F487624

General Info

Members Datasets Scaffolds Average Seq Length
990 466 1980 158

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016557553|8016565829
Length 171
Sequence HLAASSPLPEHARLAAFAGEWNGEEVVFPSRWTEGGSATSHVVAHMDLNGFYLIQDSVQTRDGKQVFATHGIFTFDREDRTYKLFWYDSLGYTPPSPASGGWSREDPDAGARLAPRQCAPRLRNHRRRFLFVEDPVLAGRGRLGRRPHRRLPPHPLTSHTLVSRKQTSCPS

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
310 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
311 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
312 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
313 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
385 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
386 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
387 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
388 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
389 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
390 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
391 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
392 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
393 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
394 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
395 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
396 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
397 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
398 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
399 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
400 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
401 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
402 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
403 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
404 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
405 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
409 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
410 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
411 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
412 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
416 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
417 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
418 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
419 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
420 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
421 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
422 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
423 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
424 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
425 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
426 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
434 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
435 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
436 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
437 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
438 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
439 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
440 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
441 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
442 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
443 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
444 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
445 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
446 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
447 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
448 2904699407
449 2906610324
450 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
451 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
452 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
453 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
454 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
455 2922425934
456 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
457 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
458 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
459 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
460 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
461 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
462 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
463 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
464 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
465 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
466 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 1.01
Isolates 3.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 2.42
Rhizoplane 5.96
Rhizosphere 72.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1004955 3300003214 Bacteria 2682
2 JGI25153J46596_10030586 3300003215 Bacteria 1829
3 JGI25404J52841_10019296 3300003659 Bacteria 1477
4 JGI25404J52841_10035351 3300003659 Bacteria 1064
5 Ga0055539_1020748 3300003752 Bacteria 783
6 Ga0055542_1014646 3300003762 Bacteria 1281
7 Ga0055543_1011352 3300004625 Bacteria 1827
8 Ga0065704_10142844 3300005289 Bacteria 1501
9 Ga0065712_10228589 3300005290 Bacteria 1003
10 Ga0065707_10024212 3300005295 Bacteria 1755
11 Ga0070676_10229590 3300005328 Bacteria 1230
12 Ga0070676_10660950 3300005328 Bacteria 759
13 Ga0070683_100109161 3300005329 Bacteria 2610
14 Ga0070683_100167461 3300005329 Bacteria 2085
15 Ga0070683_100270090 3300005329 Bacteria 1618
16 Ga0070683_100277403 3300005329 Bacteria 1595
17 Ga0070670_100746824 3300005331 Bacteria 881
18 Ga0068869_100451568 3300005334 Bacteria 1065
19 Ga0068869_101189775 3300005334 Bacteria 669
20 Ga0070666_10947092 3300005335 Bacteria 637
21 Ga0070680_100463354 3300005336 Bacteria 1083
22 Ga0070680_100852515 3300005336 Bacteria 785
23 Ga0070682_100140690 3300005337 Bacteria 1645
24 Ga0070682_100954204 3300005337 Bacteria 708
25 Ga0068868_100059956 3300005338 Bacteria 3011
26 Ga0068868_101012133 3300005338 Bacteria 761
27 Ga0068868_101458966 3300005338 Bacteria 639
28 Ga0070660_100501648 3300005339 Bacteria 1010
29 Ga0070691_10205067 3300005341 Bacteria 1038
30 Ga0070661_100466437 3300005344 Bacteria 1006
31 Ga0070661_100739494 3300005344 Bacteria 804
32 Ga0070661_101243556 3300005344 Bacteria 623
33 Ga0070668_100216872 3300005347 Bacteria 1576
34 Ga0070668_100424000 3300005347 Bacteria 1139
35 Ga0070668_100776729 3300005347 Bacteria 849
36 Ga0070668_102037548 3300005347 Bacteria 529
37 Ga0070668_102037549 3300005347 Bacteria 529
38 Ga0070669_100609029 3300005353 Bacteria 916
39 Ga0070671_101076359 3300005355 Bacteria 706
40 Ga0070674_101290983 3300005356 Bacteria 651
41 Ga0070673_100230498 3300005364 Bacteria 1606
42 Ga0070673_100760705 3300005364 Bacteria 892
43 Ga0070688_100208310 3300005365 Bacteria 1371
44 Ga0070688_100588175 3300005365 Bacteria 850
45 Ga0070659_101317869 3300005366 Bacteria 640
46 Ga0070667_100271251 3300005367 Bacteria 1521
47 Ga0070667_101493029 3300005367 Bacteria 635
48 Ga0070667_101683202 3300005367 Bacteria 596
49 Ga0070703_10299640 3300005406 Bacteria 670
50 Ga0070709_10194830 3300005434 Bacteria 1432
51 Ga0070709_10357658 3300005434 Bacteria 1080
52 Ga0070709_10420172 3300005434 Bacteria 1002
53 Ga0070709_10833475 3300005434 Bacteria 726
54 Ga0070709_10905858 3300005434 Bacteria 697
55 Ga0070714_100021967 3300005435 Bacteria 5227
56 Ga0070714_100431950 3300005435 Bacteria 1249
57 Ga0070714_100930256 3300005435 Bacteria 844
58 Ga0070713_100029455 3300005436 Bacteria 4349
59 Ga0070713_100080502 3300005436 Bacteria 2778
60 Ga0070713_100156027 3300005436 Bacteria 2034
61 Ga0070713_100330033 3300005436 Bacteria 1411
62 Ga0070713_100737828 3300005436 Bacteria 942
63 Ga0070713_101283380 3300005436 Bacteria 709
64 Ga0070710_10041326 3300005437 Bacteria 2546
65 Ga0070710_10055278 3300005437 Bacteria 2243
66 Ga0070710_10297910 3300005437 Bacteria 1052
67 Ga0070710_10336269 3300005437 Bacteria 995
68 Ga0070710_10577282 3300005437 Bacteria 780
69 Ga0070710_10611687 3300005437 Bacteria 760
70 Ga0070710_10754729 3300005437 Bacteria 691
71 Ga0070701_10194738 3300005438 Bacteria 1194
72 Ga0070711_100005553 3300005439 Bacteria 7552
73 Ga0070711_100194344 3300005439 Bacteria 1561
74 Ga0070711_100268474 3300005439 Bacteria 1345
75 Ga0070711_100315259 3300005439 Bacteria 1248
76 Ga0070700_101071426 3300005441 Bacteria 666
77 Ga0070700_101158779 3300005441 Bacteria 643
78 Ga0070700_101302622 3300005441 Bacteria 611
79 Ga0070694_100479641 3300005444 Bacteria 986
80 Ga0070663_100718471 3300005455 Bacteria 850
81 Ga0070663_100861160 3300005455 Bacteria 780
82 Ga0070663_101271406 3300005455 Bacteria 648
83 Ga0070678_100096322 3300005456 Bacteria 2282
84 Ga0070678_100363674 3300005456 Bacteria 1247
85 Ga0070678_100584240 3300005456 Bacteria 995
86 Ga0070662_100289078 3300005457 Bacteria 1328
87 Ga0070681_10017254 3300005458 Bacteria 7216
88 Ga0070681_10037401 3300005458 Bacteria 4871
89 Ga0070681_10075073 3300005458 Bacteria 3341
90 Ga0070681_10436888 3300005458 Bacteria 1221
91 Ga0068867_100630108 3300005459 Bacteria 938
92 Ga0068867_100633022 3300005459 Bacteria 936
93 Ga0070685_10466238 3300005466 Bacteria 888
94 Ga0070706_100234156 3300005467 Bacteria 1714
95 Ga0070706_100317287 3300005467 Bacteria 1454
96 Ga0070706_100574081 3300005467 Bacteria 1048
97 Ga0070706_100600472 3300005467 Bacteria 1023
98 Ga0070698_100059290 3300005471 Bacteria 3866
99 Ga0070698_100981492 3300005471 Bacteria 791
100 Ga0070699_100681478 3300005518 Bacteria 939
101 Ga0070699_100742484 3300005518 Bacteria 897
102 Ga0070679_100015647 3300005530 Bacteria 7292
103 Ga0070679_100163330 3300005530 Bacteria 2201
104 Ga0070684_100355097 3300005535 Bacteria 1349
105 Ga0070684_100395167 3300005535 Bacteria 1274
106 Ga0070684_100692908 3300005535 Bacteria 950
107 Ga0070684_100884156 3300005535 Bacteria 837
108 Ga0070697_100201326 3300005536 Bacteria 1693
109 Ga0068853_100390609 3300005539 Bacteria 1301
110 Ga0068853_100442522 3300005539 Bacteria 1221
111 Ga0068853_100484951 3300005539 Bacteria 1166
112 Ga0068853_100695337 3300005539 Bacteria 970
113 Ga0070672_100348785 3300005543 Bacteria 1261
114 Ga0070693_100040796 3300005547 Bacteria 2608
115 Ga0070693_100075050 3300005547 Bacteria 2001
116 Ga0070693_100395572 3300005547 Bacteria 957
117 Ga0070665_100206184 3300005548 Bacteria 1966
118 Ga0070665_100377590 3300005548 Bacteria 1425
119 Ga0070665_100519344 3300005548 Bacteria 1202
120 Ga0070665_101138158 3300005548 Bacteria 792
121 Ga0068855_100444992 3300005563 Bacteria 1414
122 Ga0068855_100686734 3300005563 Bacteria 1097
123 Ga0068855_101263499 3300005563 Bacteria 765
124 Ga0070664_101140914 3300005564 Bacteria 735
125 Ga0070664_101838180 3300005564 Bacteria 575
126 Ga0068857_100183974 3300005577 Bacteria 1902
127 Ga0068857_100311302 3300005577 Bacteria 1453
128 Ga0068857_100397294 3300005577 Bacteria 1282
129 Ga0068854_100272559 3300005578 Bacteria 1359
130 Ga0068854_100442540 3300005578 Bacteria 1084
131 Ga0068854_100501576 3300005578 Bacteria 1022
132 Ga0068856_100000883 3300005614 Bacteria 32112
133 Ga0068856_100107320 3300005614 Bacteria 2787
134 Ga0068856_100491914 3300005614 Bacteria 1247
135 Ga0068856_101140658 3300005614 Bacteria 796
136 Ga0068856_101473787 3300005614 Bacteria 695
137 Ga0068856_101840282 3300005614 Bacteria 617
138 Ga0068852_100067130 3300005616 Bacteria 3135
139 Ga0068852_100775901 3300005616 Bacteria 972
140 Ga0068852_100780793 3300005616 Bacteria 969
141 Ga0068852_101142168 3300005616 Bacteria 800
142 Ga0068852_101700076 3300005616 Bacteria 653
143 Ga0068859_100748173 3300005617 Bacteria 1066
144 Ga0068859_101012421 3300005617 Bacteria 912
145 Ga0068859_101200521 3300005617 Bacteria 835
146 Ga0068864_100123810 3300005618 Bacteria 2314
147 Ga0068864_100314239 3300005618 Bacteria 1470
148 Ga0068864_100339767 3300005618 Bacteria 1415
149 Ga0068866_10472137 3300005718 Bacteria 825
150 Ga0068861_100413798 3300005719 Bacteria 1200
151 Ga0068861_100541193 3300005719 Bacteria 1059
152 Ga0068870_10062707 3300005840 Bacteria 2003
153 Ga0068870_10415719 3300005840 Bacteria 879
154 Ga0068870_10419108 3300005840 Bacteria 876
155 Ga0068863_100488620 3300005841 Bacteria 1211
156 Ga0068863_100531991 3300005841 Bacteria 1159
157 Ga0068863_100554843 3300005841 Bacteria 1134
158 Ga0068860_100247682 3300005843 Bacteria 1734
159 Ga0068860_100952627 3300005843 Bacteria 875
160 Ga0068860_100960866 3300005843 Bacteria 872
161 Ga0068862_100148304 3300005844 Bacteria 2086
162 Ga0068862_100358612 3300005844 Bacteria 1354
163 Ga0068862_100632552 3300005844 Bacteria 1030
164 Ga0081540_1020688 3300005983 Bacteria 3947
165 Ga0081540_1020881 3300005983 Bacteria 3922
166 Ga0081540_1035114 3300005983 Bacteria 2693
167 Ga0081540_1055889 3300005983 Bacteria 1920
168 Ga0081540_1118995 3300005983 Bacteria 1100
169 Ga0070717_10123888 3300006028 Bacteria 2217
170 Ga0070717_10242931 3300006028 Bacteria 1588
171 Ga0070717_10549537 3300006028 Bacteria 1046
172 Ga0075365_10247886 3300006038 Bacteria 1251
173 Ga0075365_10344911 3300006038 Bacteria 1049
174 Ga0075365_10434159 3300006038 Bacteria 927
175 Ga0075365_10583859 3300006038 Bacteria 790
176 Ga0075368_10022422 3300006042 Bacteria 2404
177 Ga0075368_10071058 3300006042 Bacteria 1406
178 Ga0075363_100065058 3300006048 Bacteria 1971
179 Ga0075363_100247733 3300006048 Bacteria 1025
180 Ga0075363_100253033 3300006048 Bacteria 1015
181 Ga0075363_100285613 3300006048 Bacteria 955
182 Ga0075363_100768625 3300006048 Bacteria 584
183 Ga0075364_10102130 3300006051 Bacteria 1909
184 Ga0070715_10104876 3300006163 Bacteria 1324
185 Ga0070715_10194769 3300006163 Bacteria 1026
186 Ga0070715_10256318 3300006163 Bacteria 917
187 Ga0070716_100094913 3300006173 Bacteria 1814
188 Ga0070716_101320005 3300006173 Bacteria 584
189 Ga0070712_100038086 3300006175 Bacteria 3283
190 Ga0070712_100111114 3300006175 Bacteria 2045
191 Ga0070712_100314022 3300006175 Bacteria 1272
192 Ga0075367_10022547 3300006178 Bacteria 3533
193 Ga0075367_10112753 3300006178 Bacteria 1670
194 Ga0075367_10288413 3300006178 Bacteria 1032
195 Ga0075366_10278186 3300006195 Bacteria 1023
196 Ga0075366_10397943 3300006195 Bacteria 848
197 Ga0097621_100139391 3300006237 Bacteria 2071
198 Ga0097621_100212164 3300006237 Bacteria 1684
199 Ga0097621_100927645 3300006237 Bacteria 812
200 Ga0097621_101706938 3300006237 Bacteria 600
201 Ga0075370_10024394 3300006353 Bacteria 3340
202 Ga0075370_10093373 3300006353 Bacteria 1737
203 Ga0075370_10178205 3300006353 Bacteria 1250
204 Ga0068871_100126029 3300006358 Bacteria 2167
205 Ga0068871_100899132 3300006358 Bacteria 820
206 Ga0068871_101274140 3300006358 Bacteria 691
207 Ga0075428_100135007 3300006844 Bacteria 2683
208 Ga0075434_100287226 3300006871 Bacteria 1665
209 Ga0068865_100289192 3300006881 Bacteria 1308
210 Ga0068865_100708827 3300006881 Bacteria 861
211 Ga0097620_100748205 3300006931 Bacteria 1066
212 Ga0097620_101012391 3300006931 Bacteria 912
213 Ga0097620_101200522 3300006931 Bacteria 835
214 Ga0075435_100454561 3300007076 Bacteria 1105
215 Ga0099794_10174147 3300007265 Bacteria 1097
216 Ga0099794_10321430 3300007265 Bacteria 803
217 Ga0099795_10066779 3300007788 Bacteria 1348
218 Ga0105240_10551341 3300009093 Bacteria 1275
219 Ga0105240_10749887 3300009093 Bacteria 1061
220 Ga0105240_10822471 3300009093 Bacteria 1005
221 Ga0105240_11711774 3300009093 Bacteria 656
222 Ga0111539_10530373 3300009094 Bacteria 1372
223 Ga0111539_10932697 3300009094 Bacteria 1010
224 Ga0105245_10405664 3300009098 Bacteria 1363
225 Ga0105245_10645803 3300009098 Bacteria 1088
226 Ga0105247_10130453 3300009101 Bacteria 1638
227 Ga0105243_10393668 3300009148 Bacteria 1285
228 Ga0105243_10507900 3300009148 Bacteria 1144
229 Ga0105241_10153603 3300009174 Bacteria 1885
230 Ga0105241_10441133 3300009174 Bacteria 1150
231 Ga0105241_10503326 3300009174 Bacteria 1080
232 Ga0105241_10691131 3300009174 Bacteria 930
233 Ga0105242_10771784 3300009176 Bacteria 948
234 Ga0105242_10834310 3300009176 Bacteria 916
235 Ga0105248_10410419 3300009177 Bacteria 1525
236 Ga0105237_10186788 3300009545 Bacteria 2072
237 Ga0105237_10391897 3300009545 Bacteria 1394
238 Ga0105237_11256989 3300009545 Bacteria 747
239 Ga0105237_11267388 3300009545 Bacteria 744
240 Ga0105237_11307060 3300009545 Bacteria 732
241 Ga0105237_11310150 3300009545 Bacteria 731
242 Ga0105238_10122580 3300009551 Bacteria 2579
243 Ga0105238_10153518 3300009551 Bacteria 2277
244 Ga0105238_10589215 3300009551 Bacteria 1119
245 Ga0105238_10815971 3300009551 Bacteria 949
246 Ga0105238_10899903 3300009551 Bacteria 903
247 Ga0105238_10916090 3300009551 Bacteria 895
248 Ga0105238_11172820 3300009551 Bacteria 792
249 Ga0105238_11355898 3300009551 Bacteria 738
250 Ga0105238_11573732 3300009551 Bacteria 687
251 Ga0105249_11152751 3300009553 Bacteria 846
252 Ga0105249_11307958 3300009553 Bacteria 796
253 Ga0099796_10081558 3300010159 Bacteria 1187
254 Ga0099796_10235288 3300010159 Bacteria 755
255 Ga0105239_10325851 3300010375 Bacteria 1733
256 Ga0105239_10526109 3300010375 Bacteria 1346
257 Ga0105239_11237394 3300010375 Bacteria 861
258 Ga0105239_11992100 3300010375 Bacteria 674
259 Ga0105246_10019273 3300011119 Bacteria 4357
260 Ga0105246_10634819 3300011119 Bacteria 927
261 Ga0105246_11279383 3300011119 Bacteria 679
262 Ga0157373_10675974 3300013100 Bacteria 755
263 Ga0157370_10137726 3300013104 Bacteria 2274
264 Ga0157369_10021333 3300013105 Bacteria 7245
265 Ga0157369_10401604 3300013105 Bacteria 1422
266 Ga0157374_10054089 3300013296 Bacteria 3744
267 Ga0157374_10353683 3300013296 Bacteria 1460
268 Ga0157374_10498604 3300013296 Bacteria 1222
269 Ga0157374_11026557 3300013296 Bacteria 844
270 Ga0157378_11611005 3300013297 Bacteria 695
271 Ga0163162_10045228 3300013306 Bacteria 4411
272 Ga0163162_11000743 3300013306 Bacteria 945
273 Ga0163162_11590985 3300013306 Bacteria 745
274 Ga0163162_11937813 3300013306 Bacteria 675
275 Ga0163162_12349777 3300013306 Bacteria 613
276 Ga0163162_12826517 3300013306 Bacteria 559
277 Ga0157372_10201797 3300013307 Bacteria 2304
278 Ga0157372_10579615 3300013307 Bacteria 1308
279 Ga0157372_10940107 3300013307 Bacteria 1002
280 Ga0157375_10624930 3300013308 Bacteria 1235
281 Ga0157375_10691138 3300013308 Bacteria 1174
282 Ga0157375_10747294 3300013308 Bacteria 1130
283 Ga0163163_10127555 3300014325 Bacteria 2583
284 Ga0163163_10370574 3300014325 Bacteria 1489
285 Ga0163163_11096593 3300014325 Bacteria 859
286 Ga0163163_11391692 3300014325 Bacteria 763
287 Ga0163163_12210602 3300014325 Bacteria 609
288 Ga0157380_10341204 3300014326 Bacteria 1397
289 Ga0157380_10599164 3300014326 Bacteria 1090
290 Ga0157380_12204986 3300014326 Bacteria 615
291 Ga0157379_10209640 3300014968 Bacteria 1764
292 Ga0157379_10568872 3300014968 Bacteria 1056
293 Ga0157376_10620496 3300014969 Bacteria 1078
294 Ga0157376_10804516 3300014969 Bacteria 953
295 Ga0157376_10912082 3300014969 Bacteria 897
296 Ga0182007_10241593 3300015262 Bacteria 645
297 Ga0163161_10486050 3300017792 Bacteria 1003
298 Ga0163161_10584233 3300017792 Bacteria 919
299 Ga0163161_11136485 3300017792 Bacteria 673
300 Ga0206356_10348709 3300020070 Bacteria 608
301 Ga0206354_10763753 3300020081 Bacteria 726
302 Ga0213876_10169534 3300021384 Bacteria 1161
303 Ga0213876_10325057 3300021384 Bacteria 818
304 Ga0213876_10467307 3300021384 Bacteria 671
305 Ga0213875_10150372 3300021388 Bacteria 1091
306 Ga0224712_10096101 3300022467 Bacteria 1249
307 Ga0209563_101315 3300025230 Bacteria 6776
308 Ga0209677_100543 3300025253 Bacteria 21018
309 Ga0209677_100722 3300025253 Bacteria 16832
310 Ga0209148_1000295 3300025254 Bacteria 73660
311 Ga0209233_1002578 3300025261 Bacteria 6591
312 Ga0209233_1006623 3300025261 Bacteria 3719
313 Ga0209455_1003238 3300025272 Bacteria 5870
314 Ga0209455_1004716 3300025272 Bacteria 4383
315 Ga0209455_1021696 3300025272 Bacteria 1240
316 Ga0209758_1001900 3300025297 Bacteria 22801
317 Ga0209758_1013412 3300025297 Bacteria 4470
318 Ga0209256_1052131 3300025299 Bacteria 984
319 Ga0207697_10022598 3300025315 Bacteria 2576
320 Ga0207697_10044238 3300025315 Bacteria 1832
321 Ga0207697_10227280 3300025315 Bacteria 824
322 Ga0207697_10228741 3300025315 Bacteria 821
323 Ga0207653_10076948 3300025885 Bacteria 1149
324 Ga0207692_10042210 3300025898 Bacteria 2263
325 Ga0207692_10152647 3300025898 Bacteria 1324
326 Ga0207692_10250021 3300025898 Bacteria 1062
327 Ga0207692_10263072 3300025898 Bacteria 1038
328 Ga0207692_10340988 3300025898 Bacteria 922
329 Ga0207692_10616693 3300025898 Bacteria 699
330 Ga0207642_10097318 3300025899 Bacteria 1469
331 Ga0207642_10859819 3300025899 Bacteria 579
332 Ga0207710_10094956 3300025900 Bacteria 1400
333 Ga0207688_10151712 3300025901 Bacteria 1369
334 Ga0207680_10578662 3300025903 Bacteria 802
335 Ga0207647_10113451 3300025904 Bacteria 1602
336 Ga0207699_10011800 3300025906 Bacteria 4427
337 Ga0207699_10267408 3300025906 Bacteria 1184
338 Ga0207699_10504622 3300025906 Bacteria 873
339 Ga0207699_10586267 3300025906 Bacteria 811
340 Ga0207643_10135707 3300025908 Bacteria 1467
341 Ga0207643_10252516 3300025908 Bacteria 1087
342 Ga0207684_10366162 3300025910 Bacteria 1240
343 Ga0207654_10096920 3300025911 Bacteria 1810
344 Ga0207654_10160018 3300025911 Bacteria 1454
345 Ga0207654_10224647 3300025911 Bacteria 1247
346 Ga0207707_10008183 3300025912 Bacteria 9074
347 Ga0207707_10369948 3300025912 Bacteria 1233
348 Ga0207707_10477221 3300025912 Bacteria 1065
349 Ga0207707_10669777 3300025912 Bacteria 873
350 Ga0207695_10071334 3300025913 Bacteria 3548
351 Ga0207671_10508006 3300025914 Bacteria 961
352 Ga0207671_10595909 3300025914 Bacteria 881
353 Ga0207693_10045163 3300025915 Bacteria 3461
354 Ga0207693_10055491 3300025915 Bacteria 3108
355 Ga0207693_10263120 3300025915 Bacteria 1352
356 Ga0207663_10002736 3300025916 Bacteria 8503
357 Ga0207663_10409162 3300025916 Bacteria 1039
358 Ga0207662_10335633 3300025918 Bacteria 1012
359 Ga0207657_10173641 3300025919 Bacteria 1745
360 Ga0207657_10907579 3300025919 Bacteria 679
361 Ga0207649_10201576 3300025920 Bacteria 1406
362 Ga0207649_10355147 3300025920 Bacteria 1086
363 Ga0207649_10503760 3300025920 Bacteria 921
364 Ga0207652_10129770 3300025921 Bacteria 2247
365 Ga0207652_10164815 3300025921 Bacteria 1987
366 Ga0207652_10305259 3300025921 Bacteria 1436
367 Ga0207652_10351820 3300025921 Bacteria 1330
368 Ga0207652_10610512 3300025921 Bacteria 978
369 Ga0207652_11500576 3300025921 Bacteria 578
370 Ga0207646_10369425 3300025922 Bacteria 1296
371 Ga0207694_10206275 3300025924 Bacteria 1600
372 Ga0207694_10266828 3300025924 Bacteria 1403
373 Ga0207694_11040842 3300025924 Bacteria 693
374 Ga0207694_11235147 3300025924 Bacteria 632
375 Ga0207650_10625123 3300025925 Bacteria 907
376 Ga0207687_10305000 3300025927 Bacteria 1284
377 Ga0207687_10593584 3300025927 Bacteria 933
378 Ga0207700_10010462 3300025928 Bacteria 5857
379 Ga0207700_10012790 3300025928 Bacteria 5427
380 Ga0207700_10029757 3300025928 Bacteria 3858
381 Ga0207700_10378915 3300025928 Bacteria 1237
382 Ga0207700_10400753 3300025928 Bacteria 1202
383 Ga0207700_10684841 3300025928 Bacteria 915
384 Ga0207700_11148398 3300025928 Bacteria 694
385 Ga0207664_10254380 3300025929 Bacteria 1534
386 Ga0207664_10340402 3300025929 Bacteria 1326
387 Ga0207644_10179336 3300025931 Bacteria 1659
388 Ga0207644_10626714 3300025931 Bacteria 894
389 Ga0207706_10130949 3300025933 Bacteria 2206
390 Ga0207706_10326055 3300025933 Bacteria 1336
391 Ga0207709_10465780 3300025935 Bacteria 980
392 Ga0207709_11359072 3300025935 Bacteria 588
393 Ga0207670_10360927 3300025936 Bacteria 1153
394 Ga0207669_10207027 3300025937 Bacteria 1429
395 Ga0207669_11403328 3300025937 Bacteria 595
396 Ga0207704_10166691 3300025938 Bacteria 1574
397 Ga0207704_10708908 3300025938 Bacteria 834
398 Ga0207691_10508924 3300025940 Bacteria 1022
399 Ga0207691_10844799 3300025940 Bacteria 768
400 Ga0207711_10140227 3300025941 Bacteria 2174
401 Ga0207711_10300286 3300025941 Bacteria 1481
402 Ga0207689_10975978 3300025942 Bacteria 715
403 Ga0207661_10000878 3300025944 Bacteria 19794
404 Ga0207661_10062380 3300025944 Bacteria 3015
405 Ga0207661_10850753 3300025944 Bacteria 840
406 Ga0207661_11273548 3300025944 Bacteria 676
407 Ga0207679_10356886 3300025945 Bacteria 1276
408 Ga0207667_10105980 3300025949 Bacteria 2900
409 Ga0207667_10144958 3300025949 Bacteria 2445
410 Ga0207667_10148791 3300025949 Bacteria 2410
411 Ga0207667_11145110 3300025949 Bacteria 759
412 Ga0207712_10857651 3300025961 Bacteria 801
413 Ga0207712_11397532 3300025961 Bacteria 626
414 Ga0207668_11320483 3300025972 Bacteria 649
415 Ga0207640_10083438 3300025981 Bacteria 2191
416 Ga0207640_10229671 3300025981 Bacteria 1427
417 Ga0207640_10356669 3300025981 Bacteria 1177
418 Ga0207658_10602505 3300025986 Bacteria 987
419 Ga0207658_11332541 3300025986 Bacteria 656
420 Ga0207677_10091376 3300026023 Bacteria 2214
421 Ga0207677_10443850 3300026023 Bacteria 1110
422 Ga0207703_10065112 3300026035 Bacteria 2994
423 Ga0207703_11145258 3300026035 Bacteria 747
424 Ga0207703_11241870 3300026035 Bacteria 716
425 Ga0207639_10240699 3300026041 Bacteria 1573
426 Ga0207639_10268042 3300026041 Bacteria 1497
427 Ga0207639_10292211 3300026041 Bacteria 1437
428 Ga0207678_10246188 3300026067 Bacteria 1531
429 Ga0207678_10561648 3300026067 Bacteria 999
430 Ga0207678_10786279 3300026067 Bacteria 840
431 Ga0207678_11095558 3300026067 Bacteria 705
432 Ga0207702_10000318 3300026078 Bacteria 55209
433 Ga0207702_10312632 3300026078 Bacteria 1494
434 Ga0207702_10372300 3300026078 Bacteria 1372
435 Ga0207702_11139192 3300026078 Bacteria 774
436 Ga0207641_10357451 3300026088 Bacteria 1393
437 Ga0207641_10474896 3300026088 Bacteria 1211
438 Ga0207641_10517494 3300026088 Bacteria 1160
439 Ga0207641_12096007 3300026088 Bacteria 566
440 Ga0207648_10402717 3300026089 Bacteria 1240
441 Ga0207648_10499119 3300026089 Bacteria 1113
442 Ga0207648_10534857 3300026089 Bacteria 1075
443 Ga0207648_10706097 3300026089 Bacteria 935
444 Ga0207676_10199904 3300026095 Bacteria 1765
445 Ga0207674_10073988 3300026116 Bacteria 3420
446 Ga0207674_10666112 3300026116 Bacteria 1005
447 Ga0207674_10670582 3300026116 Bacteria 1001
448 Ga0207675_100609178 3300026118 Bacteria 1096
449 Ga0207675_101074709 3300026118 Bacteria 824
450 Ga0207683_10083899 3300026121 Bacteria 2832
451 Ga0207683_10153979 3300026121 Bacteria 2076
452 Ga0207683_10461287 3300026121 Bacteria 1172
453 Ga0207683_10478614 3300026121 Bacteria 1149
454 Ga0207683_10984709 3300026121 Bacteria 783
455 Ga0207683_11224932 3300026121 Bacteria 695
456 Ga0207683_11652559 3300026121 Bacteria 590
457 Ga0207683_11813868 3300026121 Bacteria 559
458 Ga0207698_10403643 3300026142 Bacteria 1307
459 Ga0207698_10715809 3300026142 Bacteria 997
460 Ga0209588_1060561 3300027671 Bacteria 1224
461 Ga0209813_10024630 3300027866 Bacteria 1723
462 Ga0268266_10066637 3300028379 Bacteria 3114
463 Ga0268266_10129302 3300028379 Bacteria 2257
464 Ga0268266_10341670 3300028379 Bacteria 1405
465 Ga0268266_10378883 3300028379 Bacteria 1334
466 Ga0268266_10757186 3300028379 Bacteria 937
467 Ga0268266_11222413 3300028379 Bacteria 726
468 Ga0268266_11364934 3300028379 Bacteria 684
469 Ga0268266_12068669 3300028379 Bacteria 542
470 Ga0268265_10289989 3300028380 Bacteria 1468
471 Ga0268265_10506484 3300028380 Bacteria 1138
472 Ga0268264_10297652 3300028381 Bacteria 1518
473 Ga0268264_11273547 3300028381 Bacteria 745
474 Ga0307517_10000232 3300028786 Bacteria 94332
475 Ga0307517_10469903 3300028786 Bacteria 647
476 Ga0307515_10087102 3300028794 Bacteria 3970
477 Ga0265332_10035231 3300031238 Bacteria 2174
478 Ga0265340_10091462 3300031247 Bacteria 1421
479 Ga0265340_10217072 3300031247 Bacteria 857
480 Ga0265339_10073499 3300031249 Bacteria 1818
481 Ga0265331_10089610 3300031250 Bacteria 1423
482 Ga0265316_10196584 3300031344 Bacteria 1496
483 Ga0265316_10588938 3300031344 Bacteria 789
484 Ga0307513_10191401 3300031456 Bacteria 1897
485 Ga0307513_10240504 3300031456 Bacteria 1615
486 Ga0307509_10331144 3300031507 Bacteria 1254
487 Ga0265313_10342930 3300031595 Bacteria 593
488 Ga0307508_10126440 3300031616 Bacteria 2159
489 Ga0307508_10328232 3300031616 Bacteria 1122
490 Ga0307508_10665446 3300031616 Bacteria 648
491 Ga0265314_10005054 3300031711 Bacteria 12021
492 Ga0265314_10220531 3300031711 Bacteria 1107
493 Ga0307516_10114956 3300031730 Bacteria 2488
494 Ga0307516_10178300 3300031730 Bacteria 1860
495 Ga0307516_10279702 3300031730 Bacteria 1351
496 Ga0307405_10263134 3300031731 Bacteria 1289
497 Ga0307413_10594532 3300031824 Bacteria 904
498 Ga0307406_10237733 3300031901 Bacteria 1364
499 Ga0307407_10538655 3300031903 Bacteria 861
500 Ga0307412_10530413 3300031911 Bacteria 985
501 Ga0307416_100460323 3300032002 Bacteria 1327
502 Ga0307416_101970837 3300032002 Bacteria 687
503 Ga0307416_101979258 3300032002 Bacteria 685
504 Ga0307414_10974180 3300032004 Bacteria 780
505 Ga0307415_100314346 3300032126 Bacteria 1303
506 Ga0307415_100662739 3300032126 Bacteria 937
507 Ga0307510_10072618 3300033180 Bacteria 3417
508 Ga0307510_10089264 3300033180 Bacteria 2936
509 Ga0307510_10121016 3300033180 Bacteria 2322
510 Ga0307510_10301776 3300033180 Bacteria 1063
511 Ga0315911_1000008 3300033442 Bacteria 381285
512 Ga0373958_0165769 3300034819 Bacteria 561
513 Ga0373958_0166297 3300034819 Bacteria 561
514 Ga0373926_0033050 3300035083 Bacteria 1827
515 Ga0373934_0023493 3300035086 Bacteria 2382
516 Ga0373934_0096153 3300035086 Bacteria 1196
517 Ga0373949_0072389 3300035090 Bacteria 905
518 Ga0373951_0095136 3300035091 Bacteria 786
519 Ga0373952_0253775 3300035092 Bacteria 533
520 Ga0373923_0004936 3300035111 Bacteria 4481
521 Ga0373923_0039874 3300035111 Bacteria 1930
522 Ga0373923_0042855 3300035111 Bacteria 1871
523 Ga0373936_0070753 3300035113 Bacteria 1437
524 Ga0373939_0109740 3300035114 Bacteria 959
525 Ga0373945_0015296 3300035116 Bacteria 2579
526 Ga0373945_0100694 3300035116 Bacteria 1130
527 Ga0373953_0078384 3300035117 Bacteria 1370
528 Ga0373953_0247502 3300035117 Bacteria 774
529 Ga0373954_0011463 3300035118 Bacteria 3929
530 Ga0373954_0174243 3300035118 Bacteria 1054
531 Ga0373956_0082067 3300035119 Bacteria 1480
532 Ga0373956_0155201 3300035119 Bacteria 1077
533 Ga0373956_0451395 3300035119 Bacteria 613
534 Ga0373957_0120048 3300035120 Bacteria 1063
535 Ga0373943_0141500 3300035170 Bacteria 1296
536 Ga0373943_0463427 3300035170 Bacteria 737
537 Ga0373946_0014322 3300035171 Bacteria 2989
538 Ga0373946_0214788 3300035171 Bacteria 927
539 Ga0373946_0482002 3300035171 Bacteria 634
540 Ga0373955_0004380 3300035172 Bacteria 6246
541 Ga0373955_0051079 3300035172 Bacteria 2251
542 Ga0373961_0031149 3300035241 Bacteria 1488
543 Ga0373961_0070941 3300035241 Bacteria 1077
544 Ga0373924_0033451 3300035410 Bacteria 2075
545 Ga0373924_0093920 3300035410 Bacteria 1285
546 Ga0373931_0015641 3300035691 Bacteria 3723
547 Ga0373935_0001267 3300035692 Bacteria 13929
548 Ga0373935_0039786 3300035692 Bacteria 2948
549 Ga0373927_0000766 3300035695 Bacteria 24573
550 Ga0373927_0006724 3300035695 Bacteria 7827
551 Ga0373927_0200773 3300035695 Bacteria 1309
552 Ga0373927_0288502 3300035695 Bacteria 1080
553 Ga0373927_0328502 3300035695 Bacteria 1007
554 Ga0373927_0349402 3300035695 Bacteria 974
555 Ga0373927_1123709 3300035695 Bacteria 518
556 Ga0373933_0000218 3300035724 Bacteria 37928
557 Ga0373933_0231444 3300035724 Bacteria 1187
558 Ga0373933_0356576 3300035724 Bacteria 950
559 Ga0373947_0000310 3300035725 Bacteria 27577
560 Ga0373947_0013664 3300035725 Bacteria 4651
561 Ga0373947_0374672 3300035725 Bacteria 957
562 Ga0373937_0014630 3300036401 Bacteria 6929
563 Ga0373925_0006419 3300037068 Bacteria 8654
564 Ga0373925_0021485 3300037068 Bacteria 4702
565 Ga0373925_0078313 3300037068 Bacteria 2510
566 Ga0373925_0589307 3300037068 Bacteria 915
567 Ga0373925_0654343 3300037068 Bacteria 866
568 Ga0395900_0032832 3300037418 Bacteria 5339
569 Ga0395900_0108628 3300037418 Bacteria 2850
570 Ga0395900_0199177 3300037418 Bacteria 2027
571 Ga0395900_1525769 3300037418 Bacteria 580
572 Ga0395898_0089031 3300037466 Bacteria 2971
573 Ga0395898_0631023 3300037466 Bacteria 1014
574 Ga0395905_0048135 3300037471 Bacteria 3996
575 Ga0436364_0331795 3300037853 Bacteria 1630
576 Ga0436364_0603569 3300037853 Bacteria 1111
577 Ga0395901_0113781 3300038443 Bacteria 2842
578 Ga0395901_0297332 3300038443 Bacteria 1674
579 Ga0436365_0118730 3300039437 Bacteria 842
580 Ga0436365_0135384 3300039437 Bacteria 2104
581 Ga0436365_0209743 3300039437 Bacteria 2892
582 Ga0436365_0279102 3300039437 Bacteria 2928
583 Ga0436365_0346369 3300039437 Bacteria 1174
584 Ga0436365_1026627 3300039437 Bacteria 1239
585 Ga0436362_0249161 3300039453 Bacteria 713
586 Ga0436362_1201460 3300039453 Bacteria 556
587 Ga0451789_1333214 3300041443 Bacteria 540
588 Ga0451793_1038465 3300041452 Bacteria 1074
589 Ga0451802_1431654 3300041460 Bacteria 677
590 Ga0451807_0826454 3300041486 Bacteria 519
591 Ga0451855_0143711 3300041511 Bacteria 572
592 Ga0466969_0093259 3300044656 Bacteria 1425
593 Ga0466972_0029548 3300044658 Bacteria 2698
594 Ga0466966_0343263 3300044684 Bacteria 897
595 Ga0466961_0156035 3300044693 Bacteria 1424
596 Ga0466963_0258548 3300044694 Bacteria 1222
597 Ga0466963_0996490 3300044694 Bacteria 590
598 Ga0466971_0156462 3300044719 Bacteria 1065
599 Ga0466968_0379186 3300044735 Bacteria 690
600 Ga0466970_0260390 3300044765 Bacteria 973
601 Ga0466957_0080078 3300044842 Bacteria 2033
602 Ga0466957_0237937 3300044842 Bacteria 1207
603 Ga0466957_0297429 3300044842 Bacteria 1084
604 Ga0466957_0427749 3300044842 Bacteria 909
605 Ga0466960_0181359 3300044901 Bacteria 1141
606 Ga0466959_0048894 3300045049 Bacteria 3107
607 Ga0466967_0028253 3300045976 Bacteria 4680
608 Ga0466967_0062009 3300045976 Bacteria 3318
609 Ga0466967_0204967 3300045976 Bacteria 1869
610 Ga0466967_1213654 3300045976 Bacteria 751
611 Ga0495617_107272 3300046452 Bacteria 905
612 Ga0495592_0102991 3300046454 Bacteria 2032
613 Ga0495592_0142617 3300046454 Bacteria 1664
614 Ga0495603_0000936 3300046455 Bacteria 16788
615 Ga0495603_0021318 3300046455 Bacteria 3924
616 Ga0495603_0105542 3300046455 Bacteria 1644
617 Ga0495603_0237833 3300046455 Bacteria 1049
618 Ga0495603_0392356 3300046455 Bacteria 796
619 Ga0495629_0001416 3300046459 Bacteria 18913
620 Ga0495629_0123416 3300046459 Bacteria 1804
621 Ga0495629_0484623 3300046459 Bacteria 835
622 Ga0495629_0633985 3300046459 Bacteria 713
623 Ga0495638_0139687 3300046460 Bacteria 1415
624 Ga0495638_0317616 3300046460 Bacteria 833
625 Ga0495641_0016464 3300046461 Bacteria 3896
626 Ga0495641_0138934 3300046461 Bacteria 1085
627 Ga0495651_0019880 3300046462 Bacteria 5207
628 Ga0495651_0178579 3300046462 Bacteria 1505
629 Ga0495653_0049261 3300046463 Bacteria 3246
630 Ga0495653_0117625 3300046463 Bacteria 1899
631 Ga0495650_0125333 3300046471 Bacteria 942
632 Ga0495580_0005025 3300046472 Bacteria 11027
633 Ga0495580_0006058 3300046472 Bacteria 9898
634 Ga0495580_0514895 3300046472 Bacteria 798
635 Ga0495582_0018773 3300046473 Bacteria 3780
636 Ga0495582_0038113 3300046473 Bacteria 2644
637 Ga0495582_0082250 3300046473 Bacteria 1789
638 Ga0495582_0124167 3300046473 Bacteria 1456
639 Ga0495639_0000072 3300046475 Bacteria 46904
640 Ga0495662_0000572 3300046476 Bacteria 16948
641 Ga0495662_0185583 3300046476 Bacteria 1025
642 Ga0495662_0217863 3300046476 Bacteria 941
643 Ga0495664_0014835 3300046477 Bacteria 4423
644 Ga0495664_0045196 3300046477 Bacteria 2611
645 Ga0495585_0586092 3300046492 Bacteria 525
646 Ga0495594_0000046 3300046499 Bacteria 53822
647 Ga0495594_0297721 3300046499 Bacteria 919
648 Ga0495596_0130534 3300046500 Bacteria 975
649 Ga0495596_0177088 3300046500 Bacteria 829
650 Ga0495596_0195003 3300046500 Bacteria 787
651 Ga0495606_0168025 3300046507 Bacteria 1275
652 Ga0495608_0323669 3300046511 Bacteria 952
653 Ga0495608_0637386 3300046511 Bacteria 638
654 Ga0495610_0029757 3300046512 Bacteria 2871
655 Ga0495618_0100704 3300046514 Bacteria 1849
656 Ga0495618_0186351 3300046514 Bacteria 1317
657 Ga0495620_0229342 3300046515 Bacteria 710
658 Ga0495628_0018626 3300046516 Bacteria 5747
659 Ga0495628_0033483 3300046516 Bacteria 4141
660 Ga0495628_0327775 3300046516 Bacteria 1129
661 Ga0495628_0517885 3300046516 Bacteria 859
662 Ga0495630_0024634 3300046517 Bacteria 4447
663 Ga0495630_0093534 3300046517 Bacteria 2272
664 Ga0495630_0154765 3300046517 Bacteria 1745
665 Ga0495630_0513814 3300046517 Bacteria 918
666 Ga0495631_0217855 3300046518 Bacteria 815
667 Ga0495631_0334536 3300046518 Bacteria 644
668 Ga0495632_0063839 3300046519 Bacteria 1782
669 Ga0495637_0100090 3300046520 Bacteria 1134
670 Ga0495644_0153157 3300046523 Bacteria 883
671 Ga0495644_0243040 3300046523 Bacteria 698
672 Ga0495644_0281117 3300046523 Bacteria 649
673 Ga0495644_0359059 3300046523 Bacteria 574
674 Ga0495648_0249358 3300046524 Bacteria 858
675 Ga0495648_0373903 3300046524 Bacteria 644
676 Ga0495663_0177723 3300046525 Bacteria 736
677 Ga0495666_0041837 3300046526 Bacteria 2217
678 Ga0495666_0167306 3300046526 Bacteria 1018
679 Ga0495642_0191454 3300046528 Bacteria 891
680 Ga0495642_0198449 3300046528 Bacteria 875
681 Ga0495665_0000335 3300046531 Bacteria 23811
682 Ga0495640_0002138 3300046533 Bacteria 15789
683 Ga0495640_0051516 3300046533 Bacteria 2830
684 Ga0495640_0361314 3300046533 Bacteria 895
685 Ga0495586_0059346 3300046535 Bacteria 2079
686 Ga0495587_0345412 3300046536 Bacteria 830
687 Ga0495609_0119716 3300046538 Bacteria 1133
688 Ga0495609_0131591 3300046538 Bacteria 1071
689 Ga0495645_0013978 3300046543 Bacteria 5689
690 Ga0495645_0036237 3300046543 Bacteria 3596
691 Ga0495622_0084671 3300046557 Bacteria 1458
692 Ga0495622_0249119 3300046557 Bacteria 782
693 Ga0495633_0312506 3300046558 Bacteria 713
694 Ga0495667_0032717 3300046559 Bacteria 3482
695 Ga0495667_0803522 3300046559 Bacteria 580
696 Ga0495668_0168169 3300046616 Bacteria 1201
697 Ga0495668_0481719 3300046616 Bacteria 683
698 Ga0495668_0732608 3300046616 Bacteria 547
699 Ga0495634_0003037 3300046642 Bacteria 13668
700 Ga0495634_0044482 3300046642 Bacteria 3005
701 Ga0495611_0066313 3300046648 Bacteria 1646
702 Ga0495611_0300332 3300046648 Bacteria 740
703 Ga0495625_0251011 3300046660 Bacteria 1148
704 Ga0495635_0002038 3300046663 Bacteria 13679
705 Ga0495635_0016231 3300046663 Bacteria 5198
706 Ga0495635_0089467 3300046663 Bacteria 2106
707 Ga0495635_0255921 3300046663 Bacteria 1180
708 Ga0495588_0416881 3300046674 Bacteria 705
709 Ga0495657_0121602 3300046675 Bacteria 1644
710 Ga0495599_0128792 3300046678 Bacteria 1572
711 Ga0495599_0191494 3300046678 Bacteria 1258
712 Ga0495599_0306147 3300046678 Bacteria 958
713 Ga0495599_0644747 3300046678 Bacteria 614
714 Ga0495623_0075175 3300046679 Bacteria 2098
715 Ga0495646_0066903 3300046680 Bacteria 2125
716 Ga0495646_0081016 3300046680 Bacteria 1892
717 Ga0495646_0119658 3300046680 Bacteria 1491
718 Ga0495646_0481522 3300046680 Bacteria 638
719 Ga0495647_0008783 3300046681 Bacteria 3403
720 Ga0495647_0016367 3300046681 Bacteria 2610
721 Ga0495658_0002742 3300046683 Bacteria 8859
722 Ga0495658_0009522 3300046683 Bacteria 4844
723 Ga0495658_0247379 3300046683 Bacteria 1121
724 Ga0495669_0124118 3300046684 Bacteria 1212
725 Ga0495669_0198256 3300046684 Bacteria 959
726 Ga0495669_0310627 3300046684 Bacteria 760
727 Ga0495613_0081505 3300046689 Bacteria 2351
728 Ga0495613_0148666 3300046689 Bacteria 1672
729 Ga0495624_0000795 3300046690 Bacteria 24919
730 Ga0495624_0056079 3300046690 Bacteria 2480
731 Ga0495670_0469767 3300046691 Bacteria 682
732 Ga0495671_0091675 3300046692 Bacteria 1487
733 Ga0495671_0437409 3300046692 Bacteria 625
734 Ga0495649_0299125 3300046694 Bacteria 819
735 Ga0495649_0408599 3300046694 Bacteria 681
736 Ga0495589_0135740 3300046794 Bacteria 1180
737 Ga0495600_0093192 3300046809 Bacteria 1964
738 Ga0495600_0115281 3300046809 Bacteria 1749
739 Ga0495581_0000030 3300047315 Bacteria 53487
740 Ga0495581_0126320 3300047315 Bacteria 1489
741 Ga0495581_0144120 3300047315 Bacteria 1390
742 Ga0495581_0352195 3300047315 Bacteria 859
743 Ga0495604_0105989 3300047317 Bacteria 2057
744 Ga0495604_0730681 3300047317 Bacteria 627
745 Ga0495674_0012381 3300047319 Bacteria 8036
746 Ga0495674_0026440 3300047319 Bacteria 5309
747 Ga0495674_0170500 3300047319 Bacteria 1816
748 Ga0495674_0433544 3300047319 Bacteria 1058
749 Ga0495674_1157765 3300047319 Bacteria 586
750 Ga0495672_0019292 3300047320 Bacteria 4502
751 Ga0495676_0028804 3300047321 Bacteria 4738
752 Ga0495676_0426845 3300047321 Bacteria 877
753 Ga0495680_0139443 3300047322 Bacteria 1775
754 Ga0495680_0289892 3300047322 Bacteria 1151
755 Ga0495683_0383974 3300047323 Bacteria 587
756 Ga0495675_0384899 3300047444 Bacteria 820
757 Ga0495684_0021000 3300047471 Bacteria 5029
758 Ga0495684_0053297 3300047471 Bacteria 3086
759 Ga0495686_0085355 3300047472 Bacteria 1923
760 Ga0495686_0171913 3300047472 Bacteria 1260
761 Ga0495593_0000398 3300047673 Bacteria 24218
762 Ga0495593_0181923 3300047673 Bacteria 1058
763 Ga0495614_0046075 3300048089 Bacteria 1870
764 Ga0496100_0073875 3300048903 Bacteria 2283
765 Ga0496100_0369385 3300048903 Bacteria 1087
766 Ga0496100_0926204 3300048903 Bacteria 685
767 Ga0496101_0859744 3300048904 Bacteria 715
768 Ga0496101_1368899 3300048904 Bacteria 552
769 Ga0496102_0082256 3300048905 Bacteria 2969
770 Ga0496102_0152685 3300048905 Bacteria 2170
771 Ga0496102_0260356 3300048905 Bacteria 1635
772 Ga0496102_0347549 3300048905 Bacteria 1396
773 Ga0496102_0401306 3300048905 Bacteria 1289
774 Ga0496103_0091837 3300048906 Bacteria 1916
775 Ga0496103_0135099 3300048906 Bacteria 1576
776 Ga0496103_0527388 3300048906 Bacteria 755
777 Ga0496103_0636678 3300048906 Bacteria 678
778 Ga0496104_0044883 3300048907 Bacteria 4154
779 Ga0496104_0463833 3300048907 Bacteria 1178
780 Ga0496104_0526120 3300048907 Bacteria 1093
781 Ga0496104_0548848 3300048907 Bacteria 1066
782 Ga0496104_0777062 3300048907 Bacteria 864
783 Ga0496105_0051519 3300048908 Bacteria 3400
784 Ga0496105_0094396 3300048908 Bacteria 2470
785 Ga0496105_0737928 3300048908 Bacteria 753
786 Ga0496105_0852426 3300048908 Bacteria 689
787 Ga0496106_0411555 3300048909 Bacteria 1087
788 Ga0496106_0607760 3300048909 Bacteria 875
789 Ga0496106_0628249 3300048909 Bacteria 859
790 Ga0496106_0766736 3300048909 Bacteria 766
791 Ga0496107_0037476 3300048910 Bacteria 3479
792 Ga0496107_0114537 3300048910 Bacteria 1984
793 Ga0496107_0316488 3300048910 Bacteria 1161
794 Ga0496107_1098843 3300048910 Bacteria 574
795 Ga0496108_0036615 3300048911 Bacteria 4083
796 Ga0496108_0060709 3300048911 Bacteria 3181
797 Ga0496108_0443405 3300048911 Bacteria 1134
798 Ga0496108_0571795 3300048911 Bacteria 985
799 Ga0496108_1132709 3300048911 Bacteria 664
800 Ga0496109_0057722 3300048912 Bacteria 3544
801 Ga0496109_0353316 3300048912 Bacteria 1388
802 Ga0496109_1851968 3300048912 Bacteria 536
803 Ga0496110_1252080 3300048913 Bacteria 651
804 Ga0496111_0034277 3300048914 Bacteria 3624
805 Ga0496111_0680391 3300048914 Bacteria 749
806 Ga0496112_0033543 3300048915 Bacteria 4991
807 Ga0496112_0049766 3300048915 Bacteria 4107
808 Ga0496112_0631524 3300048915 Bacteria 1001
809 Ga0496112_1010109 3300048915 Bacteria 751
810 Ga0496113_0017212 3300048916 Bacteria 5013
811 Ga0496113_0032120 3300048916 Bacteria 3813
812 Ga0496114_0078476 3300048917 Bacteria 2785
813 Ga0496114_0420047 3300048917 Bacteria 1184
814 Ga0496115_0150310 3300048918 Bacteria 1923
815 Ga0496115_0281240 3300048918 Bacteria 1366
816 Ga0496115_0335240 3300048918 Bacteria 1235
817 Ga0496115_0439175 3300048918 Bacteria 1055
818 Ga0496116_0159299 3300048919 Bacteria 1241
819 Ga0496116_0235381 3300048919 Bacteria 925
820 Ga0496117_0060867 3300048920 Bacteria 2599
821 Ga0496117_0277004 3300048920 Bacteria 900
822 Ga0496118_0134441 3300048921 Bacteria 1581
823 Ga0496118_0283652 3300048921 Bacteria 920
824 Ga0496118_0316502 3300048921 Bacteria 849
825 Ga0496118_0410405 3300048921 Bacteria 700
826 Ga0496119_0147277 3300048922 Bacteria 1265
827 Ga0496121_0000278 3300048924 Bacteria 106838
828 Ga0496121_0035287 3300048924 Bacteria 4485
829 Ga0496121_0071562 3300048924 Bacteria 2788
830 Ga0496121_0113457 3300048924 Bacteria 2062
831 Ga0496121_0125511 3300048924 Bacteria 1930
832 Ga0496121_0166716 3300048924 Bacteria 1604
833 Ga0496121_0200405 3300048924 Bacteria 1423
834 Ga0496121_0322537 3300048924 Bacteria 1039
835 Ga0496121_0518333 3300048924 Bacteria 753
836 Ga0496124_0236071 3300048927 Bacteria 1363
837 Ga0496124_0248160 3300048927 Bacteria 1319
838 Ga0496125_0576892 3300048928 Bacteria 618
839 Ga0496126_0034975 3300048929 Bacteria 4711
840 Ga0496126_0060610 3300048929 Bacteria 3402
841 Ga0496126_0162691 3300048929 Bacteria 1906
842 Ga0496126_0397020 3300048929 Bacteria 1119
843 Ga0496126_0889485 3300048929 Bacteria 676
844 Ga0501033_0597713 3300049570 Bacteria 757
845 Ga0501047_0041970 3300049581 Bacteria 4421
846 Ga0501048_0522722 3300049582 Bacteria 851
847 Ga0501067_0050483 3300049583 Bacteria 2305
848 Ga0501070_0248474 3300049586 Bacteria 1455
849 Ga0501080_0128602 3300049742 Bacteria 2345
850 Ga0501044_0083186 3300049823 Bacteria 3237
851 nmdc:mga03683_210539_c1 3300050489 Bacteria 894
852 nmdc:mga03683_265128_c1 3300050489 Bacteria 800
853 nmdc:mga03n38_14558_c1 3300050490 Bacteria 3017
854 nmdc:mga00v17_539811_c1 3300050491 Bacteria 754
855 nmdc:mga0yw44_117836_c1 3300050492 Bacteria 1708
856 nmdc:mga0yw44_464373_c1 3300050492 Bacteria 858
857 nmdc:mga0yw44_644431_c1 3300050492 Bacteria 720
858 nmdc:mga0yw44_804435_c1 3300050492 Bacteria 638
859 nmdc:mga06z11_110457_c1 3300050494 Bacteria 1522
860 nmdc:mga06z11_11045_c1 3300050494 Bacteria 3876
861 nmdc:mga06z11_460298_c1 3300050494 Bacteria 769
862 nmdc:mga06z11_583410_c1 3300050494 Bacteria 680
863 nmdc:mga04h51_29235_c1 3300050495 Bacteria 1725
864 nmdc:mga07m45_13114_c1 3300050496 Bacteria 4388
865 nmdc:mga07m45_385630_c1 3300050496 Bacteria 814
866 nmdc:mga07m45_64024_c1 3300050496 Bacteria 2086
867 nmdc:mga08y16_619065_c1 3300050511 Bacteria 1090
868 nmdc:mga0n895_378198_c1 3300050512 Bacteria 1433
869 nmdc:mga0rr50_393867_c1 3300050513 Bacteria 1169
870 nmdc:mga0a205_151249_c1 3300050515 Bacteria 2220
871 Ga0495601_0017256 3300053077 Bacteria 4380
872 Ga0495601_0136693 3300053077 Bacteria 1598
873 Ga0495601_0343333 3300053077 Bacteria 971
874 Ga0500610_0041583 3300053079 Bacteria 2377
875 Ga0495655_0112132 3300053083 Bacteria 821
876 Ga0495595_0219991 3300053084 Bacteria 947
877 Ga0495619_0236354 3300053085 Bacteria 1266
878 Ga0495619_0241630 3300053085 Bacteria 1251
879 Ga0500643_000112 3300053087 Bacteria 84793
880 Ga0500644_0362520 3300053088 Bacteria 628
881 Ga0500646_0155861 3300053090 Bacteria 759
882 Ga0500583_0085964 3300053092 Bacteria 1525
883 Ga0500583_0166310 3300053092 Bacteria 1098
884 Ga0500651_0033603 3300053093 Bacteria 3233
885 Ga0500651_0258387 3300053093 Bacteria 1010
886 Ga0500566_0011791 3300053094 Bacteria 5150
887 Ga0500566_0043525 3300053094 Bacteria 2587
888 Ga0500640_009445 3300053095 Bacteria 3899
889 Ga0500641_0060146 3300053096 Bacteria 1580
890 Ga0500641_0147163 3300053096 Bacteria 1017
891 Ga0500650_0192335 3300053098 Bacteria 932
892 Ga0500553_133854 3300053101 Bacteria 993
893 Ga0500554_067639 3300053102 Bacteria 1157
894 Ga0500555_004419 3300053103 Bacteria 3997
895 Ga0500555_083377 3300053103 Bacteria 829
896 Ga0500569_051549 3300053109 Bacteria 1243
897 Ga0500569_085728 3300053109 Bacteria 1013
898 Ga0500572_072413 3300053111 Bacteria 1067
899 Ga0500582_116210 3300053114 Bacteria 932
900 Ga0500592_014816 3300053116 Bacteria 1250
901 Ga0500592_033615 3300053116 Bacteria 827
902 Ga0500594_0011291 3300053118 Bacteria 2084
903 Ga0500594_0253250 3300053118 Bacteria 586
904 Ga0500595_001016 3300053119 Bacteria 15748
905 Ga0500595_006803 3300053119 Bacteria 4813
906 Ga0500595_014698 3300053119 Bacteria 2962
907 Ga0500595_027760 3300053119 Bacteria 1935
908 Ga0500595_043871 3300053119 Bacteria 1421
909 Ga0500607_085637 3300053121 Bacteria 1597
910 Ga0500608_234605 3300053122 Bacteria 729
911 Ga0500614_108692 3300053123 Bacteria 806
912 Ga0500614_193217 3300053123 Bacteria 625
913 Ga0500628_143339 3300053129 Bacteria 664
914 Ga0500642_0000362 3300053130 Bacteria 15284
915 Ga0500642_0000641 3300053130 Bacteria 10431
916 Ga0500642_0066658 3300053130 Bacteria 1629
917 Ga0500655_040208 3300053133 Bacteria 916
918 Ga0500658_0381921 3300053134 Bacteria 645
919 Ga0500568_0067550 3300053139 Bacteria 1373
920 Ga0500568_0129529 3300053139 Bacteria 938
921 Ga0500577_0098647 3300053142 Bacteria 1191
922 Ga0500577_0198761 3300053142 Bacteria 864
923 Ga0500588_0101524 3300053146 Bacteria 992
924 Ga0500589_226276 3300053147 Bacteria 701
925 Ga0500589_262379 3300053147 Bacteria 628
926 Ga0500590_147270 3300053148 Bacteria 1067
927 Ga0500590_223751 3300053148 Bacteria 773
928 Ga0500603_121939 3300053150 Bacteria 791
929 Ga0500604_0049059 3300053151 Bacteria 1297
930 Ga0500604_0089581 3300053151 Bacteria 1003
931 Ga0500604_0178318 3300053151 Bacteria 728
932 Ga0500616_0139503 3300053153 Bacteria 1135
933 Ga0500620_238445 3300053155 Bacteria 609
934 Ga0500622_0229091 3300053156 Bacteria 828
935 Ga0500627_0125991 3300053158 Bacteria 1156
936 Ga0500627_0203270 3300053158 Bacteria 887
937 Ga0500627_0348998 3300053158 Bacteria 639
938 Ga0500634_0212441 3300053161 Bacteria 838
939 Ga0500638_005456 3300053162 Bacteria 5068
940 Ga0500638_222988 3300053162 Bacteria 780
941 Ga0500636_0276248 3300053177 Bacteria 841
942 Ga0500636_0333676 3300053177 Bacteria 731
943 Ga0500637_0000585 3300053178 Bacteria 14328
944 Ga0500637_0186572 3300053178 Bacteria 1186
945 Ga0500570_106621 3300053724 Bacteria 1155
946 Ga0500611_158246 3300053727 Bacteria 625
947 Ga0500609_006652 3300053731 Bacteria 1572
948 Ga0500661_005871 3300055283 Bacteria 2287
949 Ga0587080_148527 3300059503 Bacteria 541
950 Ga0587083_0147968 3300059505 Bacteria 632
951 Ga0587068_101443 3300059641 Bacteria 605
952 Ga0587072_123946 3300059643 Bacteria 602
953 Ga0587075_040357 3300059644 Bacteria 780
954 Ga0587076_075966 3300059645 Bacteria 707
955 Ga0587071_046432 3300060344 Bacteria 886
956 Ga0466962_0031673 3300061719 Bacteria 2532
957 Ga0466962_0128009 3300061719 Bacteria 1227
958 8016565829 8016557553 Bacteria 8154380
959 2513659509 2513237096 Bacteria 8722461
960 2513718240 2513237104 Bacteria 10034502
961 2513859384 2513237137 Bacteria 9558895
962 2513921558 2513237145 Bacteria 8979722
963 2517889050 2517572143 Bacteria 9484767
964 2524537485 2524023228 Bacteria 10118060
965 2671124039 2667528175 Bacteria 7532676
966 2793072711 2791355197 Bacteria 8420563
967 2881368926 2881364244 Bacteria 7710352
968 2885377554 2885374607 Bacteria 8927485
969 2885415852 2885409591 Bacteria 9235467
970 2903758797 2903748898 Bacteria 9972761
971 2904691005 2904690495 Bacteria 9412302
972 2904708402
973 2906613574
974 2906635831 2906635258 Bacteria 8601019
975 2906668108 2906660503 Bacteria 8595048
976 2908747652 2908739725 Bacteria 8628932
977 2908757063 2908756301 Bacteria 8864324
978 2922363207 2922361189 Bacteria 7436256
979 2922434011
980 2935636038 2935630451 Bacteria 8169952
981 2941512658 2941507105 Bacteria 8166816
982 2941520504 2941515067 Bacteria 8166720
983 2941528518 2941523033 Bacteria 8169134
984 3005475274 3005474847 Bacteria 9259049
985 8006936003 8006933436 Bacteria 10410654
986 8006975873 8006973647 Bacteria 10679141
987 8019562653 8019555841 Bacteria 9642137
988 8019572730 8019565922 Bacteria 9639779
989 8056691144 8056689827 Bacteria 6712655
990 8056971493 8056967851 Bacteria 9038162
991 JGI25165J46597_1004955
992 JGI25153J46596_10030586
993 JGI25404J52841_10019296
994 JGI25404J52841_10035351
995 Ga0055539_1020748
996 Ga0055542_1014646
997 Ga0055543_1011352
998 Ga0065704_10142844
999 Ga0065712_10228589
1000 Ga0065707_10024212
1001 Ga0070676_10229590
1002 Ga0070676_10660950
1003 Ga0070683_100109161
1004 Ga0070683_100167461
1005 Ga0070683_100270090
1006 Ga0070683_100277403
1007 Ga0070670_100746824
1008 Ga0068869_100451568
1009 Ga0068869_101189775
1010 Ga0070666_10947092
1011 Ga0070680_100463354
1012 Ga0070680_100852515
1013 Ga0070682_100140690
1014 Ga0070682_100954204
1015 Ga0068868_100059956
1016 Ga0068868_101012133
1017 Ga0068868_101458966
1018 Ga0070660_100501648
1019 Ga0070691_10205067
1020 Ga0070661_100466437
1021 Ga0070661_100739494
1022 Ga0070661_101243556
1023 Ga0070668_100216872
1024 Ga0070668_100424000
1025 Ga0070668_100776729
1026 Ga0070668_102037548
1027 Ga0070668_102037549
1028 Ga0070669_100609029
1029 Ga0070671_101076359
1030 Ga0070674_101290983
1031 Ga0070673_100230498
1032 Ga0070673_100760705
1033 Ga0070688_100208310
1034 Ga0070688_100588175
1035 Ga0070659_101317869
1036 Ga0070667_100271251
1037 Ga0070667_101493029
1038 Ga0070667_101683202
1039 Ga0070703_10299640
1040 Ga0070709_10194830
1041 Ga0070709_10357658
1042 Ga0070709_10420172
1043 Ga0070709_10833475
1044 Ga0070709_10905858
1045 Ga0070714_100021967
1046 Ga0070714_100431950
1047 Ga0070714_100930256
1048 Ga0070713_100029455
1049 Ga0070713_100080502
1050 Ga0070713_100156027
1051 Ga0070713_100330033
1052 Ga0070713_100737828
1053 Ga0070713_101283380
1054 Ga0070710_10041326
1055 Ga0070710_10055278
1056 Ga0070710_10297910
1057 Ga0070710_10336269
1058 Ga0070710_10577282
1059 Ga0070710_10611687
1060 Ga0070710_10754729
1061 Ga0070701_10194738
1062 Ga0070711_100005553
1063 Ga0070711_100194344
1064 Ga0070711_100268474
1065 Ga0070711_100315259
1066 Ga0070700_101071426
1067 Ga0070700_101158779
1068 Ga0070700_101302622
1069 Ga0070694_100479641
1070 Ga0070663_100718471
1071 Ga0070663_100861160
1072 Ga0070663_101271406
1073 Ga0070678_100096322
1074 Ga0070678_100363674
1075 Ga0070678_100584240
1076 Ga0070662_100289078
1077 Ga0070681_10017254
1078 Ga0070681_10037401
1079 Ga0070681_10075073
1080 Ga0070681_10436888
1081 Ga0068867_100630108
1082 Ga0068867_100633022
1083 Ga0070685_10466238
1084 Ga0070706_100234156
1085 Ga0070706_100317287
1086 Ga0070706_100574081
1087 Ga0070706_100600472
1088 Ga0070698_100059290
1089 Ga0070698_100981492
1090 Ga0070699_100681478
1091 Ga0070699_100742484
1092 Ga0070679_100015647
1093 Ga0070679_100163330
1094 Ga0070684_100355097
1095 Ga0070684_100395167
1096 Ga0070684_100692908
1097 Ga0070684_100884156
1098 Ga0070697_100201326
1099 Ga0068853_100390609
1100 Ga0068853_100442522
1101 Ga0068853_100484951
1102 Ga0068853_100695337
1103 Ga0070672_100348785
1104 Ga0070693_100040796
1105 Ga0070693_100075050
1106 Ga0070693_100395572
1107 Ga0070665_100206184
1108 Ga0070665_100377590
1109 Ga0070665_100519344
1110 Ga0070665_101138158
1111 Ga0068855_100444992
1112 Ga0068855_100686734
1113 Ga0068855_101263499
1114 Ga0070664_101140914
1115 Ga0070664_101838180
1116 Ga0068857_100183974
1117 Ga0068857_100311302
1118 Ga0068857_100397294
1119 Ga0068854_100272559
1120 Ga0068854_100442540
1121 Ga0068854_100501576
1122 Ga0068856_100000883
1123 Ga0068856_100107320
1124 Ga0068856_100491914
1125 Ga0068856_101140658
1126 Ga0068856_101473787
1127 Ga0068856_101840282
1128 Ga0068852_100067130
1129 Ga0068852_100775901
1130 Ga0068852_100780793
1131 Ga0068852_101142168
1132 Ga0068852_101700076
1133 Ga0068859_100748173
1134 Ga0068859_101012421
1135 Ga0068859_101200521
1136 Ga0068864_100123810
1137 Ga0068864_100314239
1138 Ga0068864_100339767
1139 Ga0068866_10472137
1140 Ga0068861_100413798
1141 Ga0068861_100541193
1142 Ga0068870_10062707
1143 Ga0068870_10415719
1144 Ga0068870_10419108
1145 Ga0068863_100488620
1146 Ga0068863_100531991
1147 Ga0068863_100554843
1148 Ga0068860_100247682
1149 Ga0068860_100952627
1150 Ga0068860_100960866
1151 Ga0068862_100148304
1152 Ga0068862_100358612
1153 Ga0068862_100632552
1154 Ga0081540_1020688
1155 Ga0081540_1020881
1156 Ga0081540_1035114
1157 Ga0081540_1055889
1158 Ga0081540_1118995
1159 Ga0070717_10123888
1160 Ga0070717_10242931
1161 Ga0070717_10549537
1162 Ga0075365_10247886
1163 Ga0075365_10344911
1164 Ga0075365_10434159
1165 Ga0075365_10583859
1166 Ga0075368_10022422
1167 Ga0075368_10071058
1168 Ga0075363_100065058
1169 Ga0075363_100247733
1170 Ga0075363_100253033
1171 Ga0075363_100285613
1172 Ga0075363_100768625
1173 Ga0075364_10102130
1174 Ga0070715_10104876
1175 Ga0070715_10194769
1176 Ga0070715_10256318
1177 Ga0070716_100094913
1178 Ga0070716_101320005
1179 Ga0070712_100038086
1180 Ga0070712_100111114
1181 Ga0070712_100314022
1182 Ga0075367_10022547
1183 Ga0075367_10112753
1184 Ga0075367_10288413
1185 Ga0075366_10278186
1186 Ga0075366_10397943
1187 Ga0097621_100139391
1188 Ga0097621_100212164
1189 Ga0097621_100927645
1190 Ga0097621_101706938
1191 Ga0075370_10024394
1192 Ga0075370_10093373
1193 Ga0075370_10178205
1194 Ga0068871_100126029
1195 Ga0068871_100899132
1196 Ga0068871_101274140
1197 Ga0075428_100135007
1198 Ga0075434_100287226
1199 Ga0068865_100289192
1200 Ga0068865_100708827
1201 Ga0097620_100748205
1202 Ga0097620_101012391
1203 Ga0097620_101200522
1204 Ga0075435_100454561
1205 Ga0099794_10174147
1206 Ga0099794_10321430
1207 Ga0099795_10066779
1208 Ga0105240_10551341
1209 Ga0105240_10749887
1210 Ga0105240_10822471
1211 Ga0105240_11711774
1212 Ga0111539_10530373
1213 Ga0111539_10932697
1214 Ga0105245_10405664
1215 Ga0105245_10645803
1216 Ga0105247_10130453
1217 Ga0105243_10393668
1218 Ga0105243_10507900
1219 Ga0105241_10153603
1220 Ga0105241_10441133
1221 Ga0105241_10503326
1222 Ga0105241_10691131
1223 Ga0105242_10771784
1224 Ga0105242_10834310
1225 Ga0105248_10410419
1226 Ga0105237_10186788
1227 Ga0105237_10391897
1228 Ga0105237_11256989
1229 Ga0105237_11267388
1230 Ga0105237_11307060
1231 Ga0105237_11310150
1232 Ga0105238_10122580
1233 Ga0105238_10153518
1234 Ga0105238_10589215
1235 Ga0105238_10815971
1236 Ga0105238_10899903
1237 Ga0105238_10916090
1238 Ga0105238_11172820
1239 Ga0105238_11355898
1240 Ga0105238_11573732
1241 Ga0105249_11152751
1242 Ga0105249_11307958
1243 Ga0099796_10081558
1244 Ga0099796_10235288
1245 Ga0105239_10325851
1246 Ga0105239_10526109
1247 Ga0105239_11237394
1248 Ga0105239_11992100
1249 Ga0105246_10019273
1250 Ga0105246_10634819
1251 Ga0105246_11279383
1252 Ga0157373_10675974
1253 Ga0157370_10137726
1254 Ga0157369_10021333
1255 Ga0157369_10401604
1256 Ga0157374_10054089
1257 Ga0157374_10353683
1258 Ga0157374_10498604
1259 Ga0157374_11026557
1260 Ga0157378_11611005
1261 Ga0163162_10045228
1262 Ga0163162_11000743
1263 Ga0163162_11590985
1264 Ga0163162_11937813
1265 Ga0163162_12349777
1266 Ga0163162_12826517
1267 Ga0157372_10201797
1268 Ga0157372_10579615
1269 Ga0157372_10940107
1270 Ga0157375_10624930
1271 Ga0157375_10691138
1272 Ga0157375_10747294
1273 Ga0163163_10127555
1274 Ga0163163_10370574
1275 Ga0163163_11096593
1276 Ga0163163_11391692
1277 Ga0163163_12210602
1278 Ga0157380_10341204
1279 Ga0157380_10599164
1280 Ga0157380_12204986
1281 Ga0157379_10209640
1282 Ga0157379_10568872
1283 Ga0157376_10620496
1284 Ga0157376_10804516
1285 Ga0157376_10912082
1286 Ga0182007_10241593
1287 Ga0163161_10486050
1288 Ga0163161_10584233
1289 Ga0163161_11136485
1290 Ga0206356_10348709
1291 Ga0206354_10763753
1292 Ga0213876_10169534
1293 Ga0213876_10325057
1294 Ga0213876_10467307
1295 Ga0213875_10150372
1296 Ga0224712_10096101
1297 Ga0209563_101315
1298 Ga0209677_100543
1299 Ga0209677_100722
1300 Ga0209148_1000295
1301 Ga0209233_1002578
1302 Ga0209233_1006623
1303 Ga0209455_1003238
1304 Ga0209455_1004716
1305 Ga0209455_1021696
1306 Ga0209758_1001900
1307 Ga0209758_1013412
1308 Ga0209256_1052131
1309 Ga0207697_10022598
1310 Ga0207697_10044238
1311 Ga0207697_10227280
1312 Ga0207697_10228741
1313 Ga0207653_10076948
1314 Ga0207692_10042210
1315 Ga0207692_10152647
1316 Ga0207692_10250021
1317 Ga0207692_10263072
1318 Ga0207692_10340988
1319 Ga0207692_10616693
1320 Ga0207642_10097318
1321 Ga0207642_10859819
1322 Ga0207710_10094956
1323 Ga0207688_10151712
1324 Ga0207680_10578662
1325 Ga0207647_10113451
1326 Ga0207699_10011800
1327 Ga0207699_10267408
1328 Ga0207699_10504622
1329 Ga0207699_10586267
1330 Ga0207643_10135707
1331 Ga0207643_10252516
1332 Ga0207684_10366162
1333 Ga0207654_10096920
1334 Ga0207654_10160018
1335 Ga0207654_10224647
1336 Ga0207707_10008183
1337 Ga0207707_10369948
1338 Ga0207707_10477221
1339 Ga0207707_10669777
1340 Ga0207695_10071334
1341 Ga0207671_10508006
1342 Ga0207671_10595909
1343 Ga0207693_10045163
1344 Ga0207693_10055491
1345 Ga0207693_10263120
1346 Ga0207663_10002736
1347 Ga0207663_10409162
1348 Ga0207662_10335633
1349 Ga0207657_10173641
1350 Ga0207657_10907579
1351 Ga0207649_10201576
1352 Ga0207649_10355147
1353 Ga0207649_10503760
1354 Ga0207652_10129770
1355 Ga0207652_10164815
1356 Ga0207652_10305259
1357 Ga0207652_10351820
1358 Ga0207652_10610512
1359 Ga0207652_11500576
1360 Ga0207646_10369425
1361 Ga0207694_10206275
1362 Ga0207694_10266828
1363 Ga0207694_11040842
1364 Ga0207694_11235147
1365 Ga0207650_10625123
1366 Ga0207687_10305000
1367 Ga0207687_10593584
1368 Ga0207700_10010462
1369 Ga0207700_10012790
1370 Ga0207700_10029757
1371 Ga0207700_10378915
1372 Ga0207700_10400753
1373 Ga0207700_10684841
1374 Ga0207700_11148398
1375 Ga0207664_10254380
1376 Ga0207664_10340402
1377 Ga0207644_10179336
1378 Ga0207644_10626714
1379 Ga0207706_10130949
1380 Ga0207706_10326055
1381 Ga0207709_10465780
1382 Ga0207709_11359072
1383 Ga0207670_10360927
1384 Ga0207669_10207027
1385 Ga0207669_11403328
1386 Ga0207704_10166691
1387 Ga0207704_10708908
1388 Ga0207691_10508924
1389 Ga0207691_10844799
1390 Ga0207711_10140227
1391 Ga0207711_10300286
1392 Ga0207689_10975978
1393 Ga0207661_10000878
1394 Ga0207661_10062380
1395 Ga0207661_10850753
1396 Ga0207661_11273548
1397 Ga0207679_10356886
1398 Ga0207667_10105980
1399 Ga0207667_10144958
1400 Ga0207667_10148791
1401 Ga0207667_11145110
1402 Ga0207712_10857651
1403 Ga0207712_11397532
1404 Ga0207668_11320483
1405 Ga0207640_10083438
1406 Ga0207640_10229671
1407 Ga0207640_10356669
1408 Ga0207658_10602505
1409 Ga0207658_11332541
1410 Ga0207677_10091376
1411 Ga0207677_10443850
1412 Ga0207703_10065112
1413 Ga0207703_11145258
1414 Ga0207703_11241870
1415 Ga0207639_10240699
1416 Ga0207639_10268042
1417 Ga0207639_10292211
1418 Ga0207678_10246188
1419 Ga0207678_10561648
1420 Ga0207678_10786279
1421 Ga0207678_11095558
1422 Ga0207702_10000318
1423 Ga0207702_10312632
1424 Ga0207702_10372300
1425 Ga0207702_11139192
1426 Ga0207641_10357451
1427 Ga0207641_10474896
1428 Ga0207641_10517494
1429 Ga0207641_12096007
1430 Ga0207648_10402717
1431 Ga0207648_10499119
1432 Ga0207648_10534857
1433 Ga0207648_10706097
1434 Ga0207676_10199904
1435 Ga0207674_10073988
1436 Ga0207674_10666112
1437 Ga0207674_10670582
1438 Ga0207675_100609178
1439 Ga0207675_101074709
1440 Ga0207683_10083899
1441 Ga0207683_10153979
1442 Ga0207683_10461287
1443 Ga0207683_10478614
1444 Ga0207683_10984709
1445 Ga0207683_11224932
1446 Ga0207683_11652559
1447 Ga0207683_11813868
1448 Ga0207698_10403643
1449 Ga0207698_10715809
1450 Ga0209588_1060561
1451 Ga0209813_10024630
1452 Ga0268266_10066637
1453 Ga0268266_10129302
1454 Ga0268266_10341670
1455 Ga0268266_10378883
1456 Ga0268266_10757186
1457 Ga0268266_11222413
1458 Ga0268266_11364934
1459 Ga0268266_12068669
1460 Ga0268265_10289989
1461 Ga0268265_10506484
1462 Ga0268264_10297652
1463 Ga0268264_11273547
1464 Ga0307517_10000232
1465 Ga0307517_10469903
1466 Ga0307515_10087102
1467 Ga0265332_10035231
1468 Ga0265340_10091462
1469 Ga0265340_10217072
1470 Ga0265339_10073499
1471 Ga0265331_10089610
1472 Ga0265316_10196584
1473 Ga0265316_10588938
1474 Ga0307513_10191401
1475 Ga0307513_10240504
1476 Ga0307509_10331144
1477 Ga0265313_10342930
1478 Ga0307508_10126440
1479 Ga0307508_10328232
1480 Ga0307508_10665446
1481 Ga0265314_10005054
1482 Ga0265314_10220531
1483 Ga0307516_10114956
1484 Ga0307516_10178300
1485 Ga0307516_10279702
1486 Ga0307405_10263134
1487 Ga0307413_10594532
1488 Ga0307406_10237733
1489 Ga0307407_10538655
1490 Ga0307412_10530413
1491 Ga0307416_100460323
1492 Ga0307416_101970837
1493 Ga0307416_101979258
1494 Ga0307414_10974180
1495 Ga0307415_100314346
1496 Ga0307415_100662739
1497 Ga0307510_10072618
1498 Ga0307510_10089264
1499 Ga0307510_10121016
1500 Ga0307510_10301776
1501 Ga0315911_1000008
1502 Ga0373958_0165769
1503 Ga0373958_0166297
1504 Ga0373926_0033050
1505 Ga0373934_0023493
1506 Ga0373934_0096153
1507 Ga0373949_0072389
1508 Ga0373951_0095136
1509 Ga0373952_0253775
1510 Ga0373923_0004936
1511 Ga0373923_0039874
1512 Ga0373923_0042855
1513 Ga0373936_0070753
1514 Ga0373939_0109740
1515 Ga0373945_0015296
1516 Ga0373945_0100694
1517 Ga0373953_0078384
1518 Ga0373953_0247502
1519 Ga0373954_0011463
1520 Ga0373954_0174243
1521 Ga0373956_0082067
1522 Ga0373956_0155201
1523 Ga0373956_0451395
1524 Ga0373957_0120048
1525 Ga0373943_0141500
1526 Ga0373943_0463427
1527 Ga0373946_0014322
1528 Ga0373946_0214788
1529 Ga0373946_0482002
1530 Ga0373955_0004380
1531 Ga0373955_0051079
1532 Ga0373961_0031149
1533 Ga0373961_0070941
1534 Ga0373924_0033451
1535 Ga0373924_0093920
1536 Ga0373931_0015641
1537 Ga0373935_0001267
1538 Ga0373935_0039786
1539 Ga0373927_0000766
1540 Ga0373927_0006724
1541 Ga0373927_0200773
1542 Ga0373927_0288502
1543 Ga0373927_0328502
1544 Ga0373927_0349402
1545 Ga0373927_1123709
1546 Ga0373933_0000218
1547 Ga0373933_0231444
1548 Ga0373933_0356576
1549 Ga0373947_0000310
1550 Ga0373947_0013664
1551 Ga0373947_0374672
1552 Ga0373937_0014630
1553 Ga0373925_0006419
1554 Ga0373925_0021485
1555 Ga0373925_0078313
1556 Ga0373925_0589307
1557 Ga0373925_0654343
1558 Ga0395900_0032832
1559 Ga0395900_0108628
1560 Ga0395900_0199177
1561 Ga0395900_1525769
1562 Ga0395898_0089031
1563 Ga0395898_0631023
1564 Ga0395905_0048135
1565 Ga0436364_0331795
1566 Ga0436364_0603569
1567 Ga0395901_0113781
1568 Ga0395901_0297332
1569 Ga0436365_0118730
1570 Ga0436365_0135384
1571 Ga0436365_0209743
1572 Ga0436365_0279102
1573 Ga0436365_0346369
1574 Ga0436365_1026627
1575 Ga0436362_0249161
1576 Ga0436362_1201460
1577 Ga0451789_1333214
1578 Ga0451793_1038465
1579 Ga0451802_1431654
1580 Ga0451807_0826454
1581 Ga0451855_0143711
1582 Ga0466969_0093259
1583 Ga0466972_0029548
1584 Ga0466966_0343263
1585 Ga0466961_0156035
1586 Ga0466963_0258548
1587 Ga0466963_0996490
1588 Ga0466971_0156462
1589 Ga0466968_0379186
1590 Ga0466970_0260390
1591 Ga0466957_0080078
1592 Ga0466957_0237937
1593 Ga0466957_0297429
1594 Ga0466957_0427749
1595 Ga0466960_0181359
1596 Ga0466959_0048894
1597 Ga0466967_0028253
1598 Ga0466967_0062009
1599 Ga0466967_0204967
1600 Ga0466967_1213654
1601 Ga0495617_107272
1602 Ga0495592_0102991
1603 Ga0495592_0142617
1604 Ga0495603_0000936
1605 Ga0495603_0021318
1606 Ga0495603_0105542
1607 Ga0495603_0237833
1608 Ga0495603_0392356
1609 Ga0495629_0001416
1610 Ga0495629_0123416
1611 Ga0495629_0484623
1612 Ga0495629_0633985
1613 Ga0495638_0139687
1614 Ga0495638_0317616
1615 Ga0495641_0016464
1616 Ga0495641_0138934
1617 Ga0495651_0019880
1618 Ga0495651_0178579
1619 Ga0495653_0049261
1620 Ga0495653_0117625
1621 Ga0495650_0125333
1622 Ga0495580_0005025
1623 Ga0495580_0006058
1624 Ga0495580_0514895
1625 Ga0495582_0018773
1626 Ga0495582_0038113
1627 Ga0495582_0082250
1628 Ga0495582_0124167
1629 Ga0495639_0000072
1630 Ga0495662_0000572
1631 Ga0495662_0185583
1632 Ga0495662_0217863
1633 Ga0495664_0014835
1634 Ga0495664_0045196
1635 Ga0495585_0586092
1636 Ga0495594_0000046
1637 Ga0495594_0297721
1638 Ga0495596_0130534
1639 Ga0495596_0177088
1640 Ga0495596_0195003
1641 Ga0495606_0168025
1642 Ga0495608_0323669
1643 Ga0495608_0637386
1644 Ga0495610_0029757
1645 Ga0495618_0100704
1646 Ga0495618_0186351
1647 Ga0495620_0229342
1648 Ga0495628_0018626
1649 Ga0495628_0033483
1650 Ga0495628_0327775
1651 Ga0495628_0517885
1652 Ga0495630_0024634
1653 Ga0495630_0093534
1654 Ga0495630_0154765
1655 Ga0495630_0513814
1656 Ga0495631_0217855
1657 Ga0495631_0334536
1658 Ga0495632_0063839
1659 Ga0495637_0100090
1660 Ga0495644_0153157
1661 Ga0495644_0243040
1662 Ga0495644_0281117
1663 Ga0495644_0359059
1664 Ga0495648_0249358
1665 Ga0495648_0373903
1666 Ga0495663_0177723
1667 Ga0495666_0041837
1668 Ga0495666_0167306
1669 Ga0495642_0191454
1670 Ga0495642_0198449
1671 Ga0495665_0000335
1672 Ga0495640_0002138
1673 Ga0495640_0051516
1674 Ga0495640_0361314
1675 Ga0495586_0059346
1676 Ga0495587_0345412
1677 Ga0495609_0119716
1678 Ga0495609_0131591
1679 Ga0495645_0013978
1680 Ga0495645_0036237
1681 Ga0495622_0084671
1682 Ga0495622_0249119
1683 Ga0495633_0312506
1684 Ga0495667_0032717
1685 Ga0495667_0803522
1686 Ga0495668_0168169
1687 Ga0495668_0481719
1688 Ga0495668_0732608
1689 Ga0495634_0003037
1690 Ga0495634_0044482
1691 Ga0495611_0066313
1692 Ga0495611_0300332
1693 Ga0495625_0251011
1694 Ga0495635_0002038
1695 Ga0495635_0016231
1696 Ga0495635_0089467
1697 Ga0495635_0255921
1698 Ga0495588_0416881
1699 Ga0495657_0121602
1700 Ga0495599_0128792
1701 Ga0495599_0191494
1702 Ga0495599_0306147
1703 Ga0495599_0644747
1704 Ga0495623_0075175
1705 Ga0495646_0066903
1706 Ga0495646_0081016
1707 Ga0495646_0119658
1708 Ga0495646_0481522
1709 Ga0495647_0008783
1710 Ga0495647_0016367
1711 Ga0495658_0002742
1712 Ga0495658_0009522
1713 Ga0495658_0247379
1714 Ga0495669_0124118
1715 Ga0495669_0198256
1716 Ga0495669_0310627
1717 Ga0495613_0081505
1718 Ga0495613_0148666
1719 Ga0495624_0000795
1720 Ga0495624_0056079
1721 Ga0495670_0469767
1722 Ga0495671_0091675
1723 Ga0495671_0437409
1724 Ga0495649_0299125
1725 Ga0495649_0408599
1726 Ga0495589_0135740
1727 Ga0495600_0093192
1728 Ga0495600_0115281
1729 Ga0495581_0000030
1730 Ga0495581_0126320
1731 Ga0495581_0144120
1732 Ga0495581_0352195
1733 Ga0495604_0105989
1734 Ga0495604_0730681
1735 Ga0495674_0012381
1736 Ga0495674_0026440
1737 Ga0495674_0170500
1738 Ga0495674_0433544
1739 Ga0495674_1157765
1740 Ga0495672_0019292
1741 Ga0495676_0028804
1742 Ga0495676_0426845
1743 Ga0495680_0139443
1744 Ga0495680_0289892
1745 Ga0495683_0383974
1746 Ga0495675_0384899
1747 Ga0495684_0021000
1748 Ga0495684_0053297
1749 Ga0495686_0085355
1750 Ga0495686_0171913
1751 Ga0495593_0000398
1752 Ga0495593_0181923
1753 Ga0495614_0046075
1754 Ga0496100_0073875
1755 Ga0496100_0369385
1756 Ga0496100_0926204
1757 Ga0496101_0859744
1758 Ga0496101_1368899
1759 Ga0496102_0082256
1760 Ga0496102_0152685
1761 Ga0496102_0260356
1762 Ga0496102_0347549
1763 Ga0496102_0401306
1764 Ga0496103_0091837
1765 Ga0496103_0135099
1766 Ga0496103_0527388
1767 Ga0496103_0636678
1768 Ga0496104_0044883
1769 Ga0496104_0463833
1770 Ga0496104_0526120
1771 Ga0496104_0548848
1772 Ga0496104_0777062
1773 Ga0496105_0051519
1774 Ga0496105_0094396
1775 Ga0496105_0737928
1776 Ga0496105_0852426
1777 Ga0496106_0411555
1778 Ga0496106_0607760
1779 Ga0496106_0628249
1780 Ga0496106_0766736
1781 Ga0496107_0037476
1782 Ga0496107_0114537
1783 Ga0496107_0316488
1784 Ga0496107_1098843
1785 Ga0496108_0036615
1786 Ga0496108_0060709
1787 Ga0496108_0443405
1788 Ga0496108_0571795
1789 Ga0496108_1132709
1790 Ga0496109_0057722
1791 Ga0496109_0353316
1792 Ga0496109_1851968
1793 Ga0496110_1252080
1794 Ga0496111_0034277
1795 Ga0496111_0680391
1796 Ga0496112_0033543
1797 Ga0496112_0049766
1798 Ga0496112_0631524
1799 Ga0496112_1010109
1800 Ga0496113_0017212
1801 Ga0496113_0032120
1802 Ga0496114_0078476
1803 Ga0496114_0420047
1804 Ga0496115_0150310
1805 Ga0496115_0281240
1806 Ga0496115_0335240
1807 Ga0496115_0439175
1808 Ga0496116_0159299
1809 Ga0496116_0235381
1810 Ga0496117_0060867
1811 Ga0496117_0277004
1812 Ga0496118_0134441
1813 Ga0496118_0283652
1814 Ga0496118_0316502
1815 Ga0496118_0410405
1816 Ga0496119_0147277
1817 Ga0496121_0000278
1818 Ga0496121_0035287
1819 Ga0496121_0071562
1820 Ga0496121_0113457
1821 Ga0496121_0125511
1822 Ga0496121_0166716
1823 Ga0496121_0200405
1824 Ga0496121_0322537
1825 Ga0496121_0518333
1826 Ga0496124_0236071
1827 Ga0496124_0248160
1828 Ga0496125_0576892
1829 Ga0496126_0034975
1830 Ga0496126_0060610
1831 Ga0496126_0162691
1832 Ga0496126_0397020
1833 Ga0496126_0889485
1834 Ga0501033_0597713
1835 Ga0501047_0041970
1836 Ga0501048_0522722
1837 Ga0501067_0050483
1838 Ga0501070_0248474
1839 Ga0501080_0128602
1840 Ga0501044_0083186
1841 nmdc:mga03683_210539_c1
1842 nmdc:mga03683_265128_c1
1843 nmdc:mga03n38_14558_c1
1844 nmdc:mga00v17_539811_c1
1845 nmdc:mga0yw44_117836_c1
1846 nmdc:mga0yw44_464373_c1
1847 nmdc:mga0yw44_644431_c1
1848 nmdc:mga0yw44_804435_c1
1849 nmdc:mga06z11_110457_c1
1850 nmdc:mga06z11_11045_c1
1851 nmdc:mga06z11_460298_c1
1852 nmdc:mga06z11_583410_c1
1853 nmdc:mga04h51_29235_c1
1854 nmdc:mga07m45_13114_c1
1855 nmdc:mga07m45_385630_c1
1856 nmdc:mga07m45_64024_c1
1857 nmdc:mga08y16_619065_c1
1858 nmdc:mga0n895_378198_c1
1859 nmdc:mga0rr50_393867_c1
1860 nmdc:mga0a205_151249_c1
1861 Ga0495601_0017256
1862 Ga0495601_0136693
1863 Ga0495601_0343333
1864 Ga0500610_0041583
1865 Ga0495655_0112132
1866 Ga0495595_0219991
1867 Ga0495619_0236354
1868 Ga0495619_0241630
1869 Ga0500643_000112
1870 Ga0500644_0362520
1871 Ga0500646_0155861
1872 Ga0500583_0085964
1873 Ga0500583_0166310
1874 Ga0500651_0033603
1875 Ga0500651_0258387
1876 Ga0500566_0011791
1877 Ga0500566_0043525
1878 Ga0500640_009445
1879 Ga0500641_0060146
1880 Ga0500641_0147163
1881 Ga0500650_0192335
1882 Ga0500553_133854
1883 Ga0500554_067639
1884 Ga0500555_004419
1885 Ga0500555_083377
1886 Ga0500569_051549
1887 Ga0500569_085728
1888 Ga0500572_072413
1889 Ga0500582_116210
1890 Ga0500592_014816
1891 Ga0500592_033615
1892 Ga0500594_0011291
1893 Ga0500594_0253250
1894 Ga0500595_001016
1895 Ga0500595_006803
1896 Ga0500595_014698
1897 Ga0500595_027760
1898 Ga0500595_043871
1899 Ga0500607_085637
1900 Ga0500608_234605
1901 Ga0500614_108692
1902 Ga0500614_193217
1903 Ga0500628_143339
1904 Ga0500642_0000362
1905 Ga0500642_0000641
1906 Ga0500642_0066658
1907 Ga0500655_040208
1908 Ga0500658_0381921
1909 Ga0500568_0067550
1910 Ga0500568_0129529
1911 Ga0500577_0098647
1912 Ga0500577_0198761
1913 Ga0500588_0101524
1914 Ga0500589_226276
1915 Ga0500589_262379
1916 Ga0500590_147270
1917 Ga0500590_223751
1918 Ga0500603_121939
1919 Ga0500604_0049059
1920 Ga0500604_0089581
1921 Ga0500604_0178318
1922 Ga0500616_0139503
1923 Ga0500620_238445
1924 Ga0500622_0229091
1925 Ga0500627_0125991
1926 Ga0500627_0203270
1927 Ga0500627_0348998
1928 Ga0500634_0212441
1929 Ga0500638_005456
1930 Ga0500638_222988
1931 Ga0500636_0276248
1932 Ga0500636_0333676
1933 Ga0500637_0000585
1934 Ga0500637_0186572
1935 Ga0500570_106621
1936 Ga0500611_158246
1937 Ga0500609_006652
1938 Ga0500661_005871
1939 Ga0587080_148527
1940 Ga0587083_0147968
1941 Ga0587068_101443
1942 Ga0587072_123946
1943 Ga0587075_040357
1944 Ga0587076_075966
1945 Ga0587071_046432
1946 Ga0466962_0031673
1947 Ga0466962_0128009
1948 8016565829
1949 2513659509
1950 2513718240
1951 2513859384
1952 2513921558
1953 2517889050
1954 2524537485
1955 2671124039
1956 2793072711
1957 2881368926
1958 2885377554
1959 2885415852
1960 2903758797
1961 2904691005
1962 2904708402
1963 2906613574
1964 2906635831
1965 2906668108
1966 2908747652
1967 2908757063
1968 2922363207
1969 2922434011
1970 2935636038
1971 2941512658
1972 2941520504
1973 2941528518
1974 3005475274
1975 8006936003
1976 8006975873
1977 8019562653
1978 8019572730
1979 8056691144
1980 8056971493

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07617

DUF1579

Protein of unknown function (DUF1579)

6

96

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8715 7 158
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8551 7 158
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.836 1 158
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.831 1 158
7sfp-assembly1.cif.gz_A crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin 0.803 7 157
ID Description Score Start End Superfamily
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.814 11 157 2.40.128.20
af_A0A2C9C2Z6_71_253_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7961 11 157 2.40.128.20
af_Q5N900_107_401_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7919 108 158 3.40.50.150
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7896 9 158 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7882 7 157 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A537XP13-F1-model_v4 DUF1579 domain-containing protein 0.9873 33 158
AF-A0A7Y4GZB7-F1-model_v4 DUF1579 domain-containing protein 0.9818 1 158
AF-A0A534NU50-F1-model_v4 DUF1579 domain-containing protein 0.9817 5 157
AF-A0A431RL37-F1-model_v4 deleted 0.9801 1 140
AF-A0A537XP13-F1-model_v4 DUF1579 domain-containing protein 0.9796 33 158

Map