F487624
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 466 | 1980 | 158 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016557553|8016565829 |
| Length | 171 |
| Sequence | HLAASSPLPEHARLAAFAGEWNGEEVVFPSRWTEGGSATSHVVAHMDLNGFYLIQDSVQTRDGKQVFATHGIFTFDREDRTYKLFWYDSLGYTPPSPASGGWSREDPDAGARLAPRQCAPRLRNHRRRFLFVEDPVLAGRGRLGRRPHRRLPPHPLTSHTLVSRKQTSCPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 383 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 385 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 386 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 387 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 392 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 393 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 395 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 397 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 398 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 400 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 401 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 402 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 403 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 404 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 405 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 410 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 411 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 412 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 417 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 422 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 423 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 424 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 425 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 426 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 434 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 435 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 436 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 437 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 438 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 439 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 440 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 441 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 442 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 443 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 444 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 445 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 446 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 447 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 448 | 2904699407 | |||
| 449 | 2906610324 | |||
| 450 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 451 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 452 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 453 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 454 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 455 | 2922425934 | |||
| 456 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 457 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 458 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 459 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 460 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 461 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 462 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 463 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 464 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 465 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 466 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.95 |
| Metatranscriptomes | 1.01 |
| Isolates | 3.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.63 |
| Nodule | 2.42 |
| Rhizoplane | 5.96 |
| Rhizosphere | 72.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1004955 | 3300003214 | Bacteria | 2682 |
| 2 | JGI25153J46596_10030586 | 3300003215 | Bacteria | 1829 |
| 3 | JGI25404J52841_10019296 | 3300003659 | Bacteria | 1477 |
| 4 | JGI25404J52841_10035351 | 3300003659 | Bacteria | 1064 |
| 5 | Ga0055539_1020748 | 3300003752 | Bacteria | 783 |
| 6 | Ga0055542_1014646 | 3300003762 | Bacteria | 1281 |
| 7 | Ga0055543_1011352 | 3300004625 | Bacteria | 1827 |
| 8 | Ga0065704_10142844 | 3300005289 | Bacteria | 1501 |
| 9 | Ga0065712_10228589 | 3300005290 | Bacteria | 1003 |
| 10 | Ga0065707_10024212 | 3300005295 | Bacteria | 1755 |
| 11 | Ga0070676_10229590 | 3300005328 | Bacteria | 1230 |
| 12 | Ga0070676_10660950 | 3300005328 | Bacteria | 759 |
| 13 | Ga0070683_100109161 | 3300005329 | Bacteria | 2610 |
| 14 | Ga0070683_100167461 | 3300005329 | Bacteria | 2085 |
| 15 | Ga0070683_100270090 | 3300005329 | Bacteria | 1618 |
| 16 | Ga0070683_100277403 | 3300005329 | Bacteria | 1595 |
| 17 | Ga0070670_100746824 | 3300005331 | Bacteria | 881 |
| 18 | Ga0068869_100451568 | 3300005334 | Bacteria | 1065 |
| 19 | Ga0068869_101189775 | 3300005334 | Bacteria | 669 |
| 20 | Ga0070666_10947092 | 3300005335 | Bacteria | 637 |
| 21 | Ga0070680_100463354 | 3300005336 | Bacteria | 1083 |
| 22 | Ga0070680_100852515 | 3300005336 | Bacteria | 785 |
| 23 | Ga0070682_100140690 | 3300005337 | Bacteria | 1645 |
| 24 | Ga0070682_100954204 | 3300005337 | Bacteria | 708 |
| 25 | Ga0068868_100059956 | 3300005338 | Bacteria | 3011 |
| 26 | Ga0068868_101012133 | 3300005338 | Bacteria | 761 |
| 27 | Ga0068868_101458966 | 3300005338 | Bacteria | 639 |
| 28 | Ga0070660_100501648 | 3300005339 | Bacteria | 1010 |
| 29 | Ga0070691_10205067 | 3300005341 | Bacteria | 1038 |
| 30 | Ga0070661_100466437 | 3300005344 | Bacteria | 1006 |
| 31 | Ga0070661_100739494 | 3300005344 | Bacteria | 804 |
| 32 | Ga0070661_101243556 | 3300005344 | Bacteria | 623 |
| 33 | Ga0070668_100216872 | 3300005347 | Bacteria | 1576 |
| 34 | Ga0070668_100424000 | 3300005347 | Bacteria | 1139 |
| 35 | Ga0070668_100776729 | 3300005347 | Bacteria | 849 |
| 36 | Ga0070668_102037548 | 3300005347 | Bacteria | 529 |
| 37 | Ga0070668_102037549 | 3300005347 | Bacteria | 529 |
| 38 | Ga0070669_100609029 | 3300005353 | Bacteria | 916 |
| 39 | Ga0070671_101076359 | 3300005355 | Bacteria | 706 |
| 40 | Ga0070674_101290983 | 3300005356 | Bacteria | 651 |
| 41 | Ga0070673_100230498 | 3300005364 | Bacteria | 1606 |
| 42 | Ga0070673_100760705 | 3300005364 | Bacteria | 892 |
| 43 | Ga0070688_100208310 | 3300005365 | Bacteria | 1371 |
| 44 | Ga0070688_100588175 | 3300005365 | Bacteria | 850 |
| 45 | Ga0070659_101317869 | 3300005366 | Bacteria | 640 |
| 46 | Ga0070667_100271251 | 3300005367 | Bacteria | 1521 |
| 47 | Ga0070667_101493029 | 3300005367 | Bacteria | 635 |
| 48 | Ga0070667_101683202 | 3300005367 | Bacteria | 596 |
| 49 | Ga0070703_10299640 | 3300005406 | Bacteria | 670 |
| 50 | Ga0070709_10194830 | 3300005434 | Bacteria | 1432 |
| 51 | Ga0070709_10357658 | 3300005434 | Bacteria | 1080 |
| 52 | Ga0070709_10420172 | 3300005434 | Bacteria | 1002 |
| 53 | Ga0070709_10833475 | 3300005434 | Bacteria | 726 |
| 54 | Ga0070709_10905858 | 3300005434 | Bacteria | 697 |
| 55 | Ga0070714_100021967 | 3300005435 | Bacteria | 5227 |
| 56 | Ga0070714_100431950 | 3300005435 | Bacteria | 1249 |
| 57 | Ga0070714_100930256 | 3300005435 | Bacteria | 844 |
| 58 | Ga0070713_100029455 | 3300005436 | Bacteria | 4349 |
| 59 | Ga0070713_100080502 | 3300005436 | Bacteria | 2778 |
| 60 | Ga0070713_100156027 | 3300005436 | Bacteria | 2034 |
| 61 | Ga0070713_100330033 | 3300005436 | Bacteria | 1411 |
| 62 | Ga0070713_100737828 | 3300005436 | Bacteria | 942 |
| 63 | Ga0070713_101283380 | 3300005436 | Bacteria | 709 |
| 64 | Ga0070710_10041326 | 3300005437 | Bacteria | 2546 |
| 65 | Ga0070710_10055278 | 3300005437 | Bacteria | 2243 |
| 66 | Ga0070710_10297910 | 3300005437 | Bacteria | 1052 |
| 67 | Ga0070710_10336269 | 3300005437 | Bacteria | 995 |
| 68 | Ga0070710_10577282 | 3300005437 | Bacteria | 780 |
| 69 | Ga0070710_10611687 | 3300005437 | Bacteria | 760 |
| 70 | Ga0070710_10754729 | 3300005437 | Bacteria | 691 |
| 71 | Ga0070701_10194738 | 3300005438 | Bacteria | 1194 |
| 72 | Ga0070711_100005553 | 3300005439 | Bacteria | 7552 |
| 73 | Ga0070711_100194344 | 3300005439 | Bacteria | 1561 |
| 74 | Ga0070711_100268474 | 3300005439 | Bacteria | 1345 |
| 75 | Ga0070711_100315259 | 3300005439 | Bacteria | 1248 |
| 76 | Ga0070700_101071426 | 3300005441 | Bacteria | 666 |
| 77 | Ga0070700_101158779 | 3300005441 | Bacteria | 643 |
| 78 | Ga0070700_101302622 | 3300005441 | Bacteria | 611 |
| 79 | Ga0070694_100479641 | 3300005444 | Bacteria | 986 |
| 80 | Ga0070663_100718471 | 3300005455 | Bacteria | 850 |
| 81 | Ga0070663_100861160 | 3300005455 | Bacteria | 780 |
| 82 | Ga0070663_101271406 | 3300005455 | Bacteria | 648 |
| 83 | Ga0070678_100096322 | 3300005456 | Bacteria | 2282 |
| 84 | Ga0070678_100363674 | 3300005456 | Bacteria | 1247 |
| 85 | Ga0070678_100584240 | 3300005456 | Bacteria | 995 |
| 86 | Ga0070662_100289078 | 3300005457 | Bacteria | 1328 |
| 87 | Ga0070681_10017254 | 3300005458 | Bacteria | 7216 |
| 88 | Ga0070681_10037401 | 3300005458 | Bacteria | 4871 |
| 89 | Ga0070681_10075073 | 3300005458 | Bacteria | 3341 |
| 90 | Ga0070681_10436888 | 3300005458 | Bacteria | 1221 |
| 91 | Ga0068867_100630108 | 3300005459 | Bacteria | 938 |
| 92 | Ga0068867_100633022 | 3300005459 | Bacteria | 936 |
| 93 | Ga0070685_10466238 | 3300005466 | Bacteria | 888 |
| 94 | Ga0070706_100234156 | 3300005467 | Bacteria | 1714 |
| 95 | Ga0070706_100317287 | 3300005467 | Bacteria | 1454 |
| 96 | Ga0070706_100574081 | 3300005467 | Bacteria | 1048 |
| 97 | Ga0070706_100600472 | 3300005467 | Bacteria | 1023 |
| 98 | Ga0070698_100059290 | 3300005471 | Bacteria | 3866 |
| 99 | Ga0070698_100981492 | 3300005471 | Bacteria | 791 |
| 100 | Ga0070699_100681478 | 3300005518 | Bacteria | 939 |
| 101 | Ga0070699_100742484 | 3300005518 | Bacteria | 897 |
| 102 | Ga0070679_100015647 | 3300005530 | Bacteria | 7292 |
| 103 | Ga0070679_100163330 | 3300005530 | Bacteria | 2201 |
| 104 | Ga0070684_100355097 | 3300005535 | Bacteria | 1349 |
| 105 | Ga0070684_100395167 | 3300005535 | Bacteria | 1274 |
| 106 | Ga0070684_100692908 | 3300005535 | Bacteria | 950 |
| 107 | Ga0070684_100884156 | 3300005535 | Bacteria | 837 |
| 108 | Ga0070697_100201326 | 3300005536 | Bacteria | 1693 |
| 109 | Ga0068853_100390609 | 3300005539 | Bacteria | 1301 |
| 110 | Ga0068853_100442522 | 3300005539 | Bacteria | 1221 |
| 111 | Ga0068853_100484951 | 3300005539 | Bacteria | 1166 |
| 112 | Ga0068853_100695337 | 3300005539 | Bacteria | 970 |
| 113 | Ga0070672_100348785 | 3300005543 | Bacteria | 1261 |
| 114 | Ga0070693_100040796 | 3300005547 | Bacteria | 2608 |
| 115 | Ga0070693_100075050 | 3300005547 | Bacteria | 2001 |
| 116 | Ga0070693_100395572 | 3300005547 | Bacteria | 957 |
| 117 | Ga0070665_100206184 | 3300005548 | Bacteria | 1966 |
| 118 | Ga0070665_100377590 | 3300005548 | Bacteria | 1425 |
| 119 | Ga0070665_100519344 | 3300005548 | Bacteria | 1202 |
| 120 | Ga0070665_101138158 | 3300005548 | Bacteria | 792 |
| 121 | Ga0068855_100444992 | 3300005563 | Bacteria | 1414 |
| 122 | Ga0068855_100686734 | 3300005563 | Bacteria | 1097 |
| 123 | Ga0068855_101263499 | 3300005563 | Bacteria | 765 |
| 124 | Ga0070664_101140914 | 3300005564 | Bacteria | 735 |
| 125 | Ga0070664_101838180 | 3300005564 | Bacteria | 575 |
| 126 | Ga0068857_100183974 | 3300005577 | Bacteria | 1902 |
| 127 | Ga0068857_100311302 | 3300005577 | Bacteria | 1453 |
| 128 | Ga0068857_100397294 | 3300005577 | Bacteria | 1282 |
| 129 | Ga0068854_100272559 | 3300005578 | Bacteria | 1359 |
| 130 | Ga0068854_100442540 | 3300005578 | Bacteria | 1084 |
| 131 | Ga0068854_100501576 | 3300005578 | Bacteria | 1022 |
| 132 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 133 | Ga0068856_100107320 | 3300005614 | Bacteria | 2787 |
| 134 | Ga0068856_100491914 | 3300005614 | Bacteria | 1247 |
| 135 | Ga0068856_101140658 | 3300005614 | Bacteria | 796 |
| 136 | Ga0068856_101473787 | 3300005614 | Bacteria | 695 |
| 137 | Ga0068856_101840282 | 3300005614 | Bacteria | 617 |
| 138 | Ga0068852_100067130 | 3300005616 | Bacteria | 3135 |
| 139 | Ga0068852_100775901 | 3300005616 | Bacteria | 972 |
| 140 | Ga0068852_100780793 | 3300005616 | Bacteria | 969 |
| 141 | Ga0068852_101142168 | 3300005616 | Bacteria | 800 |
| 142 | Ga0068852_101700076 | 3300005616 | Bacteria | 653 |
| 143 | Ga0068859_100748173 | 3300005617 | Bacteria | 1066 |
| 144 | Ga0068859_101012421 | 3300005617 | Bacteria | 912 |
| 145 | Ga0068859_101200521 | 3300005617 | Bacteria | 835 |
| 146 | Ga0068864_100123810 | 3300005618 | Bacteria | 2314 |
| 147 | Ga0068864_100314239 | 3300005618 | Bacteria | 1470 |
| 148 | Ga0068864_100339767 | 3300005618 | Bacteria | 1415 |
| 149 | Ga0068866_10472137 | 3300005718 | Bacteria | 825 |
| 150 | Ga0068861_100413798 | 3300005719 | Bacteria | 1200 |
| 151 | Ga0068861_100541193 | 3300005719 | Bacteria | 1059 |
| 152 | Ga0068870_10062707 | 3300005840 | Bacteria | 2003 |
| 153 | Ga0068870_10415719 | 3300005840 | Bacteria | 879 |
| 154 | Ga0068870_10419108 | 3300005840 | Bacteria | 876 |
| 155 | Ga0068863_100488620 | 3300005841 | Bacteria | 1211 |
| 156 | Ga0068863_100531991 | 3300005841 | Bacteria | 1159 |
| 157 | Ga0068863_100554843 | 3300005841 | Bacteria | 1134 |
| 158 | Ga0068860_100247682 | 3300005843 | Bacteria | 1734 |
| 159 | Ga0068860_100952627 | 3300005843 | Bacteria | 875 |
| 160 | Ga0068860_100960866 | 3300005843 | Bacteria | 872 |
| 161 | Ga0068862_100148304 | 3300005844 | Bacteria | 2086 |
| 162 | Ga0068862_100358612 | 3300005844 | Bacteria | 1354 |
| 163 | Ga0068862_100632552 | 3300005844 | Bacteria | 1030 |
| 164 | Ga0081540_1020688 | 3300005983 | Bacteria | 3947 |
| 165 | Ga0081540_1020881 | 3300005983 | Bacteria | 3922 |
| 166 | Ga0081540_1035114 | 3300005983 | Bacteria | 2693 |
| 167 | Ga0081540_1055889 | 3300005983 | Bacteria | 1920 |
| 168 | Ga0081540_1118995 | 3300005983 | Bacteria | 1100 |
| 169 | Ga0070717_10123888 | 3300006028 | Bacteria | 2217 |
| 170 | Ga0070717_10242931 | 3300006028 | Bacteria | 1588 |
| 171 | Ga0070717_10549537 | 3300006028 | Bacteria | 1046 |
| 172 | Ga0075365_10247886 | 3300006038 | Bacteria | 1251 |
| 173 | Ga0075365_10344911 | 3300006038 | Bacteria | 1049 |
| 174 | Ga0075365_10434159 | 3300006038 | Bacteria | 927 |
| 175 | Ga0075365_10583859 | 3300006038 | Bacteria | 790 |
| 176 | Ga0075368_10022422 | 3300006042 | Bacteria | 2404 |
| 177 | Ga0075368_10071058 | 3300006042 | Bacteria | 1406 |
| 178 | Ga0075363_100065058 | 3300006048 | Bacteria | 1971 |
| 179 | Ga0075363_100247733 | 3300006048 | Bacteria | 1025 |
| 180 | Ga0075363_100253033 | 3300006048 | Bacteria | 1015 |
| 181 | Ga0075363_100285613 | 3300006048 | Bacteria | 955 |
| 182 | Ga0075363_100768625 | 3300006048 | Bacteria | 584 |
| 183 | Ga0075364_10102130 | 3300006051 | Bacteria | 1909 |
| 184 | Ga0070715_10104876 | 3300006163 | Bacteria | 1324 |
| 185 | Ga0070715_10194769 | 3300006163 | Bacteria | 1026 |
| 186 | Ga0070715_10256318 | 3300006163 | Bacteria | 917 |
| 187 | Ga0070716_100094913 | 3300006173 | Bacteria | 1814 |
| 188 | Ga0070716_101320005 | 3300006173 | Bacteria | 584 |
| 189 | Ga0070712_100038086 | 3300006175 | Bacteria | 3283 |
| 190 | Ga0070712_100111114 | 3300006175 | Bacteria | 2045 |
| 191 | Ga0070712_100314022 | 3300006175 | Bacteria | 1272 |
| 192 | Ga0075367_10022547 | 3300006178 | Bacteria | 3533 |
| 193 | Ga0075367_10112753 | 3300006178 | Bacteria | 1670 |
| 194 | Ga0075367_10288413 | 3300006178 | Bacteria | 1032 |
| 195 | Ga0075366_10278186 | 3300006195 | Bacteria | 1023 |
| 196 | Ga0075366_10397943 | 3300006195 | Bacteria | 848 |
| 197 | Ga0097621_100139391 | 3300006237 | Bacteria | 2071 |
| 198 | Ga0097621_100212164 | 3300006237 | Bacteria | 1684 |
| 199 | Ga0097621_100927645 | 3300006237 | Bacteria | 812 |
| 200 | Ga0097621_101706938 | 3300006237 | Bacteria | 600 |
| 201 | Ga0075370_10024394 | 3300006353 | Bacteria | 3340 |
| 202 | Ga0075370_10093373 | 3300006353 | Bacteria | 1737 |
| 203 | Ga0075370_10178205 | 3300006353 | Bacteria | 1250 |
| 204 | Ga0068871_100126029 | 3300006358 | Bacteria | 2167 |
| 205 | Ga0068871_100899132 | 3300006358 | Bacteria | 820 |
| 206 | Ga0068871_101274140 | 3300006358 | Bacteria | 691 |
| 207 | Ga0075428_100135007 | 3300006844 | Bacteria | 2683 |
| 208 | Ga0075434_100287226 | 3300006871 | Bacteria | 1665 |
| 209 | Ga0068865_100289192 | 3300006881 | Bacteria | 1308 |
| 210 | Ga0068865_100708827 | 3300006881 | Bacteria | 861 |
| 211 | Ga0097620_100748205 | 3300006931 | Bacteria | 1066 |
| 212 | Ga0097620_101012391 | 3300006931 | Bacteria | 912 |
| 213 | Ga0097620_101200522 | 3300006931 | Bacteria | 835 |
| 214 | Ga0075435_100454561 | 3300007076 | Bacteria | 1105 |
| 215 | Ga0099794_10174147 | 3300007265 | Bacteria | 1097 |
| 216 | Ga0099794_10321430 | 3300007265 | Bacteria | 803 |
| 217 | Ga0099795_10066779 | 3300007788 | Bacteria | 1348 |
| 218 | Ga0105240_10551341 | 3300009093 | Bacteria | 1275 |
| 219 | Ga0105240_10749887 | 3300009093 | Bacteria | 1061 |
| 220 | Ga0105240_10822471 | 3300009093 | Bacteria | 1005 |
| 221 | Ga0105240_11711774 | 3300009093 | Bacteria | 656 |
| 222 | Ga0111539_10530373 | 3300009094 | Bacteria | 1372 |
| 223 | Ga0111539_10932697 | 3300009094 | Bacteria | 1010 |
| 224 | Ga0105245_10405664 | 3300009098 | Bacteria | 1363 |
| 225 | Ga0105245_10645803 | 3300009098 | Bacteria | 1088 |
| 226 | Ga0105247_10130453 | 3300009101 | Bacteria | 1638 |
| 227 | Ga0105243_10393668 | 3300009148 | Bacteria | 1285 |
| 228 | Ga0105243_10507900 | 3300009148 | Bacteria | 1144 |
| 229 | Ga0105241_10153603 | 3300009174 | Bacteria | 1885 |
| 230 | Ga0105241_10441133 | 3300009174 | Bacteria | 1150 |
| 231 | Ga0105241_10503326 | 3300009174 | Bacteria | 1080 |
| 232 | Ga0105241_10691131 | 3300009174 | Bacteria | 930 |
| 233 | Ga0105242_10771784 | 3300009176 | Bacteria | 948 |
| 234 | Ga0105242_10834310 | 3300009176 | Bacteria | 916 |
| 235 | Ga0105248_10410419 | 3300009177 | Bacteria | 1525 |
| 236 | Ga0105237_10186788 | 3300009545 | Bacteria | 2072 |
| 237 | Ga0105237_10391897 | 3300009545 | Bacteria | 1394 |
| 238 | Ga0105237_11256989 | 3300009545 | Bacteria | 747 |
| 239 | Ga0105237_11267388 | 3300009545 | Bacteria | 744 |
| 240 | Ga0105237_11307060 | 3300009545 | Bacteria | 732 |
| 241 | Ga0105237_11310150 | 3300009545 | Bacteria | 731 |
| 242 | Ga0105238_10122580 | 3300009551 | Bacteria | 2579 |
| 243 | Ga0105238_10153518 | 3300009551 | Bacteria | 2277 |
| 244 | Ga0105238_10589215 | 3300009551 | Bacteria | 1119 |
| 245 | Ga0105238_10815971 | 3300009551 | Bacteria | 949 |
| 246 | Ga0105238_10899903 | 3300009551 | Bacteria | 903 |
| 247 | Ga0105238_10916090 | 3300009551 | Bacteria | 895 |
| 248 | Ga0105238_11172820 | 3300009551 | Bacteria | 792 |
| 249 | Ga0105238_11355898 | 3300009551 | Bacteria | 738 |
| 250 | Ga0105238_11573732 | 3300009551 | Bacteria | 687 |
| 251 | Ga0105249_11152751 | 3300009553 | Bacteria | 846 |
| 252 | Ga0105249_11307958 | 3300009553 | Bacteria | 796 |
| 253 | Ga0099796_10081558 | 3300010159 | Bacteria | 1187 |
| 254 | Ga0099796_10235288 | 3300010159 | Bacteria | 755 |
| 255 | Ga0105239_10325851 | 3300010375 | Bacteria | 1733 |
| 256 | Ga0105239_10526109 | 3300010375 | Bacteria | 1346 |
| 257 | Ga0105239_11237394 | 3300010375 | Bacteria | 861 |
| 258 | Ga0105239_11992100 | 3300010375 | Bacteria | 674 |
| 259 | Ga0105246_10019273 | 3300011119 | Bacteria | 4357 |
| 260 | Ga0105246_10634819 | 3300011119 | Bacteria | 927 |
| 261 | Ga0105246_11279383 | 3300011119 | Bacteria | 679 |
| 262 | Ga0157373_10675974 | 3300013100 | Bacteria | 755 |
| 263 | Ga0157370_10137726 | 3300013104 | Bacteria | 2274 |
| 264 | Ga0157369_10021333 | 3300013105 | Bacteria | 7245 |
| 265 | Ga0157369_10401604 | 3300013105 | Bacteria | 1422 |
| 266 | Ga0157374_10054089 | 3300013296 | Bacteria | 3744 |
| 267 | Ga0157374_10353683 | 3300013296 | Bacteria | 1460 |
| 268 | Ga0157374_10498604 | 3300013296 | Bacteria | 1222 |
| 269 | Ga0157374_11026557 | 3300013296 | Bacteria | 844 |
| 270 | Ga0157378_11611005 | 3300013297 | Bacteria | 695 |
| 271 | Ga0163162_10045228 | 3300013306 | Bacteria | 4411 |
| 272 | Ga0163162_11000743 | 3300013306 | Bacteria | 945 |
| 273 | Ga0163162_11590985 | 3300013306 | Bacteria | 745 |
| 274 | Ga0163162_11937813 | 3300013306 | Bacteria | 675 |
| 275 | Ga0163162_12349777 | 3300013306 | Bacteria | 613 |
| 276 | Ga0163162_12826517 | 3300013306 | Bacteria | 559 |
| 277 | Ga0157372_10201797 | 3300013307 | Bacteria | 2304 |
| 278 | Ga0157372_10579615 | 3300013307 | Bacteria | 1308 |
| 279 | Ga0157372_10940107 | 3300013307 | Bacteria | 1002 |
| 280 | Ga0157375_10624930 | 3300013308 | Bacteria | 1235 |
| 281 | Ga0157375_10691138 | 3300013308 | Bacteria | 1174 |
| 282 | Ga0157375_10747294 | 3300013308 | Bacteria | 1130 |
| 283 | Ga0163163_10127555 | 3300014325 | Bacteria | 2583 |
| 284 | Ga0163163_10370574 | 3300014325 | Bacteria | 1489 |
| 285 | Ga0163163_11096593 | 3300014325 | Bacteria | 859 |
| 286 | Ga0163163_11391692 | 3300014325 | Bacteria | 763 |
| 287 | Ga0163163_12210602 | 3300014325 | Bacteria | 609 |
| 288 | Ga0157380_10341204 | 3300014326 | Bacteria | 1397 |
| 289 | Ga0157380_10599164 | 3300014326 | Bacteria | 1090 |
| 290 | Ga0157380_12204986 | 3300014326 | Bacteria | 615 |
| 291 | Ga0157379_10209640 | 3300014968 | Bacteria | 1764 |
| 292 | Ga0157379_10568872 | 3300014968 | Bacteria | 1056 |
| 293 | Ga0157376_10620496 | 3300014969 | Bacteria | 1078 |
| 294 | Ga0157376_10804516 | 3300014969 | Bacteria | 953 |
| 295 | Ga0157376_10912082 | 3300014969 | Bacteria | 897 |
| 296 | Ga0182007_10241593 | 3300015262 | Bacteria | 645 |
| 297 | Ga0163161_10486050 | 3300017792 | Bacteria | 1003 |
| 298 | Ga0163161_10584233 | 3300017792 | Bacteria | 919 |
| 299 | Ga0163161_11136485 | 3300017792 | Bacteria | 673 |
| 300 | Ga0206356_10348709 | 3300020070 | Bacteria | 608 |
| 301 | Ga0206354_10763753 | 3300020081 | Bacteria | 726 |
| 302 | Ga0213876_10169534 | 3300021384 | Bacteria | 1161 |
| 303 | Ga0213876_10325057 | 3300021384 | Bacteria | 818 |
| 304 | Ga0213876_10467307 | 3300021384 | Bacteria | 671 |
| 305 | Ga0213875_10150372 | 3300021388 | Bacteria | 1091 |
| 306 | Ga0224712_10096101 | 3300022467 | Bacteria | 1249 |
| 307 | Ga0209563_101315 | 3300025230 | Bacteria | 6776 |
| 308 | Ga0209677_100543 | 3300025253 | Bacteria | 21018 |
| 309 | Ga0209677_100722 | 3300025253 | Bacteria | 16832 |
| 310 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 311 | Ga0209233_1002578 | 3300025261 | Bacteria | 6591 |
| 312 | Ga0209233_1006623 | 3300025261 | Bacteria | 3719 |
| 313 | Ga0209455_1003238 | 3300025272 | Bacteria | 5870 |
| 314 | Ga0209455_1004716 | 3300025272 | Bacteria | 4383 |
| 315 | Ga0209455_1021696 | 3300025272 | Bacteria | 1240 |
| 316 | Ga0209758_1001900 | 3300025297 | Bacteria | 22801 |
| 317 | Ga0209758_1013412 | 3300025297 | Bacteria | 4470 |
| 318 | Ga0209256_1052131 | 3300025299 | Bacteria | 984 |
| 319 | Ga0207697_10022598 | 3300025315 | Bacteria | 2576 |
| 320 | Ga0207697_10044238 | 3300025315 | Bacteria | 1832 |
| 321 | Ga0207697_10227280 | 3300025315 | Bacteria | 824 |
| 322 | Ga0207697_10228741 | 3300025315 | Bacteria | 821 |
| 323 | Ga0207653_10076948 | 3300025885 | Bacteria | 1149 |
| 324 | Ga0207692_10042210 | 3300025898 | Bacteria | 2263 |
| 325 | Ga0207692_10152647 | 3300025898 | Bacteria | 1324 |
| 326 | Ga0207692_10250021 | 3300025898 | Bacteria | 1062 |
| 327 | Ga0207692_10263072 | 3300025898 | Bacteria | 1038 |
| 328 | Ga0207692_10340988 | 3300025898 | Bacteria | 922 |
| 329 | Ga0207692_10616693 | 3300025898 | Bacteria | 699 |
| 330 | Ga0207642_10097318 | 3300025899 | Bacteria | 1469 |
| 331 | Ga0207642_10859819 | 3300025899 | Bacteria | 579 |
| 332 | Ga0207710_10094956 | 3300025900 | Bacteria | 1400 |
| 333 | Ga0207688_10151712 | 3300025901 | Bacteria | 1369 |
| 334 | Ga0207680_10578662 | 3300025903 | Bacteria | 802 |
| 335 | Ga0207647_10113451 | 3300025904 | Bacteria | 1602 |
| 336 | Ga0207699_10011800 | 3300025906 | Bacteria | 4427 |
| 337 | Ga0207699_10267408 | 3300025906 | Bacteria | 1184 |
| 338 | Ga0207699_10504622 | 3300025906 | Bacteria | 873 |
| 339 | Ga0207699_10586267 | 3300025906 | Bacteria | 811 |
| 340 | Ga0207643_10135707 | 3300025908 | Bacteria | 1467 |
| 341 | Ga0207643_10252516 | 3300025908 | Bacteria | 1087 |
| 342 | Ga0207684_10366162 | 3300025910 | Bacteria | 1240 |
| 343 | Ga0207654_10096920 | 3300025911 | Bacteria | 1810 |
| 344 | Ga0207654_10160018 | 3300025911 | Bacteria | 1454 |
| 345 | Ga0207654_10224647 | 3300025911 | Bacteria | 1247 |
| 346 | Ga0207707_10008183 | 3300025912 | Bacteria | 9074 |
| 347 | Ga0207707_10369948 | 3300025912 | Bacteria | 1233 |
| 348 | Ga0207707_10477221 | 3300025912 | Bacteria | 1065 |
| 349 | Ga0207707_10669777 | 3300025912 | Bacteria | 873 |
| 350 | Ga0207695_10071334 | 3300025913 | Bacteria | 3548 |
| 351 | Ga0207671_10508006 | 3300025914 | Bacteria | 961 |
| 352 | Ga0207671_10595909 | 3300025914 | Bacteria | 881 |
| 353 | Ga0207693_10045163 | 3300025915 | Bacteria | 3461 |
| 354 | Ga0207693_10055491 | 3300025915 | Bacteria | 3108 |
| 355 | Ga0207693_10263120 | 3300025915 | Bacteria | 1352 |
| 356 | Ga0207663_10002736 | 3300025916 | Bacteria | 8503 |
| 357 | Ga0207663_10409162 | 3300025916 | Bacteria | 1039 |
| 358 | Ga0207662_10335633 | 3300025918 | Bacteria | 1012 |
| 359 | Ga0207657_10173641 | 3300025919 | Bacteria | 1745 |
| 360 | Ga0207657_10907579 | 3300025919 | Bacteria | 679 |
| 361 | Ga0207649_10201576 | 3300025920 | Bacteria | 1406 |
| 362 | Ga0207649_10355147 | 3300025920 | Bacteria | 1086 |
| 363 | Ga0207649_10503760 | 3300025920 | Bacteria | 921 |
| 364 | Ga0207652_10129770 | 3300025921 | Bacteria | 2247 |
| 365 | Ga0207652_10164815 | 3300025921 | Bacteria | 1987 |
| 366 | Ga0207652_10305259 | 3300025921 | Bacteria | 1436 |
| 367 | Ga0207652_10351820 | 3300025921 | Bacteria | 1330 |
| 368 | Ga0207652_10610512 | 3300025921 | Bacteria | 978 |
| 369 | Ga0207652_11500576 | 3300025921 | Bacteria | 578 |
| 370 | Ga0207646_10369425 | 3300025922 | Bacteria | 1296 |
| 371 | Ga0207694_10206275 | 3300025924 | Bacteria | 1600 |
| 372 | Ga0207694_10266828 | 3300025924 | Bacteria | 1403 |
| 373 | Ga0207694_11040842 | 3300025924 | Bacteria | 693 |
| 374 | Ga0207694_11235147 | 3300025924 | Bacteria | 632 |
| 375 | Ga0207650_10625123 | 3300025925 | Bacteria | 907 |
| 376 | Ga0207687_10305000 | 3300025927 | Bacteria | 1284 |
| 377 | Ga0207687_10593584 | 3300025927 | Bacteria | 933 |
| 378 | Ga0207700_10010462 | 3300025928 | Bacteria | 5857 |
| 379 | Ga0207700_10012790 | 3300025928 | Bacteria | 5427 |
| 380 | Ga0207700_10029757 | 3300025928 | Bacteria | 3858 |
| 381 | Ga0207700_10378915 | 3300025928 | Bacteria | 1237 |
| 382 | Ga0207700_10400753 | 3300025928 | Bacteria | 1202 |
| 383 | Ga0207700_10684841 | 3300025928 | Bacteria | 915 |
| 384 | Ga0207700_11148398 | 3300025928 | Bacteria | 694 |
| 385 | Ga0207664_10254380 | 3300025929 | Bacteria | 1534 |
| 386 | Ga0207664_10340402 | 3300025929 | Bacteria | 1326 |
| 387 | Ga0207644_10179336 | 3300025931 | Bacteria | 1659 |
| 388 | Ga0207644_10626714 | 3300025931 | Bacteria | 894 |
| 389 | Ga0207706_10130949 | 3300025933 | Bacteria | 2206 |
| 390 | Ga0207706_10326055 | 3300025933 | Bacteria | 1336 |
| 391 | Ga0207709_10465780 | 3300025935 | Bacteria | 980 |
| 392 | Ga0207709_11359072 | 3300025935 | Bacteria | 588 |
| 393 | Ga0207670_10360927 | 3300025936 | Bacteria | 1153 |
| 394 | Ga0207669_10207027 | 3300025937 | Bacteria | 1429 |
| 395 | Ga0207669_11403328 | 3300025937 | Bacteria | 595 |
| 396 | Ga0207704_10166691 | 3300025938 | Bacteria | 1574 |
| 397 | Ga0207704_10708908 | 3300025938 | Bacteria | 834 |
| 398 | Ga0207691_10508924 | 3300025940 | Bacteria | 1022 |
| 399 | Ga0207691_10844799 | 3300025940 | Bacteria | 768 |
| 400 | Ga0207711_10140227 | 3300025941 | Bacteria | 2174 |
| 401 | Ga0207711_10300286 | 3300025941 | Bacteria | 1481 |
| 402 | Ga0207689_10975978 | 3300025942 | Bacteria | 715 |
| 403 | Ga0207661_10000878 | 3300025944 | Bacteria | 19794 |
| 404 | Ga0207661_10062380 | 3300025944 | Bacteria | 3015 |
| 405 | Ga0207661_10850753 | 3300025944 | Bacteria | 840 |
| 406 | Ga0207661_11273548 | 3300025944 | Bacteria | 676 |
| 407 | Ga0207679_10356886 | 3300025945 | Bacteria | 1276 |
| 408 | Ga0207667_10105980 | 3300025949 | Bacteria | 2900 |
| 409 | Ga0207667_10144958 | 3300025949 | Bacteria | 2445 |
| 410 | Ga0207667_10148791 | 3300025949 | Bacteria | 2410 |
| 411 | Ga0207667_11145110 | 3300025949 | Bacteria | 759 |
| 412 | Ga0207712_10857651 | 3300025961 | Bacteria | 801 |
| 413 | Ga0207712_11397532 | 3300025961 | Bacteria | 626 |
| 414 | Ga0207668_11320483 | 3300025972 | Bacteria | 649 |
| 415 | Ga0207640_10083438 | 3300025981 | Bacteria | 2191 |
| 416 | Ga0207640_10229671 | 3300025981 | Bacteria | 1427 |
| 417 | Ga0207640_10356669 | 3300025981 | Bacteria | 1177 |
| 418 | Ga0207658_10602505 | 3300025986 | Bacteria | 987 |
| 419 | Ga0207658_11332541 | 3300025986 | Bacteria | 656 |
| 420 | Ga0207677_10091376 | 3300026023 | Bacteria | 2214 |
| 421 | Ga0207677_10443850 | 3300026023 | Bacteria | 1110 |
| 422 | Ga0207703_10065112 | 3300026035 | Bacteria | 2994 |
| 423 | Ga0207703_11145258 | 3300026035 | Bacteria | 747 |
| 424 | Ga0207703_11241870 | 3300026035 | Bacteria | 716 |
| 425 | Ga0207639_10240699 | 3300026041 | Bacteria | 1573 |
| 426 | Ga0207639_10268042 | 3300026041 | Bacteria | 1497 |
| 427 | Ga0207639_10292211 | 3300026041 | Bacteria | 1437 |
| 428 | Ga0207678_10246188 | 3300026067 | Bacteria | 1531 |
| 429 | Ga0207678_10561648 | 3300026067 | Bacteria | 999 |
| 430 | Ga0207678_10786279 | 3300026067 | Bacteria | 840 |
| 431 | Ga0207678_11095558 | 3300026067 | Bacteria | 705 |
| 432 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 433 | Ga0207702_10312632 | 3300026078 | Bacteria | 1494 |
| 434 | Ga0207702_10372300 | 3300026078 | Bacteria | 1372 |
| 435 | Ga0207702_11139192 | 3300026078 | Bacteria | 774 |
| 436 | Ga0207641_10357451 | 3300026088 | Bacteria | 1393 |
| 437 | Ga0207641_10474896 | 3300026088 | Bacteria | 1211 |
| 438 | Ga0207641_10517494 | 3300026088 | Bacteria | 1160 |
| 439 | Ga0207641_12096007 | 3300026088 | Bacteria | 566 |
| 440 | Ga0207648_10402717 | 3300026089 | Bacteria | 1240 |
| 441 | Ga0207648_10499119 | 3300026089 | Bacteria | 1113 |
| 442 | Ga0207648_10534857 | 3300026089 | Bacteria | 1075 |
| 443 | Ga0207648_10706097 | 3300026089 | Bacteria | 935 |
| 444 | Ga0207676_10199904 | 3300026095 | Bacteria | 1765 |
| 445 | Ga0207674_10073988 | 3300026116 | Bacteria | 3420 |
| 446 | Ga0207674_10666112 | 3300026116 | Bacteria | 1005 |
| 447 | Ga0207674_10670582 | 3300026116 | Bacteria | 1001 |
| 448 | Ga0207675_100609178 | 3300026118 | Bacteria | 1096 |
| 449 | Ga0207675_101074709 | 3300026118 | Bacteria | 824 |
| 450 | Ga0207683_10083899 | 3300026121 | Bacteria | 2832 |
| 451 | Ga0207683_10153979 | 3300026121 | Bacteria | 2076 |
| 452 | Ga0207683_10461287 | 3300026121 | Bacteria | 1172 |
| 453 | Ga0207683_10478614 | 3300026121 | Bacteria | 1149 |
| 454 | Ga0207683_10984709 | 3300026121 | Bacteria | 783 |
| 455 | Ga0207683_11224932 | 3300026121 | Bacteria | 695 |
| 456 | Ga0207683_11652559 | 3300026121 | Bacteria | 590 |
| 457 | Ga0207683_11813868 | 3300026121 | Bacteria | 559 |
| 458 | Ga0207698_10403643 | 3300026142 | Bacteria | 1307 |
| 459 | Ga0207698_10715809 | 3300026142 | Bacteria | 997 |
| 460 | Ga0209588_1060561 | 3300027671 | Bacteria | 1224 |
| 461 | Ga0209813_10024630 | 3300027866 | Bacteria | 1723 |
| 462 | Ga0268266_10066637 | 3300028379 | Bacteria | 3114 |
| 463 | Ga0268266_10129302 | 3300028379 | Bacteria | 2257 |
| 464 | Ga0268266_10341670 | 3300028379 | Bacteria | 1405 |
| 465 | Ga0268266_10378883 | 3300028379 | Bacteria | 1334 |
| 466 | Ga0268266_10757186 | 3300028379 | Bacteria | 937 |
| 467 | Ga0268266_11222413 | 3300028379 | Bacteria | 726 |
| 468 | Ga0268266_11364934 | 3300028379 | Bacteria | 684 |
| 469 | Ga0268266_12068669 | 3300028379 | Bacteria | 542 |
| 470 | Ga0268265_10289989 | 3300028380 | Bacteria | 1468 |
| 471 | Ga0268265_10506484 | 3300028380 | Bacteria | 1138 |
| 472 | Ga0268264_10297652 | 3300028381 | Bacteria | 1518 |
| 473 | Ga0268264_11273547 | 3300028381 | Bacteria | 745 |
| 474 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 475 | Ga0307517_10469903 | 3300028786 | Bacteria | 647 |
| 476 | Ga0307515_10087102 | 3300028794 | Bacteria | 3970 |
| 477 | Ga0265332_10035231 | 3300031238 | Bacteria | 2174 |
| 478 | Ga0265340_10091462 | 3300031247 | Bacteria | 1421 |
| 479 | Ga0265340_10217072 | 3300031247 | Bacteria | 857 |
| 480 | Ga0265339_10073499 | 3300031249 | Bacteria | 1818 |
| 481 | Ga0265331_10089610 | 3300031250 | Bacteria | 1423 |
| 482 | Ga0265316_10196584 | 3300031344 | Bacteria | 1496 |
| 483 | Ga0265316_10588938 | 3300031344 | Bacteria | 789 |
| 484 | Ga0307513_10191401 | 3300031456 | Bacteria | 1897 |
| 485 | Ga0307513_10240504 | 3300031456 | Bacteria | 1615 |
| 486 | Ga0307509_10331144 | 3300031507 | Bacteria | 1254 |
| 487 | Ga0265313_10342930 | 3300031595 | Bacteria | 593 |
| 488 | Ga0307508_10126440 | 3300031616 | Bacteria | 2159 |
| 489 | Ga0307508_10328232 | 3300031616 | Bacteria | 1122 |
| 490 | Ga0307508_10665446 | 3300031616 | Bacteria | 648 |
| 491 | Ga0265314_10005054 | 3300031711 | Bacteria | 12021 |
| 492 | Ga0265314_10220531 | 3300031711 | Bacteria | 1107 |
| 493 | Ga0307516_10114956 | 3300031730 | Bacteria | 2488 |
| 494 | Ga0307516_10178300 | 3300031730 | Bacteria | 1860 |
| 495 | Ga0307516_10279702 | 3300031730 | Bacteria | 1351 |
| 496 | Ga0307405_10263134 | 3300031731 | Bacteria | 1289 |
| 497 | Ga0307413_10594532 | 3300031824 | Bacteria | 904 |
| 498 | Ga0307406_10237733 | 3300031901 | Bacteria | 1364 |
| 499 | Ga0307407_10538655 | 3300031903 | Bacteria | 861 |
| 500 | Ga0307412_10530413 | 3300031911 | Bacteria | 985 |
| 501 | Ga0307416_100460323 | 3300032002 | Bacteria | 1327 |
| 502 | Ga0307416_101970837 | 3300032002 | Bacteria | 687 |
| 503 | Ga0307416_101979258 | 3300032002 | Bacteria | 685 |
| 504 | Ga0307414_10974180 | 3300032004 | Bacteria | 780 |
| 505 | Ga0307415_100314346 | 3300032126 | Bacteria | 1303 |
| 506 | Ga0307415_100662739 | 3300032126 | Bacteria | 937 |
| 507 | Ga0307510_10072618 | 3300033180 | Bacteria | 3417 |
| 508 | Ga0307510_10089264 | 3300033180 | Bacteria | 2936 |
| 509 | Ga0307510_10121016 | 3300033180 | Bacteria | 2322 |
| 510 | Ga0307510_10301776 | 3300033180 | Bacteria | 1063 |
| 511 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 512 | Ga0373958_0165769 | 3300034819 | Bacteria | 561 |
| 513 | Ga0373958_0166297 | 3300034819 | Bacteria | 561 |
| 514 | Ga0373926_0033050 | 3300035083 | Bacteria | 1827 |
| 515 | Ga0373934_0023493 | 3300035086 | Bacteria | 2382 |
| 516 | Ga0373934_0096153 | 3300035086 | Bacteria | 1196 |
| 517 | Ga0373949_0072389 | 3300035090 | Bacteria | 905 |
| 518 | Ga0373951_0095136 | 3300035091 | Bacteria | 786 |
| 519 | Ga0373952_0253775 | 3300035092 | Bacteria | 533 |
| 520 | Ga0373923_0004936 | 3300035111 | Bacteria | 4481 |
| 521 | Ga0373923_0039874 | 3300035111 | Bacteria | 1930 |
| 522 | Ga0373923_0042855 | 3300035111 | Bacteria | 1871 |
| 523 | Ga0373936_0070753 | 3300035113 | Bacteria | 1437 |
| 524 | Ga0373939_0109740 | 3300035114 | Bacteria | 959 |
| 525 | Ga0373945_0015296 | 3300035116 | Bacteria | 2579 |
| 526 | Ga0373945_0100694 | 3300035116 | Bacteria | 1130 |
| 527 | Ga0373953_0078384 | 3300035117 | Bacteria | 1370 |
| 528 | Ga0373953_0247502 | 3300035117 | Bacteria | 774 |
| 529 | Ga0373954_0011463 | 3300035118 | Bacteria | 3929 |
| 530 | Ga0373954_0174243 | 3300035118 | Bacteria | 1054 |
| 531 | Ga0373956_0082067 | 3300035119 | Bacteria | 1480 |
| 532 | Ga0373956_0155201 | 3300035119 | Bacteria | 1077 |
| 533 | Ga0373956_0451395 | 3300035119 | Bacteria | 613 |
| 534 | Ga0373957_0120048 | 3300035120 | Bacteria | 1063 |
| 535 | Ga0373943_0141500 | 3300035170 | Bacteria | 1296 |
| 536 | Ga0373943_0463427 | 3300035170 | Bacteria | 737 |
| 537 | Ga0373946_0014322 | 3300035171 | Bacteria | 2989 |
| 538 | Ga0373946_0214788 | 3300035171 | Bacteria | 927 |
| 539 | Ga0373946_0482002 | 3300035171 | Bacteria | 634 |
| 540 | Ga0373955_0004380 | 3300035172 | Bacteria | 6246 |
| 541 | Ga0373955_0051079 | 3300035172 | Bacteria | 2251 |
| 542 | Ga0373961_0031149 | 3300035241 | Bacteria | 1488 |
| 543 | Ga0373961_0070941 | 3300035241 | Bacteria | 1077 |
| 544 | Ga0373924_0033451 | 3300035410 | Bacteria | 2075 |
| 545 | Ga0373924_0093920 | 3300035410 | Bacteria | 1285 |
| 546 | Ga0373931_0015641 | 3300035691 | Bacteria | 3723 |
| 547 | Ga0373935_0001267 | 3300035692 | Bacteria | 13929 |
| 548 | Ga0373935_0039786 | 3300035692 | Bacteria | 2948 |
| 549 | Ga0373927_0000766 | 3300035695 | Bacteria | 24573 |
| 550 | Ga0373927_0006724 | 3300035695 | Bacteria | 7827 |
| 551 | Ga0373927_0200773 | 3300035695 | Bacteria | 1309 |
| 552 | Ga0373927_0288502 | 3300035695 | Bacteria | 1080 |
| 553 | Ga0373927_0328502 | 3300035695 | Bacteria | 1007 |
| 554 | Ga0373927_0349402 | 3300035695 | Bacteria | 974 |
| 555 | Ga0373927_1123709 | 3300035695 | Bacteria | 518 |
| 556 | Ga0373933_0000218 | 3300035724 | Bacteria | 37928 |
| 557 | Ga0373933_0231444 | 3300035724 | Bacteria | 1187 |
| 558 | Ga0373933_0356576 | 3300035724 | Bacteria | 950 |
| 559 | Ga0373947_0000310 | 3300035725 | Bacteria | 27577 |
| 560 | Ga0373947_0013664 | 3300035725 | Bacteria | 4651 |
| 561 | Ga0373947_0374672 | 3300035725 | Bacteria | 957 |
| 562 | Ga0373937_0014630 | 3300036401 | Bacteria | 6929 |
| 563 | Ga0373925_0006419 | 3300037068 | Bacteria | 8654 |
| 564 | Ga0373925_0021485 | 3300037068 | Bacteria | 4702 |
| 565 | Ga0373925_0078313 | 3300037068 | Bacteria | 2510 |
| 566 | Ga0373925_0589307 | 3300037068 | Bacteria | 915 |
| 567 | Ga0373925_0654343 | 3300037068 | Bacteria | 866 |
| 568 | Ga0395900_0032832 | 3300037418 | Bacteria | 5339 |
| 569 | Ga0395900_0108628 | 3300037418 | Bacteria | 2850 |
| 570 | Ga0395900_0199177 | 3300037418 | Bacteria | 2027 |
| 571 | Ga0395900_1525769 | 3300037418 | Bacteria | 580 |
| 572 | Ga0395898_0089031 | 3300037466 | Bacteria | 2971 |
| 573 | Ga0395898_0631023 | 3300037466 | Bacteria | 1014 |
| 574 | Ga0395905_0048135 | 3300037471 | Bacteria | 3996 |
| 575 | Ga0436364_0331795 | 3300037853 | Bacteria | 1630 |
| 576 | Ga0436364_0603569 | 3300037853 | Bacteria | 1111 |
| 577 | Ga0395901_0113781 | 3300038443 | Bacteria | 2842 |
| 578 | Ga0395901_0297332 | 3300038443 | Bacteria | 1674 |
| 579 | Ga0436365_0118730 | 3300039437 | Bacteria | 842 |
| 580 | Ga0436365_0135384 | 3300039437 | Bacteria | 2104 |
| 581 | Ga0436365_0209743 | 3300039437 | Bacteria | 2892 |
| 582 | Ga0436365_0279102 | 3300039437 | Bacteria | 2928 |
| 583 | Ga0436365_0346369 | 3300039437 | Bacteria | 1174 |
| 584 | Ga0436365_1026627 | 3300039437 | Bacteria | 1239 |
| 585 | Ga0436362_0249161 | 3300039453 | Bacteria | 713 |
| 586 | Ga0436362_1201460 | 3300039453 | Bacteria | 556 |
| 587 | Ga0451789_1333214 | 3300041443 | Bacteria | 540 |
| 588 | Ga0451793_1038465 | 3300041452 | Bacteria | 1074 |
| 589 | Ga0451802_1431654 | 3300041460 | Bacteria | 677 |
| 590 | Ga0451807_0826454 | 3300041486 | Bacteria | 519 |
| 591 | Ga0451855_0143711 | 3300041511 | Bacteria | 572 |
| 592 | Ga0466969_0093259 | 3300044656 | Bacteria | 1425 |
| 593 | Ga0466972_0029548 | 3300044658 | Bacteria | 2698 |
| 594 | Ga0466966_0343263 | 3300044684 | Bacteria | 897 |
| 595 | Ga0466961_0156035 | 3300044693 | Bacteria | 1424 |
| 596 | Ga0466963_0258548 | 3300044694 | Bacteria | 1222 |
| 597 | Ga0466963_0996490 | 3300044694 | Bacteria | 590 |
| 598 | Ga0466971_0156462 | 3300044719 | Bacteria | 1065 |
| 599 | Ga0466968_0379186 | 3300044735 | Bacteria | 690 |
| 600 | Ga0466970_0260390 | 3300044765 | Bacteria | 973 |
| 601 | Ga0466957_0080078 | 3300044842 | Bacteria | 2033 |
| 602 | Ga0466957_0237937 | 3300044842 | Bacteria | 1207 |
| 603 | Ga0466957_0297429 | 3300044842 | Bacteria | 1084 |
| 604 | Ga0466957_0427749 | 3300044842 | Bacteria | 909 |
| 605 | Ga0466960_0181359 | 3300044901 | Bacteria | 1141 |
| 606 | Ga0466959_0048894 | 3300045049 | Bacteria | 3107 |
| 607 | Ga0466967_0028253 | 3300045976 | Bacteria | 4680 |
| 608 | Ga0466967_0062009 | 3300045976 | Bacteria | 3318 |
| 609 | Ga0466967_0204967 | 3300045976 | Bacteria | 1869 |
| 610 | Ga0466967_1213654 | 3300045976 | Bacteria | 751 |
| 611 | Ga0495617_107272 | 3300046452 | Bacteria | 905 |
| 612 | Ga0495592_0102991 | 3300046454 | Bacteria | 2032 |
| 613 | Ga0495592_0142617 | 3300046454 | Bacteria | 1664 |
| 614 | Ga0495603_0000936 | 3300046455 | Bacteria | 16788 |
| 615 | Ga0495603_0021318 | 3300046455 | Bacteria | 3924 |
| 616 | Ga0495603_0105542 | 3300046455 | Bacteria | 1644 |
| 617 | Ga0495603_0237833 | 3300046455 | Bacteria | 1049 |
| 618 | Ga0495603_0392356 | 3300046455 | Bacteria | 796 |
| 619 | Ga0495629_0001416 | 3300046459 | Bacteria | 18913 |
| 620 | Ga0495629_0123416 | 3300046459 | Bacteria | 1804 |
| 621 | Ga0495629_0484623 | 3300046459 | Bacteria | 835 |
| 622 | Ga0495629_0633985 | 3300046459 | Bacteria | 713 |
| 623 | Ga0495638_0139687 | 3300046460 | Bacteria | 1415 |
| 624 | Ga0495638_0317616 | 3300046460 | Bacteria | 833 |
| 625 | Ga0495641_0016464 | 3300046461 | Bacteria | 3896 |
| 626 | Ga0495641_0138934 | 3300046461 | Bacteria | 1085 |
| 627 | Ga0495651_0019880 | 3300046462 | Bacteria | 5207 |
| 628 | Ga0495651_0178579 | 3300046462 | Bacteria | 1505 |
| 629 | Ga0495653_0049261 | 3300046463 | Bacteria | 3246 |
| 630 | Ga0495653_0117625 | 3300046463 | Bacteria | 1899 |
| 631 | Ga0495650_0125333 | 3300046471 | Bacteria | 942 |
| 632 | Ga0495580_0005025 | 3300046472 | Bacteria | 11027 |
| 633 | Ga0495580_0006058 | 3300046472 | Bacteria | 9898 |
| 634 | Ga0495580_0514895 | 3300046472 | Bacteria | 798 |
| 635 | Ga0495582_0018773 | 3300046473 | Bacteria | 3780 |
| 636 | Ga0495582_0038113 | 3300046473 | Bacteria | 2644 |
| 637 | Ga0495582_0082250 | 3300046473 | Bacteria | 1789 |
| 638 | Ga0495582_0124167 | 3300046473 | Bacteria | 1456 |
| 639 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 640 | Ga0495662_0000572 | 3300046476 | Bacteria | 16948 |
| 641 | Ga0495662_0185583 | 3300046476 | Bacteria | 1025 |
| 642 | Ga0495662_0217863 | 3300046476 | Bacteria | 941 |
| 643 | Ga0495664_0014835 | 3300046477 | Bacteria | 4423 |
| 644 | Ga0495664_0045196 | 3300046477 | Bacteria | 2611 |
| 645 | Ga0495585_0586092 | 3300046492 | Bacteria | 525 |
| 646 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 647 | Ga0495594_0297721 | 3300046499 | Bacteria | 919 |
| 648 | Ga0495596_0130534 | 3300046500 | Bacteria | 975 |
| 649 | Ga0495596_0177088 | 3300046500 | Bacteria | 829 |
| 650 | Ga0495596_0195003 | 3300046500 | Bacteria | 787 |
| 651 | Ga0495606_0168025 | 3300046507 | Bacteria | 1275 |
| 652 | Ga0495608_0323669 | 3300046511 | Bacteria | 952 |
| 653 | Ga0495608_0637386 | 3300046511 | Bacteria | 638 |
| 654 | Ga0495610_0029757 | 3300046512 | Bacteria | 2871 |
| 655 | Ga0495618_0100704 | 3300046514 | Bacteria | 1849 |
| 656 | Ga0495618_0186351 | 3300046514 | Bacteria | 1317 |
| 657 | Ga0495620_0229342 | 3300046515 | Bacteria | 710 |
| 658 | Ga0495628_0018626 | 3300046516 | Bacteria | 5747 |
| 659 | Ga0495628_0033483 | 3300046516 | Bacteria | 4141 |
| 660 | Ga0495628_0327775 | 3300046516 | Bacteria | 1129 |
| 661 | Ga0495628_0517885 | 3300046516 | Bacteria | 859 |
| 662 | Ga0495630_0024634 | 3300046517 | Bacteria | 4447 |
| 663 | Ga0495630_0093534 | 3300046517 | Bacteria | 2272 |
| 664 | Ga0495630_0154765 | 3300046517 | Bacteria | 1745 |
| 665 | Ga0495630_0513814 | 3300046517 | Bacteria | 918 |
| 666 | Ga0495631_0217855 | 3300046518 | Bacteria | 815 |
| 667 | Ga0495631_0334536 | 3300046518 | Bacteria | 644 |
| 668 | Ga0495632_0063839 | 3300046519 | Bacteria | 1782 |
| 669 | Ga0495637_0100090 | 3300046520 | Bacteria | 1134 |
| 670 | Ga0495644_0153157 | 3300046523 | Bacteria | 883 |
| 671 | Ga0495644_0243040 | 3300046523 | Bacteria | 698 |
| 672 | Ga0495644_0281117 | 3300046523 | Bacteria | 649 |
| 673 | Ga0495644_0359059 | 3300046523 | Bacteria | 574 |
| 674 | Ga0495648_0249358 | 3300046524 | Bacteria | 858 |
| 675 | Ga0495648_0373903 | 3300046524 | Bacteria | 644 |
| 676 | Ga0495663_0177723 | 3300046525 | Bacteria | 736 |
| 677 | Ga0495666_0041837 | 3300046526 | Bacteria | 2217 |
| 678 | Ga0495666_0167306 | 3300046526 | Bacteria | 1018 |
| 679 | Ga0495642_0191454 | 3300046528 | Bacteria | 891 |
| 680 | Ga0495642_0198449 | 3300046528 | Bacteria | 875 |
| 681 | Ga0495665_0000335 | 3300046531 | Bacteria | 23811 |
| 682 | Ga0495640_0002138 | 3300046533 | Bacteria | 15789 |
| 683 | Ga0495640_0051516 | 3300046533 | Bacteria | 2830 |
| 684 | Ga0495640_0361314 | 3300046533 | Bacteria | 895 |
| 685 | Ga0495586_0059346 | 3300046535 | Bacteria | 2079 |
| 686 | Ga0495587_0345412 | 3300046536 | Bacteria | 830 |
| 687 | Ga0495609_0119716 | 3300046538 | Bacteria | 1133 |
| 688 | Ga0495609_0131591 | 3300046538 | Bacteria | 1071 |
| 689 | Ga0495645_0013978 | 3300046543 | Bacteria | 5689 |
| 690 | Ga0495645_0036237 | 3300046543 | Bacteria | 3596 |
| 691 | Ga0495622_0084671 | 3300046557 | Bacteria | 1458 |
| 692 | Ga0495622_0249119 | 3300046557 | Bacteria | 782 |
| 693 | Ga0495633_0312506 | 3300046558 | Bacteria | 713 |
| 694 | Ga0495667_0032717 | 3300046559 | Bacteria | 3482 |
| 695 | Ga0495667_0803522 | 3300046559 | Bacteria | 580 |
| 696 | Ga0495668_0168169 | 3300046616 | Bacteria | 1201 |
| 697 | Ga0495668_0481719 | 3300046616 | Bacteria | 683 |
| 698 | Ga0495668_0732608 | 3300046616 | Bacteria | 547 |
| 699 | Ga0495634_0003037 | 3300046642 | Bacteria | 13668 |
| 700 | Ga0495634_0044482 | 3300046642 | Bacteria | 3005 |
| 701 | Ga0495611_0066313 | 3300046648 | Bacteria | 1646 |
| 702 | Ga0495611_0300332 | 3300046648 | Bacteria | 740 |
| 703 | Ga0495625_0251011 | 3300046660 | Bacteria | 1148 |
| 704 | Ga0495635_0002038 | 3300046663 | Bacteria | 13679 |
| 705 | Ga0495635_0016231 | 3300046663 | Bacteria | 5198 |
| 706 | Ga0495635_0089467 | 3300046663 | Bacteria | 2106 |
| 707 | Ga0495635_0255921 | 3300046663 | Bacteria | 1180 |
| 708 | Ga0495588_0416881 | 3300046674 | Bacteria | 705 |
| 709 | Ga0495657_0121602 | 3300046675 | Bacteria | 1644 |
| 710 | Ga0495599_0128792 | 3300046678 | Bacteria | 1572 |
| 711 | Ga0495599_0191494 | 3300046678 | Bacteria | 1258 |
| 712 | Ga0495599_0306147 | 3300046678 | Bacteria | 958 |
| 713 | Ga0495599_0644747 | 3300046678 | Bacteria | 614 |
| 714 | Ga0495623_0075175 | 3300046679 | Bacteria | 2098 |
| 715 | Ga0495646_0066903 | 3300046680 | Bacteria | 2125 |
| 716 | Ga0495646_0081016 | 3300046680 | Bacteria | 1892 |
| 717 | Ga0495646_0119658 | 3300046680 | Bacteria | 1491 |
| 718 | Ga0495646_0481522 | 3300046680 | Bacteria | 638 |
| 719 | Ga0495647_0008783 | 3300046681 | Bacteria | 3403 |
| 720 | Ga0495647_0016367 | 3300046681 | Bacteria | 2610 |
| 721 | Ga0495658_0002742 | 3300046683 | Bacteria | 8859 |
| 722 | Ga0495658_0009522 | 3300046683 | Bacteria | 4844 |
| 723 | Ga0495658_0247379 | 3300046683 | Bacteria | 1121 |
| 724 | Ga0495669_0124118 | 3300046684 | Bacteria | 1212 |
| 725 | Ga0495669_0198256 | 3300046684 | Bacteria | 959 |
| 726 | Ga0495669_0310627 | 3300046684 | Bacteria | 760 |
| 727 | Ga0495613_0081505 | 3300046689 | Bacteria | 2351 |
| 728 | Ga0495613_0148666 | 3300046689 | Bacteria | 1672 |
| 729 | Ga0495624_0000795 | 3300046690 | Bacteria | 24919 |
| 730 | Ga0495624_0056079 | 3300046690 | Bacteria | 2480 |
| 731 | Ga0495670_0469767 | 3300046691 | Bacteria | 682 |
| 732 | Ga0495671_0091675 | 3300046692 | Bacteria | 1487 |
| 733 | Ga0495671_0437409 | 3300046692 | Bacteria | 625 |
| 734 | Ga0495649_0299125 | 3300046694 | Bacteria | 819 |
| 735 | Ga0495649_0408599 | 3300046694 | Bacteria | 681 |
| 736 | Ga0495589_0135740 | 3300046794 | Bacteria | 1180 |
| 737 | Ga0495600_0093192 | 3300046809 | Bacteria | 1964 |
| 738 | Ga0495600_0115281 | 3300046809 | Bacteria | 1749 |
| 739 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 740 | Ga0495581_0126320 | 3300047315 | Bacteria | 1489 |
| 741 | Ga0495581_0144120 | 3300047315 | Bacteria | 1390 |
| 742 | Ga0495581_0352195 | 3300047315 | Bacteria | 859 |
| 743 | Ga0495604_0105989 | 3300047317 | Bacteria | 2057 |
| 744 | Ga0495604_0730681 | 3300047317 | Bacteria | 627 |
| 745 | Ga0495674_0012381 | 3300047319 | Bacteria | 8036 |
| 746 | Ga0495674_0026440 | 3300047319 | Bacteria | 5309 |
| 747 | Ga0495674_0170500 | 3300047319 | Bacteria | 1816 |
| 748 | Ga0495674_0433544 | 3300047319 | Bacteria | 1058 |
| 749 | Ga0495674_1157765 | 3300047319 | Bacteria | 586 |
| 750 | Ga0495672_0019292 | 3300047320 | Bacteria | 4502 |
| 751 | Ga0495676_0028804 | 3300047321 | Bacteria | 4738 |
| 752 | Ga0495676_0426845 | 3300047321 | Bacteria | 877 |
| 753 | Ga0495680_0139443 | 3300047322 | Bacteria | 1775 |
| 754 | Ga0495680_0289892 | 3300047322 | Bacteria | 1151 |
| 755 | Ga0495683_0383974 | 3300047323 | Bacteria | 587 |
| 756 | Ga0495675_0384899 | 3300047444 | Bacteria | 820 |
| 757 | Ga0495684_0021000 | 3300047471 | Bacteria | 5029 |
| 758 | Ga0495684_0053297 | 3300047471 | Bacteria | 3086 |
| 759 | Ga0495686_0085355 | 3300047472 | Bacteria | 1923 |
| 760 | Ga0495686_0171913 | 3300047472 | Bacteria | 1260 |
| 761 | Ga0495593_0000398 | 3300047673 | Bacteria | 24218 |
| 762 | Ga0495593_0181923 | 3300047673 | Bacteria | 1058 |
| 763 | Ga0495614_0046075 | 3300048089 | Bacteria | 1870 |
| 764 | Ga0496100_0073875 | 3300048903 | Bacteria | 2283 |
| 765 | Ga0496100_0369385 | 3300048903 | Bacteria | 1087 |
| 766 | Ga0496100_0926204 | 3300048903 | Bacteria | 685 |
| 767 | Ga0496101_0859744 | 3300048904 | Bacteria | 715 |
| 768 | Ga0496101_1368899 | 3300048904 | Bacteria | 552 |
| 769 | Ga0496102_0082256 | 3300048905 | Bacteria | 2969 |
| 770 | Ga0496102_0152685 | 3300048905 | Bacteria | 2170 |
| 771 | Ga0496102_0260356 | 3300048905 | Bacteria | 1635 |
| 772 | Ga0496102_0347549 | 3300048905 | Bacteria | 1396 |
| 773 | Ga0496102_0401306 | 3300048905 | Bacteria | 1289 |
| 774 | Ga0496103_0091837 | 3300048906 | Bacteria | 1916 |
| 775 | Ga0496103_0135099 | 3300048906 | Bacteria | 1576 |
| 776 | Ga0496103_0527388 | 3300048906 | Bacteria | 755 |
| 777 | Ga0496103_0636678 | 3300048906 | Bacteria | 678 |
| 778 | Ga0496104_0044883 | 3300048907 | Bacteria | 4154 |
| 779 | Ga0496104_0463833 | 3300048907 | Bacteria | 1178 |
| 780 | Ga0496104_0526120 | 3300048907 | Bacteria | 1093 |
| 781 | Ga0496104_0548848 | 3300048907 | Bacteria | 1066 |
| 782 | Ga0496104_0777062 | 3300048907 | Bacteria | 864 |
| 783 | Ga0496105_0051519 | 3300048908 | Bacteria | 3400 |
| 784 | Ga0496105_0094396 | 3300048908 | Bacteria | 2470 |
| 785 | Ga0496105_0737928 | 3300048908 | Bacteria | 753 |
| 786 | Ga0496105_0852426 | 3300048908 | Bacteria | 689 |
| 787 | Ga0496106_0411555 | 3300048909 | Bacteria | 1087 |
| 788 | Ga0496106_0607760 | 3300048909 | Bacteria | 875 |
| 789 | Ga0496106_0628249 | 3300048909 | Bacteria | 859 |
| 790 | Ga0496106_0766736 | 3300048909 | Bacteria | 766 |
| 791 | Ga0496107_0037476 | 3300048910 | Bacteria | 3479 |
| 792 | Ga0496107_0114537 | 3300048910 | Bacteria | 1984 |
| 793 | Ga0496107_0316488 | 3300048910 | Bacteria | 1161 |
| 794 | Ga0496107_1098843 | 3300048910 | Bacteria | 574 |
| 795 | Ga0496108_0036615 | 3300048911 | Bacteria | 4083 |
| 796 | Ga0496108_0060709 | 3300048911 | Bacteria | 3181 |
| 797 | Ga0496108_0443405 | 3300048911 | Bacteria | 1134 |
| 798 | Ga0496108_0571795 | 3300048911 | Bacteria | 985 |
| 799 | Ga0496108_1132709 | 3300048911 | Bacteria | 664 |
| 800 | Ga0496109_0057722 | 3300048912 | Bacteria | 3544 |
| 801 | Ga0496109_0353316 | 3300048912 | Bacteria | 1388 |
| 802 | Ga0496109_1851968 | 3300048912 | Bacteria | 536 |
| 803 | Ga0496110_1252080 | 3300048913 | Bacteria | 651 |
| 804 | Ga0496111_0034277 | 3300048914 | Bacteria | 3624 |
| 805 | Ga0496111_0680391 | 3300048914 | Bacteria | 749 |
| 806 | Ga0496112_0033543 | 3300048915 | Bacteria | 4991 |
| 807 | Ga0496112_0049766 | 3300048915 | Bacteria | 4107 |
| 808 | Ga0496112_0631524 | 3300048915 | Bacteria | 1001 |
| 809 | Ga0496112_1010109 | 3300048915 | Bacteria | 751 |
| 810 | Ga0496113_0017212 | 3300048916 | Bacteria | 5013 |
| 811 | Ga0496113_0032120 | 3300048916 | Bacteria | 3813 |
| 812 | Ga0496114_0078476 | 3300048917 | Bacteria | 2785 |
| 813 | Ga0496114_0420047 | 3300048917 | Bacteria | 1184 |
| 814 | Ga0496115_0150310 | 3300048918 | Bacteria | 1923 |
| 815 | Ga0496115_0281240 | 3300048918 | Bacteria | 1366 |
| 816 | Ga0496115_0335240 | 3300048918 | Bacteria | 1235 |
| 817 | Ga0496115_0439175 | 3300048918 | Bacteria | 1055 |
| 818 | Ga0496116_0159299 | 3300048919 | Bacteria | 1241 |
| 819 | Ga0496116_0235381 | 3300048919 | Bacteria | 925 |
| 820 | Ga0496117_0060867 | 3300048920 | Bacteria | 2599 |
| 821 | Ga0496117_0277004 | 3300048920 | Bacteria | 900 |
| 822 | Ga0496118_0134441 | 3300048921 | Bacteria | 1581 |
| 823 | Ga0496118_0283652 | 3300048921 | Bacteria | 920 |
| 824 | Ga0496118_0316502 | 3300048921 | Bacteria | 849 |
| 825 | Ga0496118_0410405 | 3300048921 | Bacteria | 700 |
| 826 | Ga0496119_0147277 | 3300048922 | Bacteria | 1265 |
| 827 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 828 | Ga0496121_0035287 | 3300048924 | Bacteria | 4485 |
| 829 | Ga0496121_0071562 | 3300048924 | Bacteria | 2788 |
| 830 | Ga0496121_0113457 | 3300048924 | Bacteria | 2062 |
| 831 | Ga0496121_0125511 | 3300048924 | Bacteria | 1930 |
| 832 | Ga0496121_0166716 | 3300048924 | Bacteria | 1604 |
| 833 | Ga0496121_0200405 | 3300048924 | Bacteria | 1423 |
| 834 | Ga0496121_0322537 | 3300048924 | Bacteria | 1039 |
| 835 | Ga0496121_0518333 | 3300048924 | Bacteria | 753 |
| 836 | Ga0496124_0236071 | 3300048927 | Bacteria | 1363 |
| 837 | Ga0496124_0248160 | 3300048927 | Bacteria | 1319 |
| 838 | Ga0496125_0576892 | 3300048928 | Bacteria | 618 |
| 839 | Ga0496126_0034975 | 3300048929 | Bacteria | 4711 |
| 840 | Ga0496126_0060610 | 3300048929 | Bacteria | 3402 |
| 841 | Ga0496126_0162691 | 3300048929 | Bacteria | 1906 |
| 842 | Ga0496126_0397020 | 3300048929 | Bacteria | 1119 |
| 843 | Ga0496126_0889485 | 3300048929 | Bacteria | 676 |
| 844 | Ga0501033_0597713 | 3300049570 | Bacteria | 757 |
| 845 | Ga0501047_0041970 | 3300049581 | Bacteria | 4421 |
| 846 | Ga0501048_0522722 | 3300049582 | Bacteria | 851 |
| 847 | Ga0501067_0050483 | 3300049583 | Bacteria | 2305 |
| 848 | Ga0501070_0248474 | 3300049586 | Bacteria | 1455 |
| 849 | Ga0501080_0128602 | 3300049742 | Bacteria | 2345 |
| 850 | Ga0501044_0083186 | 3300049823 | Bacteria | 3237 |
| 851 | nmdc:mga03683_210539_c1 | 3300050489 | Bacteria | 894 |
| 852 | nmdc:mga03683_265128_c1 | 3300050489 | Bacteria | 800 |
| 853 | nmdc:mga03n38_14558_c1 | 3300050490 | Bacteria | 3017 |
| 854 | nmdc:mga00v17_539811_c1 | 3300050491 | Bacteria | 754 |
| 855 | nmdc:mga0yw44_117836_c1 | 3300050492 | Bacteria | 1708 |
| 856 | nmdc:mga0yw44_464373_c1 | 3300050492 | Bacteria | 858 |
| 857 | nmdc:mga0yw44_644431_c1 | 3300050492 | Bacteria | 720 |
| 858 | nmdc:mga0yw44_804435_c1 | 3300050492 | Bacteria | 638 |
| 859 | nmdc:mga06z11_110457_c1 | 3300050494 | Bacteria | 1522 |
| 860 | nmdc:mga06z11_11045_c1 | 3300050494 | Bacteria | 3876 |
| 861 | nmdc:mga06z11_460298_c1 | 3300050494 | Bacteria | 769 |
| 862 | nmdc:mga06z11_583410_c1 | 3300050494 | Bacteria | 680 |
| 863 | nmdc:mga04h51_29235_c1 | 3300050495 | Bacteria | 1725 |
| 864 | nmdc:mga07m45_13114_c1 | 3300050496 | Bacteria | 4388 |
| 865 | nmdc:mga07m45_385630_c1 | 3300050496 | Bacteria | 814 |
| 866 | nmdc:mga07m45_64024_c1 | 3300050496 | Bacteria | 2086 |
| 867 | nmdc:mga08y16_619065_c1 | 3300050511 | Bacteria | 1090 |
| 868 | nmdc:mga0n895_378198_c1 | 3300050512 | Bacteria | 1433 |
| 869 | nmdc:mga0rr50_393867_c1 | 3300050513 | Bacteria | 1169 |
| 870 | nmdc:mga0a205_151249_c1 | 3300050515 | Bacteria | 2220 |
| 871 | Ga0495601_0017256 | 3300053077 | Bacteria | 4380 |
| 872 | Ga0495601_0136693 | 3300053077 | Bacteria | 1598 |
| 873 | Ga0495601_0343333 | 3300053077 | Bacteria | 971 |
| 874 | Ga0500610_0041583 | 3300053079 | Bacteria | 2377 |
| 875 | Ga0495655_0112132 | 3300053083 | Bacteria | 821 |
| 876 | Ga0495595_0219991 | 3300053084 | Bacteria | 947 |
| 877 | Ga0495619_0236354 | 3300053085 | Bacteria | 1266 |
| 878 | Ga0495619_0241630 | 3300053085 | Bacteria | 1251 |
| 879 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 880 | Ga0500644_0362520 | 3300053088 | Bacteria | 628 |
| 881 | Ga0500646_0155861 | 3300053090 | Bacteria | 759 |
| 882 | Ga0500583_0085964 | 3300053092 | Bacteria | 1525 |
| 883 | Ga0500583_0166310 | 3300053092 | Bacteria | 1098 |
| 884 | Ga0500651_0033603 | 3300053093 | Bacteria | 3233 |
| 885 | Ga0500651_0258387 | 3300053093 | Bacteria | 1010 |
| 886 | Ga0500566_0011791 | 3300053094 | Bacteria | 5150 |
| 887 | Ga0500566_0043525 | 3300053094 | Bacteria | 2587 |
| 888 | Ga0500640_009445 | 3300053095 | Bacteria | 3899 |
| 889 | Ga0500641_0060146 | 3300053096 | Bacteria | 1580 |
| 890 | Ga0500641_0147163 | 3300053096 | Bacteria | 1017 |
| 891 | Ga0500650_0192335 | 3300053098 | Bacteria | 932 |
| 892 | Ga0500553_133854 | 3300053101 | Bacteria | 993 |
| 893 | Ga0500554_067639 | 3300053102 | Bacteria | 1157 |
| 894 | Ga0500555_004419 | 3300053103 | Bacteria | 3997 |
| 895 | Ga0500555_083377 | 3300053103 | Bacteria | 829 |
| 896 | Ga0500569_051549 | 3300053109 | Bacteria | 1243 |
| 897 | Ga0500569_085728 | 3300053109 | Bacteria | 1013 |
| 898 | Ga0500572_072413 | 3300053111 | Bacteria | 1067 |
| 899 | Ga0500582_116210 | 3300053114 | Bacteria | 932 |
| 900 | Ga0500592_014816 | 3300053116 | Bacteria | 1250 |
| 901 | Ga0500592_033615 | 3300053116 | Bacteria | 827 |
| 902 | Ga0500594_0011291 | 3300053118 | Bacteria | 2084 |
| 903 | Ga0500594_0253250 | 3300053118 | Bacteria | 586 |
| 904 | Ga0500595_001016 | 3300053119 | Bacteria | 15748 |
| 905 | Ga0500595_006803 | 3300053119 | Bacteria | 4813 |
| 906 | Ga0500595_014698 | 3300053119 | Bacteria | 2962 |
| 907 | Ga0500595_027760 | 3300053119 | Bacteria | 1935 |
| 908 | Ga0500595_043871 | 3300053119 | Bacteria | 1421 |
| 909 | Ga0500607_085637 | 3300053121 | Bacteria | 1597 |
| 910 | Ga0500608_234605 | 3300053122 | Bacteria | 729 |
| 911 | Ga0500614_108692 | 3300053123 | Bacteria | 806 |
| 912 | Ga0500614_193217 | 3300053123 | Bacteria | 625 |
| 913 | Ga0500628_143339 | 3300053129 | Bacteria | 664 |
| 914 | Ga0500642_0000362 | 3300053130 | Bacteria | 15284 |
| 915 | Ga0500642_0000641 | 3300053130 | Bacteria | 10431 |
| 916 | Ga0500642_0066658 | 3300053130 | Bacteria | 1629 |
| 917 | Ga0500655_040208 | 3300053133 | Bacteria | 916 |
| 918 | Ga0500658_0381921 | 3300053134 | Bacteria | 645 |
| 919 | Ga0500568_0067550 | 3300053139 | Bacteria | 1373 |
| 920 | Ga0500568_0129529 | 3300053139 | Bacteria | 938 |
| 921 | Ga0500577_0098647 | 3300053142 | Bacteria | 1191 |
| 922 | Ga0500577_0198761 | 3300053142 | Bacteria | 864 |
| 923 | Ga0500588_0101524 | 3300053146 | Bacteria | 992 |
| 924 | Ga0500589_226276 | 3300053147 | Bacteria | 701 |
| 925 | Ga0500589_262379 | 3300053147 | Bacteria | 628 |
| 926 | Ga0500590_147270 | 3300053148 | Bacteria | 1067 |
| 927 | Ga0500590_223751 | 3300053148 | Bacteria | 773 |
| 928 | Ga0500603_121939 | 3300053150 | Bacteria | 791 |
| 929 | Ga0500604_0049059 | 3300053151 | Bacteria | 1297 |
| 930 | Ga0500604_0089581 | 3300053151 | Bacteria | 1003 |
| 931 | Ga0500604_0178318 | 3300053151 | Bacteria | 728 |
| 932 | Ga0500616_0139503 | 3300053153 | Bacteria | 1135 |
| 933 | Ga0500620_238445 | 3300053155 | Bacteria | 609 |
| 934 | Ga0500622_0229091 | 3300053156 | Bacteria | 828 |
| 935 | Ga0500627_0125991 | 3300053158 | Bacteria | 1156 |
| 936 | Ga0500627_0203270 | 3300053158 | Bacteria | 887 |
| 937 | Ga0500627_0348998 | 3300053158 | Bacteria | 639 |
| 938 | Ga0500634_0212441 | 3300053161 | Bacteria | 838 |
| 939 | Ga0500638_005456 | 3300053162 | Bacteria | 5068 |
| 940 | Ga0500638_222988 | 3300053162 | Bacteria | 780 |
| 941 | Ga0500636_0276248 | 3300053177 | Bacteria | 841 |
| 942 | Ga0500636_0333676 | 3300053177 | Bacteria | 731 |
| 943 | Ga0500637_0000585 | 3300053178 | Bacteria | 14328 |
| 944 | Ga0500637_0186572 | 3300053178 | Bacteria | 1186 |
| 945 | Ga0500570_106621 | 3300053724 | Bacteria | 1155 |
| 946 | Ga0500611_158246 | 3300053727 | Bacteria | 625 |
| 947 | Ga0500609_006652 | 3300053731 | Bacteria | 1572 |
| 948 | Ga0500661_005871 | 3300055283 | Bacteria | 2287 |
| 949 | Ga0587080_148527 | 3300059503 | Bacteria | 541 |
| 950 | Ga0587083_0147968 | 3300059505 | Bacteria | 632 |
| 951 | Ga0587068_101443 | 3300059641 | Bacteria | 605 |
| 952 | Ga0587072_123946 | 3300059643 | Bacteria | 602 |
| 953 | Ga0587075_040357 | 3300059644 | Bacteria | 780 |
| 954 | Ga0587076_075966 | 3300059645 | Bacteria | 707 |
| 955 | Ga0587071_046432 | 3300060344 | Bacteria | 886 |
| 956 | Ga0466962_0031673 | 3300061719 | Bacteria | 2532 |
| 957 | Ga0466962_0128009 | 3300061719 | Bacteria | 1227 |
| 958 | 8016565829 | 8016557553 | Bacteria | 8154380 |
| 959 | 2513659509 | 2513237096 | Bacteria | 8722461 |
| 960 | 2513718240 | 2513237104 | Bacteria | 10034502 |
| 961 | 2513859384 | 2513237137 | Bacteria | 9558895 |
| 962 | 2513921558 | 2513237145 | Bacteria | 8979722 |
| 963 | 2517889050 | 2517572143 | Bacteria | 9484767 |
| 964 | 2524537485 | 2524023228 | Bacteria | 10118060 |
| 965 | 2671124039 | 2667528175 | Bacteria | 7532676 |
| 966 | 2793072711 | 2791355197 | Bacteria | 8420563 |
| 967 | 2881368926 | 2881364244 | Bacteria | 7710352 |
| 968 | 2885377554 | 2885374607 | Bacteria | 8927485 |
| 969 | 2885415852 | 2885409591 | Bacteria | 9235467 |
| 970 | 2903758797 | 2903748898 | Bacteria | 9972761 |
| 971 | 2904691005 | 2904690495 | Bacteria | 9412302 |
| 972 | 2904708402 | |||
| 973 | 2906613574 | |||
| 974 | 2906635831 | 2906635258 | Bacteria | 8601019 |
| 975 | 2906668108 | 2906660503 | Bacteria | 8595048 |
| 976 | 2908747652 | 2908739725 | Bacteria | 8628932 |
| 977 | 2908757063 | 2908756301 | Bacteria | 8864324 |
| 978 | 2922363207 | 2922361189 | Bacteria | 7436256 |
| 979 | 2922434011 | |||
| 980 | 2935636038 | 2935630451 | Bacteria | 8169952 |
| 981 | 2941512658 | 2941507105 | Bacteria | 8166816 |
| 982 | 2941520504 | 2941515067 | Bacteria | 8166720 |
| 983 | 2941528518 | 2941523033 | Bacteria | 8169134 |
| 984 | 3005475274 | 3005474847 | Bacteria | 9259049 |
| 985 | 8006936003 | 8006933436 | Bacteria | 10410654 |
| 986 | 8006975873 | 8006973647 | Bacteria | 10679141 |
| 987 | 8019562653 | 8019555841 | Bacteria | 9642137 |
| 988 | 8019572730 | 8019565922 | Bacteria | 9639779 |
| 989 | 8056691144 | 8056689827 | Bacteria | 6712655 |
| 990 | 8056971493 | 8056967851 | Bacteria | 9038162 |
| 991 | JGI25165J46597_1004955 | |||
| 992 | JGI25153J46596_10030586 | |||
| 993 | JGI25404J52841_10019296 | |||
| 994 | JGI25404J52841_10035351 | |||
| 995 | Ga0055539_1020748 | |||
| 996 | Ga0055542_1014646 | |||
| 997 | Ga0055543_1011352 | |||
| 998 | Ga0065704_10142844 | |||
| 999 | Ga0065712_10228589 | |||
| 1000 | Ga0065707_10024212 | |||
| 1001 | Ga0070676_10229590 | |||
| 1002 | Ga0070676_10660950 | |||
| 1003 | Ga0070683_100109161 | |||
| 1004 | Ga0070683_100167461 | |||
| 1005 | Ga0070683_100270090 | |||
| 1006 | Ga0070683_100277403 | |||
| 1007 | Ga0070670_100746824 | |||
| 1008 | Ga0068869_100451568 | |||
| 1009 | Ga0068869_101189775 | |||
| 1010 | Ga0070666_10947092 | |||
| 1011 | Ga0070680_100463354 | |||
| 1012 | Ga0070680_100852515 | |||
| 1013 | Ga0070682_100140690 | |||
| 1014 | Ga0070682_100954204 | |||
| 1015 | Ga0068868_100059956 | |||
| 1016 | Ga0068868_101012133 | |||
| 1017 | Ga0068868_101458966 | |||
| 1018 | Ga0070660_100501648 | |||
| 1019 | Ga0070691_10205067 | |||
| 1020 | Ga0070661_100466437 | |||
| 1021 | Ga0070661_100739494 | |||
| 1022 | Ga0070661_101243556 | |||
| 1023 | Ga0070668_100216872 | |||
| 1024 | Ga0070668_100424000 | |||
| 1025 | Ga0070668_100776729 | |||
| 1026 | Ga0070668_102037548 | |||
| 1027 | Ga0070668_102037549 | |||
| 1028 | Ga0070669_100609029 | |||
| 1029 | Ga0070671_101076359 | |||
| 1030 | Ga0070674_101290983 | |||
| 1031 | Ga0070673_100230498 | |||
| 1032 | Ga0070673_100760705 | |||
| 1033 | Ga0070688_100208310 | |||
| 1034 | Ga0070688_100588175 | |||
| 1035 | Ga0070659_101317869 | |||
| 1036 | Ga0070667_100271251 | |||
| 1037 | Ga0070667_101493029 | |||
| 1038 | Ga0070667_101683202 | |||
| 1039 | Ga0070703_10299640 | |||
| 1040 | Ga0070709_10194830 | |||
| 1041 | Ga0070709_10357658 | |||
| 1042 | Ga0070709_10420172 | |||
| 1043 | Ga0070709_10833475 | |||
| 1044 | Ga0070709_10905858 | |||
| 1045 | Ga0070714_100021967 | |||
| 1046 | Ga0070714_100431950 | |||
| 1047 | Ga0070714_100930256 | |||
| 1048 | Ga0070713_100029455 | |||
| 1049 | Ga0070713_100080502 | |||
| 1050 | Ga0070713_100156027 | |||
| 1051 | Ga0070713_100330033 | |||
| 1052 | Ga0070713_100737828 | |||
| 1053 | Ga0070713_101283380 | |||
| 1054 | Ga0070710_10041326 | |||
| 1055 | Ga0070710_10055278 | |||
| 1056 | Ga0070710_10297910 | |||
| 1057 | Ga0070710_10336269 | |||
| 1058 | Ga0070710_10577282 | |||
| 1059 | Ga0070710_10611687 | |||
| 1060 | Ga0070710_10754729 | |||
| 1061 | Ga0070701_10194738 | |||
| 1062 | Ga0070711_100005553 | |||
| 1063 | Ga0070711_100194344 | |||
| 1064 | Ga0070711_100268474 | |||
| 1065 | Ga0070711_100315259 | |||
| 1066 | Ga0070700_101071426 | |||
| 1067 | Ga0070700_101158779 | |||
| 1068 | Ga0070700_101302622 | |||
| 1069 | Ga0070694_100479641 | |||
| 1070 | Ga0070663_100718471 | |||
| 1071 | Ga0070663_100861160 | |||
| 1072 | Ga0070663_101271406 | |||
| 1073 | Ga0070678_100096322 | |||
| 1074 | Ga0070678_100363674 | |||
| 1075 | Ga0070678_100584240 | |||
| 1076 | Ga0070662_100289078 | |||
| 1077 | Ga0070681_10017254 | |||
| 1078 | Ga0070681_10037401 | |||
| 1079 | Ga0070681_10075073 | |||
| 1080 | Ga0070681_10436888 | |||
| 1081 | Ga0068867_100630108 | |||
| 1082 | Ga0068867_100633022 | |||
| 1083 | Ga0070685_10466238 | |||
| 1084 | Ga0070706_100234156 | |||
| 1085 | Ga0070706_100317287 | |||
| 1086 | Ga0070706_100574081 | |||
| 1087 | Ga0070706_100600472 | |||
| 1088 | Ga0070698_100059290 | |||
| 1089 | Ga0070698_100981492 | |||
| 1090 | Ga0070699_100681478 | |||
| 1091 | Ga0070699_100742484 | |||
| 1092 | Ga0070679_100015647 | |||
| 1093 | Ga0070679_100163330 | |||
| 1094 | Ga0070684_100355097 | |||
| 1095 | Ga0070684_100395167 | |||
| 1096 | Ga0070684_100692908 | |||
| 1097 | Ga0070684_100884156 | |||
| 1098 | Ga0070697_100201326 | |||
| 1099 | Ga0068853_100390609 | |||
| 1100 | Ga0068853_100442522 | |||
| 1101 | Ga0068853_100484951 | |||
| 1102 | Ga0068853_100695337 | |||
| 1103 | Ga0070672_100348785 | |||
| 1104 | Ga0070693_100040796 | |||
| 1105 | Ga0070693_100075050 | |||
| 1106 | Ga0070693_100395572 | |||
| 1107 | Ga0070665_100206184 | |||
| 1108 | Ga0070665_100377590 | |||
| 1109 | Ga0070665_100519344 | |||
| 1110 | Ga0070665_101138158 | |||
| 1111 | Ga0068855_100444992 | |||
| 1112 | Ga0068855_100686734 | |||
| 1113 | Ga0068855_101263499 | |||
| 1114 | Ga0070664_101140914 | |||
| 1115 | Ga0070664_101838180 | |||
| 1116 | Ga0068857_100183974 | |||
| 1117 | Ga0068857_100311302 | |||
| 1118 | Ga0068857_100397294 | |||
| 1119 | Ga0068854_100272559 | |||
| 1120 | Ga0068854_100442540 | |||
| 1121 | Ga0068854_100501576 | |||
| 1122 | Ga0068856_100000883 | |||
| 1123 | Ga0068856_100107320 | |||
| 1124 | Ga0068856_100491914 | |||
| 1125 | Ga0068856_101140658 | |||
| 1126 | Ga0068856_101473787 | |||
| 1127 | Ga0068856_101840282 | |||
| 1128 | Ga0068852_100067130 | |||
| 1129 | Ga0068852_100775901 | |||
| 1130 | Ga0068852_100780793 | |||
| 1131 | Ga0068852_101142168 | |||
| 1132 | Ga0068852_101700076 | |||
| 1133 | Ga0068859_100748173 | |||
| 1134 | Ga0068859_101012421 | |||
| 1135 | Ga0068859_101200521 | |||
| 1136 | Ga0068864_100123810 | |||
| 1137 | Ga0068864_100314239 | |||
| 1138 | Ga0068864_100339767 | |||
| 1139 | Ga0068866_10472137 | |||
| 1140 | Ga0068861_100413798 | |||
| 1141 | Ga0068861_100541193 | |||
| 1142 | Ga0068870_10062707 | |||
| 1143 | Ga0068870_10415719 | |||
| 1144 | Ga0068870_10419108 | |||
| 1145 | Ga0068863_100488620 | |||
| 1146 | Ga0068863_100531991 | |||
| 1147 | Ga0068863_100554843 | |||
| 1148 | Ga0068860_100247682 | |||
| 1149 | Ga0068860_100952627 | |||
| 1150 | Ga0068860_100960866 | |||
| 1151 | Ga0068862_100148304 | |||
| 1152 | Ga0068862_100358612 | |||
| 1153 | Ga0068862_100632552 | |||
| 1154 | Ga0081540_1020688 | |||
| 1155 | Ga0081540_1020881 | |||
| 1156 | Ga0081540_1035114 | |||
| 1157 | Ga0081540_1055889 | |||
| 1158 | Ga0081540_1118995 | |||
| 1159 | Ga0070717_10123888 | |||
| 1160 | Ga0070717_10242931 | |||
| 1161 | Ga0070717_10549537 | |||
| 1162 | Ga0075365_10247886 | |||
| 1163 | Ga0075365_10344911 | |||
| 1164 | Ga0075365_10434159 | |||
| 1165 | Ga0075365_10583859 | |||
| 1166 | Ga0075368_10022422 | |||
| 1167 | Ga0075368_10071058 | |||
| 1168 | Ga0075363_100065058 | |||
| 1169 | Ga0075363_100247733 | |||
| 1170 | Ga0075363_100253033 | |||
| 1171 | Ga0075363_100285613 | |||
| 1172 | Ga0075363_100768625 | |||
| 1173 | Ga0075364_10102130 | |||
| 1174 | Ga0070715_10104876 | |||
| 1175 | Ga0070715_10194769 | |||
| 1176 | Ga0070715_10256318 | |||
| 1177 | Ga0070716_100094913 | |||
| 1178 | Ga0070716_101320005 | |||
| 1179 | Ga0070712_100038086 | |||
| 1180 | Ga0070712_100111114 | |||
| 1181 | Ga0070712_100314022 | |||
| 1182 | Ga0075367_10022547 | |||
| 1183 | Ga0075367_10112753 | |||
| 1184 | Ga0075367_10288413 | |||
| 1185 | Ga0075366_10278186 | |||
| 1186 | Ga0075366_10397943 | |||
| 1187 | Ga0097621_100139391 | |||
| 1188 | Ga0097621_100212164 | |||
| 1189 | Ga0097621_100927645 | |||
| 1190 | Ga0097621_101706938 | |||
| 1191 | Ga0075370_10024394 | |||
| 1192 | Ga0075370_10093373 | |||
| 1193 | Ga0075370_10178205 | |||
| 1194 | Ga0068871_100126029 | |||
| 1195 | Ga0068871_100899132 | |||
| 1196 | Ga0068871_101274140 | |||
| 1197 | Ga0075428_100135007 | |||
| 1198 | Ga0075434_100287226 | |||
| 1199 | Ga0068865_100289192 | |||
| 1200 | Ga0068865_100708827 | |||
| 1201 | Ga0097620_100748205 | |||
| 1202 | Ga0097620_101012391 | |||
| 1203 | Ga0097620_101200522 | |||
| 1204 | Ga0075435_100454561 | |||
| 1205 | Ga0099794_10174147 | |||
| 1206 | Ga0099794_10321430 | |||
| 1207 | Ga0099795_10066779 | |||
| 1208 | Ga0105240_10551341 | |||
| 1209 | Ga0105240_10749887 | |||
| 1210 | Ga0105240_10822471 | |||
| 1211 | Ga0105240_11711774 | |||
| 1212 | Ga0111539_10530373 | |||
| 1213 | Ga0111539_10932697 | |||
| 1214 | Ga0105245_10405664 | |||
| 1215 | Ga0105245_10645803 | |||
| 1216 | Ga0105247_10130453 | |||
| 1217 | Ga0105243_10393668 | |||
| 1218 | Ga0105243_10507900 | |||
| 1219 | Ga0105241_10153603 | |||
| 1220 | Ga0105241_10441133 | |||
| 1221 | Ga0105241_10503326 | |||
| 1222 | Ga0105241_10691131 | |||
| 1223 | Ga0105242_10771784 | |||
| 1224 | Ga0105242_10834310 | |||
| 1225 | Ga0105248_10410419 | |||
| 1226 | Ga0105237_10186788 | |||
| 1227 | Ga0105237_10391897 | |||
| 1228 | Ga0105237_11256989 | |||
| 1229 | Ga0105237_11267388 | |||
| 1230 | Ga0105237_11307060 | |||
| 1231 | Ga0105237_11310150 | |||
| 1232 | Ga0105238_10122580 | |||
| 1233 | Ga0105238_10153518 | |||
| 1234 | Ga0105238_10589215 | |||
| 1235 | Ga0105238_10815971 | |||
| 1236 | Ga0105238_10899903 | |||
| 1237 | Ga0105238_10916090 | |||
| 1238 | Ga0105238_11172820 | |||
| 1239 | Ga0105238_11355898 | |||
| 1240 | Ga0105238_11573732 | |||
| 1241 | Ga0105249_11152751 | |||
| 1242 | Ga0105249_11307958 | |||
| 1243 | Ga0099796_10081558 | |||
| 1244 | Ga0099796_10235288 | |||
| 1245 | Ga0105239_10325851 | |||
| 1246 | Ga0105239_10526109 | |||
| 1247 | Ga0105239_11237394 | |||
| 1248 | Ga0105239_11992100 | |||
| 1249 | Ga0105246_10019273 | |||
| 1250 | Ga0105246_10634819 | |||
| 1251 | Ga0105246_11279383 | |||
| 1252 | Ga0157373_10675974 | |||
| 1253 | Ga0157370_10137726 | |||
| 1254 | Ga0157369_10021333 | |||
| 1255 | Ga0157369_10401604 | |||
| 1256 | Ga0157374_10054089 | |||
| 1257 | Ga0157374_10353683 | |||
| 1258 | Ga0157374_10498604 | |||
| 1259 | Ga0157374_11026557 | |||
| 1260 | Ga0157378_11611005 | |||
| 1261 | Ga0163162_10045228 | |||
| 1262 | Ga0163162_11000743 | |||
| 1263 | Ga0163162_11590985 | |||
| 1264 | Ga0163162_11937813 | |||
| 1265 | Ga0163162_12349777 | |||
| 1266 | Ga0163162_12826517 | |||
| 1267 | Ga0157372_10201797 | |||
| 1268 | Ga0157372_10579615 | |||
| 1269 | Ga0157372_10940107 | |||
| 1270 | Ga0157375_10624930 | |||
| 1271 | Ga0157375_10691138 | |||
| 1272 | Ga0157375_10747294 | |||
| 1273 | Ga0163163_10127555 | |||
| 1274 | Ga0163163_10370574 | |||
| 1275 | Ga0163163_11096593 | |||
| 1276 | Ga0163163_11391692 | |||
| 1277 | Ga0163163_12210602 | |||
| 1278 | Ga0157380_10341204 | |||
| 1279 | Ga0157380_10599164 | |||
| 1280 | Ga0157380_12204986 | |||
| 1281 | Ga0157379_10209640 | |||
| 1282 | Ga0157379_10568872 | |||
| 1283 | Ga0157376_10620496 | |||
| 1284 | Ga0157376_10804516 | |||
| 1285 | Ga0157376_10912082 | |||
| 1286 | Ga0182007_10241593 | |||
| 1287 | Ga0163161_10486050 | |||
| 1288 | Ga0163161_10584233 | |||
| 1289 | Ga0163161_11136485 | |||
| 1290 | Ga0206356_10348709 | |||
| 1291 | Ga0206354_10763753 | |||
| 1292 | Ga0213876_10169534 | |||
| 1293 | Ga0213876_10325057 | |||
| 1294 | Ga0213876_10467307 | |||
| 1295 | Ga0213875_10150372 | |||
| 1296 | Ga0224712_10096101 | |||
| 1297 | Ga0209563_101315 | |||
| 1298 | Ga0209677_100543 | |||
| 1299 | Ga0209677_100722 | |||
| 1300 | Ga0209148_1000295 | |||
| 1301 | Ga0209233_1002578 | |||
| 1302 | Ga0209233_1006623 | |||
| 1303 | Ga0209455_1003238 | |||
| 1304 | Ga0209455_1004716 | |||
| 1305 | Ga0209455_1021696 | |||
| 1306 | Ga0209758_1001900 | |||
| 1307 | Ga0209758_1013412 | |||
| 1308 | Ga0209256_1052131 | |||
| 1309 | Ga0207697_10022598 | |||
| 1310 | Ga0207697_10044238 | |||
| 1311 | Ga0207697_10227280 | |||
| 1312 | Ga0207697_10228741 | |||
| 1313 | Ga0207653_10076948 | |||
| 1314 | Ga0207692_10042210 | |||
| 1315 | Ga0207692_10152647 | |||
| 1316 | Ga0207692_10250021 | |||
| 1317 | Ga0207692_10263072 | |||
| 1318 | Ga0207692_10340988 | |||
| 1319 | Ga0207692_10616693 | |||
| 1320 | Ga0207642_10097318 | |||
| 1321 | Ga0207642_10859819 | |||
| 1322 | Ga0207710_10094956 | |||
| 1323 | Ga0207688_10151712 | |||
| 1324 | Ga0207680_10578662 | |||
| 1325 | Ga0207647_10113451 | |||
| 1326 | Ga0207699_10011800 | |||
| 1327 | Ga0207699_10267408 | |||
| 1328 | Ga0207699_10504622 | |||
| 1329 | Ga0207699_10586267 | |||
| 1330 | Ga0207643_10135707 | |||
| 1331 | Ga0207643_10252516 | |||
| 1332 | Ga0207684_10366162 | |||
| 1333 | Ga0207654_10096920 | |||
| 1334 | Ga0207654_10160018 | |||
| 1335 | Ga0207654_10224647 | |||
| 1336 | Ga0207707_10008183 | |||
| 1337 | Ga0207707_10369948 | |||
| 1338 | Ga0207707_10477221 | |||
| 1339 | Ga0207707_10669777 | |||
| 1340 | Ga0207695_10071334 | |||
| 1341 | Ga0207671_10508006 | |||
| 1342 | Ga0207671_10595909 | |||
| 1343 | Ga0207693_10045163 | |||
| 1344 | Ga0207693_10055491 | |||
| 1345 | Ga0207693_10263120 | |||
| 1346 | Ga0207663_10002736 | |||
| 1347 | Ga0207663_10409162 | |||
| 1348 | Ga0207662_10335633 | |||
| 1349 | Ga0207657_10173641 | |||
| 1350 | Ga0207657_10907579 | |||
| 1351 | Ga0207649_10201576 | |||
| 1352 | Ga0207649_10355147 | |||
| 1353 | Ga0207649_10503760 | |||
| 1354 | Ga0207652_10129770 | |||
| 1355 | Ga0207652_10164815 | |||
| 1356 | Ga0207652_10305259 | |||
| 1357 | Ga0207652_10351820 | |||
| 1358 | Ga0207652_10610512 | |||
| 1359 | Ga0207652_11500576 | |||
| 1360 | Ga0207646_10369425 | |||
| 1361 | Ga0207694_10206275 | |||
| 1362 | Ga0207694_10266828 | |||
| 1363 | Ga0207694_11040842 | |||
| 1364 | Ga0207694_11235147 | |||
| 1365 | Ga0207650_10625123 | |||
| 1366 | Ga0207687_10305000 | |||
| 1367 | Ga0207687_10593584 | |||
| 1368 | Ga0207700_10010462 | |||
| 1369 | Ga0207700_10012790 | |||
| 1370 | Ga0207700_10029757 | |||
| 1371 | Ga0207700_10378915 | |||
| 1372 | Ga0207700_10400753 | |||
| 1373 | Ga0207700_10684841 | |||
| 1374 | Ga0207700_11148398 | |||
| 1375 | Ga0207664_10254380 | |||
| 1376 | Ga0207664_10340402 | |||
| 1377 | Ga0207644_10179336 | |||
| 1378 | Ga0207644_10626714 | |||
| 1379 | Ga0207706_10130949 | |||
| 1380 | Ga0207706_10326055 | |||
| 1381 | Ga0207709_10465780 | |||
| 1382 | Ga0207709_11359072 | |||
| 1383 | Ga0207670_10360927 | |||
| 1384 | Ga0207669_10207027 | |||
| 1385 | Ga0207669_11403328 | |||
| 1386 | Ga0207704_10166691 | |||
| 1387 | Ga0207704_10708908 | |||
| 1388 | Ga0207691_10508924 | |||
| 1389 | Ga0207691_10844799 | |||
| 1390 | Ga0207711_10140227 | |||
| 1391 | Ga0207711_10300286 | |||
| 1392 | Ga0207689_10975978 | |||
| 1393 | Ga0207661_10000878 | |||
| 1394 | Ga0207661_10062380 | |||
| 1395 | Ga0207661_10850753 | |||
| 1396 | Ga0207661_11273548 | |||
| 1397 | Ga0207679_10356886 | |||
| 1398 | Ga0207667_10105980 | |||
| 1399 | Ga0207667_10144958 | |||
| 1400 | Ga0207667_10148791 | |||
| 1401 | Ga0207667_11145110 | |||
| 1402 | Ga0207712_10857651 | |||
| 1403 | Ga0207712_11397532 | |||
| 1404 | Ga0207668_11320483 | |||
| 1405 | Ga0207640_10083438 | |||
| 1406 | Ga0207640_10229671 | |||
| 1407 | Ga0207640_10356669 | |||
| 1408 | Ga0207658_10602505 | |||
| 1409 | Ga0207658_11332541 | |||
| 1410 | Ga0207677_10091376 | |||
| 1411 | Ga0207677_10443850 | |||
| 1412 | Ga0207703_10065112 | |||
| 1413 | Ga0207703_11145258 | |||
| 1414 | Ga0207703_11241870 | |||
| 1415 | Ga0207639_10240699 | |||
| 1416 | Ga0207639_10268042 | |||
| 1417 | Ga0207639_10292211 | |||
| 1418 | Ga0207678_10246188 | |||
| 1419 | Ga0207678_10561648 | |||
| 1420 | Ga0207678_10786279 | |||
| 1421 | Ga0207678_11095558 | |||
| 1422 | Ga0207702_10000318 | |||
| 1423 | Ga0207702_10312632 | |||
| 1424 | Ga0207702_10372300 | |||
| 1425 | Ga0207702_11139192 | |||
| 1426 | Ga0207641_10357451 | |||
| 1427 | Ga0207641_10474896 | |||
| 1428 | Ga0207641_10517494 | |||
| 1429 | Ga0207641_12096007 | |||
| 1430 | Ga0207648_10402717 | |||
| 1431 | Ga0207648_10499119 | |||
| 1432 | Ga0207648_10534857 | |||
| 1433 | Ga0207648_10706097 | |||
| 1434 | Ga0207676_10199904 | |||
| 1435 | Ga0207674_10073988 | |||
| 1436 | Ga0207674_10666112 | |||
| 1437 | Ga0207674_10670582 | |||
| 1438 | Ga0207675_100609178 | |||
| 1439 | Ga0207675_101074709 | |||
| 1440 | Ga0207683_10083899 | |||
| 1441 | Ga0207683_10153979 | |||
| 1442 | Ga0207683_10461287 | |||
| 1443 | Ga0207683_10478614 | |||
| 1444 | Ga0207683_10984709 | |||
| 1445 | Ga0207683_11224932 | |||
| 1446 | Ga0207683_11652559 | |||
| 1447 | Ga0207683_11813868 | |||
| 1448 | Ga0207698_10403643 | |||
| 1449 | Ga0207698_10715809 | |||
| 1450 | Ga0209588_1060561 | |||
| 1451 | Ga0209813_10024630 | |||
| 1452 | Ga0268266_10066637 | |||
| 1453 | Ga0268266_10129302 | |||
| 1454 | Ga0268266_10341670 | |||
| 1455 | Ga0268266_10378883 | |||
| 1456 | Ga0268266_10757186 | |||
| 1457 | Ga0268266_11222413 | |||
| 1458 | Ga0268266_11364934 | |||
| 1459 | Ga0268266_12068669 | |||
| 1460 | Ga0268265_10289989 | |||
| 1461 | Ga0268265_10506484 | |||
| 1462 | Ga0268264_10297652 | |||
| 1463 | Ga0268264_11273547 | |||
| 1464 | Ga0307517_10000232 | |||
| 1465 | Ga0307517_10469903 | |||
| 1466 | Ga0307515_10087102 | |||
| 1467 | Ga0265332_10035231 | |||
| 1468 | Ga0265340_10091462 | |||
| 1469 | Ga0265340_10217072 | |||
| 1470 | Ga0265339_10073499 | |||
| 1471 | Ga0265331_10089610 | |||
| 1472 | Ga0265316_10196584 | |||
| 1473 | Ga0265316_10588938 | |||
| 1474 | Ga0307513_10191401 | |||
| 1475 | Ga0307513_10240504 | |||
| 1476 | Ga0307509_10331144 | |||
| 1477 | Ga0265313_10342930 | |||
| 1478 | Ga0307508_10126440 | |||
| 1479 | Ga0307508_10328232 | |||
| 1480 | Ga0307508_10665446 | |||
| 1481 | Ga0265314_10005054 | |||
| 1482 | Ga0265314_10220531 | |||
| 1483 | Ga0307516_10114956 | |||
| 1484 | Ga0307516_10178300 | |||
| 1485 | Ga0307516_10279702 | |||
| 1486 | Ga0307405_10263134 | |||
| 1487 | Ga0307413_10594532 | |||
| 1488 | Ga0307406_10237733 | |||
| 1489 | Ga0307407_10538655 | |||
| 1490 | Ga0307412_10530413 | |||
| 1491 | Ga0307416_100460323 | |||
| 1492 | Ga0307416_101970837 | |||
| 1493 | Ga0307416_101979258 | |||
| 1494 | Ga0307414_10974180 | |||
| 1495 | Ga0307415_100314346 | |||
| 1496 | Ga0307415_100662739 | |||
| 1497 | Ga0307510_10072618 | |||
| 1498 | Ga0307510_10089264 | |||
| 1499 | Ga0307510_10121016 | |||
| 1500 | Ga0307510_10301776 | |||
| 1501 | Ga0315911_1000008 | |||
| 1502 | Ga0373958_0165769 | |||
| 1503 | Ga0373958_0166297 | |||
| 1504 | Ga0373926_0033050 | |||
| 1505 | Ga0373934_0023493 | |||
| 1506 | Ga0373934_0096153 | |||
| 1507 | Ga0373949_0072389 | |||
| 1508 | Ga0373951_0095136 | |||
| 1509 | Ga0373952_0253775 | |||
| 1510 | Ga0373923_0004936 | |||
| 1511 | Ga0373923_0039874 | |||
| 1512 | Ga0373923_0042855 | |||
| 1513 | Ga0373936_0070753 | |||
| 1514 | Ga0373939_0109740 | |||
| 1515 | Ga0373945_0015296 | |||
| 1516 | Ga0373945_0100694 | |||
| 1517 | Ga0373953_0078384 | |||
| 1518 | Ga0373953_0247502 | |||
| 1519 | Ga0373954_0011463 | |||
| 1520 | Ga0373954_0174243 | |||
| 1521 | Ga0373956_0082067 | |||
| 1522 | Ga0373956_0155201 | |||
| 1523 | Ga0373956_0451395 | |||
| 1524 | Ga0373957_0120048 | |||
| 1525 | Ga0373943_0141500 | |||
| 1526 | Ga0373943_0463427 | |||
| 1527 | Ga0373946_0014322 | |||
| 1528 | Ga0373946_0214788 | |||
| 1529 | Ga0373946_0482002 | |||
| 1530 | Ga0373955_0004380 | |||
| 1531 | Ga0373955_0051079 | |||
| 1532 | Ga0373961_0031149 | |||
| 1533 | Ga0373961_0070941 | |||
| 1534 | Ga0373924_0033451 | |||
| 1535 | Ga0373924_0093920 | |||
| 1536 | Ga0373931_0015641 | |||
| 1537 | Ga0373935_0001267 | |||
| 1538 | Ga0373935_0039786 | |||
| 1539 | Ga0373927_0000766 | |||
| 1540 | Ga0373927_0006724 | |||
| 1541 | Ga0373927_0200773 | |||
| 1542 | Ga0373927_0288502 | |||
| 1543 | Ga0373927_0328502 | |||
| 1544 | Ga0373927_0349402 | |||
| 1545 | Ga0373927_1123709 | |||
| 1546 | Ga0373933_0000218 | |||
| 1547 | Ga0373933_0231444 | |||
| 1548 | Ga0373933_0356576 | |||
| 1549 | Ga0373947_0000310 | |||
| 1550 | Ga0373947_0013664 | |||
| 1551 | Ga0373947_0374672 | |||
| 1552 | Ga0373937_0014630 | |||
| 1553 | Ga0373925_0006419 | |||
| 1554 | Ga0373925_0021485 | |||
| 1555 | Ga0373925_0078313 | |||
| 1556 | Ga0373925_0589307 | |||
| 1557 | Ga0373925_0654343 | |||
| 1558 | Ga0395900_0032832 | |||
| 1559 | Ga0395900_0108628 | |||
| 1560 | Ga0395900_0199177 | |||
| 1561 | Ga0395900_1525769 | |||
| 1562 | Ga0395898_0089031 | |||
| 1563 | Ga0395898_0631023 | |||
| 1564 | Ga0395905_0048135 | |||
| 1565 | Ga0436364_0331795 | |||
| 1566 | Ga0436364_0603569 | |||
| 1567 | Ga0395901_0113781 | |||
| 1568 | Ga0395901_0297332 | |||
| 1569 | Ga0436365_0118730 | |||
| 1570 | Ga0436365_0135384 | |||
| 1571 | Ga0436365_0209743 | |||
| 1572 | Ga0436365_0279102 | |||
| 1573 | Ga0436365_0346369 | |||
| 1574 | Ga0436365_1026627 | |||
| 1575 | Ga0436362_0249161 | |||
| 1576 | Ga0436362_1201460 | |||
| 1577 | Ga0451789_1333214 | |||
| 1578 | Ga0451793_1038465 | |||
| 1579 | Ga0451802_1431654 | |||
| 1580 | Ga0451807_0826454 | |||
| 1581 | Ga0451855_0143711 | |||
| 1582 | Ga0466969_0093259 | |||
| 1583 | Ga0466972_0029548 | |||
| 1584 | Ga0466966_0343263 | |||
| 1585 | Ga0466961_0156035 | |||
| 1586 | Ga0466963_0258548 | |||
| 1587 | Ga0466963_0996490 | |||
| 1588 | Ga0466971_0156462 | |||
| 1589 | Ga0466968_0379186 | |||
| 1590 | Ga0466970_0260390 | |||
| 1591 | Ga0466957_0080078 | |||
| 1592 | Ga0466957_0237937 | |||
| 1593 | Ga0466957_0297429 | |||
| 1594 | Ga0466957_0427749 | |||
| 1595 | Ga0466960_0181359 | |||
| 1596 | Ga0466959_0048894 | |||
| 1597 | Ga0466967_0028253 | |||
| 1598 | Ga0466967_0062009 | |||
| 1599 | Ga0466967_0204967 | |||
| 1600 | Ga0466967_1213654 | |||
| 1601 | Ga0495617_107272 | |||
| 1602 | Ga0495592_0102991 | |||
| 1603 | Ga0495592_0142617 | |||
| 1604 | Ga0495603_0000936 | |||
| 1605 | Ga0495603_0021318 | |||
| 1606 | Ga0495603_0105542 | |||
| 1607 | Ga0495603_0237833 | |||
| 1608 | Ga0495603_0392356 | |||
| 1609 | Ga0495629_0001416 | |||
| 1610 | Ga0495629_0123416 | |||
| 1611 | Ga0495629_0484623 | |||
| 1612 | Ga0495629_0633985 | |||
| 1613 | Ga0495638_0139687 | |||
| 1614 | Ga0495638_0317616 | |||
| 1615 | Ga0495641_0016464 | |||
| 1616 | Ga0495641_0138934 | |||
| 1617 | Ga0495651_0019880 | |||
| 1618 | Ga0495651_0178579 | |||
| 1619 | Ga0495653_0049261 | |||
| 1620 | Ga0495653_0117625 | |||
| 1621 | Ga0495650_0125333 | |||
| 1622 | Ga0495580_0005025 | |||
| 1623 | Ga0495580_0006058 | |||
| 1624 | Ga0495580_0514895 | |||
| 1625 | Ga0495582_0018773 | |||
| 1626 | Ga0495582_0038113 | |||
| 1627 | Ga0495582_0082250 | |||
| 1628 | Ga0495582_0124167 | |||
| 1629 | Ga0495639_0000072 | |||
| 1630 | Ga0495662_0000572 | |||
| 1631 | Ga0495662_0185583 | |||
| 1632 | Ga0495662_0217863 | |||
| 1633 | Ga0495664_0014835 | |||
| 1634 | Ga0495664_0045196 | |||
| 1635 | Ga0495585_0586092 | |||
| 1636 | Ga0495594_0000046 | |||
| 1637 | Ga0495594_0297721 | |||
| 1638 | Ga0495596_0130534 | |||
| 1639 | Ga0495596_0177088 | |||
| 1640 | Ga0495596_0195003 | |||
| 1641 | Ga0495606_0168025 | |||
| 1642 | Ga0495608_0323669 | |||
| 1643 | Ga0495608_0637386 | |||
| 1644 | Ga0495610_0029757 | |||
| 1645 | Ga0495618_0100704 | |||
| 1646 | Ga0495618_0186351 | |||
| 1647 | Ga0495620_0229342 | |||
| 1648 | Ga0495628_0018626 | |||
| 1649 | Ga0495628_0033483 | |||
| 1650 | Ga0495628_0327775 | |||
| 1651 | Ga0495628_0517885 | |||
| 1652 | Ga0495630_0024634 | |||
| 1653 | Ga0495630_0093534 | |||
| 1654 | Ga0495630_0154765 | |||
| 1655 | Ga0495630_0513814 | |||
| 1656 | Ga0495631_0217855 | |||
| 1657 | Ga0495631_0334536 | |||
| 1658 | Ga0495632_0063839 | |||
| 1659 | Ga0495637_0100090 | |||
| 1660 | Ga0495644_0153157 | |||
| 1661 | Ga0495644_0243040 | |||
| 1662 | Ga0495644_0281117 | |||
| 1663 | Ga0495644_0359059 | |||
| 1664 | Ga0495648_0249358 | |||
| 1665 | Ga0495648_0373903 | |||
| 1666 | Ga0495663_0177723 | |||
| 1667 | Ga0495666_0041837 | |||
| 1668 | Ga0495666_0167306 | |||
| 1669 | Ga0495642_0191454 | |||
| 1670 | Ga0495642_0198449 | |||
| 1671 | Ga0495665_0000335 | |||
| 1672 | Ga0495640_0002138 | |||
| 1673 | Ga0495640_0051516 | |||
| 1674 | Ga0495640_0361314 | |||
| 1675 | Ga0495586_0059346 | |||
| 1676 | Ga0495587_0345412 | |||
| 1677 | Ga0495609_0119716 | |||
| 1678 | Ga0495609_0131591 | |||
| 1679 | Ga0495645_0013978 | |||
| 1680 | Ga0495645_0036237 | |||
| 1681 | Ga0495622_0084671 | |||
| 1682 | Ga0495622_0249119 | |||
| 1683 | Ga0495633_0312506 | |||
| 1684 | Ga0495667_0032717 | |||
| 1685 | Ga0495667_0803522 | |||
| 1686 | Ga0495668_0168169 | |||
| 1687 | Ga0495668_0481719 | |||
| 1688 | Ga0495668_0732608 | |||
| 1689 | Ga0495634_0003037 | |||
| 1690 | Ga0495634_0044482 | |||
| 1691 | Ga0495611_0066313 | |||
| 1692 | Ga0495611_0300332 | |||
| 1693 | Ga0495625_0251011 | |||
| 1694 | Ga0495635_0002038 | |||
| 1695 | Ga0495635_0016231 | |||
| 1696 | Ga0495635_0089467 | |||
| 1697 | Ga0495635_0255921 | |||
| 1698 | Ga0495588_0416881 | |||
| 1699 | Ga0495657_0121602 | |||
| 1700 | Ga0495599_0128792 | |||
| 1701 | Ga0495599_0191494 | |||
| 1702 | Ga0495599_0306147 | |||
| 1703 | Ga0495599_0644747 | |||
| 1704 | Ga0495623_0075175 | |||
| 1705 | Ga0495646_0066903 | |||
| 1706 | Ga0495646_0081016 | |||
| 1707 | Ga0495646_0119658 | |||
| 1708 | Ga0495646_0481522 | |||
| 1709 | Ga0495647_0008783 | |||
| 1710 | Ga0495647_0016367 | |||
| 1711 | Ga0495658_0002742 | |||
| 1712 | Ga0495658_0009522 | |||
| 1713 | Ga0495658_0247379 | |||
| 1714 | Ga0495669_0124118 | |||
| 1715 | Ga0495669_0198256 | |||
| 1716 | Ga0495669_0310627 | |||
| 1717 | Ga0495613_0081505 | |||
| 1718 | Ga0495613_0148666 | |||
| 1719 | Ga0495624_0000795 | |||
| 1720 | Ga0495624_0056079 | |||
| 1721 | Ga0495670_0469767 | |||
| 1722 | Ga0495671_0091675 | |||
| 1723 | Ga0495671_0437409 | |||
| 1724 | Ga0495649_0299125 | |||
| 1725 | Ga0495649_0408599 | |||
| 1726 | Ga0495589_0135740 | |||
| 1727 | Ga0495600_0093192 | |||
| 1728 | Ga0495600_0115281 | |||
| 1729 | Ga0495581_0000030 | |||
| 1730 | Ga0495581_0126320 | |||
| 1731 | Ga0495581_0144120 | |||
| 1732 | Ga0495581_0352195 | |||
| 1733 | Ga0495604_0105989 | |||
| 1734 | Ga0495604_0730681 | |||
| 1735 | Ga0495674_0012381 | |||
| 1736 | Ga0495674_0026440 | |||
| 1737 | Ga0495674_0170500 | |||
| 1738 | Ga0495674_0433544 | |||
| 1739 | Ga0495674_1157765 | |||
| 1740 | Ga0495672_0019292 | |||
| 1741 | Ga0495676_0028804 | |||
| 1742 | Ga0495676_0426845 | |||
| 1743 | Ga0495680_0139443 | |||
| 1744 | Ga0495680_0289892 | |||
| 1745 | Ga0495683_0383974 | |||
| 1746 | Ga0495675_0384899 | |||
| 1747 | Ga0495684_0021000 | |||
| 1748 | Ga0495684_0053297 | |||
| 1749 | Ga0495686_0085355 | |||
| 1750 | Ga0495686_0171913 | |||
| 1751 | Ga0495593_0000398 | |||
| 1752 | Ga0495593_0181923 | |||
| 1753 | Ga0495614_0046075 | |||
| 1754 | Ga0496100_0073875 | |||
| 1755 | Ga0496100_0369385 | |||
| 1756 | Ga0496100_0926204 | |||
| 1757 | Ga0496101_0859744 | |||
| 1758 | Ga0496101_1368899 | |||
| 1759 | Ga0496102_0082256 | |||
| 1760 | Ga0496102_0152685 | |||
| 1761 | Ga0496102_0260356 | |||
| 1762 | Ga0496102_0347549 | |||
| 1763 | Ga0496102_0401306 | |||
| 1764 | Ga0496103_0091837 | |||
| 1765 | Ga0496103_0135099 | |||
| 1766 | Ga0496103_0527388 | |||
| 1767 | Ga0496103_0636678 | |||
| 1768 | Ga0496104_0044883 | |||
| 1769 | Ga0496104_0463833 | |||
| 1770 | Ga0496104_0526120 | |||
| 1771 | Ga0496104_0548848 | |||
| 1772 | Ga0496104_0777062 | |||
| 1773 | Ga0496105_0051519 | |||
| 1774 | Ga0496105_0094396 | |||
| 1775 | Ga0496105_0737928 | |||
| 1776 | Ga0496105_0852426 | |||
| 1777 | Ga0496106_0411555 | |||
| 1778 | Ga0496106_0607760 | |||
| 1779 | Ga0496106_0628249 | |||
| 1780 | Ga0496106_0766736 | |||
| 1781 | Ga0496107_0037476 | |||
| 1782 | Ga0496107_0114537 | |||
| 1783 | Ga0496107_0316488 | |||
| 1784 | Ga0496107_1098843 | |||
| 1785 | Ga0496108_0036615 | |||
| 1786 | Ga0496108_0060709 | |||
| 1787 | Ga0496108_0443405 | |||
| 1788 | Ga0496108_0571795 | |||
| 1789 | Ga0496108_1132709 | |||
| 1790 | Ga0496109_0057722 | |||
| 1791 | Ga0496109_0353316 | |||
| 1792 | Ga0496109_1851968 | |||
| 1793 | Ga0496110_1252080 | |||
| 1794 | Ga0496111_0034277 | |||
| 1795 | Ga0496111_0680391 | |||
| 1796 | Ga0496112_0033543 | |||
| 1797 | Ga0496112_0049766 | |||
| 1798 | Ga0496112_0631524 | |||
| 1799 | Ga0496112_1010109 | |||
| 1800 | Ga0496113_0017212 | |||
| 1801 | Ga0496113_0032120 | |||
| 1802 | Ga0496114_0078476 | |||
| 1803 | Ga0496114_0420047 | |||
| 1804 | Ga0496115_0150310 | |||
| 1805 | Ga0496115_0281240 | |||
| 1806 | Ga0496115_0335240 | |||
| 1807 | Ga0496115_0439175 | |||
| 1808 | Ga0496116_0159299 | |||
| 1809 | Ga0496116_0235381 | |||
| 1810 | Ga0496117_0060867 | |||
| 1811 | Ga0496117_0277004 | |||
| 1812 | Ga0496118_0134441 | |||
| 1813 | Ga0496118_0283652 | |||
| 1814 | Ga0496118_0316502 | |||
| 1815 | Ga0496118_0410405 | |||
| 1816 | Ga0496119_0147277 | |||
| 1817 | Ga0496121_0000278 | |||
| 1818 | Ga0496121_0035287 | |||
| 1819 | Ga0496121_0071562 | |||
| 1820 | Ga0496121_0113457 | |||
| 1821 | Ga0496121_0125511 | |||
| 1822 | Ga0496121_0166716 | |||
| 1823 | Ga0496121_0200405 | |||
| 1824 | Ga0496121_0322537 | |||
| 1825 | Ga0496121_0518333 | |||
| 1826 | Ga0496124_0236071 | |||
| 1827 | Ga0496124_0248160 | |||
| 1828 | Ga0496125_0576892 | |||
| 1829 | Ga0496126_0034975 | |||
| 1830 | Ga0496126_0060610 | |||
| 1831 | Ga0496126_0162691 | |||
| 1832 | Ga0496126_0397020 | |||
| 1833 | Ga0496126_0889485 | |||
| 1834 | Ga0501033_0597713 | |||
| 1835 | Ga0501047_0041970 | |||
| 1836 | Ga0501048_0522722 | |||
| 1837 | Ga0501067_0050483 | |||
| 1838 | Ga0501070_0248474 | |||
| 1839 | Ga0501080_0128602 | |||
| 1840 | Ga0501044_0083186 | |||
| 1841 | nmdc:mga03683_210539_c1 | |||
| 1842 | nmdc:mga03683_265128_c1 | |||
| 1843 | nmdc:mga03n38_14558_c1 | |||
| 1844 | nmdc:mga00v17_539811_c1 | |||
| 1845 | nmdc:mga0yw44_117836_c1 | |||
| 1846 | nmdc:mga0yw44_464373_c1 | |||
| 1847 | nmdc:mga0yw44_644431_c1 | |||
| 1848 | nmdc:mga0yw44_804435_c1 | |||
| 1849 | nmdc:mga06z11_110457_c1 | |||
| 1850 | nmdc:mga06z11_11045_c1 | |||
| 1851 | nmdc:mga06z11_460298_c1 | |||
| 1852 | nmdc:mga06z11_583410_c1 | |||
| 1853 | nmdc:mga04h51_29235_c1 | |||
| 1854 | nmdc:mga07m45_13114_c1 | |||
| 1855 | nmdc:mga07m45_385630_c1 | |||
| 1856 | nmdc:mga07m45_64024_c1 | |||
| 1857 | nmdc:mga08y16_619065_c1 | |||
| 1858 | nmdc:mga0n895_378198_c1 | |||
| 1859 | nmdc:mga0rr50_393867_c1 | |||
| 1860 | nmdc:mga0a205_151249_c1 | |||
| 1861 | Ga0495601_0017256 | |||
| 1862 | Ga0495601_0136693 | |||
| 1863 | Ga0495601_0343333 | |||
| 1864 | Ga0500610_0041583 | |||
| 1865 | Ga0495655_0112132 | |||
| 1866 | Ga0495595_0219991 | |||
| 1867 | Ga0495619_0236354 | |||
| 1868 | Ga0495619_0241630 | |||
| 1869 | Ga0500643_000112 | |||
| 1870 | Ga0500644_0362520 | |||
| 1871 | Ga0500646_0155861 | |||
| 1872 | Ga0500583_0085964 | |||
| 1873 | Ga0500583_0166310 | |||
| 1874 | Ga0500651_0033603 | |||
| 1875 | Ga0500651_0258387 | |||
| 1876 | Ga0500566_0011791 | |||
| 1877 | Ga0500566_0043525 | |||
| 1878 | Ga0500640_009445 | |||
| 1879 | Ga0500641_0060146 | |||
| 1880 | Ga0500641_0147163 | |||
| 1881 | Ga0500650_0192335 | |||
| 1882 | Ga0500553_133854 | |||
| 1883 | Ga0500554_067639 | |||
| 1884 | Ga0500555_004419 | |||
| 1885 | Ga0500555_083377 | |||
| 1886 | Ga0500569_051549 | |||
| 1887 | Ga0500569_085728 | |||
| 1888 | Ga0500572_072413 | |||
| 1889 | Ga0500582_116210 | |||
| 1890 | Ga0500592_014816 | |||
| 1891 | Ga0500592_033615 | |||
| 1892 | Ga0500594_0011291 | |||
| 1893 | Ga0500594_0253250 | |||
| 1894 | Ga0500595_001016 | |||
| 1895 | Ga0500595_006803 | |||
| 1896 | Ga0500595_014698 | |||
| 1897 | Ga0500595_027760 | |||
| 1898 | Ga0500595_043871 | |||
| 1899 | Ga0500607_085637 | |||
| 1900 | Ga0500608_234605 | |||
| 1901 | Ga0500614_108692 | |||
| 1902 | Ga0500614_193217 | |||
| 1903 | Ga0500628_143339 | |||
| 1904 | Ga0500642_0000362 | |||
| 1905 | Ga0500642_0000641 | |||
| 1906 | Ga0500642_0066658 | |||
| 1907 | Ga0500655_040208 | |||
| 1908 | Ga0500658_0381921 | |||
| 1909 | Ga0500568_0067550 | |||
| 1910 | Ga0500568_0129529 | |||
| 1911 | Ga0500577_0098647 | |||
| 1912 | Ga0500577_0198761 | |||
| 1913 | Ga0500588_0101524 | |||
| 1914 | Ga0500589_226276 | |||
| 1915 | Ga0500589_262379 | |||
| 1916 | Ga0500590_147270 | |||
| 1917 | Ga0500590_223751 | |||
| 1918 | Ga0500603_121939 | |||
| 1919 | Ga0500604_0049059 | |||
| 1920 | Ga0500604_0089581 | |||
| 1921 | Ga0500604_0178318 | |||
| 1922 | Ga0500616_0139503 | |||
| 1923 | Ga0500620_238445 | |||
| 1924 | Ga0500622_0229091 | |||
| 1925 | Ga0500627_0125991 | |||
| 1926 | Ga0500627_0203270 | |||
| 1927 | Ga0500627_0348998 | |||
| 1928 | Ga0500634_0212441 | |||
| 1929 | Ga0500638_005456 | |||
| 1930 | Ga0500638_222988 | |||
| 1931 | Ga0500636_0276248 | |||
| 1932 | Ga0500636_0333676 | |||
| 1933 | Ga0500637_0000585 | |||
| 1934 | Ga0500637_0186572 | |||
| 1935 | Ga0500570_106621 | |||
| 1936 | Ga0500611_158246 | |||
| 1937 | Ga0500609_006652 | |||
| 1938 | Ga0500661_005871 | |||
| 1939 | Ga0587080_148527 | |||
| 1940 | Ga0587083_0147968 | |||
| 1941 | Ga0587068_101443 | |||
| 1942 | Ga0587072_123946 | |||
| 1943 | Ga0587075_040357 | |||
| 1944 | Ga0587076_075966 | |||
| 1945 | Ga0587071_046432 | |||
| 1946 | Ga0466962_0031673 | |||
| 1947 | Ga0466962_0128009 | |||
| 1948 | 8016565829 | |||
| 1949 | 2513659509 | |||
| 1950 | 2513718240 | |||
| 1951 | 2513859384 | |||
| 1952 | 2513921558 | |||
| 1953 | 2517889050 | |||
| 1954 | 2524537485 | |||
| 1955 | 2671124039 | |||
| 1956 | 2793072711 | |||
| 1957 | 2881368926 | |||
| 1958 | 2885377554 | |||
| 1959 | 2885415852 | |||
| 1960 | 2903758797 | |||
| 1961 | 2904691005 | |||
| 1962 | 2904708402 | |||
| 1963 | 2906613574 | |||
| 1964 | 2906635831 | |||
| 1965 | 2906668108 | |||
| 1966 | 2908747652 | |||
| 1967 | 2908757063 | |||
| 1968 | 2922363207 | |||
| 1969 | 2922434011 | |||
| 1970 | 2935636038 | |||
| 1971 | 2941512658 | |||
| 1972 | 2941520504 | |||
| 1973 | 2941528518 | |||
| 1974 | 3005475274 | |||
| 1975 | 8006936003 | |||
| 1976 | 8006975873 | |||
| 1977 | 8019562653 | |||
| 1978 | 8019572730 | |||
| 1979 | 8056691144 | |||
| 1980 | 8056971493 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sfn-assembly1.cif.gz_A | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.8715 | 7 | 158 |
| 7sfn-assembly1.cif.gz_A | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.8551 | 7 | 158 |
| 7sfn-assembly1.cif.gz_B | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.836 | 1 | 158 |
| 7sfn-assembly1.cif.gz_B | crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin | 0.831 | 1 | 158 |
| 7sfp-assembly1.cif.gz_A | crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin | 0.803 | 7 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q556I7_1_158_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.814 | 11 | 157 | 2.40.128.20 |
| af_A0A2C9C2Z6_71_253_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7961 | 11 | 157 | 2.40.128.20 |
| af_Q5N900_107_401_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7919 | 108 | 158 | 3.40.50.150 |
| af_Q22857_66_227_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7896 | 9 | 158 | 2.40.128.20 |
| 3wjeB00 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.7882 | 7 | 157 | 2.40.128.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537XP13-F1-model_v4 | DUF1579 domain-containing protein | 0.9873 | 33 | 158 |
|
| AF-A0A7Y4GZB7-F1-model_v4 | DUF1579 domain-containing protein | 0.9818 | 1 | 158 |
|
| AF-A0A534NU50-F1-model_v4 | DUF1579 domain-containing protein | 0.9817 | 5 | 157 |
|
| AF-A0A431RL37-F1-model_v4 | deleted | 0.9801 | 1 | 140 |
|
| AF-A0A537XP13-F1-model_v4 | DUF1579 domain-containing protein | 0.9796 | 33 | 158 |
|