F487607

General Info

Members Datasets Scaffolds Average Seq Length
990 387 1980 163

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10492224|Ga0105240_104922242
Length 189
Sequence MSMRMSSVIRRAVCPGSFDPVTNGHLDIIGRAANLYDELVVAVLINKSKSSLFTVDERIAMLTDVTAEYGNVRVDSFHGLLVDYCRANQIPVVVKGLRAVSDFDYELQMAQMNRGLAGVDTLFMPTNPEYSFLASSLVKEIATYGGDVTSLLPDAVHKQLLSRLAERAQHERAQHVDSSTTSAERSEQP

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
116 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
251 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
260 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
272 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
369 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
370 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
371 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
372 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
373 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
374 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
375 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
376 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
377 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
378 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
379 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
380 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
381 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
382 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
383 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
384 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
385 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
386 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
387 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 1.41
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.95
Rhizosphere 91.72
Stem 0
Stem Tuber 0.1
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10492224 3300009093 Bacteria 1365
2 JGI24739J22299_10020085 3300001989 Bacteria 2386
3 JGI24737J22298_10007912 3300001990 Bacteria 3577
4 JGI24737J22298_10050823 3300001990 Bacteria 1259
5 JGI24737J22298_10116046 3300001990 Bacteria 791
6 JGI24743J22301_10062833 3300001991 Bacteria 767
7 JGI24735J21928_10045306 3300002067 Bacteria 1277
8 JGI24735J21928_10185665 3300002067 Bacteria 602
9 JGI24738J21930_10028319 3300002075 Bacteria 1147
10 JGI25406J46586_10062510 3300003203 Bacteria 1196
11 JGI25407J50210_10045653 3300003373 Bacteria 1116
12 JGI25405J52794_10028845 3300003911 Bacteria 1147
13 Ga0070658_10037109 3300005327 Bacteria 3927
14 Ga0070658_10151448 3300005327 Bacteria 1942
15 Ga0070658_10159873 3300005327 Bacteria 1890
16 Ga0070676_10237223 3300005328 Bacteria 1211
17 Ga0070676_10283069 3300005328 Bacteria 1118
18 Ga0070683_100014452 3300005329 Bacteria 6906
19 Ga0070683_100107472 3300005329 Bacteria 2631
20 Ga0070683_100808326 3300005329 Bacteria 899
21 Ga0070690_100280286 3300005330 Bacteria 1189
22 Ga0070670_100120405 3300005331 Bacteria 2264
23 Ga0070670_100456509 3300005331 Bacteria 1133
24 Ga0070677_10536144 3300005333 Bacteria 639
25 Ga0068869_100001830 3300005334 Bacteria 12777
26 Ga0068869_100013851 3300005334 Bacteria 5376
27 Ga0070666_10008045 3300005335 Bacteria 6524
28 Ga0070666_10010640 3300005335 Bacteria 5760
29 Ga0070680_100219847 3300005336 Bacteria 1603
30 Ga0070680_100290920 3300005336 Bacteria 1385
31 Ga0070682_100068612 3300005337 Bacteria 2262
32 Ga0068868_100019172 3300005338 Bacteria 5124
33 Ga0068868_100044868 3300005338 Bacteria 3457
34 Ga0068868_100117031 3300005338 Bacteria 2171
35 Ga0068868_100747426 3300005338 Bacteria 878
36 Ga0070660_100029442 3300005339 Bacteria 4115
37 Ga0070660_100496170 3300005339 Bacteria 1015
38 Ga0070689_100039992 3300005340 Bacteria 3593
39 Ga0070691_10323694 3300005341 Bacteria 849
40 Ga0070687_100015748 3300005343 Bacteria 3427
41 Ga0070687_100107291 3300005343 Bacteria 1574
42 Ga0070661_100280650 3300005344 Bacteria 1292
43 Ga0070692_10003704 3300005345 Bacteria 6267
44 Ga0070692_10016341 3300005345 Bacteria 3529
45 Ga0070668_100003437 3300005347 Bacteria 11692
46 Ga0070668_100006857 3300005347 Bacteria 8446
47 Ga0070668_100026621 3300005347 Bacteria 4390
48 Ga0070668_100532772 3300005347 Bacteria 1020
49 Ga0070669_100105295 3300005353 Bacteria 2134
50 Ga0070675_100000145 3300005354 Bacteria 42348
51 Ga0070675_100049433 3300005354 Bacteria 3452
52 Ga0070671_100001993 3300005355 Bacteria 15683
53 Ga0070671_100155998 3300005355 Bacteria 1929
54 Ga0070674_100376460 3300005356 Bacteria 1154
55 Ga0070673_100721548 3300005364 Bacteria 916
56 Ga0070688_100115244 3300005365 Bacteria 1793
57 Ga0070659_100050002 3300005366 Bacteria 3288
58 Ga0070659_100156150 3300005366 Bacteria 1863
59 Ga0070659_100263424 3300005366 Bacteria 1430
60 Ga0070667_100003161 3300005367 Bacteria 14113
61 Ga0070667_100009470 3300005367 Bacteria 8079
62 Ga0070709_10248084 3300005434 Bacteria 1281
63 Ga0070709_10250149 3300005434 Bacteria 1276
64 Ga0070709_11300033 3300005434 Bacteria 587
65 Ga0070714_100151905 3300005435 Bacteria 2088
66 Ga0070714_100460076 3300005435 Bacteria 1209
67 Ga0070714_100816398 3300005435 Bacteria 903
68 Ga0070713_100031457 3300005436 Bacteria 4227
69 Ga0070713_100049113 3300005436 Bacteria 3479
70 Ga0070713_100056458 3300005436 Bacteria 3266
71 Ga0070713_100115918 3300005436 Bacteria 2342
72 Ga0070713_100894992 3300005436 Bacteria 854
73 Ga0070710_10353383 3300005437 Bacteria 973
74 Ga0070710_10407150 3300005437 Bacteria 913
75 Ga0070710_10564315 3300005437 Bacteria 788
76 Ga0070701_10069060 3300005438 Bacteria 1884
77 Ga0070701_10245009 3300005438 Bacteria 1080
78 Ga0070711_100007880 3300005439 Bacteria 6493
79 Ga0070705_100116635 3300005440 Bacteria 1716
80 Ga0070700_100000164 3300005441 Bacteria 38488
81 Ga0070700_100007339 3300005441 Bacteria 5946
82 Ga0070700_100944242 3300005441 Bacteria 705
83 Ga0070694_100006357 3300005444 Bacteria 7167
84 Ga0070694_100167136 3300005444 Bacteria 1618
85 Ga0070708_100416689 3300005445 Bacteria 1267
86 Ga0070663_100000675 3300005455 Bacteria 18307
87 Ga0070663_100010524 3300005455 Bacteria 5766
88 Ga0070663_100047088 3300005455 Bacteria 3054
89 Ga0070663_100083440 3300005455 Bacteria 2353
90 Ga0070663_100251146 3300005455 Bacteria 1400
91 Ga0070663_100267598 3300005455 Bacteria 1358
92 Ga0070678_100001267 3300005456 Bacteria 13414
93 Ga0070678_100132988 3300005456 Bacteria 1979
94 Ga0070662_100014391 3300005457 Bacteria 5284
95 Ga0070662_100225224 3300005457 Bacteria 1498
96 Ga0070681_10854719 3300005458 Bacteria 828
97 Ga0070685_10171120 3300005466 Bacteria 1392
98 Ga0070706_100283652 3300005467 Bacteria 1546
99 Ga0070706_101162971 3300005467 Bacteria 709
100 Ga0070707_100057492 3300005468 Bacteria 3731
101 Ga0070707_100543209 3300005468 Bacteria 1124
102 Ga0070707_100620258 3300005468 Bacteria 1044
103 Ga0070698_100318881 3300005471 Bacteria 1485
104 Ga0070699_100070298 3300005518 Bacteria 3043
105 Ga0070679_100114755 3300005530 Bacteria 2679
106 Ga0070679_100695174 3300005530 Bacteria 960
107 Ga0070684_100142337 3300005535 Bacteria 2169
108 Ga0070684_100229242 3300005535 Bacteria 1696
109 Ga0070697_100770029 3300005536 Bacteria 851
110 Ga0068853_100141807 3300005539 Bacteria 2157
111 Ga0068853_100153332 3300005539 Bacteria 2075
112 Ga0068853_100361814 3300005539 Bacteria 1352
113 Ga0068853_100606802 3300005539 Bacteria 1040
114 Ga0070672_100032755 3300005543 Bacteria 3927
115 Ga0070672_100246585 3300005543 Bacteria 1504
116 Ga0070686_100233093 3300005544 Bacteria 1336
117 Ga0070695_101067412 3300005545 Bacteria 659
118 Ga0070696_100030170 3300005546 Bacteria 3711
119 Ga0070693_100106982 3300005547 Bacteria 1714
120 Ga0070665_100000757 3300005548 Bacteria 42748
121 Ga0070665_100051417 3300005548 Bacteria 4132
122 Ga0070665_100383112 3300005548 Bacteria 1414
123 Ga0070704_100157914 3300005549 Bacteria 1790
124 Ga0070704_100184101 3300005549 Bacteria 1673
125 Ga0068855_100004304 3300005563 Bacteria 17405
126 Ga0068855_100010280 3300005563 Bacteria 11287
127 Ga0068855_100014029 3300005563 Bacteria 9658
128 Ga0068855_100073171 3300005563 Bacteria 3982
129 Ga0068855_100250296 3300005563 Bacteria 1976
130 Ga0068855_100340943 3300005563 Bacteria 1652
131 Ga0068855_100388279 3300005563 Bacteria 1532
132 Ga0070664_100002843 3300005564 Bacteria 14002
133 Ga0070664_100543117 3300005564 Bacteria 1074
134 Ga0068854_100042153 3300005578 Bacteria 3229
135 Ga0068854_100314709 3300005578 Bacteria 1270
136 Ga0068854_100707372 3300005578 Bacteria 870
137 Ga0068856_100045377 3300005614 Bacteria 4327
138 Ga0068856_100074801 3300005614 Bacteria 3354
139 Ga0068856_100075064 3300005614 Bacteria 3349
140 Ga0068856_100159414 3300005614 Bacteria 2266
141 Ga0068856_100235318 3300005614 Bacteria 1847
142 Ga0068856_100352643 3300005614 Bacteria 1490
143 Ga0070702_100002421 3300005615 Bacteria 8041
144 Ga0070702_100099669 3300005615 Bacteria 1779
145 Ga0068852_100020897 3300005616 Bacteria 5212
146 Ga0068852_100163472 3300005616 Bacteria 2080
147 Ga0068852_100417109 3300005616 Bacteria 1323
148 Ga0068859_100002002 3300005617 Bacteria 20795
149 Ga0068859_100002765 3300005617 Bacteria 17784
150 Ga0068859_100024225 3300005617 Bacteria 6090
151 Ga0068859_100394406 3300005617 Bacteria 1480
152 Ga0068864_100005426 3300005618 Bacteria 10454
153 Ga0068864_100028621 3300005618 Bacteria 4712
154 Ga0068866_10179024 3300005718 Bacteria 1251
155 Ga0068866_10392685 3300005718 Bacteria 893
156 Ga0068861_100003837 3300005719 Bacteria 10034
157 Ga0068861_100124345 3300005719 Bacteria 2085
158 Ga0068861_100310298 3300005719 Bacteria 1370
159 Ga0068851_10015584 3300005834 Bacteria 3623
160 Ga0068851_10053701 3300005834 Bacteria 2052
161 Ga0068870_10004082 3300005840 Bacteria 6245
162 Ga0068870_10171209 3300005840 Bacteria 1296
163 Ga0068870_10419495 3300005840 Bacteria 875
164 Ga0068863_100000677 3300005841 Bacteria 34450
165 Ga0068863_100001145 3300005841 Bacteria 26469
166 Ga0068863_100126068 3300005841 Bacteria 2442
167 Ga0068863_100155931 3300005841 Bacteria 2186
168 Ga0068858_100017987 3300005842 Bacteria 6620
169 Ga0068858_100026937 3300005842 Bacteria 5339
170 Ga0068858_100111932 3300005842 Bacteria 2550
171 Ga0068858_100405824 3300005842 Bacteria 1310
172 Ga0068860_100000214 3300005843 Bacteria 90752
173 Ga0068860_100046841 3300005843 Bacteria 4122
174 Ga0068860_100143083 3300005843 Bacteria 2299
175 Ga0068862_100031007 3300005844 Bacteria 4509
176 Ga0068862_100168726 3300005844 Bacteria 1958
177 Ga0081455_10000856 3300005937 Bacteria 39231
178 Ga0081455_10001927 3300005937 Bacteria 24929
179 Ga0081455_10004130 3300005937 Bacteria 16420
180 Ga0081455_10012269 3300005937 Bacteria 8552
181 Ga0081455_10346067 3300005937 Bacteria 1050
182 Ga0081538_10001015 3300005981 Bacteria 29959
183 Ga0081538_10054137 3300005981 Bacteria 2376
184 Ga0081540_1013636 3300005983 Bacteria 5270
185 Ga0081540_1088482 3300005983 Bacteria 1369
186 Ga0081539_10000314 3300005985 Bacteria 108451
187 Ga0081539_10017187 3300005985 Bacteria 5095
188 Ga0070717_10133014 3300006028 Bacteria 2140
189 Ga0070717_10271583 3300006028 Bacteria 1502
190 Ga0075432_10009343 3300006058 Bacteria 3338
191 Ga0075432_10019149 3300006058 Bacteria 2337
192 Ga0075432_10115423 3300006058 Bacteria 1004
193 Ga0070716_100005395 3300006173 Bacteria 6189
194 Ga0070716_100110044 3300006173 Bacteria 1705
195 Ga0070712_100170895 3300006175 Bacteria 1686
196 Ga0070712_100369286 3300006175 Bacteria 1179
197 Ga0097621_100013167 3300006237 Bacteria 6153
198 Ga0097621_100163114 3300006237 Bacteria 1917
199 Ga0068871_100030952 3300006358 Bacteria 4217
200 Ga0068871_100131377 3300006358 Bacteria 2123
201 Ga0075428_100072107 3300006844 Bacteria 3774
202 Ga0075430_100040154 3300006846 Bacteria 3961
203 Ga0075430_100637422 3300006846 Bacteria 879
204 Ga0075431_100005266 3300006847 Bacteria 12742
205 Ga0075431_100145167 3300006847 Bacteria 2445
206 Ga0075431_100230894 3300006847 Bacteria 1885
207 Ga0075431_100985455 3300006847 Bacteria 810
208 Ga0075433_10006200 3300006852 Bacteria 9432
209 Ga0075433_10062775 3300006852 Bacteria 3254
210 Ga0075433_10217963 3300006852 Bacteria 1696
211 Ga0075434_100039963 3300006871 Bacteria 4646
212 Ga0075434_100447822 3300006871 Bacteria 1312
213 Ga0075429_100018670 3300006880 Bacteria 6005
214 Ga0075429_100477292 3300006880 Bacteria 1093
215 Ga0068865_100116516 3300006881 Bacteria 1979
216 Ga0075436_100033515 3300006914 Bacteria 3540
217 Ga0075436_100084376 3300006914 Bacteria 2204
218 Ga0097620_100002002 3300006931 Bacteria 20795
219 Ga0097620_100002765 3300006931 Bacteria 17784
220 Ga0097620_100024224 3300006931 Bacteria 6090
221 Ga0097620_100394412 3300006931 Bacteria 1480
222 Ga0075435_100001179 3300007076 Bacteria 16688
223 Ga0075435_100033992 3300007076 Bacteria 4036
224 Ga0099794_10094948 3300007265 Bacteria 1483
225 Ga0099795_10138581 3300007788 Bacteria 988
226 Ga0105251_10029047 3300009011 Bacteria 2788
227 Ga0105251_10095888 3300009011 Bacteria 1359
228 Ga0105240_10006845 3300009093 Bacteria 16667
229 Ga0105240_10044174 3300009093 Bacteria 5665
230 Ga0105240_10059388 3300009093 Bacteria 4773
231 Ga0105240_10081917 3300009093 Bacteria 3964
232 Ga0105240_10098365 3300009093 Bacteria 3563
233 Ga0105240_10323450 3300009093 Bacteria 1757
234 Ga0111539_10001513 3300009094 Bacteria 31034
235 Ga0111539_10056914 3300009094 Bacteria 4646
236 Ga0111539_10073676 3300009094 Bacteria 4025
237 Ga0111539_10102794 3300009094 Bacteria 3354
238 Ga0105245_10005340 3300009098 Bacteria 11287
239 Ga0105245_10006149 3300009098 Bacteria 10565
240 Ga0105245_10319276 3300009098 Bacteria 1529
241 Ga0105245_10368289 3300009098 Bacteria 1428
242 Ga0105245_10908495 3300009098 Bacteria 922
243 Ga0105247_10012824 3300009101 Bacteria 5030
244 Ga0105247_10073481 3300009101 Bacteria 2143
245 Ga0105247_10091776 3300009101 Bacteria 1929
246 Ga0105247_10144070 3300009101 Bacteria 1564
247 Ga0114129_10004688 3300009147 Bacteria 19312
248 Ga0114129_10068460 3300009147 Bacteria 4949
249 Ga0114129_10092703 3300009147 Bacteria 4184
250 Ga0105243_10099971 3300009148 Bacteria 2406
251 Ga0105243_10123218 3300009148 Bacteria 2189
252 Ga0105243_10362118 3300009148 Bacteria 1335
253 Ga0105243_10529299 3300009148 Bacteria 1122
254 Ga0105241_10026727 3300009174 Bacteria 4296
255 Ga0105241_10033989 3300009174 Bacteria 3830
256 Ga0105241_10064345 3300009174 Bacteria 2831
257 Ga0105241_10115248 3300009174 Bacteria 2157
258 Ga0105242_10433186 3300009176 Bacteria 1235
259 Ga0105237_10044946 3300009545 Bacteria 4447
260 Ga0105237_10076020 3300009545 Bacteria 3349
261 Ga0105237_10195463 3300009545 Bacteria 2022
262 Ga0105237_10289532 3300009545 Bacteria 1641
263 Ga0105237_10399907 3300009545 Bacteria 1378
264 Ga0105238_10067235 3300009551 Bacteria 3585
265 Ga0105238_10570210 3300009551 Bacteria 1137
266 Ga0105238_11114820 3300009551 Bacteria 812
267 Ga0105238_11626699 3300009551 Bacteria 676
268 Ga0105249_10026601 3300009553 Bacteria 5216
269 Ga0105249_10145213 3300009553 Bacteria 2279
270 Ga0105249_10191615 3300009553 Bacteria 1996
271 Ga0105249_10291789 3300009553 Bacteria 1633
272 Ga0105249_10413166 3300009553 Bacteria 1382
273 Ga0105030_102902 3300009987 Bacteria 1486
274 Ga0105028_100390 3300009993 Bacteria 4706
275 Ga0105028_141640 3300009993 Unclassified 518
276 Ga0099796_10166112 3300010159 Bacteria 878
277 Ga0099796_10362534 3300010159 Bacteria 627
278 Ga0105239_10033309 3300010375 Bacteria 5659
279 Ga0105239_10063795 3300010375 Bacteria 4044
280 Ga0105239_10142088 3300010375 Bacteria 2675
281 Ga0105239_10236700 3300010375 Bacteria 2049
282 Ga0105239_10266904 3300010375 Bacteria 1924
283 Ga0105246_10000043 3300011119 Bacteria 47690
284 Ga0105246_10004064 3300011119 Bacteria 8888
285 Ga0105246_10363077 3300011119 Bacteria 1190
286 Ga0157373_10241974 3300013100 Bacteria 1275
287 Ga0157373_10301635 3300013100 Bacteria 1137
288 Ga0157371_10004316 3300013102 Bacteria 12464
289 Ga0157371_10023607 3300013102 Bacteria 4498
290 Ga0157370_10040635 3300013104 Bacteria 4490
291 Ga0157370_10072062 3300013104 Bacteria 3260
292 Ga0157370_10310090 3300013104 Bacteria 1456
293 Ga0157369_10104029 3300013105 Bacteria 3024
294 Ga0157369_10109050 3300013105 Bacteria 2944
295 Ga0157369_11154483 3300013105 Bacteria 791
296 Ga0157374_10090469 3300013296 Bacteria 2918
297 Ga0157374_10359219 3300013296 Bacteria 1448
298 Ga0157378_10071247 3300013297 Bacteria 3121
299 Ga0157378_10994549 3300013297 Bacteria 873
300 Ga0163162_10014741 3300013306 Bacteria 7639
301 Ga0163162_10311610 3300013306 Bacteria 1706
302 Ga0163162_11223651 3300013306 Bacteria 852
303 Ga0163162_11349162 3300013306 Bacteria 811
304 Ga0157372_10000044 3300013307 Bacteria 152637
305 Ga0157372_10202141 3300013307 Bacteria 2301
306 Ga0157372_10777466 3300013307 Bacteria 1113
307 Ga0157375_10028197 3300013308 Bacteria 5259
308 Ga0157375_10275358 3300013308 Bacteria 1845
309 Ga0163163_10033528 3300014325 Bacteria 4968
310 Ga0163163_10523207 3300014325 Bacteria 1248
311 Ga0163163_10756768 3300014325 Bacteria 1035
312 Ga0163163_10935708 3300014325 Bacteria 930
313 Ga0157380_10092763 3300014326 Bacteria 2496
314 Ga0182008_10103200 3300014497 Bacteria 1410
315 Ga0157377_10003703 3300014745 Bacteria 6934
316 Ga0157377_10013082 3300014745 Bacteria 4191
317 Ga0157377_10214301 3300014745 Bacteria 1229
318 Ga0157379_10029889 3300014968 Bacteria 4846
319 Ga0157379_10244323 3300014968 Bacteria 1628
320 Ga0157376_10010771 3300014969 Bacteria 6709
321 Ga0157376_10304946 3300014969 Bacteria 1509
322 Ga0163161_10020614 3300017792 Bacteria 4628
323 Ga0163161_10506359 3300017792 Bacteria 984
324 Ga0206356_10753640 3300020070 Bacteria 775
325 Ga0206349_1470408 3300020075 Bacteria 898
326 Ga0206355_1357797 3300020076 Bacteria 718
327 Ga0206350_10968991 3300020080 Bacteria 3012
328 Ga0206354_10015922 3300020081 Bacteria 1059
329 Ga0206354_10607060 3300020081 Bacteria 1118
330 Ga0206354_11197133 3300020081 Bacteria 1154
331 Ga0206353_10374875 3300020082 Bacteria 3686
332 Ga0206353_10375344 3300020082 Bacteria 2323
333 Ga0206353_11751898 3300020082 Bacteria 2117
334 Ga0213872_10164806 3300021361 Bacteria 963
335 Ga0213872_10169852 3300021361 Bacteria 946
336 Ga0213876_10346643 3300021384 Bacteria 790
337 Ga0224712_10003123 3300022467 Bacteria 4233
338 Ga0224712_10048813 3300022467 Bacteria 1636
339 Ga0224712_10361128 3300022467 Bacteria 688
340 Ga0207713_1085318 3300025735 Bacteria 1124
341 Ga0207653_10029558 3300025885 Bacteria 1765
342 Ga0207692_10294763 3300025898 Bacteria 985
343 Ga0207642_10165566 3300025899 Bacteria 1191
344 Ga0207642_10225428 3300025899 Bacteria 1050
345 Ga0207710_10109892 3300025900 Bacteria 1308
346 Ga0207688_10005818 3300025901 Bacteria 6711
347 Ga0207688_10217001 3300025901 Bacteria 1151
348 Ga0207680_10021603 3300025903 Bacteria 3485
349 Ga0207647_10005262 3300025904 Bacteria 9523
350 Ga0207647_10015085 3300025904 Bacteria 5309
351 Ga0207647_10124091 3300025904 Bacteria 1521
352 Ga0207647_10168969 3300025904 Bacteria 1274
353 Ga0207647_10186303 3300025904 Bacteria 1204
354 Ga0207647_10228151 3300025904 Bacteria 1072
355 Ga0207685_10004863 3300025905 Bacteria 3473
356 Ga0207699_10002396 3300025906 Bacteria 8853
357 Ga0207699_10691371 3300025906 Bacteria 746
358 Ga0207645_10074778 3300025907 Bacteria 2169
359 Ga0207645_10152119 3300025907 Bacteria 1511
360 Ga0207643_10000255 3300025908 Bacteria 37233
361 Ga0207643_10176293 3300025908 Bacteria 1292
362 Ga0207643_10188212 3300025908 Bacteria 1252
363 Ga0207705_10017694 3300025909 Bacteria 5099
364 Ga0207705_10922438 3300025909 Bacteria 676
365 Ga0207684_10264165 3300025910 Bacteria 1485
366 Ga0207654_10013466 3300025911 Bacteria 4208
367 Ga0207654_10766095 3300025911 Bacteria 696
368 Ga0207707_10221366 3300025912 Bacteria 1647
369 Ga0207707_10460312 3300025912 Bacteria 1088
370 Ga0207695_10033289 3300025913 Bacteria 5624
371 Ga0207695_10041233 3300025913 Bacteria 4942
372 Ga0207695_10174565 3300025913 Bacteria 2072
373 Ga0207695_10196804 3300025913 Bacteria 1931
374 Ga0207695_10511307 3300025913 Bacteria 1083
375 Ga0207695_10519048 3300025913 Bacteria 1073
376 Ga0207671_10098280 3300025914 Bacteria 2214
377 Ga0207671_10131878 3300025914 Bacteria 1918
378 Ga0207671_10262904 3300025914 Bacteria 1358
379 Ga0207693_10000510 3300025915 Bacteria 35052
380 Ga0207693_10369168 3300025915 Bacteria 1122
381 Ga0207663_10162755 3300025916 Bacteria 1577
382 Ga0207660_10033041 3300025917 Bacteria 3575
383 Ga0207662_10010838 3300025918 Bacteria 5039
384 Ga0207662_10527207 3300025918 Bacteria 816
385 Ga0207657_10003758 3300025919 Bacteria 16133
386 Ga0207657_10090962 3300025919 Bacteria 2546
387 Ga0207657_10533622 3300025919 Bacteria 918
388 Ga0207649_10070873 3300025920 Bacteria 2224
389 Ga0207652_10017664 3300025921 Bacteria 5840
390 Ga0207652_10159459 3300025921 Bacteria 2022
391 Ga0207652_10844164 3300025921 Bacteria 811
392 Ga0207646_10626235 3300025922 Bacteria 965
393 Ga0207681_10361795 3300025923 Bacteria 1164
394 Ga0207694_10214648 3300025924 Bacteria 1568
395 Ga0207694_10425935 3300025924 Bacteria 1106
396 Ga0207694_10634291 3300025924 Bacteria 900
397 Ga0207650_10075611 3300025925 Bacteria 2542
398 Ga0207659_10013890 3300025926 Bacteria 5177
399 Ga0207659_10049580 3300025926 Bacteria 2979
400 Ga0207687_10017746 3300025927 Bacteria 4691
401 Ga0207687_10042459 3300025927 Bacteria 3129
402 Ga0207687_10052780 3300025927 Bacteria 2838
403 Ga0207687_10081087 3300025927 Bacteria 2344
404 Ga0207687_10181917 3300025927 Bacteria 1629
405 Ga0207687_10385726 3300025927 Bacteria 1149
406 Ga0207700_10046571 3300025928 Bacteria 3208
407 Ga0207700_10215065 3300025928 Bacteria 1627
408 Ga0207700_10971895 3300025928 Bacteria 760
409 Ga0207700_11417052 3300025928 Bacteria 618
410 Ga0207664_10246224 3300025929 Bacteria 1558
411 Ga0207644_10227608 3300025931 Bacteria 1480
412 Ga0207690_10643543 3300025932 Bacteria 868
413 Ga0207706_10003631 3300025933 Bacteria 14741
414 Ga0207706_10166454 3300025933 Bacteria 1937
415 Ga0207706_10167910 3300025933 Unclassified 1928
416 Ga0207686_10750436 3300025934 Bacteria 779
417 Ga0207686_11199305 3300025934 Bacteria 621
418 Ga0207709_10270334 3300025935 Bacteria 1251
419 Ga0207670_10058601 3300025936 Bacteria 2616
420 Ga0207669_10405452 3300025937 Bacteria 1069
421 Ga0207704_10374554 3300025938 Bacteria 1116
422 Ga0207665_10004900 3300025939 Bacteria 8922
423 Ga0207691_10023934 3300025940 Bacteria 5747
424 Ga0207691_10262974 3300025940 Unclassified 1487
425 Ga0207711_10325713 3300025941 Bacteria 1420
426 Ga0207689_10002623 3300025942 Bacteria 16648
427 Ga0207689_10006181 3300025942 Bacteria 10599
428 Ga0207661_10005765 3300025944 Bacteria 8732
429 Ga0207661_10009531 3300025944 Bacteria 6971
430 Ga0207661_10089286 3300025944 Bacteria 2564
431 Ga0207661_10182989 3300025944 Bacteria 1832
432 Ga0207679_10004056 3300025945 Bacteria 9099
433 Ga0207679_10010471 3300025945 Bacteria 5971
434 Ga0207679_10015188 3300025945 Bacteria 5080
435 Ga0207679_10180868 3300025945 Bacteria 1744
436 Ga0207667_10107338 3300025949 Bacteria 2880
437 Ga0207667_10318290 3300025949 Bacteria 1589
438 Ga0207651_11302496 3300025960 Bacteria 653
439 Ga0207712_10055807 3300025961 Bacteria 2781
440 Ga0207712_10440426 3300025961 Bacteria 1103
441 Ga0207712_10534287 3300025961 Bacteria 1007
442 Ga0207712_10883621 3300025961 Bacteria 789
443 Ga0207668_10025417 3300025972 Bacteria 3832
444 Ga0207668_10069537 3300025972 Bacteria 2507
445 Ga0207640_10366577 3300025981 Bacteria 1163
446 Ga0207640_10374123 3300025981 Bacteria 1152
447 Ga0207640_10564494 3300025981 Bacteria 958
448 Ga0207658_10016590 3300025986 Bacteria 5069
449 Ga0207658_10043343 3300025986 Bacteria 3270
450 Ga0207677_10011844 3300026023 Bacteria 4989
451 Ga0207677_10030853 3300026023 Bacteria 3427
452 Ga0207677_10142971 3300026023 Bacteria 1835
453 Ga0207677_10175387 3300026023 Bacteria 1681
454 Ga0207677_10527144 3300026023 Bacteria 1026
455 Ga0207703_10013801 3300026035 Bacteria 6296
456 Ga0207703_10041423 3300026035 Bacteria 3689
457 Ga0207703_10179145 3300026035 Bacteria 1869
458 Ga0207639_10487861 3300026041 Bacteria 1124
459 Ga0207678_10000077 3300026067 Bacteria 78930
460 Ga0207678_10000346 3300026067 Bacteria 41986
461 Ga0207678_10001130 3300026067 Bacteria 24459
462 Ga0207678_10067839 3300026067 Bacteria 3061
463 Ga0207678_10184182 3300026067 Bacteria 1783
464 Ga0207678_10208382 3300026067 Bacteria 1672
465 Ga0207708_10000110 3300026075 Bacteria 62957
466 Ga0207708_10015918 3300026075 Bacteria 5647
467 Ga0207708_10052736 3300026075 Bacteria 3098
468 Ga0207708_10060832 3300026075 Bacteria 2883
469 Ga0207702_10000631 3300026078 Bacteria 38615
470 Ga0207702_10009206 3300026078 Bacteria 8304
471 Ga0207702_10067537 3300026078 Bacteria 3069
472 Ga0207702_10200106 3300026078 Bacteria 1851
473 Ga0207702_10212286 3300026078 Bacteria 1800
474 Ga0207641_10000499 3300026088 Bacteria 44189
475 Ga0207641_10002176 3300026088 Bacteria 18459
476 Ga0207641_10656590 3300026088 Bacteria 1030
477 Ga0207641_11054361 3300026088 Bacteria 811
478 Ga0207676_10016110 3300026095 Bacteria 5406
479 Ga0207674_10020922 3300026116 Bacteria 7058
480 Ga0207674_10395918 3300026116 Bacteria 1335
481 Ga0207675_100039773 3300026118 Bacteria 4389
482 Ga0207675_100335288 3300026118 Bacteria 1479
483 Ga0207683_10000342 3300026121 Bacteria 42329
484 Ga0207683_10000915 3300026121 Bacteria 27154
485 Ga0207683_10316100 3300026121 Bacteria 1430
486 Ga0207698_10014073 3300026142 Bacteria 5304
487 Ga0207698_10057689 3300026142 Bacteria 3005
488 Ga0207698_10202223 3300026142 Bacteria 1780
489 Ga0209588_1160905 3300027671 Bacteria 709
490 Ga0207428_10003594 3300027907 Bacteria 14973
491 Ga0207428_10008491 3300027907 Bacteria 9276
492 Ga0268266_10010410 3300028379 Bacteria 8128
493 Ga0268266_10030224 3300028379 Bacteria 4604
494 Ga0268266_10072788 3300028379 Bacteria 2981
495 Ga0268266_10577085 3300028379 Bacteria 1079
496 Ga0268265_10008211 3300028380 Bacteria 7054
497 Ga0268265_10240267 3300028380 Bacteria 1598
498 Ga0268265_10489557 3300028380 Bacteria 1157
499 Ga0268264_10000027 3300028381 Bacteria 440852
500 Ga0268264_10255781 3300028381 Bacteria 1629
501 Ga0307515_10017393 3300028794 Bacteria 13099
502 Ga0307515_10854143 3300028794 Bacteria 537
503 Ga0265760_10018948 3300031090 Bacteria 1983
504 Ga0265340_10057467 3300031247 Bacteria 1870
505 Ga0307508_10489127 3300031616 Bacteria 825
506 Ga0307514_10356424 3300031649 Bacteria 776
507 Ga0316576_10001887 3300031727 Bacteria 11655
508 Ga0316576_10024896 3300031727 Bacteria 4184
509 Ga0316578_10089013 3300031728 Bacteria 1842
510 Ga0307405_10268778 3300031731 Bacteria 1278
511 Ga0307405_10436909 3300031731 Bacteria 1034
512 Ga0316577_10000803 3300031733 Bacteria 13607
513 Ga0307413_10270623 3300031824 Bacteria 1272
514 Ga0307518_10020035 3300031838 Bacteria 4802
515 Ga0307406_10024433 3300031901 Bacteria 3610
516 Ga0307406_10181412 3300031901 Bacteria 1533
517 Ga0307406_10246160 3300031901 Bacteria 1344
518 Ga0307409_100068776 3300031995 Bacteria 2802
519 Ga0307409_100964642 3300031995 Bacteria 869
520 Ga0307416_100120946 3300032002 Bacteria 2333
521 Ga0307415_100018917 3300032126 Bacteria 4171
522 Ga0307415_100020868 3300032126 Bacteria 4011
523 Ga0307415_100040696 3300032126 Bacteria 3081
524 Ga0307415_100062408 3300032126 Bacteria 2585
525 Ga0307415_100170276 3300032126 Bacteria 1697
526 Ga0307415_100350405 3300032126 Bacteria 1243
527 Ga0307415_100780178 3300032126 Bacteria 870
528 Ga0307507_10096532 3300033179 Bacteria 2499
529 Ga0307507_10336648 3300033179 Bacteria 897
530 Ga0307510_10038091 3300033180 Bacteria 5320
531 Ga0373948_0022349 3300034817 Bacteria 1219
532 Ga0373958_0071624 3300034819 Bacteria 770
533 Ga0373938_0030561 3300034957 Bacteria 1150
534 Ga0373928_0091798 3300035084 Bacteria 780
535 Ga0373929_0074956 3300035085 Bacteria 815
536 Ga0373952_0001893 3300035092 Bacteria 3800
537 Ga0373923_0348545 3300035111 Bacteria 707
538 Ga0373932_0020236 3300035112 Bacteria 1743
539 Ga0373941_0079330 3300035115 Bacteria 1106
540 Ga0373956_0415589 3300035119 Bacteria 642
541 Ga0373960_0004107 3300035121 Bacteria 3328
542 Ga0373943_0330764 3300035170 Bacteria 870
543 Ga0373946_0616314 3300035171 Bacteria 563
544 Ga0373961_0003240 3300035241 Bacteria 4058
545 Ga0373931_0031228 3300035691 Bacteria 2748
546 Ga0373931_0198656 3300035691 Bacteria 1197
547 Ga0373931_0225001 3300035691 Bacteria 1131
548 Ga0373935_0130632 3300035692 Bacteria 1687
549 Ga0373927_0114568 3300035695 Bacteria 1757
550 Ga0373927_0247829 3300035695 Bacteria 1171
551 Ga0373947_0350216 3300035725 Bacteria 991
552 Ga0316582_0773783 3300036647 Bacteria 658
553 Ga0316584_0093298 3300036712 Bacteria 2254
554 Ga0373925_0116117 3300037068 Bacteria 2073
555 Ga0436364_1373090 3300037853 Bacteria 1809
556 Ga0395901_0229166 3300038443 Bacteria 1940
557 Ga0395901_0264741 3300038443 Bacteria 1789
558 Ga0436365_0493326 3300039437 Bacteria 2123
559 Ga0436361_0217474 3300039447 Bacteria 1442
560 Ga0436361_0741574 3300039447 Bacteria 1076
561 Ga0436362_0031375 3300039453 Bacteria 2197
562 Ga0439448_0108720 3300042005 Bacteria 946
563 Ga0439455_0065376 3300042012 Bacteria 970
564 Ga0439456_082315 3300042013 Bacteria 719
565 Ga0439458_0025483 3300042157 Bacteria 1388
566 Ga0439459_0011222 3300042438 Bacteria 1576
567 Ga0450918_069859 3300042531 Unclassified 658
568 Ga0466969_0042350 3300044656 Bacteria 2274
569 Ga0466969_0264183 3300044656 Bacteria 780
570 Ga0466972_0004679 3300044658 Bacteria 6854
571 Ga0466972_0006007 3300044658 Bacteria 6100
572 Ga0466972_0049397 3300044658 Bacteria 2032
573 Ga0466972_0113273 3300044658 Bacteria 1281
574 Ga0466972_0186865 3300044658 Bacteria 971
575 Ga0466972_0475496 3300044658 Bacteria 588
576 Ga0466965_0006947 3300044683 Bacteria 5180
577 Ga0466965_0280132 3300044683 Bacteria 900
578 Ga0466965_0491415 3300044683 Bacteria 687
579 Ga0466966_0009485 3300044684 Bacteria 6445
580 Ga0466966_0011224 3300044684 Bacteria 5944
581 Ga0466966_0016840 3300044684 Bacteria 4830
582 Ga0466966_0017484 3300044684 Bacteria 4737
583 Ga0466966_0273011 3300044684 Bacteria 1017
584 Ga0466961_0000954 3300044693 Bacteria 17882
585 Ga0466961_0044630 3300044693 Bacteria 2836
586 Ga0466961_0051245 3300044693 Bacteria 2636
587 Ga0466961_0104881 3300044693 Bacteria 1780
588 Ga0466961_0178425 3300044693 Bacteria 1319
589 Ga0466963_0001440 3300044694 Bacteria 12815
590 Ga0466963_0002729 3300044694 Bacteria 9959
591 Ga0466963_0008730 3300044694 Bacteria 6084
592 Ga0466963_0010439 3300044694 Bacteria 5622
593 Ga0466963_0016395 3300044694 Bacteria 4608
594 Ga0466963_0077779 3300044694 Bacteria 2242
595 Ga0466963_0078499 3300044694 Bacteria 2232
596 Ga0466963_0081702 3300044694 Bacteria 2189
597 Ga0466963_0132441 3300044694 Bacteria 1723
598 Ga0466963_0139397 3300044694 Bacteria 1679
599 Ga0466963_0243892 3300044694 Bacteria 1260
600 Ga0466963_0253748 3300044694 Bacteria 1234
601 Ga0466963_0484253 3300044694 Bacteria 873
602 Ga0466963_0871959 3300044694 Bacteria 634
603 Ga0466964_0011541 3300044706 Bacteria 3339
604 Ga0466964_0012829 3300044706 Bacteria 3174
605 Ga0466971_0005559 3300044719 Bacteria 5476
606 Ga0466971_0278915 3300044719 Bacteria 800
607 Ga0466968_0071634 3300044735 Bacteria 1510
608 Ga0466968_0131487 3300044735 Bacteria 1139
609 Ga0466970_0004565 3300044765 Bacteria 6834
610 Ga0466970_0036177 3300044765 Bacteria 2615
611 Ga0466970_0039469 3300044765 Bacteria 2505
612 Ga0466970_0183055 3300044765 Bacteria 1163
613 Ga0466970_0281973 3300044765 Bacteria 934
614 Ga0466970_0313365 3300044765 Bacteria 886
615 Ga0466957_0007208 3300044842 Bacteria 6286
616 Ga0466957_0022908 3300044842 Bacteria 3688
617 Ga0466957_0101726 3300044842 Bacteria 1812
618 Ga0466957_0148514 3300044842 Bacteria 1514
619 Ga0466957_0232039 3300044842 Bacteria 1222
620 Ga0466957_0505674 3300044842 Bacteria 838
621 Ga0466960_0122647 3300044901 Bacteria 1363
622 Ga0466960_0217337 3300044901 Bacteria 1050
623 Ga0466960_0963174 3300044901 Bacteria 523
624 Ga0466959_0012703 3300045049 Bacteria 6091
625 Ga0466959_0082302 3300045049 Bacteria 2319
626 Ga0466959_0213729 3300045049 Bacteria 1339
627 Ga0466959_0620743 3300045049 Bacteria 727
628 Ga0466958_0002544 3300045836 Bacteria 9201
629 Ga0466958_0013570 3300045836 Bacteria 4641
630 Ga0466958_0024044 3300045836 Bacteria 3582
631 Ga0466958_0134981 3300045836 Bacteria 1551
632 Ga0466958_0152079 3300045836 Bacteria 1460
633 Ga0466958_0186100 3300045836 Bacteria 1319
634 Ga0466958_0220602 3300045836 Bacteria 1210
635 Ga0466958_0264100 3300045836 Bacteria 1102
636 Ga0466958_0547006 3300045836 Bacteria 752
637 Ga0466958_0606639 3300045836 Bacteria 712
638 Ga0466967_0000447 3300045976 Bacteria 19752
639 Ga0466967_0004131 3300045976 Bacteria 9706
640 Ga0466967_0017852 3300045976 Bacteria 5651
641 Ga0466967_0021196 3300045976 Bacteria 5271
642 Ga0466967_0057388 3300045976 Bacteria 3437
643 Ga0466967_0062570 3300045976 Bacteria 3304
644 Ga0466967_0062792 3300045976 Bacteria 3299
645 Ga0466967_0088316 3300045976 Bacteria 2813
646 Ga0466967_0107011 3300045976 Bacteria 2565
647 Ga0466967_0240946 3300045976 Bacteria 1725
648 Ga0466967_0280526 3300045976 Bacteria 1598
649 Ga0466967_0298133 3300045976 Bacteria 1550
650 Ga0466967_0535459 3300045976 Bacteria 1152
651 Ga0466967_0852657 3300045976 Bacteria 905
652 Ga0466967_1326312 3300045976 Bacteria 717
653 Ga0466967_1616946 3300045976 Bacteria 645
654 Ga0495627_015412 3300046453 Bacteria 2639
655 Ga0495603_0475421 3300046455 Bacteria 716
656 Ga0495590_0110055 3300046457 Bacteria 983
657 Ga0495653_0219525 3300046463 Bacteria 1279
658 Ga0495650_0103083 3300046471 Bacteria 1069
659 Ga0495580_0508178 3300046472 Bacteria 804
660 Ga0495580_0553546 3300046472 Bacteria 764
661 Ga0495582_0408347 3300046473 Bacteria 783
662 Ga0495628_0101829 3300046516 Bacteria 2216
663 Ga0495666_0294438 3300046526 Bacteria 735
664 Ga0495652_0202368 3300046529 Bacteria 1506
665 Ga0495667_0399878 3300046559 Bacteria 865
666 Ga0495658_0505962 3300046683 Bacteria 773
667 Ga0495624_0813535 3300046690 Bacteria 552
668 Ga0495649_0355334 3300046694 Bacteria 740
669 Ga0495604_0074366 3300047317 Bacteria 2561
670 Ga0495674_0119035 3300047319 Bacteria 2233
671 Ga0495674_0217665 3300047319 Bacteria 1580
672 Ga0495672_0070237 3300047320 Bacteria 1985
673 Ga0495602_0086361 3300048088 Bacteria 2619
674 Ga0496100_0024189 3300048903 Bacteria 3701
675 Ga0496100_0142337 3300048903 Bacteria 1701
676 Ga0496101_0011520 3300048904 Bacteria 5871
677 Ga0496101_0074768 3300048904 Bacteria 2493
678 Ga0496101_0231926 3300048904 Bacteria 1435
679 Ga0496102_0000044 3300048905 Bacteria 187834
680 Ga0496102_0000713 3300048905 Bacteria 32911
681 Ga0496102_0281685 3300048905 Bacteria 1567
682 Ga0496102_0426459 3300048905 Bacteria 1245
683 Ga0496102_0702524 3300048905 Bacteria 934
684 Ga0496103_0000117 3300048906 Bacteria 86837
685 Ga0496103_0005769 3300048906 Bacteria 7390
686 Ga0496103_0084089 3300048906 Bacteria 2004
687 Ga0496104_0025282 3300048907 Bacteria 5474
688 Ga0496104_0080614 3300048907 Bacteria 3103
689 Ga0496104_0123936 3300048907 Bacteria 2481
690 Ga0496104_1700501 3300048907 Bacteria 533
691 Ga0496105_0010565 3300048908 Bacteria 7261
692 Ga0496105_0018736 3300048908 Bacteria 5573
693 Ga0496105_0185845 3300048908 Bacteria 1701
694 Ga0496105_0510379 3300048908 Bacteria 943
695 Ga0496106_0027596 3300048909 Bacteria 4229
696 Ga0496106_0130108 3300048909 Bacteria 1973
697 Ga0496107_0011721 3300048910 Bacteria 6115
698 Ga0496107_0152489 3300048910 Bacteria 1710
699 Ga0496108_0019388 3300048911 Bacteria 5584
700 Ga0496108_0162064 3300048911 Bacteria 1933
701 Ga0496108_0641541 3300048911 Bacteria 923
702 Ga0496108_1081442 3300048911 Bacteria 682
703 Ga0496109_0003861 3300048912 Bacteria 12516
704 Ga0496109_0010941 3300048912 Bacteria 7773
705 Ga0496109_0047173 3300048912 Bacteria 3916
706 Ga0496110_0002011 3300048913 Bacteria 15139
707 Ga0496110_0004089 3300048913 Bacteria 11261
708 Ga0496110_0077935 3300048913 Bacteria 2949
709 Ga0496110_0293693 3300048913 Bacteria 1480
710 Ga0496111_0020045 3300048914 Bacteria 4651
711 Ga0496111_0054239 3300048914 Bacteria 2897
712 Ga0496112_0058246 3300048915 Bacteria 3804
713 Ga0496112_0149996 3300048915 Bacteria 2299
714 Ga0496112_0330726 3300048915 Bacteria 1467
715 Ga0496112_1141158 3300048915 Bacteria 697
716 Ga0496113_0010420 3300048916 Bacteria 6145
717 Ga0496113_0012659 3300048916 Bacteria 5678
718 Ga0496113_0081850 3300048916 Bacteria 2475
719 Ga0496113_0107909 3300048916 Bacteria 2164
720 Ga0496114_0008858 3300048917 Bacteria 7976
721 Ga0496114_0474997 3300048917 Bacteria 1106
722 Ga0496115_0372303 3300048918 Bacteria 1162
723 Ga0496118_0102261 3300048921 Bacteria 1932
724 Ga0496118_0104372 3300048921 Bacteria 1903
725 Ga0496119_0003451 3300048922 Bacteria 16407
726 Ga0496120_0001931 3300048923 Bacteria 22782
727 Ga0496121_0018975 3300048924 Bacteria 6901
728 Ga0496126_0000006 3300048929 Bacteria 798804
729 Ga0501031_0001780 3300049568 Bacteria 13515
730 Ga0501031_0019140 3300049568 Bacteria 4457
731 Ga0501031_0108334 3300049568 Bacteria 1814
732 Ga0501031_0350300 3300049568 Bacteria 956
733 Ga0501031_0896218 3300049568 Unclassified 568
734 Ga0501033_0021805 3300049570 Bacteria 4834
735 Ga0501033_0131256 3300049570 Bacteria 1815
736 Ga0501033_0274610 3300049570 Bacteria 1191
737 Ga0501034_0432938 3300049571 Bacteria 1235
738 Ga0501036_0002879 3300049572 Bacteria 13646
739 Ga0501036_0013567 3300049572 Bacteria 6774
740 Ga0501036_0048035 3300049572 Bacteria 3614
741 Ga0501036_0135911 3300049572 Unclassified 2075
742 Ga0501036_0584673 3300049572 Unclassified 927
743 Ga0501036_0912335 3300049572 Bacteria 721
744 Ga0501037_0018318 3300049573 Bacteria 5160
745 Ga0501037_0038293 3300049573 Bacteria 3533
746 Ga0501037_0065975 3300049573 Bacteria 2637
747 Ga0501037_0099271 3300049573 Unclassified 2103
748 Ga0501037_0163507 3300049573 Unclassified 1586
749 Ga0501037_0255756 3300049573 Bacteria 1225
750 Ga0501038_0000729 3300049574 Bacteria 29347
751 Ga0501038_0022743 3300049574 Bacteria 5612
752 Ga0501038_0041430 3300049574 Bacteria 4016
753 Ga0501038_0056599 3300049574 Bacteria 3368
754 Ga0501038_0132916 3300049574 Unclassified 2041
755 Ga0501038_0144887 3300049574 Bacteria 1940
756 Ga0501039_0002714 3300049575 Bacteria 13204
757 Ga0501039_0010078 3300049575 Bacteria 7202
758 Ga0501039_0015236 3300049575 Bacteria 5884
759 Ga0501039_0021997 3300049575 Bacteria 4893
760 Ga0501039_0041159 3300049575 Bacteria 3568
761 Ga0501039_0136815 3300049575 Unclassified 1924
762 Ga0501040_0001767 3300049576 Bacteria 13886
763 Ga0501040_0001830 3300049576 Bacteria 13676
764 Ga0501040_0019976 3300049576 Bacteria 4460
765 Ga0501040_0029496 3300049576 Bacteria 3704
766 Ga0501040_0029505 3300049576 Bacteria 3703
767 Ga0501040_0032633 3300049576 Bacteria 3525
768 Ga0501040_0033356 3300049576 Bacteria 3487
769 Ga0501040_0046709 3300049576 Bacteria 2955
770 Ga0501040_0149112 3300049576 Bacteria 1649
771 Ga0501041_0001005 3300049577 Bacteria 15446
772 Ga0501041_0002936 3300049577 Bacteria 9786
773 Ga0501041_0035113 3300049577 Bacteria 3037
774 Ga0501041_0200026 3300049577 Bacteria 1252
775 Ga0501042_0000239 3300049578 Bacteria 26543
776 Ga0501042_0007078 3300049578 Bacteria 7328
777 Ga0501042_0013811 3300049578 Bacteria 5501
778 Ga0501042_0018185 3300049578 Bacteria 4863
779 Ga0501042_0241839 3300049578 Unclassified 1302
780 Ga0501042_0275153 3300049578 Bacteria 1216
781 Ga0501042_0406110 3300049578 Bacteria 987
782 Ga0501042_1250739 3300049578 Bacteria 541
783 Ga0501043_0048957 3300049579 Bacteria 3322
784 Ga0501043_0217951 3300049579 Bacteria 1477
785 Ga0501043_0230136 3300049579 Bacteria 1432
786 Ga0501043_0313798 3300049579 Bacteria 1196
787 Ga0501046_0012074 3300049580 Bacteria 7365
788 Ga0501046_0021049 3300049580 Bacteria 5386
789 Ga0501046_0024589 3300049580 Bacteria 4939
790 Ga0501046_0102211 3300049580 Bacteria 2197
791 Ga0501046_0165197 3300049580 Bacteria 1663
792 Ga0501047_0020554 3300049581 Bacteria 6338
793 Ga0501047_0098841 3300049581 Bacteria 2797
794 Ga0501048_0000611 3300049582 Bacteria 25411
795 Ga0501048_0004412 3300049582 Bacteria 10715
796 Ga0501048_0007580 3300049582 Bacteria 8228
797 Ga0501048_0011520 3300049582 Bacteria 6593
798 Ga0501048_0038277 3300049582 Bacteria 3442
799 Ga0501048_0043343 3300049582 Bacteria 3221
800 Ga0501048_0115097 3300049582 Bacteria 1900
801 Ga0501048_0574936 3300049582 Unclassified 809
802 Ga0501068_0009321 3300049584 Bacteria 5489
803 Ga0501068_0028606 3300049584 Bacteria 3297
804 Ga0501068_0047233 3300049584 Bacteria 2597
805 Ga0501068_0663049 3300049584 Unclassified 681
806 Ga0501069_0038793 3300049585 Unclassified 2630
807 Ga0501069_0128904 3300049585 Unclassified 1448
808 Ga0501069_0885616 3300049585 Unclassified 543
809 Ga0501070_0015871 3300049586 Bacteria 6332
810 Ga0501070_0194594 3300049586 Bacteria 1666
811 Ga0501070_0269047 3300049586 Bacteria 1392
812 Ga0501070_0384448 3300049586 Bacteria 1137
813 Ga0501070_0635856 3300049586 Bacteria 848
814 Ga0501071_0000062 3300049587 Bacteria 37621
815 Ga0501071_0002438 3300049587 Bacteria 11282
816 Ga0501071_0003996 3300049587 Bacteria 9308
817 Ga0501071_0005805 3300049587 Bacteria 7972
818 Ga0501071_0024149 3300049587 Bacteria 4250
819 Ga0501071_0032103 3300049587 Bacteria 3727
820 Ga0501071_0041766 3300049587 Bacteria 3284
821 Ga0501071_0079211 3300049587 Bacteria 2402
822 Ga0501071_0124614 3300049587 Bacteria 1911
823 Ga0501071_0246653 3300049587 Unclassified 1347
824 Ga0501071_1133761 3300049587 Bacteria 604
825 Ga0501072_0004395 3300049588 Bacteria 10701
826 Ga0501072_0004712 3300049588 Bacteria 10394
827 Ga0501072_0008700 3300049588 Bacteria 7706
828 Ga0501072_0045315 3300049588 Bacteria 3458
829 Ga0501072_0047440 3300049588 Bacteria 3382
830 Ga0501072_0055284 3300049588 Bacteria 3129
831 Ga0501072_0107951 3300049588 Bacteria 2214
832 Ga0501072_0113778 3300049588 Bacteria 2154
833 Ga0501072_0130484 3300049588 Bacteria 2003
834 Ga0501072_0597220 3300049588 Unclassified 870
835 Ga0501072_0613307 3300049588 Bacteria 857
836 Ga0501073_0034926 3300049589 Bacteria 3576
837 Ga0501073_0035165 3300049589 Bacteria 3562
838 Ga0501074_0005674 3300049590 Bacteria 8992
839 Ga0501074_0009203 3300049590 Bacteria 7176
840 Ga0501074_0014380 3300049590 Bacteria 5760
841 Ga0501074_0119681 3300049590 Unclassified 1883
842 Ga0501074_0541351 3300049590 Bacteria 824
843 Ga0501074_0640849 3300049590 Bacteria 751
844 Ga0501075_0006070 3300049591 Bacteria 8289
845 Ga0501075_0010862 3300049591 Bacteria 6421
846 Ga0501075_0018077 3300049591 Bacteria 5097
847 Ga0501075_0027631 3300049591 Bacteria 4183
848 Ga0501075_0033187 3300049591 Bacteria 3840
849 Ga0501075_0040651 3300049591 Bacteria 3483
850 Ga0501075_0094631 3300049591 Bacteria 2267
851 Ga0501075_0144339 3300049591 Bacteria 1814
852 Ga0501075_0172381 3300049591 Bacteria 1651
853 Ga0501075_0816599 3300049591 Bacteria 709
854 Ga0501076_0005061 3300049592 Bacteria 9438
855 Ga0501076_0108961 3300049592 Bacteria 2238
856 Ga0501076_0166942 3300049592 Bacteria 1794
857 Ga0501076_0187035 3300049592 Bacteria 1689
858 Ga0501076_0298349 3300049592 Bacteria 1321
859 Ga0501076_0492262 3300049592 Bacteria 1010
860 Ga0501076_0656990 3300049592 Unclassified 865
861 Ga0501076_1154154 3300049592 Unclassified 638
862 Ga0501077_0005645 3300049593 Bacteria 7624
863 Ga0501077_0009054 3300049593 Bacteria 6179
864 Ga0501077_0009503 3300049593 Bacteria 6045
865 Ga0501077_0010462 3300049593 Bacteria 5775
866 Ga0501077_0096521 3300049593 Bacteria 1873
867 Ga0501077_0349401 3300049593 Bacteria 944
868 Ga0501079_0000728 3300049741 Bacteria 22229
869 Ga0501079_0003279 3300049741 Bacteria 11855
870 Ga0501079_0004086 3300049741 Bacteria 10804
871 Ga0501079_0007964 3300049741 Bacteria 8034
872 Ga0501079_0019126 3300049741 Bacteria 5232
873 Ga0501079_0024713 3300049741 Bacteria 4610
874 Ga0501079_0035311 3300049741 Bacteria 3848
875 Ga0501079_0060478 3300049741 Bacteria 2922
876 Ga0501079_0073873 3300049741 Bacteria 2636
877 Ga0501079_0074235 3300049741 Bacteria 2629
878 Ga0501079_0188289 3300049741 Unclassified 1611
879 Ga0501080_0011960 3300049742 Bacteria 7949
880 Ga0501080_0129272 3300049742 Bacteria 2338
881 Ga0501080_0220006 3300049742 Unclassified 1738
882 Ga0501080_0237566 3300049742 Unclassified 1664
883 Ga0501081_0001987 3300049743 Bacteria 12750
884 Ga0501081_0005223 3300049743 Bacteria 8363
885 Ga0501081_0006609 3300049743 Bacteria 7532
886 Ga0501081_0016737 3300049743 Bacteria 4847
887 Ga0501081_0026970 3300049743 Bacteria 3876
888 Ga0501081_0038578 3300049743 Bacteria 3264
889 Ga0501081_0050599 3300049743 Bacteria 2862
890 Ga0501081_0194310 3300049743 Unclassified 1470
891 Ga0501081_0198726 3300049743 Bacteria 1454
892 Ga0501081_0282035 3300049743 Unclassified 1216
893 Ga0501083_0009211 3300049744 Bacteria 6974
894 Ga0501083_0079816 3300049744 Unclassified 2170
895 Ga0501083_0090566 3300049744 Bacteria 2020
896 Ga0501083_0985693 3300049744 Bacteria 548
897 Ga0501035_0005557 3300049822 Bacteria 11913
898 Ga0501035_0016934 3300049822 Bacteria 6718
899 Ga0501035_0024078 3300049822 Bacteria 5586
900 Ga0501035_0041768 3300049822 Bacteria 4140
901 Ga0501035_0825018 3300049822 Unclassified 739
902 Ga0501044_0108974 3300049823 Bacteria 2779
903 Ga0501044_0127085 3300049823 Bacteria 2546
904 Ga0501044_0260157 3300049823 Unclassified 1674
905 Ga0501044_0465067 3300049823 Bacteria 1170
906 Ga0501044_1299258 3300049823 Unclassified 594
907 Ga0501045_0003979 3300049824 Bacteria 10170
908 Ga0501045_0005995 3300049824 Bacteria 8409
909 Ga0501045_0013828 3300049824 Bacteria 5707
910 Ga0501045_0032635 3300049824 Unclassified 3774
911 Ga0501045_0058330 3300049824 Bacteria 2826
912 Ga0501045_0134135 3300049824 Bacteria 1841
913 Ga0501045_0199680 3300049824 Bacteria 1490
914 Ga0501045_0240852 3300049824 Bacteria 1347
915 nmdc:mga05p37_1192_c1 3300050507 Bacteria 30031
916 nmdc:mga05p37_190998_c1 3300050507 Bacteria 2486
917 nmdc:mga05p37_972350_c1 3300050507 Bacteria 906
918 nmdc:mga09592_241_c1 3300050508 Bacteria 39617
919 nmdc:mga0qj67_36841_c1 3300050509 Bacteria 3829
920 nmdc:mga0qj67_550017_c1 3300050509 Bacteria 926
921 nmdc:mga06r32_283_c1 3300050510 Bacteria 42355
922 nmdc:mga06r32_374372_c1 3300050510 Bacteria 1407
923 nmdc:mga06r32_8334_c1 3300050510 Bacteria 9331
924 nmdc:mga08y16_1006549_c1 3300050511 Bacteria 813
925 nmdc:mga08y16_24412_c1 3300050511 Bacteria 6381
926 nmdc:mga08y16_8609_c1 3300050511 Bacteria 10694
927 nmdc:mga0n895_8279_c1 3300050512 Bacteria 8993
928 nmdc:mga0rr50_9865_c1 3300050513 Bacteria 6034
929 nmdc:mga08x19_113668_c1 3300050514 Bacteria 1808
930 nmdc:mga08x19_144963_c1 3300050514 Bacteria 1606
931 nmdc:mga08x19_163173_c1 3300050514 Bacteria 1514
932 nmdc:mga0a205_306391_c1 3300050515 Bacteria 1461
933 nmdc:mga0a205_359882_c1 3300050515 Bacteria 1322
934 nmdc:mga0a205_41748_c1 3300050515 Bacteria 4419
935 Ga0495601_0003900 3300053077 Bacteria 8584
936 Ga0495612_0223809 3300053078 Bacteria 833
937 Ga0495612_0283338 3300053078 Bacteria 741
938 Ga0495655_0007418 3300053083 Bacteria 2038
939 Ga0495595_0074698 3300053084 Bacteria 1607
940 Ga0495595_0126167 3300053084 Bacteria 1249
941 Ga0495619_0996627 3300053085 Bacteria 560
942 Ga0500654_106318 3300053099 Bacteria 1171
943 Ga0500568_0153315 3300053139 Bacteria 852
944 Ga0500616_0020355 3300053153 Bacteria 3727
945 Ga0501084_0003344 3300054114 Bacteria 12990
946 Ga0501084_0038176 3300054114 Bacteria 4015
947 Ga0501084_0053873 3300054114 Bacteria 3365
948 Ga0501084_0090844 3300054114 Bacteria 2564
949 Ga0501084_0302702 3300054114 Bacteria 1350
950 Ga0501084_1067131 3300054114 Bacteria 678
951 Ga0501082_0002626 3300060353 Bacteria 15701
952 Ga0501082_0011337 3300060353 Bacteria 7663
953 Ga0501082_0011615 3300060353 Bacteria 7570
954 Ga0501082_0021836 3300060353 Bacteria 5517
955 Ga0501082_0047265 3300060353 Bacteria 3709
956 Ga0501082_0211167 3300060353 Bacteria 1689
957 Ga0501082_1570900 3300060353 Unclassified 574
958 Ga0466962_0023113 3300061719 Bacteria 2988
959 Ga0466962_0032618 3300061719 Bacteria 2493
960 Ga0466962_0050764 3300061719 Bacteria 1983
961 Ga0466962_0056766 3300061719 Bacteria 1870
962 Ga0466962_0102272 3300061719 Bacteria 1376
963 Ga0466962_0140585 3300061719 Bacteria 1169
964 Ga0466962_0239257 3300061719 Bacteria 891
965 Ga0466962_0384450 3300061719 Bacteria 701
966 Ga0530510_0006632 3300061734 Bacteria 8071
967 Ga0530510_0016464 3300061734 Bacteria 5234
968 Ga0530510_0018663 3300061734 Bacteria 4917
969 Ga0530510_0020682 3300061734 Bacteria 4679
970 Ga0530510_0029979 3300061734 Bacteria 3906
971 Ga0530510_0065335 3300061734 Bacteria 2636
972 Ga0530510_0075777 3300061734 Bacteria 2443
973 2586059137 2585427649 Bacteria 9053857
974 2676488925 2675903060 Bacteria 10051191
975 2809592106 2808606522 Bacteria 9488490
976 2816504704 2816332139 Bacteria 9138787
977 2870784845 2870782633 Bacteria 9624083
978 2884702499 2884693830 Bacteria 11273186
979 2895429279 2895427314 Bacteria 13147766
980 2895451998 2895442618 Bacteria 11027144
981 2899364055 2899359706 Bacteria 10940472
982 2899373231 2899370129 Bacteria 6781179
983 2904770131 2904765812 Bacteria 5369154
984 2904771020 2904770941 Bacteria 5580202
985 2908815064 2908811453 Bacteria 5478616
986 2915776204 2915768154 Bacteria 8424322
987 2917743339 2917736166 Bacteria 9690793
988 2919424453 2919420072 Bacteria 5390363
989 2919436846 2919432681 Bacteria 5390474
990 8003322679 8003314358 Bacteria 10575343
991 Ga0105240_10492224
992 JGI24739J22299_10020085
993 JGI24737J22298_10007912
994 JGI24737J22298_10050823
995 JGI24737J22298_10116046
996 JGI24743J22301_10062833
997 JGI24735J21928_10045306
998 JGI24735J21928_10185665
999 JGI24738J21930_10028319
1000 JGI25406J46586_10062510
1001 JGI25407J50210_10045653
1002 JGI25405J52794_10028845
1003 Ga0070658_10037109
1004 Ga0070658_10151448
1005 Ga0070658_10159873
1006 Ga0070676_10237223
1007 Ga0070676_10283069
1008 Ga0070683_100014452
1009 Ga0070683_100107472
1010 Ga0070683_100808326
1011 Ga0070690_100280286
1012 Ga0070670_100120405
1013 Ga0070670_100456509
1014 Ga0070677_10536144
1015 Ga0068869_100001830
1016 Ga0068869_100013851
1017 Ga0070666_10008045
1018 Ga0070666_10010640
1019 Ga0070680_100219847
1020 Ga0070680_100290920
1021 Ga0070682_100068612
1022 Ga0068868_100019172
1023 Ga0068868_100044868
1024 Ga0068868_100117031
1025 Ga0068868_100747426
1026 Ga0070660_100029442
1027 Ga0070660_100496170
1028 Ga0070689_100039992
1029 Ga0070691_10323694
1030 Ga0070687_100015748
1031 Ga0070687_100107291
1032 Ga0070661_100280650
1033 Ga0070692_10003704
1034 Ga0070692_10016341
1035 Ga0070668_100003437
1036 Ga0070668_100006857
1037 Ga0070668_100026621
1038 Ga0070668_100532772
1039 Ga0070669_100105295
1040 Ga0070675_100000145
1041 Ga0070675_100049433
1042 Ga0070671_100001993
1043 Ga0070671_100155998
1044 Ga0070674_100376460
1045 Ga0070673_100721548
1046 Ga0070688_100115244
1047 Ga0070659_100050002
1048 Ga0070659_100156150
1049 Ga0070659_100263424
1050 Ga0070667_100003161
1051 Ga0070667_100009470
1052 Ga0070709_10248084
1053 Ga0070709_10250149
1054 Ga0070709_11300033
1055 Ga0070714_100151905
1056 Ga0070714_100460076
1057 Ga0070714_100816398
1058 Ga0070713_100031457
1059 Ga0070713_100049113
1060 Ga0070713_100056458
1061 Ga0070713_100115918
1062 Ga0070713_100894992
1063 Ga0070710_10353383
1064 Ga0070710_10407150
1065 Ga0070710_10564315
1066 Ga0070701_10069060
1067 Ga0070701_10245009
1068 Ga0070711_100007880
1069 Ga0070705_100116635
1070 Ga0070700_100000164
1071 Ga0070700_100007339
1072 Ga0070700_100944242
1073 Ga0070694_100006357
1074 Ga0070694_100167136
1075 Ga0070708_100416689
1076 Ga0070663_100000675
1077 Ga0070663_100010524
1078 Ga0070663_100047088
1079 Ga0070663_100083440
1080 Ga0070663_100251146
1081 Ga0070663_100267598
1082 Ga0070678_100001267
1083 Ga0070678_100132988
1084 Ga0070662_100014391
1085 Ga0070662_100225224
1086 Ga0070681_10854719
1087 Ga0070685_10171120
1088 Ga0070706_100283652
1089 Ga0070706_101162971
1090 Ga0070707_100057492
1091 Ga0070707_100543209
1092 Ga0070707_100620258
1093 Ga0070698_100318881
1094 Ga0070699_100070298
1095 Ga0070679_100114755
1096 Ga0070679_100695174
1097 Ga0070684_100142337
1098 Ga0070684_100229242
1099 Ga0070697_100770029
1100 Ga0068853_100141807
1101 Ga0068853_100153332
1102 Ga0068853_100361814
1103 Ga0068853_100606802
1104 Ga0070672_100032755
1105 Ga0070672_100246585
1106 Ga0070686_100233093
1107 Ga0070695_101067412
1108 Ga0070696_100030170
1109 Ga0070693_100106982
1110 Ga0070665_100000757
1111 Ga0070665_100051417
1112 Ga0070665_100383112
1113 Ga0070704_100157914
1114 Ga0070704_100184101
1115 Ga0068855_100004304
1116 Ga0068855_100010280
1117 Ga0068855_100014029
1118 Ga0068855_100073171
1119 Ga0068855_100250296
1120 Ga0068855_100340943
1121 Ga0068855_100388279
1122 Ga0070664_100002843
1123 Ga0070664_100543117
1124 Ga0068854_100042153
1125 Ga0068854_100314709
1126 Ga0068854_100707372
1127 Ga0068856_100045377
1128 Ga0068856_100074801
1129 Ga0068856_100075064
1130 Ga0068856_100159414
1131 Ga0068856_100235318
1132 Ga0068856_100352643
1133 Ga0070702_100002421
1134 Ga0070702_100099669
1135 Ga0068852_100020897
1136 Ga0068852_100163472
1137 Ga0068852_100417109
1138 Ga0068859_100002002
1139 Ga0068859_100002765
1140 Ga0068859_100024225
1141 Ga0068859_100394406
1142 Ga0068864_100005426
1143 Ga0068864_100028621
1144 Ga0068866_10179024
1145 Ga0068866_10392685
1146 Ga0068861_100003837
1147 Ga0068861_100124345
1148 Ga0068861_100310298
1149 Ga0068851_10015584
1150 Ga0068851_10053701
1151 Ga0068870_10004082
1152 Ga0068870_10171209
1153 Ga0068870_10419495
1154 Ga0068863_100000677
1155 Ga0068863_100001145
1156 Ga0068863_100126068
1157 Ga0068863_100155931
1158 Ga0068858_100017987
1159 Ga0068858_100026937
1160 Ga0068858_100111932
1161 Ga0068858_100405824
1162 Ga0068860_100000214
1163 Ga0068860_100046841
1164 Ga0068860_100143083
1165 Ga0068862_100031007
1166 Ga0068862_100168726
1167 Ga0081455_10000856
1168 Ga0081455_10001927
1169 Ga0081455_10004130
1170 Ga0081455_10012269
1171 Ga0081455_10346067
1172 Ga0081538_10001015
1173 Ga0081538_10054137
1174 Ga0081540_1013636
1175 Ga0081540_1088482
1176 Ga0081539_10000314
1177 Ga0081539_10017187
1178 Ga0070717_10133014
1179 Ga0070717_10271583
1180 Ga0075432_10009343
1181 Ga0075432_10019149
1182 Ga0075432_10115423
1183 Ga0070716_100005395
1184 Ga0070716_100110044
1185 Ga0070712_100170895
1186 Ga0070712_100369286
1187 Ga0097621_100013167
1188 Ga0097621_100163114
1189 Ga0068871_100030952
1190 Ga0068871_100131377
1191 Ga0075428_100072107
1192 Ga0075430_100040154
1193 Ga0075430_100637422
1194 Ga0075431_100005266
1195 Ga0075431_100145167
1196 Ga0075431_100230894
1197 Ga0075431_100985455
1198 Ga0075433_10006200
1199 Ga0075433_10062775
1200 Ga0075433_10217963
1201 Ga0075434_100039963
1202 Ga0075434_100447822
1203 Ga0075429_100018670
1204 Ga0075429_100477292
1205 Ga0068865_100116516
1206 Ga0075436_100033515
1207 Ga0075436_100084376
1208 Ga0097620_100002002
1209 Ga0097620_100002765
1210 Ga0097620_100024224
1211 Ga0097620_100394412
1212 Ga0075435_100001179
1213 Ga0075435_100033992
1214 Ga0099794_10094948
1215 Ga0099795_10138581
1216 Ga0105251_10029047
1217 Ga0105251_10095888
1218 Ga0105240_10006845
1219 Ga0105240_10044174
1220 Ga0105240_10059388
1221 Ga0105240_10081917
1222 Ga0105240_10098365
1223 Ga0105240_10323450
1224 Ga0111539_10001513
1225 Ga0111539_10056914
1226 Ga0111539_10073676
1227 Ga0111539_10102794
1228 Ga0105245_10005340
1229 Ga0105245_10006149
1230 Ga0105245_10319276
1231 Ga0105245_10368289
1232 Ga0105245_10908495
1233 Ga0105247_10012824
1234 Ga0105247_10073481
1235 Ga0105247_10091776
1236 Ga0105247_10144070
1237 Ga0114129_10004688
1238 Ga0114129_10068460
1239 Ga0114129_10092703
1240 Ga0105243_10099971
1241 Ga0105243_10123218
1242 Ga0105243_10362118
1243 Ga0105243_10529299
1244 Ga0105241_10026727
1245 Ga0105241_10033989
1246 Ga0105241_10064345
1247 Ga0105241_10115248
1248 Ga0105242_10433186
1249 Ga0105237_10044946
1250 Ga0105237_10076020
1251 Ga0105237_10195463
1252 Ga0105237_10289532
1253 Ga0105237_10399907
1254 Ga0105238_10067235
1255 Ga0105238_10570210
1256 Ga0105238_11114820
1257 Ga0105238_11626699
1258 Ga0105249_10026601
1259 Ga0105249_10145213
1260 Ga0105249_10191615
1261 Ga0105249_10291789
1262 Ga0105249_10413166
1263 Ga0105030_102902
1264 Ga0105028_100390
1265 Ga0105028_141640
1266 Ga0099796_10166112
1267 Ga0099796_10362534
1268 Ga0105239_10033309
1269 Ga0105239_10063795
1270 Ga0105239_10142088
1271 Ga0105239_10236700
1272 Ga0105239_10266904
1273 Ga0105246_10000043
1274 Ga0105246_10004064
1275 Ga0105246_10363077
1276 Ga0157373_10241974
1277 Ga0157373_10301635
1278 Ga0157371_10004316
1279 Ga0157371_10023607
1280 Ga0157370_10040635
1281 Ga0157370_10072062
1282 Ga0157370_10310090
1283 Ga0157369_10104029
1284 Ga0157369_10109050
1285 Ga0157369_11154483
1286 Ga0157374_10090469
1287 Ga0157374_10359219
1288 Ga0157378_10071247
1289 Ga0157378_10994549
1290 Ga0163162_10014741
1291 Ga0163162_10311610
1292 Ga0163162_11223651
1293 Ga0163162_11349162
1294 Ga0157372_10000044
1295 Ga0157372_10202141
1296 Ga0157372_10777466
1297 Ga0157375_10028197
1298 Ga0157375_10275358
1299 Ga0163163_10033528
1300 Ga0163163_10523207
1301 Ga0163163_10756768
1302 Ga0163163_10935708
1303 Ga0157380_10092763
1304 Ga0182008_10103200
1305 Ga0157377_10003703
1306 Ga0157377_10013082
1307 Ga0157377_10214301
1308 Ga0157379_10029889
1309 Ga0157379_10244323
1310 Ga0157376_10010771
1311 Ga0157376_10304946
1312 Ga0163161_10020614
1313 Ga0163161_10506359
1314 Ga0206356_10753640
1315 Ga0206349_1470408
1316 Ga0206355_1357797
1317 Ga0206350_10968991
1318 Ga0206354_10015922
1319 Ga0206354_10607060
1320 Ga0206354_11197133
1321 Ga0206353_10374875
1322 Ga0206353_10375344
1323 Ga0206353_11751898
1324 Ga0213872_10164806
1325 Ga0213872_10169852
1326 Ga0213876_10346643
1327 Ga0224712_10003123
1328 Ga0224712_10048813
1329 Ga0224712_10361128
1330 Ga0207713_1085318
1331 Ga0207653_10029558
1332 Ga0207692_10294763
1333 Ga0207642_10165566
1334 Ga0207642_10225428
1335 Ga0207710_10109892
1336 Ga0207688_10005818
1337 Ga0207688_10217001
1338 Ga0207680_10021603
1339 Ga0207647_10005262
1340 Ga0207647_10015085
1341 Ga0207647_10124091
1342 Ga0207647_10168969
1343 Ga0207647_10186303
1344 Ga0207647_10228151
1345 Ga0207685_10004863
1346 Ga0207699_10002396
1347 Ga0207699_10691371
1348 Ga0207645_10074778
1349 Ga0207645_10152119
1350 Ga0207643_10000255
1351 Ga0207643_10176293
1352 Ga0207643_10188212
1353 Ga0207705_10017694
1354 Ga0207705_10922438
1355 Ga0207684_10264165
1356 Ga0207654_10013466
1357 Ga0207654_10766095
1358 Ga0207707_10221366
1359 Ga0207707_10460312
1360 Ga0207695_10033289
1361 Ga0207695_10041233
1362 Ga0207695_10174565
1363 Ga0207695_10196804
1364 Ga0207695_10511307
1365 Ga0207695_10519048
1366 Ga0207671_10098280
1367 Ga0207671_10131878
1368 Ga0207671_10262904
1369 Ga0207693_10000510
1370 Ga0207693_10369168
1371 Ga0207663_10162755
1372 Ga0207660_10033041
1373 Ga0207662_10010838
1374 Ga0207662_10527207
1375 Ga0207657_10003758
1376 Ga0207657_10090962
1377 Ga0207657_10533622
1378 Ga0207649_10070873
1379 Ga0207652_10017664
1380 Ga0207652_10159459
1381 Ga0207652_10844164
1382 Ga0207646_10626235
1383 Ga0207681_10361795
1384 Ga0207694_10214648
1385 Ga0207694_10425935
1386 Ga0207694_10634291
1387 Ga0207650_10075611
1388 Ga0207659_10013890
1389 Ga0207659_10049580
1390 Ga0207687_10017746
1391 Ga0207687_10042459
1392 Ga0207687_10052780
1393 Ga0207687_10081087
1394 Ga0207687_10181917
1395 Ga0207687_10385726
1396 Ga0207700_10046571
1397 Ga0207700_10215065
1398 Ga0207700_10971895
1399 Ga0207700_11417052
1400 Ga0207664_10246224
1401 Ga0207644_10227608
1402 Ga0207690_10643543
1403 Ga0207706_10003631
1404 Ga0207706_10166454
1405 Ga0207706_10167910
1406 Ga0207686_10750436
1407 Ga0207686_11199305
1408 Ga0207709_10270334
1409 Ga0207670_10058601
1410 Ga0207669_10405452
1411 Ga0207704_10374554
1412 Ga0207665_10004900
1413 Ga0207691_10023934
1414 Ga0207691_10262974
1415 Ga0207711_10325713
1416 Ga0207689_10002623
1417 Ga0207689_10006181
1418 Ga0207661_10005765
1419 Ga0207661_10009531
1420 Ga0207661_10089286
1421 Ga0207661_10182989
1422 Ga0207679_10004056
1423 Ga0207679_10010471
1424 Ga0207679_10015188
1425 Ga0207679_10180868
1426 Ga0207667_10107338
1427 Ga0207667_10318290
1428 Ga0207651_11302496
1429 Ga0207712_10055807
1430 Ga0207712_10440426
1431 Ga0207712_10534287
1432 Ga0207712_10883621
1433 Ga0207668_10025417
1434 Ga0207668_10069537
1435 Ga0207640_10366577
1436 Ga0207640_10374123
1437 Ga0207640_10564494
1438 Ga0207658_10016590
1439 Ga0207658_10043343
1440 Ga0207677_10011844
1441 Ga0207677_10030853
1442 Ga0207677_10142971
1443 Ga0207677_10175387
1444 Ga0207677_10527144
1445 Ga0207703_10013801
1446 Ga0207703_10041423
1447 Ga0207703_10179145
1448 Ga0207639_10487861
1449 Ga0207678_10000077
1450 Ga0207678_10000346
1451 Ga0207678_10001130
1452 Ga0207678_10067839
1453 Ga0207678_10184182
1454 Ga0207678_10208382
1455 Ga0207708_10000110
1456 Ga0207708_10015918
1457 Ga0207708_10052736
1458 Ga0207708_10060832
1459 Ga0207702_10000631
1460 Ga0207702_10009206
1461 Ga0207702_10067537
1462 Ga0207702_10200106
1463 Ga0207702_10212286
1464 Ga0207641_10000499
1465 Ga0207641_10002176
1466 Ga0207641_10656590
1467 Ga0207641_11054361
1468 Ga0207676_10016110
1469 Ga0207674_10020922
1470 Ga0207674_10395918
1471 Ga0207675_100039773
1472 Ga0207675_100335288
1473 Ga0207683_10000342
1474 Ga0207683_10000915
1475 Ga0207683_10316100
1476 Ga0207698_10014073
1477 Ga0207698_10057689
1478 Ga0207698_10202223
1479 Ga0209588_1160905
1480 Ga0207428_10003594
1481 Ga0207428_10008491
1482 Ga0268266_10010410
1483 Ga0268266_10030224
1484 Ga0268266_10072788
1485 Ga0268266_10577085
1486 Ga0268265_10008211
1487 Ga0268265_10240267
1488 Ga0268265_10489557
1489 Ga0268264_10000027
1490 Ga0268264_10255781
1491 Ga0307515_10017393
1492 Ga0307515_10854143
1493 Ga0265760_10018948
1494 Ga0265340_10057467
1495 Ga0307508_10489127
1496 Ga0307514_10356424
1497 Ga0316576_10001887
1498 Ga0316576_10024896
1499 Ga0316578_10089013
1500 Ga0307405_10268778
1501 Ga0307405_10436909
1502 Ga0316577_10000803
1503 Ga0307413_10270623
1504 Ga0307518_10020035
1505 Ga0307406_10024433
1506 Ga0307406_10181412
1507 Ga0307406_10246160
1508 Ga0307409_100068776
1509 Ga0307409_100964642
1510 Ga0307416_100120946
1511 Ga0307415_100018917
1512 Ga0307415_100020868
1513 Ga0307415_100040696
1514 Ga0307415_100062408
1515 Ga0307415_100170276
1516 Ga0307415_100350405
1517 Ga0307415_100780178
1518 Ga0307507_10096532
1519 Ga0307507_10336648
1520 Ga0307510_10038091
1521 Ga0373948_0022349
1522 Ga0373958_0071624
1523 Ga0373938_0030561
1524 Ga0373928_0091798
1525 Ga0373929_0074956
1526 Ga0373952_0001893
1527 Ga0373923_0348545
1528 Ga0373932_0020236
1529 Ga0373941_0079330
1530 Ga0373956_0415589
1531 Ga0373960_0004107
1532 Ga0373943_0330764
1533 Ga0373946_0616314
1534 Ga0373961_0003240
1535 Ga0373931_0031228
1536 Ga0373931_0198656
1537 Ga0373931_0225001
1538 Ga0373935_0130632
1539 Ga0373927_0114568
1540 Ga0373927_0247829
1541 Ga0373947_0350216
1542 Ga0316582_0773783
1543 Ga0316584_0093298
1544 Ga0373925_0116117
1545 Ga0436364_1373090
1546 Ga0395901_0229166
1547 Ga0395901_0264741
1548 Ga0436365_0493326
1549 Ga0436361_0217474
1550 Ga0436361_0741574
1551 Ga0436362_0031375
1552 Ga0439448_0108720
1553 Ga0439455_0065376
1554 Ga0439456_082315
1555 Ga0439458_0025483
1556 Ga0439459_0011222
1557 Ga0450918_069859
1558 Ga0466969_0042350
1559 Ga0466969_0264183
1560 Ga0466972_0004679
1561 Ga0466972_0006007
1562 Ga0466972_0049397
1563 Ga0466972_0113273
1564 Ga0466972_0186865
1565 Ga0466972_0475496
1566 Ga0466965_0006947
1567 Ga0466965_0280132
1568 Ga0466965_0491415
1569 Ga0466966_0009485
1570 Ga0466966_0011224
1571 Ga0466966_0016840
1572 Ga0466966_0017484
1573 Ga0466966_0273011
1574 Ga0466961_0000954
1575 Ga0466961_0044630
1576 Ga0466961_0051245
1577 Ga0466961_0104881
1578 Ga0466961_0178425
1579 Ga0466963_0001440
1580 Ga0466963_0002729
1581 Ga0466963_0008730
1582 Ga0466963_0010439
1583 Ga0466963_0016395
1584 Ga0466963_0077779
1585 Ga0466963_0078499
1586 Ga0466963_0081702
1587 Ga0466963_0132441
1588 Ga0466963_0139397
1589 Ga0466963_0243892
1590 Ga0466963_0253748
1591 Ga0466963_0484253
1592 Ga0466963_0871959
1593 Ga0466964_0011541
1594 Ga0466964_0012829
1595 Ga0466971_0005559
1596 Ga0466971_0278915
1597 Ga0466968_0071634
1598 Ga0466968_0131487
1599 Ga0466970_0004565
1600 Ga0466970_0036177
1601 Ga0466970_0039469
1602 Ga0466970_0183055
1603 Ga0466970_0281973
1604 Ga0466970_0313365
1605 Ga0466957_0007208
1606 Ga0466957_0022908
1607 Ga0466957_0101726
1608 Ga0466957_0148514
1609 Ga0466957_0232039
1610 Ga0466957_0505674
1611 Ga0466960_0122647
1612 Ga0466960_0217337
1613 Ga0466960_0963174
1614 Ga0466959_0012703
1615 Ga0466959_0082302
1616 Ga0466959_0213729
1617 Ga0466959_0620743
1618 Ga0466958_0002544
1619 Ga0466958_0013570
1620 Ga0466958_0024044
1621 Ga0466958_0134981
1622 Ga0466958_0152079
1623 Ga0466958_0186100
1624 Ga0466958_0220602
1625 Ga0466958_0264100
1626 Ga0466958_0547006
1627 Ga0466958_0606639
1628 Ga0466967_0000447
1629 Ga0466967_0004131
1630 Ga0466967_0017852
1631 Ga0466967_0021196
1632 Ga0466967_0057388
1633 Ga0466967_0062570
1634 Ga0466967_0062792
1635 Ga0466967_0088316
1636 Ga0466967_0107011
1637 Ga0466967_0240946
1638 Ga0466967_0280526
1639 Ga0466967_0298133
1640 Ga0466967_0535459
1641 Ga0466967_0852657
1642 Ga0466967_1326312
1643 Ga0466967_1616946
1644 Ga0495627_015412
1645 Ga0495603_0475421
1646 Ga0495590_0110055
1647 Ga0495653_0219525
1648 Ga0495650_0103083
1649 Ga0495580_0508178
1650 Ga0495580_0553546
1651 Ga0495582_0408347
1652 Ga0495628_0101829
1653 Ga0495666_0294438
1654 Ga0495652_0202368
1655 Ga0495667_0399878
1656 Ga0495658_0505962
1657 Ga0495624_0813535
1658 Ga0495649_0355334
1659 Ga0495604_0074366
1660 Ga0495674_0119035
1661 Ga0495674_0217665
1662 Ga0495672_0070237
1663 Ga0495602_0086361
1664 Ga0496100_0024189
1665 Ga0496100_0142337
1666 Ga0496101_0011520
1667 Ga0496101_0074768
1668 Ga0496101_0231926
1669 Ga0496102_0000044
1670 Ga0496102_0000713
1671 Ga0496102_0281685
1672 Ga0496102_0426459
1673 Ga0496102_0702524
1674 Ga0496103_0000117
1675 Ga0496103_0005769
1676 Ga0496103_0084089
1677 Ga0496104_0025282
1678 Ga0496104_0080614
1679 Ga0496104_0123936
1680 Ga0496104_1700501
1681 Ga0496105_0010565
1682 Ga0496105_0018736
1683 Ga0496105_0185845
1684 Ga0496105_0510379
1685 Ga0496106_0027596
1686 Ga0496106_0130108
1687 Ga0496107_0011721
1688 Ga0496107_0152489
1689 Ga0496108_0019388
1690 Ga0496108_0162064
1691 Ga0496108_0641541
1692 Ga0496108_1081442
1693 Ga0496109_0003861
1694 Ga0496109_0010941
1695 Ga0496109_0047173
1696 Ga0496110_0002011
1697 Ga0496110_0004089
1698 Ga0496110_0077935
1699 Ga0496110_0293693
1700 Ga0496111_0020045
1701 Ga0496111_0054239
1702 Ga0496112_0058246
1703 Ga0496112_0149996
1704 Ga0496112_0330726
1705 Ga0496112_1141158
1706 Ga0496113_0010420
1707 Ga0496113_0012659
1708 Ga0496113_0081850
1709 Ga0496113_0107909
1710 Ga0496114_0008858
1711 Ga0496114_0474997
1712 Ga0496115_0372303
1713 Ga0496118_0102261
1714 Ga0496118_0104372
1715 Ga0496119_0003451
1716 Ga0496120_0001931
1717 Ga0496121_0018975
1718 Ga0496126_0000006
1719 Ga0501031_0001780
1720 Ga0501031_0019140
1721 Ga0501031_0108334
1722 Ga0501031_0350300
1723 Ga0501031_0896218
1724 Ga0501033_0021805
1725 Ga0501033_0131256
1726 Ga0501033_0274610
1727 Ga0501034_0432938
1728 Ga0501036_0002879
1729 Ga0501036_0013567
1730 Ga0501036_0048035
1731 Ga0501036_0135911
1732 Ga0501036_0584673
1733 Ga0501036_0912335
1734 Ga0501037_0018318
1735 Ga0501037_0038293
1736 Ga0501037_0065975
1737 Ga0501037_0099271
1738 Ga0501037_0163507
1739 Ga0501037_0255756
1740 Ga0501038_0000729
1741 Ga0501038_0022743
1742 Ga0501038_0041430
1743 Ga0501038_0056599
1744 Ga0501038_0132916
1745 Ga0501038_0144887
1746 Ga0501039_0002714
1747 Ga0501039_0010078
1748 Ga0501039_0015236
1749 Ga0501039_0021997
1750 Ga0501039_0041159
1751 Ga0501039_0136815
1752 Ga0501040_0001767
1753 Ga0501040_0001830
1754 Ga0501040_0019976
1755 Ga0501040_0029496
1756 Ga0501040_0029505
1757 Ga0501040_0032633
1758 Ga0501040_0033356
1759 Ga0501040_0046709
1760 Ga0501040_0149112
1761 Ga0501041_0001005
1762 Ga0501041_0002936
1763 Ga0501041_0035113
1764 Ga0501041_0200026
1765 Ga0501042_0000239
1766 Ga0501042_0007078
1767 Ga0501042_0013811
1768 Ga0501042_0018185
1769 Ga0501042_0241839
1770 Ga0501042_0275153
1771 Ga0501042_0406110
1772 Ga0501042_1250739
1773 Ga0501043_0048957
1774 Ga0501043_0217951
1775 Ga0501043_0230136
1776 Ga0501043_0313798
1777 Ga0501046_0012074
1778 Ga0501046_0021049
1779 Ga0501046_0024589
1780 Ga0501046_0102211
1781 Ga0501046_0165197
1782 Ga0501047_0020554
1783 Ga0501047_0098841
1784 Ga0501048_0000611
1785 Ga0501048_0004412
1786 Ga0501048_0007580
1787 Ga0501048_0011520
1788 Ga0501048_0038277
1789 Ga0501048_0043343
1790 Ga0501048_0115097
1791 Ga0501048_0574936
1792 Ga0501068_0009321
1793 Ga0501068_0028606
1794 Ga0501068_0047233
1795 Ga0501068_0663049
1796 Ga0501069_0038793
1797 Ga0501069_0128904
1798 Ga0501069_0885616
1799 Ga0501070_0015871
1800 Ga0501070_0194594
1801 Ga0501070_0269047
1802 Ga0501070_0384448
1803 Ga0501070_0635856
1804 Ga0501071_0000062
1805 Ga0501071_0002438
1806 Ga0501071_0003996
1807 Ga0501071_0005805
1808 Ga0501071_0024149
1809 Ga0501071_0032103
1810 Ga0501071_0041766
1811 Ga0501071_0079211
1812 Ga0501071_0124614
1813 Ga0501071_0246653
1814 Ga0501071_1133761
1815 Ga0501072_0004395
1816 Ga0501072_0004712
1817 Ga0501072_0008700
1818 Ga0501072_0045315
1819 Ga0501072_0047440
1820 Ga0501072_0055284
1821 Ga0501072_0107951
1822 Ga0501072_0113778
1823 Ga0501072_0130484
1824 Ga0501072_0597220
1825 Ga0501072_0613307
1826 Ga0501073_0034926
1827 Ga0501073_0035165
1828 Ga0501074_0005674
1829 Ga0501074_0009203
1830 Ga0501074_0014380
1831 Ga0501074_0119681
1832 Ga0501074_0541351
1833 Ga0501074_0640849
1834 Ga0501075_0006070
1835 Ga0501075_0010862
1836 Ga0501075_0018077
1837 Ga0501075_0027631
1838 Ga0501075_0033187
1839 Ga0501075_0040651
1840 Ga0501075_0094631
1841 Ga0501075_0144339
1842 Ga0501075_0172381
1843 Ga0501075_0816599
1844 Ga0501076_0005061
1845 Ga0501076_0108961
1846 Ga0501076_0166942
1847 Ga0501076_0187035
1848 Ga0501076_0298349
1849 Ga0501076_0492262
1850 Ga0501076_0656990
1851 Ga0501076_1154154
1852 Ga0501077_0005645
1853 Ga0501077_0009054
1854 Ga0501077_0009503
1855 Ga0501077_0010462
1856 Ga0501077_0096521
1857 Ga0501077_0349401
1858 Ga0501079_0000728
1859 Ga0501079_0003279
1860 Ga0501079_0004086
1861 Ga0501079_0007964
1862 Ga0501079_0019126
1863 Ga0501079_0024713
1864 Ga0501079_0035311
1865 Ga0501079_0060478
1866 Ga0501079_0073873
1867 Ga0501079_0074235
1868 Ga0501079_0188289
1869 Ga0501080_0011960
1870 Ga0501080_0129272
1871 Ga0501080_0220006
1872 Ga0501080_0237566
1873 Ga0501081_0001987
1874 Ga0501081_0005223
1875 Ga0501081_0006609
1876 Ga0501081_0016737
1877 Ga0501081_0026970
1878 Ga0501081_0038578
1879 Ga0501081_0050599
1880 Ga0501081_0194310
1881 Ga0501081_0198726
1882 Ga0501081_0282035
1883 Ga0501083_0009211
1884 Ga0501083_0079816
1885 Ga0501083_0090566
1886 Ga0501083_0985693
1887 Ga0501035_0005557
1888 Ga0501035_0016934
1889 Ga0501035_0024078
1890 Ga0501035_0041768
1891 Ga0501035_0825018
1892 Ga0501044_0108974
1893 Ga0501044_0127085
1894 Ga0501044_0260157
1895 Ga0501044_0465067
1896 Ga0501044_1299258
1897 Ga0501045_0003979
1898 Ga0501045_0005995
1899 Ga0501045_0013828
1900 Ga0501045_0032635
1901 Ga0501045_0058330
1902 Ga0501045_0134135
1903 Ga0501045_0199680
1904 Ga0501045_0240852
1905 nmdc:mga05p37_1192_c1
1906 nmdc:mga05p37_190998_c1
1907 nmdc:mga05p37_972350_c1
1908 nmdc:mga09592_241_c1
1909 nmdc:mga0qj67_36841_c1
1910 nmdc:mga0qj67_550017_c1
1911 nmdc:mga06r32_283_c1
1912 nmdc:mga06r32_374372_c1
1913 nmdc:mga06r32_8334_c1
1914 nmdc:mga08y16_1006549_c1
1915 nmdc:mga08y16_24412_c1
1916 nmdc:mga08y16_8609_c1
1917 nmdc:mga0n895_8279_c1
1918 nmdc:mga0rr50_9865_c1
1919 nmdc:mga08x19_113668_c1
1920 nmdc:mga08x19_144963_c1
1921 nmdc:mga08x19_163173_c1
1922 nmdc:mga0a205_306391_c1
1923 nmdc:mga0a205_359882_c1
1924 nmdc:mga0a205_41748_c1
1925 Ga0495601_0003900
1926 Ga0495612_0223809
1927 Ga0495612_0283338
1928 Ga0495655_0007418
1929 Ga0495595_0074698
1930 Ga0495595_0126167
1931 Ga0495619_0996627
1932 Ga0500654_106318
1933 Ga0500568_0153315
1934 Ga0500616_0020355
1935 Ga0501084_0003344
1936 Ga0501084_0038176
1937 Ga0501084_0053873
1938 Ga0501084_0090844
1939 Ga0501084_0302702
1940 Ga0501084_1067131
1941 Ga0501082_0002626
1942 Ga0501082_0011337
1943 Ga0501082_0011615
1944 Ga0501082_0021836
1945 Ga0501082_0047265
1946 Ga0501082_0211167
1947 Ga0501082_1570900
1948 Ga0466962_0023113
1949 Ga0466962_0032618
1950 Ga0466962_0050764
1951 Ga0466962_0056766
1952 Ga0466962_0102272
1953 Ga0466962_0140585
1954 Ga0466962_0239257
1955 Ga0466962_0384450
1956 Ga0530510_0006632
1957 Ga0530510_0016464
1958 Ga0530510_0018663
1959 Ga0530510_0020682
1960 Ga0530510_0029979
1961 Ga0530510_0065335
1962 Ga0530510_0075777
1963 2586059137
1964 2676488925
1965 2809592106
1966 2816504704
1967 2870784845
1968 2884702499
1969 2895429279
1970 2895451998
1971 2899364055
1972 2899373231
1973 2904770131
1974 2904771020
1975 2908815064
1976 2915776204
1977 2917743339
1978 2919424453
1979 2919436846
1980 8003322679

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

13

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9864 1 155
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9826 1 155
5o08-assembly1.cif.gz_A crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with dephospho-coenzyme a 0.9818 1 156
5h7x-assembly1.cif.gz_E crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with 2-hydroxy-1,2,3-propane tricarboxylate at 1.76 a resolution 0.9765 2 154
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9764 2 156
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9747 1 154 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9665 1 154 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9633 1 155 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9513 1 155 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9511 2 155 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7L5ZF09-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9937 3 155 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-Q6A7Q4-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9925 3 154 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A6L6ESX5-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9923 2 155 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0G3V2A6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9922 2 155 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-T5JS59-F1-model_v4 deleted 0.991 1 156

Map