a205_2491_c1 | nmdc:mga0a205_2491_c1_4268_4984 | 238 |
| 860 | 3300050515 | nmdc:mga0a205_768_c4 | nmdc:mga0a205_768_c4_13335_14051 | 238 |
| 861 | 3300053077 | Ga0495601_0001987 | Ga0495601_0001987_2698_3414 | 238 |
| 862 | 3300053077 | Ga0495601_0002541 | Ga0495601_0002541_1771_2487 | 238 |
| 863 | 3300053078 | Ga0495612_0000243 | Ga0495612_0000243_7226_7942 | 238 |
| 864 | 3300053078 | Ga0495612_0004160 | Ga0495612_0004160_4978_5694 | 238 |
| 865 | 3300053078 | Ga0495612_0004394 | Ga0495612_0004394_4248_4964 | 238 |
| 866 | 3300053084 | Ga0495595_0002469 | Ga0495595_0002469_2108_2824 | 238 |
| 867 | 3300053084 | Ga0495595_0003265 | Ga0495595_0003265_4985_5701 | 238 |
| 868 | 3300053085 | Ga0495619_0000139 | Ga0495619_0000139_40269_40985 | 238 |
| 869 | 3300053085 | Ga0495619_0000365 | Ga0495619_0000365_308_1024 | 238 |
| 870 | 3300053085 | Ga0495619_0001830 | Ga0495619_0001830_6270_6986 | 238 |
| 871 | 3300053085 | Ga0495619_0049976 | Ga0495619_0049976_1622_2338 | 238 |
| 872 | 3300053094 | Ga0500566_0203336 | Ga0500566_0203336_268_984 | 238 |
| 873 | 3300054114 | Ga0501084_0312396 | Ga0501084_0312396_149_865 | 238 |
| 874 | iso_pu_bacteria | 8006973647 | 8006976192 | 238 |
| 875 | 3300009174 | Ga0105241_10071516 | Ga0105241_100715164 | 242 |
| 876 | 3300009551 | Ga0105238_10147753 | Ga0105238_101477534 | 242 |
| 877 | 3300013307 | Ga0157372_10295438 | Ga0157372_102954382 | 242 |
| 878 | 3300049578 | Ga0501042_0034896 | Ga0501042_0034896_857_1591 | 242 |
| 879 | 3300049587 | Ga0501071_0039005 | Ga0501071_0039005_1430_2164 | 242 |
| 880 | 3300049588 | Ga0501072_0080592 | Ga0501072_0080592_419_1153 | 242 |
| 881 | 3300049592 | Ga0501076_0009353 | Ga0501076_0009353_6042_6776 | 242 |
| 882 | 3300049593 | Ga0501077_0111132 | Ga0501077_0111132_455_1189 | 242 |
| 883 | 3300049741 | Ga0501079_0046174 | Ga0501079_0046174_1900_2634 | 242 |
| 884 | 3300049742 | Ga0501080_0807015 | Ga0501080_0807015_16_750 | 242 |
| 885 | 3300049743 | Ga0501081_0018810 | Ga0501081_0018810_2935_3669 | 242 |
| 886 | 3300060353 | Ga0501082_0042848 | Ga0501082_0042848_101_835 | 242 |
| 887 | 3300061734 | Ga0530510_0029878 | Ga0530510_0029878_1277_2011 | 242 |
| 888 | 3300005329 | Ga0070683_100099828 | Ga0070683_1000998282 | 243 |
| 889 | 3300005336 | Ga0070680_100150823 | Ga0070680_1001508232 | 243 |
| 890 | 3300005439 | Ga0070711_100275404 | Ga0070711_1002754042 | 243 |
| 891 | 3300005458 | Ga0070681_10127736 | Ga0070681_101277363 | 243 |
| 892 | 3300005535 | Ga0070684_100041910 | Ga0070684_1000419102 | 243 |
| 893 | 3300005547 | Ga0070693_100193276 | Ga0070693_1001932762 | 243 |
| 894 | 3300009093 | Ga0105240_10164390 | Ga0105240_101643902 | 243 |
| 895 | 3300013100 | Ga0157373_10078404 | Ga0157373_100784042 | 243 |
| 896 | 3300013104 | Ga0157370_10094541 | Ga0157370_100945412 | 243 |
| 897 | 3300013105 | Ga0157369_10118116 | Ga0157369_101181162 | 243 |
| 898 | 3300020082 | Ga0206353_10968937 | Ga0206353_109689372 | 243 |
| 899 | 3300025898 | Ga0207692_10099162 | Ga0207692_100991622 | 243 |
| 900 | 3300025915 | Ga0207693_10002221 | Ga0207693_1000222110 | 243 |
| 901 | 3300025917 | Ga0207660_10234908 | Ga0207660_102349082 | 243 |
| 902 | 3300025924 | Ga0207694_10282189 | Ga0207694_102821892 | 243 |
| 903 | 3300025939 | Ga0207665_10112739 | Ga0207665_101127393 | 243 |
| 904 | 3300025949 | Ga0207667_10107081 | Ga0207667_101070813 | 243 |
| 905 | 3300025981 | Ga0207640_10157223 | Ga0207640_101572232 | 243 |
| 906 | 3300000043 | ARcpr5yngRDRAFT_c000045 | ARcpr5yngRDRAFT_0000453 | 245 |
| 907 | 3300005330 | Ga0070690_100009502 | Ga0070690_1000095027 | 245 |
| 908 | 3300005366 | Ga0070659_100035555 | Ga0070659_1000355552 | 245 |
| 909 | 3300005549 | Ga0070704_100031993 | Ga0070704_1000319934 | 245 |
| 910 | 3300005841 | Ga0068863_100476300 | Ga0068863_1004763002 | 245 |
| 911 | 3300014325 | Ga0163163_10873168 | Ga0163163_108731681 | 245 |
| 912 | 3300005331 | Ga0070670_100156248 | Ga0070670_1001562483 | 246 |
| 913 | 3300048903 | Ga0496100_0001041 | Ga0496100_0001041_2604_3353 | 247 |
| 914 | 3300048905 | Ga0496102_0014986 | Ga0496102_0014986_5824_6573 | 247 |
| 915 | 3300048906 | Ga0496103_0122185 | Ga0496103_0122185_768_1517 | 247 |
| 916 | 3300048907 | Ga0496104_0002158 | Ga0496104_0002158_9341_10090 | 247 |
| 917 | 3300048908 | Ga0496105_0036316 | Ga0496105_0036316_3084_3833 | 247 |
| 918 | 3300048909 | Ga0496106_0079869 | Ga0496106_0079869_1041_1790 | 247 |
| 919 | 3300048910 | Ga0496107_0065092 | Ga0496107_0065092_1050_1799 | 247 |
| 920 | 3300048911 | Ga0496108_0001911 | Ga0496108_0001911_7810_8559 | 247 |
| 921 | 3300048918 | Ga0496115_0055608 | Ga0496115_0055608_1328_2077 | 247 |
| 922 | 3300049585 | Ga0501069_0263236 | Ga0501069_0263236_197_946 | 247 |
| 923 | 3300005329 | Ga0070683_100162944 | Ga0070683_1001629442 | 248 |
| 924 | 3300005530 | Ga0070679_100266003 | Ga0070679_1002660032 | 248 |
| 925 | 3300005563 | Ga0068855_100036036 | Ga0068855_1000360362 | 248 |
| 926 | 3300025921 | Ga0207652_10199447 | Ga0207652_101994472 | 248 |
| 927 | 3300005335 | Ga0070666_10001254 | Ga0070666_1000125413 | 251 |
| 928 | 3300005347 | Ga0070668_100225429 | Ga0070668_1002254292 | 251 |
| 929 | 3300005365 | Ga0070688_100039337 | Ga0070688_1000393373 | 251 |
| 930 | 3300005367 | Ga0070667_100029594 | Ga0070667_1000295944 | 251 |
| 931 | 3300005436 | Ga0070713_100000749 | Ga0070713_10000074913 | 251 |
| 932 | 3300005617 | Ga0068859_100039474 | Ga0068859_1000394744 | 251 |
| 933 | 3300006163 | Ga0070715_10001906 | Ga0070715_100019068 | 251 |
| 934 | 3300006358 | Ga0068871_100011284 | Ga0068871_1000112847 | 251 |
| 935 | 3300006881 | Ga0068865_100010595 | Ga0068865_1000105952 | 251 |
| 936 | 3300006931 | Ga0097620_100039475 | Ga0097620_1000394754 | 251 |
| 937 | 3300025927 | Ga0207687_10013822 | Ga0207687_100138224 | 251 |
| 938 | 3300025929 | Ga0207664_10063853 | Ga0207664_100638532 | 251 |
| 939 | 3300025935 | Ga0207709_10076700 | Ga0207709_100767002 | 251 |
| 940 | 3300025936 | Ga0207670_10202010 | Ga0207670_102020102 | 251 |
| 941 | 3300025938 | Ga0207704_10013384 | Ga0207704_100133844 | 251 |
| 942 | 3300025941 | Ga0207711_10033759 | Ga0207711_100337594 | 251 |
| 943 | 3300025960 | Ga0207651_10037796 | Ga0207651_100377962 | 251 |
| 944 | 3300025972 | Ga0207668_10275683 | Ga0207668_102756832 | 251 |
| 945 | 3300026035 | Ga0207703_10015632 | Ga0207703_100156327 | 251 |
| 946 | 3300026041 | Ga0207639_10060951 | Ga0207639_100609512 | 251 |
| 947 | 3300026067 | Ga0207678_10022132 | Ga0207678_100221324 | 251 |
| 948 | 3300035172 | Ga0373955_0037464 | Ga0373955_0037464_566_1351 | 251 |
| 949 | 3300046511 | Ga0495608_0348362 | Ga0495608_0348362_31_816 | 251 |
| 950 | 3300047317 | Ga0495604_0110806 | Ga0495604_0110806_15_800 | 251 |
| 951 | 3300005437 | Ga0070710_10010981 | Ga0070710_100109814 | 252 |
| 952 | 3300005439 | Ga0070711_100036981 | Ga0070711_1000369812 | 252 |
| 953 | 3300005543 | Ga0070672_100278922 | Ga0070672_1002789221 | 252 |
| 954 | 3300005614 | Ga0068856_100129813 | Ga0068856_1001298133 | 252 |
| 955 | 3300006173 | Ga0070716_100021168 | Ga0070716_1000211683 | 252 |
| 956 | 3300006175 | Ga0070712_100248395 | Ga0070712_1002483951 | 252 |
| 957 | 3300025898 | Ga0207692_10006921 | Ga0207692_100069214 | 252 |
| 958 | 3300025911 | Ga0207654_10080821 | Ga0207654_100808213 | 252 |
| 959 | 3300025931 | Ga0207644_10011436 | Ga0207644_100114362 | 252 |
| 960 | 3300025934 | Ga0207686_10132324 | Ga0207686_101323242 | 252 |
| 961 | 3300025939 | Ga0207665_10007282 | Ga0207665_100072827 | 252 |
| 962 | 3300026023 | Ga0207677_10144649 | Ga0207677_101446491 | 252 |
| 963 | 3300049571 | Ga0501034_0083273 | Ga0501034_0083273_683_1480 | 252 |
| 964 | 3300036647 | Ga0316582_0165993 | Ga0316582_0165993_517_1287 | 256 |
| 965 | 3300049573 | Ga0501037_0079639 | Ga0501037_0079639_959_1756 | 261 |
| 966 | 3300049581 | Ga0501047_0011528 | Ga0501047_0011528_4339_5136 | 261 |
| 967 | 3300049742 | Ga0501080_0202684 | Ga0501080_0202684_1011_1808 | 261 |
| 968 | 3300049822 | Ga0501035_0127484 | Ga0501035_0127484_471_1268 | 261 |
| 969 | 3300049823 | Ga0501044_0069624 | Ga0501044_0069624_699_1496 | 261 |
| 970 | 3300005840 | Ga0068870_10259385 | Ga0068870_102593851 | 264 |
| 971 | 3300006852 | Ga0075433_10007157 | Ga0075433_100071572 | 264 |
| 972 | 3300006871 | Ga0075434_100009281 | Ga0075434_1000092813 | 264 |
| 973 | 3300007076 | Ga0075435_100003880 | Ga0075435_1000038806 | 264 |
| 974 | 3300009147 | Ga0114129_10006668 | Ga0114129_1000666821 | 264 |
| 975 | 3300025908 | Ga0207643_10246779 | Ga0207643_102467792 | 264 |
| 976 | 3300005614 | Ga0068856_100058628 | Ga0068856_1000586285 | 273 |
| 977 | 3300005615 | Ga0070702_100192188 | Ga0070702_1001921881 | 273 |
| 978 | 3300048089 | Ga0495614_0026352 | Ga0495614_0026352_330_1154 | 273 |
| 979 | 3300005937 | Ga0081455_10000002 | Ga0081455_10000002273 | 283 |
| 980 | 3300025933 | Ga0207706_10068324 | Ga0207706_100683245 | 288 |
| 981 | 3300000041 | ARcpr5oldR_c000176 | ARcpr5oldR_0001763 | 290 |
| 982 | 3300000042 | ARSoilYngRDRAFT_c00912 | ARSoilYngRDRAFT_009123 | 290 |
| 983 | 3300000044 | ARSoilOldRDRAFT_c000265 | ARSoilOldRDRAFT_0002653 | 290 |
| 984 | 3300000044 | ARSoilOldRDRAFT_c000599 | ARSoilOldRDRAFT_0005994 | 290 |
| 985 | 3300000652 | ARCol0yngRDRAFT_1001185 | ARCol0yngRDRAFT_10011853 | 290 |
| 986 | 3300005290 | Ga0065712_10000851 | Ga0065712_100008513 | 290 |
| 987 | 3300005293 | Ga0065715_10116267 | Ga0065715_101162673 | 290 |
| 988 | 3300005354 | Ga0070675_100096691 | Ga0070675_1000966913 | 290 |
| 989 | 3300005458 | Ga0070681_10056008 | Ga0070681_100560084 | 290 |
| 990 | 3300013105 | Ga0157369_10401104 | Ga0157369_104011042 | 290 |
| 991 | 3300025917 | Ga0207660_10055323 | Ga0207660_100553234 | 290 |
| 992 | 3300025961 | Ga0207712_10031991 | Ga0207712_100319914 | 290 |
| 993 | 3300025981 | Ga0207640_10078383 | Ga0207640_100783832 | 290 |
| 994 | 3300028380 | Ga0268265_10033423 | Ga0268265_100334233 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cw9-assembly1.cif.gz_A | crystal structure of human tim44 c-terminal domain | 0.864 | 141 | 289 |
| 7qh6-assembly1.cif.gz_d | cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 1 | 0.8505 | 144 | 288 |
| 7qh7-assembly1.cif.gz_d | cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 4 | 0.8469 | 144 | 290 |
| 6nu3-assembly1.cif.gz_d | structural insights into unique features of the human mitochondrial ribosome recycling | 0.839 | 142 | 290 |
| 8scx-assembly1.cif.gz_C | cryo-em structure of the core tim23 complex from s. cerevisiae | 0.8293 | 140 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8GXP7_158_313_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9129 | 142 | 287 | 3.10.450.240 |
| af_O02161_236_422_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9023 | 141 | 287 | 3.10.450.240 |
| af_Q8GXP7_158_313_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.852 | 142 | 287 | 3.10.450.240 |
| 2cw9A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8458 | 143 | 289 | 3.10.450.240 |
| af_A0A1D6ILC0_91_266_3.10.450.240 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8445 | 141 | 288 | 3.10.450.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522WFA1-F1-model_v4 | Tim44 domain-containing protein | 0.9903 | 164 | 290 |
|
| AF-A0A4R5XK26-F1-model_v4 | deleted | 0.9894 | 155 | 290 |
|
| AF-A0A520HWE3-F1-model_v4 | Tim44 domain-containing protein | 0.9846 | 162 | 289 |
|
| AF-D5RNY5-F1-model_v4 | Tim44-like domain protein | 0.9842 | 135 | 289 |
GO:0005840
GO:1990904 |
| AF-A0A434EZN2-F1-model_v4 | Calcium-binding protein | 0.9842 | 191 | 288 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar