F487607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 990 | 387 | 1980 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10492224|Ga0105240_104922242 |
| Length | 189 |
| Sequence | MSMRMSSVIRRAVCPGSFDPVTNGHLDIIGRAANLYDELVVAVLINKSKSSLFTVDERIAMLTDVTAEYGNVRVDSFHGLLVDYCRANQIPVVVKGLRAVSDFDYELQMAQMNRGLAGVDTLFMPTNPEYSFLASSLVKEIATYGGDVTSLLPDAVHKQLLSRLAERAQHERAQHVDSSTTSAERSEQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 116 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 220 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 221 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 251 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 263 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 272 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 369 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 370 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 371 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 372 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 373 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 374 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 375 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 376 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 377 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 378 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 379 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 380 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 381 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 382 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 383 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 384 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 385 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 386 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 387 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.77 |
| Metatranscriptomes | 1.41 |
| Isolates | 1.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 4.95 |
| Rhizosphere | 91.72 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 3.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10492224 | 3300009093 | Bacteria | 1365 |
| 2 | JGI24739J22299_10020085 | 3300001989 | Bacteria | 2386 |
| 3 | JGI24737J22298_10007912 | 3300001990 | Bacteria | 3577 |
| 4 | JGI24737J22298_10050823 | 3300001990 | Bacteria | 1259 |
| 5 | JGI24737J22298_10116046 | 3300001990 | Bacteria | 791 |
| 6 | JGI24743J22301_10062833 | 3300001991 | Bacteria | 767 |
| 7 | JGI24735J21928_10045306 | 3300002067 | Bacteria | 1277 |
| 8 | JGI24735J21928_10185665 | 3300002067 | Bacteria | 602 |
| 9 | JGI24738J21930_10028319 | 3300002075 | Bacteria | 1147 |
| 10 | JGI25406J46586_10062510 | 3300003203 | Bacteria | 1196 |
| 11 | JGI25407J50210_10045653 | 3300003373 | Bacteria | 1116 |
| 12 | JGI25405J52794_10028845 | 3300003911 | Bacteria | 1147 |
| 13 | Ga0070658_10037109 | 3300005327 | Bacteria | 3927 |
| 14 | Ga0070658_10151448 | 3300005327 | Bacteria | 1942 |
| 15 | Ga0070658_10159873 | 3300005327 | Bacteria | 1890 |
| 16 | Ga0070676_10237223 | 3300005328 | Bacteria | 1211 |
| 17 | Ga0070676_10283069 | 3300005328 | Bacteria | 1118 |
| 18 | Ga0070683_100014452 | 3300005329 | Bacteria | 6906 |
| 19 | Ga0070683_100107472 | 3300005329 | Bacteria | 2631 |
| 20 | Ga0070683_100808326 | 3300005329 | Bacteria | 899 |
| 21 | Ga0070690_100280286 | 3300005330 | Bacteria | 1189 |
| 22 | Ga0070670_100120405 | 3300005331 | Bacteria | 2264 |
| 23 | Ga0070670_100456509 | 3300005331 | Bacteria | 1133 |
| 24 | Ga0070677_10536144 | 3300005333 | Bacteria | 639 |
| 25 | Ga0068869_100001830 | 3300005334 | Bacteria | 12777 |
| 26 | Ga0068869_100013851 | 3300005334 | Bacteria | 5376 |
| 27 | Ga0070666_10008045 | 3300005335 | Bacteria | 6524 |
| 28 | Ga0070666_10010640 | 3300005335 | Bacteria | 5760 |
| 29 | Ga0070680_100219847 | 3300005336 | Bacteria | 1603 |
| 30 | Ga0070680_100290920 | 3300005336 | Bacteria | 1385 |
| 31 | Ga0070682_100068612 | 3300005337 | Bacteria | 2262 |
| 32 | Ga0068868_100019172 | 3300005338 | Bacteria | 5124 |
| 33 | Ga0068868_100044868 | 3300005338 | Bacteria | 3457 |
| 34 | Ga0068868_100117031 | 3300005338 | Bacteria | 2171 |
| 35 | Ga0068868_100747426 | 3300005338 | Bacteria | 878 |
| 36 | Ga0070660_100029442 | 3300005339 | Bacteria | 4115 |
| 37 | Ga0070660_100496170 | 3300005339 | Bacteria | 1015 |
| 38 | Ga0070689_100039992 | 3300005340 | Bacteria | 3593 |
| 39 | Ga0070691_10323694 | 3300005341 | Bacteria | 849 |
| 40 | Ga0070687_100015748 | 3300005343 | Bacteria | 3427 |
| 41 | Ga0070687_100107291 | 3300005343 | Bacteria | 1574 |
| 42 | Ga0070661_100280650 | 3300005344 | Bacteria | 1292 |
| 43 | Ga0070692_10003704 | 3300005345 | Bacteria | 6267 |
| 44 | Ga0070692_10016341 | 3300005345 | Bacteria | 3529 |
| 45 | Ga0070668_100003437 | 3300005347 | Bacteria | 11692 |
| 46 | Ga0070668_100006857 | 3300005347 | Bacteria | 8446 |
| 47 | Ga0070668_100026621 | 3300005347 | Bacteria | 4390 |
| 48 | Ga0070668_100532772 | 3300005347 | Bacteria | 1020 |
| 49 | Ga0070669_100105295 | 3300005353 | Bacteria | 2134 |
| 50 | Ga0070675_100000145 | 3300005354 | Bacteria | 42348 |
| 51 | Ga0070675_100049433 | 3300005354 | Bacteria | 3452 |
| 52 | Ga0070671_100001993 | 3300005355 | Bacteria | 15683 |
| 53 | Ga0070671_100155998 | 3300005355 | Bacteria | 1929 |
| 54 | Ga0070674_100376460 | 3300005356 | Bacteria | 1154 |
| 55 | Ga0070673_100721548 | 3300005364 | Bacteria | 916 |
| 56 | Ga0070688_100115244 | 3300005365 | Bacteria | 1793 |
| 57 | Ga0070659_100050002 | 3300005366 | Bacteria | 3288 |
| 58 | Ga0070659_100156150 | 3300005366 | Bacteria | 1863 |
| 59 | Ga0070659_100263424 | 3300005366 | Bacteria | 1430 |
| 60 | Ga0070667_100003161 | 3300005367 | Bacteria | 14113 |
| 61 | Ga0070667_100009470 | 3300005367 | Bacteria | 8079 |
| 62 | Ga0070709_10248084 | 3300005434 | Bacteria | 1281 |
| 63 | Ga0070709_10250149 | 3300005434 | Bacteria | 1276 |
| 64 | Ga0070709_11300033 | 3300005434 | Bacteria | 587 |
| 65 | Ga0070714_100151905 | 3300005435 | Bacteria | 2088 |
| 66 | Ga0070714_100460076 | 3300005435 | Bacteria | 1209 |
| 67 | Ga0070714_100816398 | 3300005435 | Bacteria | 903 |
| 68 | Ga0070713_100031457 | 3300005436 | Bacteria | 4227 |
| 69 | Ga0070713_100049113 | 3300005436 | Bacteria | 3479 |
| 70 | Ga0070713_100056458 | 3300005436 | Bacteria | 3266 |
| 71 | Ga0070713_100115918 | 3300005436 | Bacteria | 2342 |
| 72 | Ga0070713_100894992 | 3300005436 | Bacteria | 854 |
| 73 | Ga0070710_10353383 | 3300005437 | Bacteria | 973 |
| 74 | Ga0070710_10407150 | 3300005437 | Bacteria | 913 |
| 75 | Ga0070710_10564315 | 3300005437 | Bacteria | 788 |
| 76 | Ga0070701_10069060 | 3300005438 | Bacteria | 1884 |
| 77 | Ga0070701_10245009 | 3300005438 | Bacteria | 1080 |
| 78 | Ga0070711_100007880 | 3300005439 | Bacteria | 6493 |
| 79 | Ga0070705_100116635 | 3300005440 | Bacteria | 1716 |
| 80 | Ga0070700_100000164 | 3300005441 | Bacteria | 38488 |
| 81 | Ga0070700_100007339 | 3300005441 | Bacteria | 5946 |
| 82 | Ga0070700_100944242 | 3300005441 | Bacteria | 705 |
| 83 | Ga0070694_100006357 | 3300005444 | Bacteria | 7167 |
| 84 | Ga0070694_100167136 | 3300005444 | Bacteria | 1618 |
| 85 | Ga0070708_100416689 | 3300005445 | Bacteria | 1267 |
| 86 | Ga0070663_100000675 | 3300005455 | Bacteria | 18307 |
| 87 | Ga0070663_100010524 | 3300005455 | Bacteria | 5766 |
| 88 | Ga0070663_100047088 | 3300005455 | Bacteria | 3054 |
| 89 | Ga0070663_100083440 | 3300005455 | Bacteria | 2353 |
| 90 | Ga0070663_100251146 | 3300005455 | Bacteria | 1400 |
| 91 | Ga0070663_100267598 | 3300005455 | Bacteria | 1358 |
| 92 | Ga0070678_100001267 | 3300005456 | Bacteria | 13414 |
| 93 | Ga0070678_100132988 | 3300005456 | Bacteria | 1979 |
| 94 | Ga0070662_100014391 | 3300005457 | Bacteria | 5284 |
| 95 | Ga0070662_100225224 | 3300005457 | Bacteria | 1498 |
| 96 | Ga0070681_10854719 | 3300005458 | Bacteria | 828 |
| 97 | Ga0070685_10171120 | 3300005466 | Bacteria | 1392 |
| 98 | Ga0070706_100283652 | 3300005467 | Bacteria | 1546 |
| 99 | Ga0070706_101162971 | 3300005467 | Bacteria | 709 |
| 100 | Ga0070707_100057492 | 3300005468 | Bacteria | 3731 |
| 101 | Ga0070707_100543209 | 3300005468 | Bacteria | 1124 |
| 102 | Ga0070707_100620258 | 3300005468 | Bacteria | 1044 |
| 103 | Ga0070698_100318881 | 3300005471 | Bacteria | 1485 |
| 104 | Ga0070699_100070298 | 3300005518 | Bacteria | 3043 |
| 105 | Ga0070679_100114755 | 3300005530 | Bacteria | 2679 |
| 106 | Ga0070679_100695174 | 3300005530 | Bacteria | 960 |
| 107 | Ga0070684_100142337 | 3300005535 | Bacteria | 2169 |
| 108 | Ga0070684_100229242 | 3300005535 | Bacteria | 1696 |
| 109 | Ga0070697_100770029 | 3300005536 | Bacteria | 851 |
| 110 | Ga0068853_100141807 | 3300005539 | Bacteria | 2157 |
| 111 | Ga0068853_100153332 | 3300005539 | Bacteria | 2075 |
| 112 | Ga0068853_100361814 | 3300005539 | Bacteria | 1352 |
| 113 | Ga0068853_100606802 | 3300005539 | Bacteria | 1040 |
| 114 | Ga0070672_100032755 | 3300005543 | Bacteria | 3927 |
| 115 | Ga0070672_100246585 | 3300005543 | Bacteria | 1504 |
| 116 | Ga0070686_100233093 | 3300005544 | Bacteria | 1336 |
| 117 | Ga0070695_101067412 | 3300005545 | Bacteria | 659 |
| 118 | Ga0070696_100030170 | 3300005546 | Bacteria | 3711 |
| 119 | Ga0070693_100106982 | 3300005547 | Bacteria | 1714 |
| 120 | Ga0070665_100000757 | 3300005548 | Bacteria | 42748 |
| 121 | Ga0070665_100051417 | 3300005548 | Bacteria | 4132 |
| 122 | Ga0070665_100383112 | 3300005548 | Bacteria | 1414 |
| 123 | Ga0070704_100157914 | 3300005549 | Bacteria | 1790 |
| 124 | Ga0070704_100184101 | 3300005549 | Bacteria | 1673 |
| 125 | Ga0068855_100004304 | 3300005563 | Bacteria | 17405 |
| 126 | Ga0068855_100010280 | 3300005563 | Bacteria | 11287 |
| 127 | Ga0068855_100014029 | 3300005563 | Bacteria | 9658 |
| 128 | Ga0068855_100073171 | 3300005563 | Bacteria | 3982 |
| 129 | Ga0068855_100250296 | 3300005563 | Bacteria | 1976 |
| 130 | Ga0068855_100340943 | 3300005563 | Bacteria | 1652 |
| 131 | Ga0068855_100388279 | 3300005563 | Bacteria | 1532 |
| 132 | Ga0070664_100002843 | 3300005564 | Bacteria | 14002 |
| 133 | Ga0070664_100543117 | 3300005564 | Bacteria | 1074 |
| 134 | Ga0068854_100042153 | 3300005578 | Bacteria | 3229 |
| 135 | Ga0068854_100314709 | 3300005578 | Bacteria | 1270 |
| 136 | Ga0068854_100707372 | 3300005578 | Bacteria | 870 |
| 137 | Ga0068856_100045377 | 3300005614 | Bacteria | 4327 |
| 138 | Ga0068856_100074801 | 3300005614 | Bacteria | 3354 |
| 139 | Ga0068856_100075064 | 3300005614 | Bacteria | 3349 |
| 140 | Ga0068856_100159414 | 3300005614 | Bacteria | 2266 |
| 141 | Ga0068856_100235318 | 3300005614 | Bacteria | 1847 |
| 142 | Ga0068856_100352643 | 3300005614 | Bacteria | 1490 |
| 143 | Ga0070702_100002421 | 3300005615 | Bacteria | 8041 |
| 144 | Ga0070702_100099669 | 3300005615 | Bacteria | 1779 |
| 145 | Ga0068852_100020897 | 3300005616 | Bacteria | 5212 |
| 146 | Ga0068852_100163472 | 3300005616 | Bacteria | 2080 |
| 147 | Ga0068852_100417109 | 3300005616 | Bacteria | 1323 |
| 148 | Ga0068859_100002002 | 3300005617 | Bacteria | 20795 |
| 149 | Ga0068859_100002765 | 3300005617 | Bacteria | 17784 |
| 150 | Ga0068859_100024225 | 3300005617 | Bacteria | 6090 |
| 151 | Ga0068859_100394406 | 3300005617 | Bacteria | 1480 |
| 152 | Ga0068864_100005426 | 3300005618 | Bacteria | 10454 |
| 153 | Ga0068864_100028621 | 3300005618 | Bacteria | 4712 |
| 154 | Ga0068866_10179024 | 3300005718 | Bacteria | 1251 |
| 155 | Ga0068866_10392685 | 3300005718 | Bacteria | 893 |
| 156 | Ga0068861_100003837 | 3300005719 | Bacteria | 10034 |
| 157 | Ga0068861_100124345 | 3300005719 | Bacteria | 2085 |
| 158 | Ga0068861_100310298 | 3300005719 | Bacteria | 1370 |
| 159 | Ga0068851_10015584 | 3300005834 | Bacteria | 3623 |
| 160 | Ga0068851_10053701 | 3300005834 | Bacteria | 2052 |
| 161 | Ga0068870_10004082 | 3300005840 | Bacteria | 6245 |
| 162 | Ga0068870_10171209 | 3300005840 | Bacteria | 1296 |
| 163 | Ga0068870_10419495 | 3300005840 | Bacteria | 875 |
| 164 | Ga0068863_100000677 | 3300005841 | Bacteria | 34450 |
| 165 | Ga0068863_100001145 | 3300005841 | Bacteria | 26469 |
| 166 | Ga0068863_100126068 | 3300005841 | Bacteria | 2442 |
| 167 | Ga0068863_100155931 | 3300005841 | Bacteria | 2186 |
| 168 | Ga0068858_100017987 | 3300005842 | Bacteria | 6620 |
| 169 | Ga0068858_100026937 | 3300005842 | Bacteria | 5339 |
| 170 | Ga0068858_100111932 | 3300005842 | Bacteria | 2550 |
| 171 | Ga0068858_100405824 | 3300005842 | Bacteria | 1310 |
| 172 | Ga0068860_100000214 | 3300005843 | Bacteria | 90752 |
| 173 | Ga0068860_100046841 | 3300005843 | Bacteria | 4122 |
| 174 | Ga0068860_100143083 | 3300005843 | Bacteria | 2299 |
| 175 | Ga0068862_100031007 | 3300005844 | Bacteria | 4509 |
| 176 | Ga0068862_100168726 | 3300005844 | Bacteria | 1958 |
| 177 | Ga0081455_10000856 | 3300005937 | Bacteria | 39231 |
| 178 | Ga0081455_10001927 | 3300005937 | Bacteria | 24929 |
| 179 | Ga0081455_10004130 | 3300005937 | Bacteria | 16420 |
| 180 | Ga0081455_10012269 | 3300005937 | Bacteria | 8552 |
| 181 | Ga0081455_10346067 | 3300005937 | Bacteria | 1050 |
| 182 | Ga0081538_10001015 | 3300005981 | Bacteria | 29959 |
| 183 | Ga0081538_10054137 | 3300005981 | Bacteria | 2376 |
| 184 | Ga0081540_1013636 | 3300005983 | Bacteria | 5270 |
| 185 | Ga0081540_1088482 | 3300005983 | Bacteria | 1369 |
| 186 | Ga0081539_10000314 | 3300005985 | Bacteria | 108451 |
| 187 | Ga0081539_10017187 | 3300005985 | Bacteria | 5095 |
| 188 | Ga0070717_10133014 | 3300006028 | Bacteria | 2140 |
| 189 | Ga0070717_10271583 | 3300006028 | Bacteria | 1502 |
| 190 | Ga0075432_10009343 | 3300006058 | Bacteria | 3338 |
| 191 | Ga0075432_10019149 | 3300006058 | Bacteria | 2337 |
| 192 | Ga0075432_10115423 | 3300006058 | Bacteria | 1004 |
| 193 | Ga0070716_100005395 | 3300006173 | Bacteria | 6189 |
| 194 | Ga0070716_100110044 | 3300006173 | Bacteria | 1705 |
| 195 | Ga0070712_100170895 | 3300006175 | Bacteria | 1686 |
| 196 | Ga0070712_100369286 | 3300006175 | Bacteria | 1179 |
| 197 | Ga0097621_100013167 | 3300006237 | Bacteria | 6153 |
| 198 | Ga0097621_100163114 | 3300006237 | Bacteria | 1917 |
| 199 | Ga0068871_100030952 | 3300006358 | Bacteria | 4217 |
| 200 | Ga0068871_100131377 | 3300006358 | Bacteria | 2123 |
| 201 | Ga0075428_100072107 | 3300006844 | Bacteria | 3774 |
| 202 | Ga0075430_100040154 | 3300006846 | Bacteria | 3961 |
| 203 | Ga0075430_100637422 | 3300006846 | Bacteria | 879 |
| 204 | Ga0075431_100005266 | 3300006847 | Bacteria | 12742 |
| 205 | Ga0075431_100145167 | 3300006847 | Bacteria | 2445 |
| 206 | Ga0075431_100230894 | 3300006847 | Bacteria | 1885 |
| 207 | Ga0075431_100985455 | 3300006847 | Bacteria | 810 |
| 208 | Ga0075433_10006200 | 3300006852 | Bacteria | 9432 |
| 209 | Ga0075433_10062775 | 3300006852 | Bacteria | 3254 |
| 210 | Ga0075433_10217963 | 3300006852 | Bacteria | 1696 |
| 211 | Ga0075434_100039963 | 3300006871 | Bacteria | 4646 |
| 212 | Ga0075434_100447822 | 3300006871 | Bacteria | 1312 |
| 213 | Ga0075429_100018670 | 3300006880 | Bacteria | 6005 |
| 214 | Ga0075429_100477292 | 3300006880 | Bacteria | 1093 |
| 215 | Ga0068865_100116516 | 3300006881 | Bacteria | 1979 |
| 216 | Ga0075436_100033515 | 3300006914 | Bacteria | 3540 |
| 217 | Ga0075436_100084376 | 3300006914 | Bacteria | 2204 |
| 218 | Ga0097620_100002002 | 3300006931 | Bacteria | 20795 |
| 219 | Ga0097620_100002765 | 3300006931 | Bacteria | 17784 |
| 220 | Ga0097620_100024224 | 3300006931 | Bacteria | 6090 |
| 221 | Ga0097620_100394412 | 3300006931 | Bacteria | 1480 |
| 222 | Ga0075435_100001179 | 3300007076 | Bacteria | 16688 |
| 223 | Ga0075435_100033992 | 3300007076 | Bacteria | 4036 |
| 224 | Ga0099794_10094948 | 3300007265 | Bacteria | 1483 |
| 225 | Ga0099795_10138581 | 3300007788 | Bacteria | 988 |
| 226 | Ga0105251_10029047 | 3300009011 | Bacteria | 2788 |
| 227 | Ga0105251_10095888 | 3300009011 | Bacteria | 1359 |
| 228 | Ga0105240_10006845 | 3300009093 | Bacteria | 16667 |
| 229 | Ga0105240_10044174 | 3300009093 | Bacteria | 5665 |
| 230 | Ga0105240_10059388 | 3300009093 | Bacteria | 4773 |
| 231 | Ga0105240_10081917 | 3300009093 | Bacteria | 3964 |
| 232 | Ga0105240_10098365 | 3300009093 | Bacteria | 3563 |
| 233 | Ga0105240_10323450 | 3300009093 | Bacteria | 1757 |
| 234 | Ga0111539_10001513 | 3300009094 | Bacteria | 31034 |
| 235 | Ga0111539_10056914 | 3300009094 | Bacteria | 4646 |
| 236 | Ga0111539_10073676 | 3300009094 | Bacteria | 4025 |
| 237 | Ga0111539_10102794 | 3300009094 | Bacteria | 3354 |
| 238 | Ga0105245_10005340 | 3300009098 | Bacteria | 11287 |
| 239 | Ga0105245_10006149 | 3300009098 | Bacteria | 10565 |
| 240 | Ga0105245_10319276 | 3300009098 | Bacteria | 1529 |
| 241 | Ga0105245_10368289 | 3300009098 | Bacteria | 1428 |
| 242 | Ga0105245_10908495 | 3300009098 | Bacteria | 922 |
| 243 | Ga0105247_10012824 | 3300009101 | Bacteria | 5030 |
| 244 | Ga0105247_10073481 | 3300009101 | Bacteria | 2143 |
| 245 | Ga0105247_10091776 | 3300009101 | Bacteria | 1929 |
| 246 | Ga0105247_10144070 | 3300009101 | Bacteria | 1564 |
| 247 | Ga0114129_10004688 | 3300009147 | Bacteria | 19312 |
| 248 | Ga0114129_10068460 | 3300009147 | Bacteria | 4949 |
| 249 | Ga0114129_10092703 | 3300009147 | Bacteria | 4184 |
| 250 | Ga0105243_10099971 | 3300009148 | Bacteria | 2406 |
| 251 | Ga0105243_10123218 | 3300009148 | Bacteria | 2189 |
| 252 | Ga0105243_10362118 | 3300009148 | Bacteria | 1335 |
| 253 | Ga0105243_10529299 | 3300009148 | Bacteria | 1122 |
| 254 | Ga0105241_10026727 | 3300009174 | Bacteria | 4296 |
| 255 | Ga0105241_10033989 | 3300009174 | Bacteria | 3830 |
| 256 | Ga0105241_10064345 | 3300009174 | Bacteria | 2831 |
| 257 | Ga0105241_10115248 | 3300009174 | Bacteria | 2157 |
| 258 | Ga0105242_10433186 | 3300009176 | Bacteria | 1235 |
| 259 | Ga0105237_10044946 | 3300009545 | Bacteria | 4447 |
| 260 | Ga0105237_10076020 | 3300009545 | Bacteria | 3349 |
| 261 | Ga0105237_10195463 | 3300009545 | Bacteria | 2022 |
| 262 | Ga0105237_10289532 | 3300009545 | Bacteria | 1641 |
| 263 | Ga0105237_10399907 | 3300009545 | Bacteria | 1378 |
| 264 | Ga0105238_10067235 | 3300009551 | Bacteria | 3585 |
| 265 | Ga0105238_10570210 | 3300009551 | Bacteria | 1137 |
| 266 | Ga0105238_11114820 | 3300009551 | Bacteria | 812 |
| 267 | Ga0105238_11626699 | 3300009551 | Bacteria | 676 |
| 268 | Ga0105249_10026601 | 3300009553 | Bacteria | 5216 |
| 269 | Ga0105249_10145213 | 3300009553 | Bacteria | 2279 |
| 270 | Ga0105249_10191615 | 3300009553 | Bacteria | 1996 |
| 271 | Ga0105249_10291789 | 3300009553 | Bacteria | 1633 |
| 272 | Ga0105249_10413166 | 3300009553 | Bacteria | 1382 |
| 273 | Ga0105030_102902 | 3300009987 | Bacteria | 1486 |
| 274 | Ga0105028_100390 | 3300009993 | Bacteria | 4706 |
| 275 | Ga0105028_141640 | 3300009993 | Unclassified | 518 |
| 276 | Ga0099796_10166112 | 3300010159 | Bacteria | 878 |
| 277 | Ga0099796_10362534 | 3300010159 | Bacteria | 627 |
| 278 | Ga0105239_10033309 | 3300010375 | Bacteria | 5659 |
| 279 | Ga0105239_10063795 | 3300010375 | Bacteria | 4044 |
| 280 | Ga0105239_10142088 | 3300010375 | Bacteria | 2675 |
| 281 | Ga0105239_10236700 | 3300010375 | Bacteria | 2049 |
| 282 | Ga0105239_10266904 | 3300010375 | Bacteria | 1924 |
| 283 | Ga0105246_10000043 | 3300011119 | Bacteria | 47690 |
| 284 | Ga0105246_10004064 | 3300011119 | Bacteria | 8888 |
| 285 | Ga0105246_10363077 | 3300011119 | Bacteria | 1190 |
| 286 | Ga0157373_10241974 | 3300013100 | Bacteria | 1275 |
| 287 | Ga0157373_10301635 | 3300013100 | Bacteria | 1137 |
| 288 | Ga0157371_10004316 | 3300013102 | Bacteria | 12464 |
| 289 | Ga0157371_10023607 | 3300013102 | Bacteria | 4498 |
| 290 | Ga0157370_10040635 | 3300013104 | Bacteria | 4490 |
| 291 | Ga0157370_10072062 | 3300013104 | Bacteria | 3260 |
| 292 | Ga0157370_10310090 | 3300013104 | Bacteria | 1456 |
| 293 | Ga0157369_10104029 | 3300013105 | Bacteria | 3024 |
| 294 | Ga0157369_10109050 | 3300013105 | Bacteria | 2944 |
| 295 | Ga0157369_11154483 | 3300013105 | Bacteria | 791 |
| 296 | Ga0157374_10090469 | 3300013296 | Bacteria | 2918 |
| 297 | Ga0157374_10359219 | 3300013296 | Bacteria | 1448 |
| 298 | Ga0157378_10071247 | 3300013297 | Bacteria | 3121 |
| 299 | Ga0157378_10994549 | 3300013297 | Bacteria | 873 |
| 300 | Ga0163162_10014741 | 3300013306 | Bacteria | 7639 |
| 301 | Ga0163162_10311610 | 3300013306 | Bacteria | 1706 |
| 302 | Ga0163162_11223651 | 3300013306 | Bacteria | 852 |
| 303 | Ga0163162_11349162 | 3300013306 | Bacteria | 811 |
| 304 | Ga0157372_10000044 | 3300013307 | Bacteria | 152637 |
| 305 | Ga0157372_10202141 | 3300013307 | Bacteria | 2301 |
| 306 | Ga0157372_10777466 | 3300013307 | Bacteria | 1113 |
| 307 | Ga0157375_10028197 | 3300013308 | Bacteria | 5259 |
| 308 | Ga0157375_10275358 | 3300013308 | Bacteria | 1845 |
| 309 | Ga0163163_10033528 | 3300014325 | Bacteria | 4968 |
| 310 | Ga0163163_10523207 | 3300014325 | Bacteria | 1248 |
| 311 | Ga0163163_10756768 | 3300014325 | Bacteria | 1035 |
| 312 | Ga0163163_10935708 | 3300014325 | Bacteria | 930 |
| 313 | Ga0157380_10092763 | 3300014326 | Bacteria | 2496 |
| 314 | Ga0182008_10103200 | 3300014497 | Bacteria | 1410 |
| 315 | Ga0157377_10003703 | 3300014745 | Bacteria | 6934 |
| 316 | Ga0157377_10013082 | 3300014745 | Bacteria | 4191 |
| 317 | Ga0157377_10214301 | 3300014745 | Bacteria | 1229 |
| 318 | Ga0157379_10029889 | 3300014968 | Bacteria | 4846 |
| 319 | Ga0157379_10244323 | 3300014968 | Bacteria | 1628 |
| 320 | Ga0157376_10010771 | 3300014969 | Bacteria | 6709 |
| 321 | Ga0157376_10304946 | 3300014969 | Bacteria | 1509 |
| 322 | Ga0163161_10020614 | 3300017792 | Bacteria | 4628 |
| 323 | Ga0163161_10506359 | 3300017792 | Bacteria | 984 |
| 324 | Ga0206356_10753640 | 3300020070 | Bacteria | 775 |
| 325 | Ga0206349_1470408 | 3300020075 | Bacteria | 898 |
| 326 | Ga0206355_1357797 | 3300020076 | Bacteria | 718 |
| 327 | Ga0206350_10968991 | 3300020080 | Bacteria | 3012 |
| 328 | Ga0206354_10015922 | 3300020081 | Bacteria | 1059 |
| 329 | Ga0206354_10607060 | 3300020081 | Bacteria | 1118 |
| 330 | Ga0206354_11197133 | 3300020081 | Bacteria | 1154 |
| 331 | Ga0206353_10374875 | 3300020082 | Bacteria | 3686 |
| 332 | Ga0206353_10375344 | 3300020082 | Bacteria | 2323 |
| 333 | Ga0206353_11751898 | 3300020082 | Bacteria | 2117 |
| 334 | Ga0213872_10164806 | 3300021361 | Bacteria | 963 |
| 335 | Ga0213872_10169852 | 3300021361 | Bacteria | 946 |
| 336 | Ga0213876_10346643 | 3300021384 | Bacteria | 790 |
| 337 | Ga0224712_10003123 | 3300022467 | Bacteria | 4233 |
| 338 | Ga0224712_10048813 | 3300022467 | Bacteria | 1636 |
| 339 | Ga0224712_10361128 | 3300022467 | Bacteria | 688 |
| 340 | Ga0207713_1085318 | 3300025735 | Bacteria | 1124 |
| 341 | Ga0207653_10029558 | 3300025885 | Bacteria | 1765 |
| 342 | Ga0207692_10294763 | 3300025898 | Bacteria | 985 |
| 343 | Ga0207642_10165566 | 3300025899 | Bacteria | 1191 |
| 344 | Ga0207642_10225428 | 3300025899 | Bacteria | 1050 |
| 345 | Ga0207710_10109892 | 3300025900 | Bacteria | 1308 |
| 346 | Ga0207688_10005818 | 3300025901 | Bacteria | 6711 |
| 347 | Ga0207688_10217001 | 3300025901 | Bacteria | 1151 |
| 348 | Ga0207680_10021603 | 3300025903 | Bacteria | 3485 |
| 349 | Ga0207647_10005262 | 3300025904 | Bacteria | 9523 |
| 350 | Ga0207647_10015085 | 3300025904 | Bacteria | 5309 |
| 351 | Ga0207647_10124091 | 3300025904 | Bacteria | 1521 |
| 352 | Ga0207647_10168969 | 3300025904 | Bacteria | 1274 |
| 353 | Ga0207647_10186303 | 3300025904 | Bacteria | 1204 |
| 354 | Ga0207647_10228151 | 3300025904 | Bacteria | 1072 |
| 355 | Ga0207685_10004863 | 3300025905 | Bacteria | 3473 |
| 356 | Ga0207699_10002396 | 3300025906 | Bacteria | 8853 |
| 357 | Ga0207699_10691371 | 3300025906 | Bacteria | 746 |
| 358 | Ga0207645_10074778 | 3300025907 | Bacteria | 2169 |
| 359 | Ga0207645_10152119 | 3300025907 | Bacteria | 1511 |
| 360 | Ga0207643_10000255 | 3300025908 | Bacteria | 37233 |
| 361 | Ga0207643_10176293 | 3300025908 | Bacteria | 1292 |
| 362 | Ga0207643_10188212 | 3300025908 | Bacteria | 1252 |
| 363 | Ga0207705_10017694 | 3300025909 | Bacteria | 5099 |
| 364 | Ga0207705_10922438 | 3300025909 | Bacteria | 676 |
| 365 | Ga0207684_10264165 | 3300025910 | Bacteria | 1485 |
| 366 | Ga0207654_10013466 | 3300025911 | Bacteria | 4208 |
| 367 | Ga0207654_10766095 | 3300025911 | Bacteria | 696 |
| 368 | Ga0207707_10221366 | 3300025912 | Bacteria | 1647 |
| 369 | Ga0207707_10460312 | 3300025912 | Bacteria | 1088 |
| 370 | Ga0207695_10033289 | 3300025913 | Bacteria | 5624 |
| 371 | Ga0207695_10041233 | 3300025913 | Bacteria | 4942 |
| 372 | Ga0207695_10174565 | 3300025913 | Bacteria | 2072 |
| 373 | Ga0207695_10196804 | 3300025913 | Bacteria | 1931 |
| 374 | Ga0207695_10511307 | 3300025913 | Bacteria | 1083 |
| 375 | Ga0207695_10519048 | 3300025913 | Bacteria | 1073 |
| 376 | Ga0207671_10098280 | 3300025914 | Bacteria | 2214 |
| 377 | Ga0207671_10131878 | 3300025914 | Bacteria | 1918 |
| 378 | Ga0207671_10262904 | 3300025914 | Bacteria | 1358 |
| 379 | Ga0207693_10000510 | 3300025915 | Bacteria | 35052 |
| 380 | Ga0207693_10369168 | 3300025915 | Bacteria | 1122 |
| 381 | Ga0207663_10162755 | 3300025916 | Bacteria | 1577 |
| 382 | Ga0207660_10033041 | 3300025917 | Bacteria | 3575 |
| 383 | Ga0207662_10010838 | 3300025918 | Bacteria | 5039 |
| 384 | Ga0207662_10527207 | 3300025918 | Bacteria | 816 |
| 385 | Ga0207657_10003758 | 3300025919 | Bacteria | 16133 |
| 386 | Ga0207657_10090962 | 3300025919 | Bacteria | 2546 |
| 387 | Ga0207657_10533622 | 3300025919 | Bacteria | 918 |
| 388 | Ga0207649_10070873 | 3300025920 | Bacteria | 2224 |
| 389 | Ga0207652_10017664 | 3300025921 | Bacteria | 5840 |
| 390 | Ga0207652_10159459 | 3300025921 | Bacteria | 2022 |
| 391 | Ga0207652_10844164 | 3300025921 | Bacteria | 811 |
| 392 | Ga0207646_10626235 | 3300025922 | Bacteria | 965 |
| 393 | Ga0207681_10361795 | 3300025923 | Bacteria | 1164 |
| 394 | Ga0207694_10214648 | 3300025924 | Bacteria | 1568 |
| 395 | Ga0207694_10425935 | 3300025924 | Bacteria | 1106 |
| 396 | Ga0207694_10634291 | 3300025924 | Bacteria | 900 |
| 397 | Ga0207650_10075611 | 3300025925 | Bacteria | 2542 |
| 398 | Ga0207659_10013890 | 3300025926 | Bacteria | 5177 |
| 399 | Ga0207659_10049580 | 3300025926 | Bacteria | 2979 |
| 400 | Ga0207687_10017746 | 3300025927 | Bacteria | 4691 |
| 401 | Ga0207687_10042459 | 3300025927 | Bacteria | 3129 |
| 402 | Ga0207687_10052780 | 3300025927 | Bacteria | 2838 |
| 403 | Ga0207687_10081087 | 3300025927 | Bacteria | 2344 |
| 404 | Ga0207687_10181917 | 3300025927 | Bacteria | 1629 |
| 405 | Ga0207687_10385726 | 3300025927 | Bacteria | 1149 |
| 406 | Ga0207700_10046571 | 3300025928 | Bacteria | 3208 |
| 407 | Ga0207700_10215065 | 3300025928 | Bacteria | 1627 |
| 408 | Ga0207700_10971895 | 3300025928 | Bacteria | 760 |
| 409 | Ga0207700_11417052 | 3300025928 | Bacteria | 618 |
| 410 | Ga0207664_10246224 | 3300025929 | Bacteria | 1558 |
| 411 | Ga0207644_10227608 | 3300025931 | Bacteria | 1480 |
| 412 | Ga0207690_10643543 | 3300025932 | Bacteria | 868 |
| 413 | Ga0207706_10003631 | 3300025933 | Bacteria | 14741 |
| 414 | Ga0207706_10166454 | 3300025933 | Bacteria | 1937 |
| 415 | Ga0207706_10167910 | 3300025933 | Unclassified | 1928 |
| 416 | Ga0207686_10750436 | 3300025934 | Bacteria | 779 |
| 417 | Ga0207686_11199305 | 3300025934 | Bacteria | 621 |
| 418 | Ga0207709_10270334 | 3300025935 | Bacteria | 1251 |
| 419 | Ga0207670_10058601 | 3300025936 | Bacteria | 2616 |
| 420 | Ga0207669_10405452 | 3300025937 | Bacteria | 1069 |
| 421 | Ga0207704_10374554 | 3300025938 | Bacteria | 1116 |
| 422 | Ga0207665_10004900 | 3300025939 | Bacteria | 8922 |
| 423 | Ga0207691_10023934 | 3300025940 | Bacteria | 5747 |
| 424 | Ga0207691_10262974 | 3300025940 | Unclassified | 1487 |
| 425 | Ga0207711_10325713 | 3300025941 | Bacteria | 1420 |
| 426 | Ga0207689_10002623 | 3300025942 | Bacteria | 16648 |
| 427 | Ga0207689_10006181 | 3300025942 | Bacteria | 10599 |
| 428 | Ga0207661_10005765 | 3300025944 | Bacteria | 8732 |
| 429 | Ga0207661_10009531 | 3300025944 | Bacteria | 6971 |
| 430 | Ga0207661_10089286 | 3300025944 | Bacteria | 2564 |
| 431 | Ga0207661_10182989 | 3300025944 | Bacteria | 1832 |
| 432 | Ga0207679_10004056 | 3300025945 | Bacteria | 9099 |
| 433 | Ga0207679_10010471 | 3300025945 | Bacteria | 5971 |
| 434 | Ga0207679_10015188 | 3300025945 | Bacteria | 5080 |
| 435 | Ga0207679_10180868 | 3300025945 | Bacteria | 1744 |
| 436 | Ga0207667_10107338 | 3300025949 | Bacteria | 2880 |
| 437 | Ga0207667_10318290 | 3300025949 | Bacteria | 1589 |
| 438 | Ga0207651_11302496 | 3300025960 | Bacteria | 653 |
| 439 | Ga0207712_10055807 | 3300025961 | Bacteria | 2781 |
| 440 | Ga0207712_10440426 | 3300025961 | Bacteria | 1103 |
| 441 | Ga0207712_10534287 | 3300025961 | Bacteria | 1007 |
| 442 | Ga0207712_10883621 | 3300025961 | Bacteria | 789 |
| 443 | Ga0207668_10025417 | 3300025972 | Bacteria | 3832 |
| 444 | Ga0207668_10069537 | 3300025972 | Bacteria | 2507 |
| 445 | Ga0207640_10366577 | 3300025981 | Bacteria | 1163 |
| 446 | Ga0207640_10374123 | 3300025981 | Bacteria | 1152 |
| 447 | Ga0207640_10564494 | 3300025981 | Bacteria | 958 |
| 448 | Ga0207658_10016590 | 3300025986 | Bacteria | 5069 |
| 449 | Ga0207658_10043343 | 3300025986 | Bacteria | 3270 |
| 450 | Ga0207677_10011844 | 3300026023 | Bacteria | 4989 |
| 451 | Ga0207677_10030853 | 3300026023 | Bacteria | 3427 |
| 452 | Ga0207677_10142971 | 3300026023 | Bacteria | 1835 |
| 453 | Ga0207677_10175387 | 3300026023 | Bacteria | 1681 |
| 454 | Ga0207677_10527144 | 3300026023 | Bacteria | 1026 |
| 455 | Ga0207703_10013801 | 3300026035 | Bacteria | 6296 |
| 456 | Ga0207703_10041423 | 3300026035 | Bacteria | 3689 |
| 457 | Ga0207703_10179145 | 3300026035 | Bacteria | 1869 |
| 458 | Ga0207639_10487861 | 3300026041 | Bacteria | 1124 |
| 459 | Ga0207678_10000077 | 3300026067 | Bacteria | 78930 |
| 460 | Ga0207678_10000346 | 3300026067 | Bacteria | 41986 |
| 461 | Ga0207678_10001130 | 3300026067 | Bacteria | 24459 |
| 462 | Ga0207678_10067839 | 3300026067 | Bacteria | 3061 |
| 463 | Ga0207678_10184182 | 3300026067 | Bacteria | 1783 |
| 464 | Ga0207678_10208382 | 3300026067 | Bacteria | 1672 |
| 465 | Ga0207708_10000110 | 3300026075 | Bacteria | 62957 |
| 466 | Ga0207708_10015918 | 3300026075 | Bacteria | 5647 |
| 467 | Ga0207708_10052736 | 3300026075 | Bacteria | 3098 |
| 468 | Ga0207708_10060832 | 3300026075 | Bacteria | 2883 |
| 469 | Ga0207702_10000631 | 3300026078 | Bacteria | 38615 |
| 470 | Ga0207702_10009206 | 3300026078 | Bacteria | 8304 |
| 471 | Ga0207702_10067537 | 3300026078 | Bacteria | 3069 |
| 472 | Ga0207702_10200106 | 3300026078 | Bacteria | 1851 |
| 473 | Ga0207702_10212286 | 3300026078 | Bacteria | 1800 |
| 474 | Ga0207641_10000499 | 3300026088 | Bacteria | 44189 |
| 475 | Ga0207641_10002176 | 3300026088 | Bacteria | 18459 |
| 476 | Ga0207641_10656590 | 3300026088 | Bacteria | 1030 |
| 477 | Ga0207641_11054361 | 3300026088 | Bacteria | 811 |
| 478 | Ga0207676_10016110 | 3300026095 | Bacteria | 5406 |
| 479 | Ga0207674_10020922 | 3300026116 | Bacteria | 7058 |
| 480 | Ga0207674_10395918 | 3300026116 | Bacteria | 1335 |
| 481 | Ga0207675_100039773 | 3300026118 | Bacteria | 4389 |
| 482 | Ga0207675_100335288 | 3300026118 | Bacteria | 1479 |
| 483 | Ga0207683_10000342 | 3300026121 | Bacteria | 42329 |
| 484 | Ga0207683_10000915 | 3300026121 | Bacteria | 27154 |
| 485 | Ga0207683_10316100 | 3300026121 | Bacteria | 1430 |
| 486 | Ga0207698_10014073 | 3300026142 | Bacteria | 5304 |
| 487 | Ga0207698_10057689 | 3300026142 | Bacteria | 3005 |
| 488 | Ga0207698_10202223 | 3300026142 | Bacteria | 1780 |
| 489 | Ga0209588_1160905 | 3300027671 | Bacteria | 709 |
| 490 | Ga0207428_10003594 | 3300027907 | Bacteria | 14973 |
| 491 | Ga0207428_10008491 | 3300027907 | Bacteria | 9276 |
| 492 | Ga0268266_10010410 | 3300028379 | Bacteria | 8128 |
| 493 | Ga0268266_10030224 | 3300028379 | Bacteria | 4604 |
| 494 | Ga0268266_10072788 | 3300028379 | Bacteria | 2981 |
| 495 | Ga0268266_10577085 | 3300028379 | Bacteria | 1079 |
| 496 | Ga0268265_10008211 | 3300028380 | Bacteria | 7054 |
| 497 | Ga0268265_10240267 | 3300028380 | Bacteria | 1598 |
| 498 | Ga0268265_10489557 | 3300028380 | Bacteria | 1157 |
| 499 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 500 | Ga0268264_10255781 | 3300028381 | Bacteria | 1629 |
| 501 | Ga0307515_10017393 | 3300028794 | Bacteria | 13099 |
| 502 | Ga0307515_10854143 | 3300028794 | Bacteria | 537 |
| 503 | Ga0265760_10018948 | 3300031090 | Bacteria | 1983 |
| 504 | Ga0265340_10057467 | 3300031247 | Bacteria | 1870 |
| 505 | Ga0307508_10489127 | 3300031616 | Bacteria | 825 |
| 506 | Ga0307514_10356424 | 3300031649 | Bacteria | 776 |
| 507 | Ga0316576_10001887 | 3300031727 | Bacteria | 11655 |
| 508 | Ga0316576_10024896 | 3300031727 | Bacteria | 4184 |
| 509 | Ga0316578_10089013 | 3300031728 | Bacteria | 1842 |
| 510 | Ga0307405_10268778 | 3300031731 | Bacteria | 1278 |
| 511 | Ga0307405_10436909 | 3300031731 | Bacteria | 1034 |
| 512 | Ga0316577_10000803 | 3300031733 | Bacteria | 13607 |
| 513 | Ga0307413_10270623 | 3300031824 | Bacteria | 1272 |
| 514 | Ga0307518_10020035 | 3300031838 | Bacteria | 4802 |
| 515 | Ga0307406_10024433 | 3300031901 | Bacteria | 3610 |
| 516 | Ga0307406_10181412 | 3300031901 | Bacteria | 1533 |
| 517 | Ga0307406_10246160 | 3300031901 | Bacteria | 1344 |
| 518 | Ga0307409_100068776 | 3300031995 | Bacteria | 2802 |
| 519 | Ga0307409_100964642 | 3300031995 | Bacteria | 869 |
| 520 | Ga0307416_100120946 | 3300032002 | Bacteria | 2333 |
| 521 | Ga0307415_100018917 | 3300032126 | Bacteria | 4171 |
| 522 | Ga0307415_100020868 | 3300032126 | Bacteria | 4011 |
| 523 | Ga0307415_100040696 | 3300032126 | Bacteria | 3081 |
| 524 | Ga0307415_100062408 | 3300032126 | Bacteria | 2585 |
| 525 | Ga0307415_100170276 | 3300032126 | Bacteria | 1697 |
| 526 | Ga0307415_100350405 | 3300032126 | Bacteria | 1243 |
| 527 | Ga0307415_100780178 | 3300032126 | Bacteria | 870 |
| 528 | Ga0307507_10096532 | 3300033179 | Bacteria | 2499 |
| 529 | Ga0307507_10336648 | 3300033179 | Bacteria | 897 |
| 530 | Ga0307510_10038091 | 3300033180 | Bacteria | 5320 |
| 531 | Ga0373948_0022349 | 3300034817 | Bacteria | 1219 |
| 532 | Ga0373958_0071624 | 3300034819 | Bacteria | 770 |
| 533 | Ga0373938_0030561 | 3300034957 | Bacteria | 1150 |
| 534 | Ga0373928_0091798 | 3300035084 | Bacteria | 780 |
| 535 | Ga0373929_0074956 | 3300035085 | Bacteria | 815 |
| 536 | Ga0373952_0001893 | 3300035092 | Bacteria | 3800 |
| 537 | Ga0373923_0348545 | 3300035111 | Bacteria | 707 |
| 538 | Ga0373932_0020236 | 3300035112 | Bacteria | 1743 |
| 539 | Ga0373941_0079330 | 3300035115 | Bacteria | 1106 |
| 540 | Ga0373956_0415589 | 3300035119 | Bacteria | 642 |
| 541 | Ga0373960_0004107 | 3300035121 | Bacteria | 3328 |
| 542 | Ga0373943_0330764 | 3300035170 | Bacteria | 870 |
| 543 | Ga0373946_0616314 | 3300035171 | Bacteria | 563 |
| 544 | Ga0373961_0003240 | 3300035241 | Bacteria | 4058 |
| 545 | Ga0373931_0031228 | 3300035691 | Bacteria | 2748 |
| 546 | Ga0373931_0198656 | 3300035691 | Bacteria | 1197 |
| 547 | Ga0373931_0225001 | 3300035691 | Bacteria | 1131 |
| 548 | Ga0373935_0130632 | 3300035692 | Bacteria | 1687 |
| 549 | Ga0373927_0114568 | 3300035695 | Bacteria | 1757 |
| 550 | Ga0373927_0247829 | 3300035695 | Bacteria | 1171 |
| 551 | Ga0373947_0350216 | 3300035725 | Bacteria | 991 |
| 552 | Ga0316582_0773783 | 3300036647 | Bacteria | 658 |
| 553 | Ga0316584_0093298 | 3300036712 | Bacteria | 2254 |
| 554 | Ga0373925_0116117 | 3300037068 | Bacteria | 2073 |
| 555 | Ga0436364_1373090 | 3300037853 | Bacteria | 1809 |
| 556 | Ga0395901_0229166 | 3300038443 | Bacteria | 1940 |
| 557 | Ga0395901_0264741 | 3300038443 | Bacteria | 1789 |
| 558 | Ga0436365_0493326 | 3300039437 | Bacteria | 2123 |
| 559 | Ga0436361_0217474 | 3300039447 | Bacteria | 1442 |
| 560 | Ga0436361_0741574 | 3300039447 | Bacteria | 1076 |
| 561 | Ga0436362_0031375 | 3300039453 | Bacteria | 2197 |
| 562 | Ga0439448_0108720 | 3300042005 | Bacteria | 946 |
| 563 | Ga0439455_0065376 | 3300042012 | Bacteria | 970 |
| 564 | Ga0439456_082315 | 3300042013 | Bacteria | 719 |
| 565 | Ga0439458_0025483 | 3300042157 | Bacteria | 1388 |
| 566 | Ga0439459_0011222 | 3300042438 | Bacteria | 1576 |
| 567 | Ga0450918_069859 | 3300042531 | Unclassified | 658 |
| 568 | Ga0466969_0042350 | 3300044656 | Bacteria | 2274 |
| 569 | Ga0466969_0264183 | 3300044656 | Bacteria | 780 |
| 570 | Ga0466972_0004679 | 3300044658 | Bacteria | 6854 |
| 571 | Ga0466972_0006007 | 3300044658 | Bacteria | 6100 |
| 572 | Ga0466972_0049397 | 3300044658 | Bacteria | 2032 |
| 573 | Ga0466972_0113273 | 3300044658 | Bacteria | 1281 |
| 574 | Ga0466972_0186865 | 3300044658 | Bacteria | 971 |
| 575 | Ga0466972_0475496 | 3300044658 | Bacteria | 588 |
| 576 | Ga0466965_0006947 | 3300044683 | Bacteria | 5180 |
| 577 | Ga0466965_0280132 | 3300044683 | Bacteria | 900 |
| 578 | Ga0466965_0491415 | 3300044683 | Bacteria | 687 |
| 579 | Ga0466966_0009485 | 3300044684 | Bacteria | 6445 |
| 580 | Ga0466966_0011224 | 3300044684 | Bacteria | 5944 |
| 581 | Ga0466966_0016840 | 3300044684 | Bacteria | 4830 |
| 582 | Ga0466966_0017484 | 3300044684 | Bacteria | 4737 |
| 583 | Ga0466966_0273011 | 3300044684 | Bacteria | 1017 |
| 584 | Ga0466961_0000954 | 3300044693 | Bacteria | 17882 |
| 585 | Ga0466961_0044630 | 3300044693 | Bacteria | 2836 |
| 586 | Ga0466961_0051245 | 3300044693 | Bacteria | 2636 |
| 587 | Ga0466961_0104881 | 3300044693 | Bacteria | 1780 |
| 588 | Ga0466961_0178425 | 3300044693 | Bacteria | 1319 |
| 589 | Ga0466963_0001440 | 3300044694 | Bacteria | 12815 |
| 590 | Ga0466963_0002729 | 3300044694 | Bacteria | 9959 |
| 591 | Ga0466963_0008730 | 3300044694 | Bacteria | 6084 |
| 592 | Ga0466963_0010439 | 3300044694 | Bacteria | 5622 |
| 593 | Ga0466963_0016395 | 3300044694 | Bacteria | 4608 |
| 594 | Ga0466963_0077779 | 3300044694 | Bacteria | 2242 |
| 595 | Ga0466963_0078499 | 3300044694 | Bacteria | 2232 |
| 596 | Ga0466963_0081702 | 3300044694 | Bacteria | 2189 |
| 597 | Ga0466963_0132441 | 3300044694 | Bacteria | 1723 |
| 598 | Ga0466963_0139397 | 3300044694 | Bacteria | 1679 |
| 599 | Ga0466963_0243892 | 3300044694 | Bacteria | 1260 |
| 600 | Ga0466963_0253748 | 3300044694 | Bacteria | 1234 |
| 601 | Ga0466963_0484253 | 3300044694 | Bacteria | 873 |
| 602 | Ga0466963_0871959 | 3300044694 | Bacteria | 634 |
| 603 | Ga0466964_0011541 | 3300044706 | Bacteria | 3339 |
| 604 | Ga0466964_0012829 | 3300044706 | Bacteria | 3174 |
| 605 | Ga0466971_0005559 | 3300044719 | Bacteria | 5476 |
| 606 | Ga0466971_0278915 | 3300044719 | Bacteria | 800 |
| 607 | Ga0466968_0071634 | 3300044735 | Bacteria | 1510 |
| 608 | Ga0466968_0131487 | 3300044735 | Bacteria | 1139 |
| 609 | Ga0466970_0004565 | 3300044765 | Bacteria | 6834 |
| 610 | Ga0466970_0036177 | 3300044765 | Bacteria | 2615 |
| 611 | Ga0466970_0039469 | 3300044765 | Bacteria | 2505 |
| 612 | Ga0466970_0183055 | 3300044765 | Bacteria | 1163 |
| 613 | Ga0466970_0281973 | 3300044765 | Bacteria | 934 |
| 614 | Ga0466970_0313365 | 3300044765 | Bacteria | 886 |
| 615 | Ga0466957_0007208 | 3300044842 | Bacteria | 6286 |
| 616 | Ga0466957_0022908 | 3300044842 | Bacteria | 3688 |
| 617 | Ga0466957_0101726 | 3300044842 | Bacteria | 1812 |
| 618 | Ga0466957_0148514 | 3300044842 | Bacteria | 1514 |
| 619 | Ga0466957_0232039 | 3300044842 | Bacteria | 1222 |
| 620 | Ga0466957_0505674 | 3300044842 | Bacteria | 838 |
| 621 | Ga0466960_0122647 | 3300044901 | Bacteria | 1363 |
| 622 | Ga0466960_0217337 | 3300044901 | Bacteria | 1050 |
| 623 | Ga0466960_0963174 | 3300044901 | Bacteria | 523 |
| 624 | Ga0466959_0012703 | 3300045049 | Bacteria | 6091 |
| 625 | Ga0466959_0082302 | 3300045049 | Bacteria | 2319 |
| 626 | Ga0466959_0213729 | 3300045049 | Bacteria | 1339 |
| 627 | Ga0466959_0620743 | 3300045049 | Bacteria | 727 |
| 628 | Ga0466958_0002544 | 3300045836 | Bacteria | 9201 |
| 629 | Ga0466958_0013570 | 3300045836 | Bacteria | 4641 |
| 630 | Ga0466958_0024044 | 3300045836 | Bacteria | 3582 |
| 631 | Ga0466958_0134981 | 3300045836 | Bacteria | 1551 |
| 632 | Ga0466958_0152079 | 3300045836 | Bacteria | 1460 |
| 633 | Ga0466958_0186100 | 3300045836 | Bacteria | 1319 |
| 634 | Ga0466958_0220602 | 3300045836 | Bacteria | 1210 |
| 635 | Ga0466958_0264100 | 3300045836 | Bacteria | 1102 |
| 636 | Ga0466958_0547006 | 3300045836 | Bacteria | 752 |
| 637 | Ga0466958_0606639 | 3300045836 | Bacteria | 712 |
| 638 | Ga0466967_0000447 | 3300045976 | Bacteria | 19752 |
| 639 | Ga0466967_0004131 | 3300045976 | Bacteria | 9706 |
| 640 | Ga0466967_0017852 | 3300045976 | Bacteria | 5651 |
| 641 | Ga0466967_0021196 | 3300045976 | Bacteria | 5271 |
| 642 | Ga0466967_0057388 | 3300045976 | Bacteria | 3437 |
| 643 | Ga0466967_0062570 | 3300045976 | Bacteria | 3304 |
| 644 | Ga0466967_0062792 | 3300045976 | Bacteria | 3299 |
| 645 | Ga0466967_0088316 | 3300045976 | Bacteria | 2813 |
| 646 | Ga0466967_0107011 | 3300045976 | Bacteria | 2565 |
| 647 | Ga0466967_0240946 | 3300045976 | Bacteria | 1725 |
| 648 | Ga0466967_0280526 | 3300045976 | Bacteria | 1598 |
| 649 | Ga0466967_0298133 | 3300045976 | Bacteria | 1550 |
| 650 | Ga0466967_0535459 | 3300045976 | Bacteria | 1152 |
| 651 | Ga0466967_0852657 | 3300045976 | Bacteria | 905 |
| 652 | Ga0466967_1326312 | 3300045976 | Bacteria | 717 |
| 653 | Ga0466967_1616946 | 3300045976 | Bacteria | 645 |
| 654 | Ga0495627_015412 | 3300046453 | Bacteria | 2639 |
| 655 | Ga0495603_0475421 | 3300046455 | Bacteria | 716 |
| 656 | Ga0495590_0110055 | 3300046457 | Bacteria | 983 |
| 657 | Ga0495653_0219525 | 3300046463 | Bacteria | 1279 |
| 658 | Ga0495650_0103083 | 3300046471 | Bacteria | 1069 |
| 659 | Ga0495580_0508178 | 3300046472 | Bacteria | 804 |
| 660 | Ga0495580_0553546 | 3300046472 | Bacteria | 764 |
| 661 | Ga0495582_0408347 | 3300046473 | Bacteria | 783 |
| 662 | Ga0495628_0101829 | 3300046516 | Bacteria | 2216 |
| 663 | Ga0495666_0294438 | 3300046526 | Bacteria | 735 |
| 664 | Ga0495652_0202368 | 3300046529 | Bacteria | 1506 |
| 665 | Ga0495667_0399878 | 3300046559 | Bacteria | 865 |
| 666 | Ga0495658_0505962 | 3300046683 | Bacteria | 773 |
| 667 | Ga0495624_0813535 | 3300046690 | Bacteria | 552 |
| 668 | Ga0495649_0355334 | 3300046694 | Bacteria | 740 |
| 669 | Ga0495604_0074366 | 3300047317 | Bacteria | 2561 |
| 670 | Ga0495674_0119035 | 3300047319 | Bacteria | 2233 |
| 671 | Ga0495674_0217665 | 3300047319 | Bacteria | 1580 |
| 672 | Ga0495672_0070237 | 3300047320 | Bacteria | 1985 |
| 673 | Ga0495602_0086361 | 3300048088 | Bacteria | 2619 |
| 674 | Ga0496100_0024189 | 3300048903 | Bacteria | 3701 |
| 675 | Ga0496100_0142337 | 3300048903 | Bacteria | 1701 |
| 676 | Ga0496101_0011520 | 3300048904 | Bacteria | 5871 |
| 677 | Ga0496101_0074768 | 3300048904 | Bacteria | 2493 |
| 678 | Ga0496101_0231926 | 3300048904 | Bacteria | 1435 |
| 679 | Ga0496102_0000044 | 3300048905 | Bacteria | 187834 |
| 680 | Ga0496102_0000713 | 3300048905 | Bacteria | 32911 |
| 681 | Ga0496102_0281685 | 3300048905 | Bacteria | 1567 |
| 682 | Ga0496102_0426459 | 3300048905 | Bacteria | 1245 |
| 683 | Ga0496102_0702524 | 3300048905 | Bacteria | 934 |
| 684 | Ga0496103_0000117 | 3300048906 | Bacteria | 86837 |
| 685 | Ga0496103_0005769 | 3300048906 | Bacteria | 7390 |
| 686 | Ga0496103_0084089 | 3300048906 | Bacteria | 2004 |
| 687 | Ga0496104_0025282 | 3300048907 | Bacteria | 5474 |
| 688 | Ga0496104_0080614 | 3300048907 | Bacteria | 3103 |
| 689 | Ga0496104_0123936 | 3300048907 | Bacteria | 2481 |
| 690 | Ga0496104_1700501 | 3300048907 | Bacteria | 533 |
| 691 | Ga0496105_0010565 | 3300048908 | Bacteria | 7261 |
| 692 | Ga0496105_0018736 | 3300048908 | Bacteria | 5573 |
| 693 | Ga0496105_0185845 | 3300048908 | Bacteria | 1701 |
| 694 | Ga0496105_0510379 | 3300048908 | Bacteria | 943 |
| 695 | Ga0496106_0027596 | 3300048909 | Bacteria | 4229 |
| 696 | Ga0496106_0130108 | 3300048909 | Bacteria | 1973 |
| 697 | Ga0496107_0011721 | 3300048910 | Bacteria | 6115 |
| 698 | Ga0496107_0152489 | 3300048910 | Bacteria | 1710 |
| 699 | Ga0496108_0019388 | 3300048911 | Bacteria | 5584 |
| 700 | Ga0496108_0162064 | 3300048911 | Bacteria | 1933 |
| 701 | Ga0496108_0641541 | 3300048911 | Bacteria | 923 |
| 702 | Ga0496108_1081442 | 3300048911 | Bacteria | 682 |
| 703 | Ga0496109_0003861 | 3300048912 | Bacteria | 12516 |
| 704 | Ga0496109_0010941 | 3300048912 | Bacteria | 7773 |
| 705 | Ga0496109_0047173 | 3300048912 | Bacteria | 3916 |
| 706 | Ga0496110_0002011 | 3300048913 | Bacteria | 15139 |
| 707 | Ga0496110_0004089 | 3300048913 | Bacteria | 11261 |
| 708 | Ga0496110_0077935 | 3300048913 | Bacteria | 2949 |
| 709 | Ga0496110_0293693 | 3300048913 | Bacteria | 1480 |
| 710 | Ga0496111_0020045 | 3300048914 | Bacteria | 4651 |
| 711 | Ga0496111_0054239 | 3300048914 | Bacteria | 2897 |
| 712 | Ga0496112_0058246 | 3300048915 | Bacteria | 3804 |
| 713 | Ga0496112_0149996 | 3300048915 | Bacteria | 2299 |
| 714 | Ga0496112_0330726 | 3300048915 | Bacteria | 1467 |
| 715 | Ga0496112_1141158 | 3300048915 | Bacteria | 697 |
| 716 | Ga0496113_0010420 | 3300048916 | Bacteria | 6145 |
| 717 | Ga0496113_0012659 | 3300048916 | Bacteria | 5678 |
| 718 | Ga0496113_0081850 | 3300048916 | Bacteria | 2475 |
| 719 | Ga0496113_0107909 | 3300048916 | Bacteria | 2164 |
| 720 | Ga0496114_0008858 | 3300048917 | Bacteria | 7976 |
| 721 | Ga0496114_0474997 | 3300048917 | Bacteria | 1106 |
| 722 | Ga0496115_0372303 | 3300048918 | Bacteria | 1162 |
| 723 | Ga0496118_0102261 | 3300048921 | Bacteria | 1932 |
| 724 | Ga0496118_0104372 | 3300048921 | Bacteria | 1903 |
| 725 | Ga0496119_0003451 | 3300048922 | Bacteria | 16407 |
| 726 | Ga0496120_0001931 | 3300048923 | Bacteria | 22782 |
| 727 | Ga0496121_0018975 | 3300048924 | Bacteria | 6901 |
| 728 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 729 | Ga0501031_0001780 | 3300049568 | Bacteria | 13515 |
| 730 | Ga0501031_0019140 | 3300049568 | Bacteria | 4457 |
| 731 | Ga0501031_0108334 | 3300049568 | Bacteria | 1814 |
| 732 | Ga0501031_0350300 | 3300049568 | Bacteria | 956 |
| 733 | Ga0501031_0896218 | 3300049568 | Unclassified | 568 |
| 734 | Ga0501033_0021805 | 3300049570 | Bacteria | 4834 |
| 735 | Ga0501033_0131256 | 3300049570 | Bacteria | 1815 |
| 736 | Ga0501033_0274610 | 3300049570 | Bacteria | 1191 |
| 737 | Ga0501034_0432938 | 3300049571 | Bacteria | 1235 |
| 738 | Ga0501036_0002879 | 3300049572 | Bacteria | 13646 |
| 739 | Ga0501036_0013567 | 3300049572 | Bacteria | 6774 |
| 740 | Ga0501036_0048035 | 3300049572 | Bacteria | 3614 |
| 741 | Ga0501036_0135911 | 3300049572 | Unclassified | 2075 |
| 742 | Ga0501036_0584673 | 3300049572 | Unclassified | 927 |
| 743 | Ga0501036_0912335 | 3300049572 | Bacteria | 721 |
| 744 | Ga0501037_0018318 | 3300049573 | Bacteria | 5160 |
| 745 | Ga0501037_0038293 | 3300049573 | Bacteria | 3533 |
| 746 | Ga0501037_0065975 | 3300049573 | Bacteria | 2637 |
| 747 | Ga0501037_0099271 | 3300049573 | Unclassified | 2103 |
| 748 | Ga0501037_0163507 | 3300049573 | Unclassified | 1586 |
| 749 | Ga0501037_0255756 | 3300049573 | Bacteria | 1225 |
| 750 | Ga0501038_0000729 | 3300049574 | Bacteria | 29347 |
| 751 | Ga0501038_0022743 | 3300049574 | Bacteria | 5612 |
| 752 | Ga0501038_0041430 | 3300049574 | Bacteria | 4016 |
| 753 | Ga0501038_0056599 | 3300049574 | Bacteria | 3368 |
| 754 | Ga0501038_0132916 | 3300049574 | Unclassified | 2041 |
| 755 | Ga0501038_0144887 | 3300049574 | Bacteria | 1940 |
| 756 | Ga0501039_0002714 | 3300049575 | Bacteria | 13204 |
| 757 | Ga0501039_0010078 | 3300049575 | Bacteria | 7202 |
| 758 | Ga0501039_0015236 | 3300049575 | Bacteria | 5884 |
| 759 | Ga0501039_0021997 | 3300049575 | Bacteria | 4893 |
| 760 | Ga0501039_0041159 | 3300049575 | Bacteria | 3568 |
| 761 | Ga0501039_0136815 | 3300049575 | Unclassified | 1924 |
| 762 | Ga0501040_0001767 | 3300049576 | Bacteria | 13886 |
| 763 | Ga0501040_0001830 | 3300049576 | Bacteria | 13676 |
| 764 | Ga0501040_0019976 | 3300049576 | Bacteria | 4460 |
| 765 | Ga0501040_0029496 | 3300049576 | Bacteria | 3704 |
| 766 | Ga0501040_0029505 | 3300049576 | Bacteria | 3703 |
| 767 | Ga0501040_0032633 | 3300049576 | Bacteria | 3525 |
| 768 | Ga0501040_0033356 | 3300049576 | Bacteria | 3487 |
| 769 | Ga0501040_0046709 | 3300049576 | Bacteria | 2955 |
| 770 | Ga0501040_0149112 | 3300049576 | Bacteria | 1649 |
| 771 | Ga0501041_0001005 | 3300049577 | Bacteria | 15446 |
| 772 | Ga0501041_0002936 | 3300049577 | Bacteria | 9786 |
| 773 | Ga0501041_0035113 | 3300049577 | Bacteria | 3037 |
| 774 | Ga0501041_0200026 | 3300049577 | Bacteria | 1252 |
| 775 | Ga0501042_0000239 | 3300049578 | Bacteria | 26543 |
| 776 | Ga0501042_0007078 | 3300049578 | Bacteria | 7328 |
| 777 | Ga0501042_0013811 | 3300049578 | Bacteria | 5501 |
| 778 | Ga0501042_0018185 | 3300049578 | Bacteria | 4863 |
| 779 | Ga0501042_0241839 | 3300049578 | Unclassified | 1302 |
| 780 | Ga0501042_0275153 | 3300049578 | Bacteria | 1216 |
| 781 | Ga0501042_0406110 | 3300049578 | Bacteria | 987 |
| 782 | Ga0501042_1250739 | 3300049578 | Bacteria | 541 |
| 783 | Ga0501043_0048957 | 3300049579 | Bacteria | 3322 |
| 784 | Ga0501043_0217951 | 3300049579 | Bacteria | 1477 |
| 785 | Ga0501043_0230136 | 3300049579 | Bacteria | 1432 |
| 786 | Ga0501043_0313798 | 3300049579 | Bacteria | 1196 |
| 787 | Ga0501046_0012074 | 3300049580 | Bacteria | 7365 |
| 788 | Ga0501046_0021049 | 3300049580 | Bacteria | 5386 |
| 789 | Ga0501046_0024589 | 3300049580 | Bacteria | 4939 |
| 790 | Ga0501046_0102211 | 3300049580 | Bacteria | 2197 |
| 791 | Ga0501046_0165197 | 3300049580 | Bacteria | 1663 |
| 792 | Ga0501047_0020554 | 3300049581 | Bacteria | 6338 |
| 793 | Ga0501047_0098841 | 3300049581 | Bacteria | 2797 |
| 794 | Ga0501048_0000611 | 3300049582 | Bacteria | 25411 |
| 795 | Ga0501048_0004412 | 3300049582 | Bacteria | 10715 |
| 796 | Ga0501048_0007580 | 3300049582 | Bacteria | 8228 |
| 797 | Ga0501048_0011520 | 3300049582 | Bacteria | 6593 |
| 798 | Ga0501048_0038277 | 3300049582 | Bacteria | 3442 |
| 799 | Ga0501048_0043343 | 3300049582 | Bacteria | 3221 |
| 800 | Ga0501048_0115097 | 3300049582 | Bacteria | 1900 |
| 801 | Ga0501048_0574936 | 3300049582 | Unclassified | 809 |
| 802 | Ga0501068_0009321 | 3300049584 | Bacteria | 5489 |
| 803 | Ga0501068_0028606 | 3300049584 | Bacteria | 3297 |
| 804 | Ga0501068_0047233 | 3300049584 | Bacteria | 2597 |
| 805 | Ga0501068_0663049 | 3300049584 | Unclassified | 681 |
| 806 | Ga0501069_0038793 | 3300049585 | Unclassified | 2630 |
| 807 | Ga0501069_0128904 | 3300049585 | Unclassified | 1448 |
| 808 | Ga0501069_0885616 | 3300049585 | Unclassified | 543 |
| 809 | Ga0501070_0015871 | 3300049586 | Bacteria | 6332 |
| 810 | Ga0501070_0194594 | 3300049586 | Bacteria | 1666 |
| 811 | Ga0501070_0269047 | 3300049586 | Bacteria | 1392 |
| 812 | Ga0501070_0384448 | 3300049586 | Bacteria | 1137 |
| 813 | Ga0501070_0635856 | 3300049586 | Bacteria | 848 |
| 814 | Ga0501071_0000062 | 3300049587 | Bacteria | 37621 |
| 815 | Ga0501071_0002438 | 3300049587 | Bacteria | 11282 |
| 816 | Ga0501071_0003996 | 3300049587 | Bacteria | 9308 |
| 817 | Ga0501071_0005805 | 3300049587 | Bacteria | 7972 |
| 818 | Ga0501071_0024149 | 3300049587 | Bacteria | 4250 |
| 819 | Ga0501071_0032103 | 3300049587 | Bacteria | 3727 |
| 820 | Ga0501071_0041766 | 3300049587 | Bacteria | 3284 |
| 821 | Ga0501071_0079211 | 3300049587 | Bacteria | 2402 |
| 822 | Ga0501071_0124614 | 3300049587 | Bacteria | 1911 |
| 823 | Ga0501071_0246653 | 3300049587 | Unclassified | 1347 |
| 824 | Ga0501071_1133761 | 3300049587 | Bacteria | 604 |
| 825 | Ga0501072_0004395 | 3300049588 | Bacteria | 10701 |
| 826 | Ga0501072_0004712 | 3300049588 | Bacteria | 10394 |
| 827 | Ga0501072_0008700 | 3300049588 | Bacteria | 7706 |
| 828 | Ga0501072_0045315 | 3300049588 | Bacteria | 3458 |
| 829 | Ga0501072_0047440 | 3300049588 | Bacteria | 3382 |
| 830 | Ga0501072_0055284 | 3300049588 | Bacteria | 3129 |
| 831 | Ga0501072_0107951 | 3300049588 | Bacteria | 2214 |
| 832 | Ga0501072_0113778 | 3300049588 | Bacteria | 2154 |
| 833 | Ga0501072_0130484 | 3300049588 | Bacteria | 2003 |
| 834 | Ga0501072_0597220 | 3300049588 | Unclassified | 870 |
| 835 | Ga0501072_0613307 | 3300049588 | Bacteria | 857 |
| 836 | Ga0501073_0034926 | 3300049589 | Bacteria | 3576 |
| 837 | Ga0501073_0035165 | 3300049589 | Bacteria | 3562 |
| 838 | Ga0501074_0005674 | 3300049590 | Bacteria | 8992 |
| 839 | Ga0501074_0009203 | 3300049590 | Bacteria | 7176 |
| 840 | Ga0501074_0014380 | 3300049590 | Bacteria | 5760 |
| 841 | Ga0501074_0119681 | 3300049590 | Unclassified | 1883 |
| 842 | Ga0501074_0541351 | 3300049590 | Bacteria | 824 |
| 843 | Ga0501074_0640849 | 3300049590 | Bacteria | 751 |
| 844 | Ga0501075_0006070 | 3300049591 | Bacteria | 8289 |
| 845 | Ga0501075_0010862 | 3300049591 | Bacteria | 6421 |
| 846 | Ga0501075_0018077 | 3300049591 | Bacteria | 5097 |
| 847 | Ga0501075_0027631 | 3300049591 | Bacteria | 4183 |
| 848 | Ga0501075_0033187 | 3300049591 | Bacteria | 3840 |
| 849 | Ga0501075_0040651 | 3300049591 | Bacteria | 3483 |
| 850 | Ga0501075_0094631 | 3300049591 | Bacteria | 2267 |
| 851 | Ga0501075_0144339 | 3300049591 | Bacteria | 1814 |
| 852 | Ga0501075_0172381 | 3300049591 | Bacteria | 1651 |
| 853 | Ga0501075_0816599 | 3300049591 | Bacteria | 709 |
| 854 | Ga0501076_0005061 | 3300049592 | Bacteria | 9438 |
| 855 | Ga0501076_0108961 | 3300049592 | Bacteria | 2238 |
| 856 | Ga0501076_0166942 | 3300049592 | Bacteria | 1794 |
| 857 | Ga0501076_0187035 | 3300049592 | Bacteria | 1689 |
| 858 | Ga0501076_0298349 | 3300049592 | Bacteria | 1321 |
| 859 | Ga0501076_0492262 | 3300049592 | Bacteria | 1010 |
| 860 | Ga0501076_0656990 | 3300049592 | Unclassified | 865 |
| 861 | Ga0501076_1154154 | 3300049592 | Unclassified | 638 |
| 862 | Ga0501077_0005645 | 3300049593 | Bacteria | 7624 |
| 863 | Ga0501077_0009054 | 3300049593 | Bacteria | 6179 |
| 864 | Ga0501077_0009503 | 3300049593 | Bacteria | 6045 |
| 865 | Ga0501077_0010462 | 3300049593 | Bacteria | 5775 |
| 866 | Ga0501077_0096521 | 3300049593 | Bacteria | 1873 |
| 867 | Ga0501077_0349401 | 3300049593 | Bacteria | 944 |
| 868 | Ga0501079_0000728 | 3300049741 | Bacteria | 22229 |
| 869 | Ga0501079_0003279 | 3300049741 | Bacteria | 11855 |
| 870 | Ga0501079_0004086 | 3300049741 | Bacteria | 10804 |
| 871 | Ga0501079_0007964 | 3300049741 | Bacteria | 8034 |
| 872 | Ga0501079_0019126 | 3300049741 | Bacteria | 5232 |
| 873 | Ga0501079_0024713 | 3300049741 | Bacteria | 4610 |
| 874 | Ga0501079_0035311 | 3300049741 | Bacteria | 3848 |
| 875 | Ga0501079_0060478 | 3300049741 | Bacteria | 2922 |
| 876 | Ga0501079_0073873 | 3300049741 | Bacteria | 2636 |
| 877 | Ga0501079_0074235 | 3300049741 | Bacteria | 2629 |
| 878 | Ga0501079_0188289 | 3300049741 | Unclassified | 1611 |
| 879 | Ga0501080_0011960 | 3300049742 | Bacteria | 7949 |
| 880 | Ga0501080_0129272 | 3300049742 | Bacteria | 2338 |
| 881 | Ga0501080_0220006 | 3300049742 | Unclassified | 1738 |
| 882 | Ga0501080_0237566 | 3300049742 | Unclassified | 1664 |
| 883 | Ga0501081_0001987 | 3300049743 | Bacteria | 12750 |
| 884 | Ga0501081_0005223 | 3300049743 | Bacteria | 8363 |
| 885 | Ga0501081_0006609 | 3300049743 | Bacteria | 7532 |
| 886 | Ga0501081_0016737 | 3300049743 | Bacteria | 4847 |
| 887 | Ga0501081_0026970 | 3300049743 | Bacteria | 3876 |
| 888 | Ga0501081_0038578 | 3300049743 | Bacteria | 3264 |
| 889 | Ga0501081_0050599 | 3300049743 | Bacteria | 2862 |
| 890 | Ga0501081_0194310 | 3300049743 | Unclassified | 1470 |
| 891 | Ga0501081_0198726 | 3300049743 | Bacteria | 1454 |
| 892 | Ga0501081_0282035 | 3300049743 | Unclassified | 1216 |
| 893 | Ga0501083_0009211 | 3300049744 | Bacteria | 6974 |
| 894 | Ga0501083_0079816 | 3300049744 | Unclassified | 2170 |
| 895 | Ga0501083_0090566 | 3300049744 | Bacteria | 2020 |
| 896 | Ga0501083_0985693 | 3300049744 | Bacteria | 548 |
| 897 | Ga0501035_0005557 | 3300049822 | Bacteria | 11913 |
| 898 | Ga0501035_0016934 | 3300049822 | Bacteria | 6718 |
| 899 | Ga0501035_0024078 | 3300049822 | Bacteria | 5586 |
| 900 | Ga0501035_0041768 | 3300049822 | Bacteria | 4140 |
| 901 | Ga0501035_0825018 | 3300049822 | Unclassified | 739 |
| 902 | Ga0501044_0108974 | 3300049823 | Bacteria | 2779 |
| 903 | Ga0501044_0127085 | 3300049823 | Bacteria | 2546 |
| 904 | Ga0501044_0260157 | 3300049823 | Unclassified | 1674 |
| 905 | Ga0501044_0465067 | 3300049823 | Bacteria | 1170 |
| 906 | Ga0501044_1299258 | 3300049823 | Unclassified | 594 |
| 907 | Ga0501045_0003979 | 3300049824 | Bacteria | 10170 |
| 908 | Ga0501045_0005995 | 3300049824 | Bacteria | 8409 |
| 909 | Ga0501045_0013828 | 3300049824 | Bacteria | 5707 |
| 910 | Ga0501045_0032635 | 3300049824 | Unclassified | 3774 |
| 911 | Ga0501045_0058330 | 3300049824 | Bacteria | 2826 |
| 912 | Ga0501045_0134135 | 3300049824 | Bacteria | 1841 |
| 913 | Ga0501045_0199680 | 3300049824 | Bacteria | 1490 |
| 914 | Ga0501045_0240852 | 3300049824 | Bacteria | 1347 |
| 915 | nmdc:mga05p37_1192_c1 | 3300050507 | Bacteria | 30031 |
| 916 | nmdc:mga05p37_190998_c1 | 3300050507 | Bacteria | 2486 |
| 917 | nmdc:mga05p37_972350_c1 | 3300050507 | Bacteria | 906 |
| 918 | nmdc:mga09592_241_c1 | 3300050508 | Bacteria | 39617 |
| 919 | nmdc:mga0qj67_36841_c1 | 3300050509 | Bacteria | 3829 |
| 920 | nmdc:mga0qj67_550017_c1 | 3300050509 | Bacteria | 926 |
| 921 | nmdc:mga06r32_283_c1 | 3300050510 | Bacteria | 42355 |
| 922 | nmdc:mga06r32_374372_c1 | 3300050510 | Bacteria | 1407 |
| 923 | nmdc:mga06r32_8334_c1 | 3300050510 | Bacteria | 9331 |
| 924 | nmdc:mga08y16_1006549_c1 | 3300050511 | Bacteria | 813 |
| 925 | nmdc:mga08y16_24412_c1 | 3300050511 | Bacteria | 6381 |
| 926 | nmdc:mga08y16_8609_c1 | 3300050511 | Bacteria | 10694 |
| 927 | nmdc:mga0n895_8279_c1 | 3300050512 | Bacteria | 8993 |
| 928 | nmdc:mga0rr50_9865_c1 | 3300050513 | Bacteria | 6034 |
| 929 | nmdc:mga08x19_113668_c1 | 3300050514 | Bacteria | 1808 |
| 930 | nmdc:mga08x19_144963_c1 | 3300050514 | Bacteria | 1606 |
| 931 | nmdc:mga08x19_163173_c1 | 3300050514 | Bacteria | 1514 |
| 932 | nmdc:mga0a205_306391_c1 | 3300050515 | Bacteria | 1461 |
| 933 | nmdc:mga0a205_359882_c1 | 3300050515 | Bacteria | 1322 |
| 934 | nmdc:mga0a205_41748_c1 | 3300050515 | Bacteria | 4419 |
| 935 | Ga0495601_0003900 | 3300053077 | Bacteria | 8584 |
| 936 | Ga0495612_0223809 | 3300053078 | Bacteria | 833 |
| 937 | Ga0495612_0283338 | 3300053078 | Bacteria | 741 |
| 938 | Ga0495655_0007418 | 3300053083 | Bacteria | 2038 |
| 939 | Ga0495595_0074698 | 3300053084 | Bacteria | 1607 |
| 940 | Ga0495595_0126167 | 3300053084 | Bacteria | 1249 |
| 941 | Ga0495619_0996627 | 3300053085 | Bacteria | 560 |
| 942 | Ga0500654_106318 | 3300053099 | Bacteria | 1171 |
| 943 | Ga0500568_0153315 | 3300053139 | Bacteria | 852 |
| 944 | Ga0500616_0020355 | 3300053153 | Bacteria | 3727 |
| 945 | Ga0501084_0003344 | 3300054114 | Bacteria | 12990 |
| 946 | Ga0501084_0038176 | 3300054114 | Bacteria | 4015 |
| 947 | Ga0501084_0053873 | 3300054114 | Bacteria | 3365 |
| 948 | Ga0501084_0090844 | 3300054114 | Bacteria | 2564 |
| 949 | Ga0501084_0302702 | 3300054114 | Bacteria | 1350 |
| 950 | Ga0501084_1067131 | 3300054114 | Bacteria | 678 |
| 951 | Ga0501082_0002626 | 3300060353 | Bacteria | 15701 |
| 952 | Ga0501082_0011337 | 3300060353 | Bacteria | 7663 |
| 953 | Ga0501082_0011615 | 3300060353 | Bacteria | 7570 |
| 954 | Ga0501082_0021836 | 3300060353 | Bacteria | 5517 |
| 955 | Ga0501082_0047265 | 3300060353 | Bacteria | 3709 |
| 956 | Ga0501082_0211167 | 3300060353 | Bacteria | 1689 |
| 957 | Ga0501082_1570900 | 3300060353 | Unclassified | 574 |
| 958 | Ga0466962_0023113 | 3300061719 | Bacteria | 2988 |
| 959 | Ga0466962_0032618 | 3300061719 | Bacteria | 2493 |
| 960 | Ga0466962_0050764 | 3300061719 | Bacteria | 1983 |
| 961 | Ga0466962_0056766 | 3300061719 | Bacteria | 1870 |
| 962 | Ga0466962_0102272 | 3300061719 | Bacteria | 1376 |
| 963 | Ga0466962_0140585 | 3300061719 | Bacteria | 1169 |
| 964 | Ga0466962_0239257 | 3300061719 | Bacteria | 891 |
| 965 | Ga0466962_0384450 | 3300061719 | Bacteria | 701 |
| 966 | Ga0530510_0006632 | 3300061734 | Bacteria | 8071 |
| 967 | Ga0530510_0016464 | 3300061734 | Bacteria | 5234 |
| 968 | Ga0530510_0018663 | 3300061734 | Bacteria | 4917 |
| 969 | Ga0530510_0020682 | 3300061734 | Bacteria | 4679 |
| 970 | Ga0530510_0029979 | 3300061734 | Bacteria | 3906 |
| 971 | Ga0530510_0065335 | 3300061734 | Bacteria | 2636 |
| 972 | Ga0530510_0075777 | 3300061734 | Bacteria | 2443 |
| 973 | 2586059137 | 2585427649 | Bacteria | 9053857 |
| 974 | 2676488925 | 2675903060 | Bacteria | 10051191 |
| 975 | 2809592106 | 2808606522 | Bacteria | 9488490 |
| 976 | 2816504704 | 2816332139 | Bacteria | 9138787 |
| 977 | 2870784845 | 2870782633 | Bacteria | 9624083 |
| 978 | 2884702499 | 2884693830 | Bacteria | 11273186 |
| 979 | 2895429279 | 2895427314 | Bacteria | 13147766 |
| 980 | 2895451998 | 2895442618 | Bacteria | 11027144 |
| 981 | 2899364055 | 2899359706 | Bacteria | 10940472 |
| 982 | 2899373231 | 2899370129 | Bacteria | 6781179 |
| 983 | 2904770131 | 2904765812 | Bacteria | 5369154 |
| 984 | 2904771020 | 2904770941 | Bacteria | 5580202 |
| 985 | 2908815064 | 2908811453 | Bacteria | 5478616 |
| 986 | 2915776204 | 2915768154 | Bacteria | 8424322 |
| 987 | 2917743339 | 2917736166 | Bacteria | 9690793 |
| 988 | 2919424453 | 2919420072 | Bacteria | 5390363 |
| 989 | 2919436846 | 2919432681 | Bacteria | 5390474 |
| 990 | 8003322679 | 8003314358 | Bacteria | 10575343 |
| 991 | Ga0105240_10492224 | |||
| 992 | JGI24739J22299_10020085 | |||
| 993 | JGI24737J22298_10007912 | |||
| 994 | JGI24737J22298_10050823 | |||
| 995 | JGI24737J22298_10116046 | |||
| 996 | JGI24743J22301_10062833 | |||
| 997 | JGI24735J21928_10045306 | |||
| 998 | JGI24735J21928_10185665 | |||
| 999 | JGI24738J21930_10028319 | |||
| 1000 | JGI25406J46586_10062510 | |||
| 1001 | JGI25407J50210_10045653 | |||
| 1002 | JGI25405J52794_10028845 | |||
| 1003 | Ga0070658_10037109 | |||
| 1004 | Ga0070658_10151448 | |||
| 1005 | Ga0070658_10159873 | |||
| 1006 | Ga0070676_10237223 | |||
| 1007 | Ga0070676_10283069 | |||
| 1008 | Ga0070683_100014452 | |||
| 1009 | Ga0070683_100107472 | |||
| 1010 | Ga0070683_100808326 | |||
| 1011 | Ga0070690_100280286 | |||
| 1012 | Ga0070670_100120405 | |||
| 1013 | Ga0070670_100456509 | |||
| 1014 | Ga0070677_10536144 | |||
| 1015 | Ga0068869_100001830 | |||
| 1016 | Ga0068869_100013851 | |||
| 1017 | Ga0070666_10008045 | |||
| 1018 | Ga0070666_10010640 | |||
| 1019 | Ga0070680_100219847 | |||
| 1020 | Ga0070680_100290920 | |||
| 1021 | Ga0070682_100068612 | |||
| 1022 | Ga0068868_100019172 | |||
| 1023 | Ga0068868_100044868 | |||
| 1024 | Ga0068868_100117031 | |||
| 1025 | Ga0068868_100747426 | |||
| 1026 | Ga0070660_100029442 | |||
| 1027 | Ga0070660_100496170 | |||
| 1028 | Ga0070689_100039992 | |||
| 1029 | Ga0070691_10323694 | |||
| 1030 | Ga0070687_100015748 | |||
| 1031 | Ga0070687_100107291 | |||
| 1032 | Ga0070661_100280650 | |||
| 1033 | Ga0070692_10003704 | |||
| 1034 | Ga0070692_10016341 | |||
| 1035 | Ga0070668_100003437 | |||
| 1036 | Ga0070668_100006857 | |||
| 1037 | Ga0070668_100026621 | |||
| 1038 | Ga0070668_100532772 | |||
| 1039 | Ga0070669_100105295 | |||
| 1040 | Ga0070675_100000145 | |||
| 1041 | Ga0070675_100049433 | |||
| 1042 | Ga0070671_100001993 | |||
| 1043 | Ga0070671_100155998 | |||
| 1044 | Ga0070674_100376460 | |||
| 1045 | Ga0070673_100721548 | |||
| 1046 | Ga0070688_100115244 | |||
| 1047 | Ga0070659_100050002 | |||
| 1048 | Ga0070659_100156150 | |||
| 1049 | Ga0070659_100263424 | |||
| 1050 | Ga0070667_100003161 | |||
| 1051 | Ga0070667_100009470 | |||
| 1052 | Ga0070709_10248084 | |||
| 1053 | Ga0070709_10250149 | |||
| 1054 | Ga0070709_11300033 | |||
| 1055 | Ga0070714_100151905 | |||
| 1056 | Ga0070714_100460076 | |||
| 1057 | Ga0070714_100816398 | |||
| 1058 | Ga0070713_100031457 | |||
| 1059 | Ga0070713_100049113 | |||
| 1060 | Ga0070713_100056458 | |||
| 1061 | Ga0070713_100115918 | |||
| 1062 | Ga0070713_100894992 | |||
| 1063 | Ga0070710_10353383 | |||
| 1064 | Ga0070710_10407150 | |||
| 1065 | Ga0070710_10564315 | |||
| 1066 | Ga0070701_10069060 | |||
| 1067 | Ga0070701_10245009 | |||
| 1068 | Ga0070711_100007880 | |||
| 1069 | Ga0070705_100116635 | |||
| 1070 | Ga0070700_100000164 | |||
| 1071 | Ga0070700_100007339 | |||
| 1072 | Ga0070700_100944242 | |||
| 1073 | Ga0070694_100006357 | |||
| 1074 | Ga0070694_100167136 | |||
| 1075 | Ga0070708_100416689 | |||
| 1076 | Ga0070663_100000675 | |||
| 1077 | Ga0070663_100010524 | |||
| 1078 | Ga0070663_100047088 | |||
| 1079 | Ga0070663_100083440 | |||
| 1080 | Ga0070663_100251146 | |||
| 1081 | Ga0070663_100267598 | |||
| 1082 | Ga0070678_100001267 | |||
| 1083 | Ga0070678_100132988 | |||
| 1084 | Ga0070662_100014391 | |||
| 1085 | Ga0070662_100225224 | |||
| 1086 | Ga0070681_10854719 | |||
| 1087 | Ga0070685_10171120 | |||
| 1088 | Ga0070706_100283652 | |||
| 1089 | Ga0070706_101162971 | |||
| 1090 | Ga0070707_100057492 | |||
| 1091 | Ga0070707_100543209 | |||
| 1092 | Ga0070707_100620258 | |||
| 1093 | Ga0070698_100318881 | |||
| 1094 | Ga0070699_100070298 | |||
| 1095 | Ga0070679_100114755 | |||
| 1096 | Ga0070679_100695174 | |||
| 1097 | Ga0070684_100142337 | |||
| 1098 | Ga0070684_100229242 | |||
| 1099 | Ga0070697_100770029 | |||
| 1100 | Ga0068853_100141807 | |||
| 1101 | Ga0068853_100153332 | |||
| 1102 | Ga0068853_100361814 | |||
| 1103 | Ga0068853_100606802 | |||
| 1104 | Ga0070672_100032755 | |||
| 1105 | Ga0070672_100246585 | |||
| 1106 | Ga0070686_100233093 | |||
| 1107 | Ga0070695_101067412 | |||
| 1108 | Ga0070696_100030170 | |||
| 1109 | Ga0070693_100106982 | |||
| 1110 | Ga0070665_100000757 | |||
| 1111 | Ga0070665_100051417 | |||
| 1112 | Ga0070665_100383112 | |||
| 1113 | Ga0070704_100157914 | |||
| 1114 | Ga0070704_100184101 | |||
| 1115 | Ga0068855_100004304 | |||
| 1116 | Ga0068855_100010280 | |||
| 1117 | Ga0068855_100014029 | |||
| 1118 | Ga0068855_100073171 | |||
| 1119 | Ga0068855_100250296 | |||
| 1120 | Ga0068855_100340943 | |||
| 1121 | Ga0068855_100388279 | |||
| 1122 | Ga0070664_100002843 | |||
| 1123 | Ga0070664_100543117 | |||
| 1124 | Ga0068854_100042153 | |||
| 1125 | Ga0068854_100314709 | |||
| 1126 | Ga0068854_100707372 | |||
| 1127 | Ga0068856_100045377 | |||
| 1128 | Ga0068856_100074801 | |||
| 1129 | Ga0068856_100075064 | |||
| 1130 | Ga0068856_100159414 | |||
| 1131 | Ga0068856_100235318 | |||
| 1132 | Ga0068856_100352643 | |||
| 1133 | Ga0070702_100002421 | |||
| 1134 | Ga0070702_100099669 | |||
| 1135 | Ga0068852_100020897 | |||
| 1136 | Ga0068852_100163472 | |||
| 1137 | Ga0068852_100417109 | |||
| 1138 | Ga0068859_100002002 | |||
| 1139 | Ga0068859_100002765 | |||
| 1140 | Ga0068859_100024225 | |||
| 1141 | Ga0068859_100394406 | |||
| 1142 | Ga0068864_100005426 | |||
| 1143 | Ga0068864_100028621 | |||
| 1144 | Ga0068866_10179024 | |||
| 1145 | Ga0068866_10392685 | |||
| 1146 | Ga0068861_100003837 | |||
| 1147 | Ga0068861_100124345 | |||
| 1148 | Ga0068861_100310298 | |||
| 1149 | Ga0068851_10015584 | |||
| 1150 | Ga0068851_10053701 | |||
| 1151 | Ga0068870_10004082 | |||
| 1152 | Ga0068870_10171209 | |||
| 1153 | Ga0068870_10419495 | |||
| 1154 | Ga0068863_100000677 | |||
| 1155 | Ga0068863_100001145 | |||
| 1156 | Ga0068863_100126068 | |||
| 1157 | Ga0068863_100155931 | |||
| 1158 | Ga0068858_100017987 | |||
| 1159 | Ga0068858_100026937 | |||
| 1160 | Ga0068858_100111932 | |||
| 1161 | Ga0068858_100405824 | |||
| 1162 | Ga0068860_100000214 | |||
| 1163 | Ga0068860_100046841 | |||
| 1164 | Ga0068860_100143083 | |||
| 1165 | Ga0068862_100031007 | |||
| 1166 | Ga0068862_100168726 | |||
| 1167 | Ga0081455_10000856 | |||
| 1168 | Ga0081455_10001927 | |||
| 1169 | Ga0081455_10004130 | |||
| 1170 | Ga0081455_10012269 | |||
| 1171 | Ga0081455_10346067 | |||
| 1172 | Ga0081538_10001015 | |||
| 1173 | Ga0081538_10054137 | |||
| 1174 | Ga0081540_1013636 | |||
| 1175 | Ga0081540_1088482 | |||
| 1176 | Ga0081539_10000314 | |||
| 1177 | Ga0081539_10017187 | |||
| 1178 | Ga0070717_10133014 | |||
| 1179 | Ga0070717_10271583 | |||
| 1180 | Ga0075432_10009343 | |||
| 1181 | Ga0075432_10019149 | |||
| 1182 | Ga0075432_10115423 | |||
| 1183 | Ga0070716_100005395 | |||
| 1184 | Ga0070716_100110044 | |||
| 1185 | Ga0070712_100170895 | |||
| 1186 | Ga0070712_100369286 | |||
| 1187 | Ga0097621_100013167 | |||
| 1188 | Ga0097621_100163114 | |||
| 1189 | Ga0068871_100030952 | |||
| 1190 | Ga0068871_100131377 | |||
| 1191 | Ga0075428_100072107 | |||
| 1192 | Ga0075430_100040154 | |||
| 1193 | Ga0075430_100637422 | |||
| 1194 | Ga0075431_100005266 | |||
| 1195 | Ga0075431_100145167 | |||
| 1196 | Ga0075431_100230894 | |||
| 1197 | Ga0075431_100985455 | |||
| 1198 | Ga0075433_10006200 | |||
| 1199 | Ga0075433_10062775 | |||
| 1200 | Ga0075433_10217963 | |||
| 1201 | Ga0075434_100039963 | |||
| 1202 | Ga0075434_100447822 | |||
| 1203 | Ga0075429_100018670 | |||
| 1204 | Ga0075429_100477292 | |||
| 1205 | Ga0068865_100116516 | |||
| 1206 | Ga0075436_100033515 | |||
| 1207 | Ga0075436_100084376 | |||
| 1208 | Ga0097620_100002002 | |||
| 1209 | Ga0097620_100002765 | |||
| 1210 | Ga0097620_100024224 | |||
| 1211 | Ga0097620_100394412 | |||
| 1212 | Ga0075435_100001179 | |||
| 1213 | Ga0075435_100033992 | |||
| 1214 | Ga0099794_10094948 | |||
| 1215 | Ga0099795_10138581 | |||
| 1216 | Ga0105251_10029047 | |||
| 1217 | Ga0105251_10095888 | |||
| 1218 | Ga0105240_10006845 | |||
| 1219 | Ga0105240_10044174 | |||
| 1220 | Ga0105240_10059388 | |||
| 1221 | Ga0105240_10081917 | |||
| 1222 | Ga0105240_10098365 | |||
| 1223 | Ga0105240_10323450 | |||
| 1224 | Ga0111539_10001513 | |||
| 1225 | Ga0111539_10056914 | |||
| 1226 | Ga0111539_10073676 | |||
| 1227 | Ga0111539_10102794 | |||
| 1228 | Ga0105245_10005340 | |||
| 1229 | Ga0105245_10006149 | |||
| 1230 | Ga0105245_10319276 | |||
| 1231 | Ga0105245_10368289 | |||
| 1232 | Ga0105245_10908495 | |||
| 1233 | Ga0105247_10012824 | |||
| 1234 | Ga0105247_10073481 | |||
| 1235 | Ga0105247_10091776 | |||
| 1236 | Ga0105247_10144070 | |||
| 1237 | Ga0114129_10004688 | |||
| 1238 | Ga0114129_10068460 | |||
| 1239 | Ga0114129_10092703 | |||
| 1240 | Ga0105243_10099971 | |||
| 1241 | Ga0105243_10123218 | |||
| 1242 | Ga0105243_10362118 | |||
| 1243 | Ga0105243_10529299 | |||
| 1244 | Ga0105241_10026727 | |||
| 1245 | Ga0105241_10033989 | |||
| 1246 | Ga0105241_10064345 | |||
| 1247 | Ga0105241_10115248 | |||
| 1248 | Ga0105242_10433186 | |||
| 1249 | Ga0105237_10044946 | |||
| 1250 | Ga0105237_10076020 | |||
| 1251 | Ga0105237_10195463 | |||
| 1252 | Ga0105237_10289532 | |||
| 1253 | Ga0105237_10399907 | |||
| 1254 | Ga0105238_10067235 | |||
| 1255 | Ga0105238_10570210 | |||
| 1256 | Ga0105238_11114820 | |||
| 1257 | Ga0105238_11626699 | |||
| 1258 | Ga0105249_10026601 | |||
| 1259 | Ga0105249_10145213 | |||
| 1260 | Ga0105249_10191615 | |||
| 1261 | Ga0105249_10291789 | |||
| 1262 | Ga0105249_10413166 | |||
| 1263 | Ga0105030_102902 | |||
| 1264 | Ga0105028_100390 | |||
| 1265 | Ga0105028_141640 | |||
| 1266 | Ga0099796_10166112 | |||
| 1267 | Ga0099796_10362534 | |||
| 1268 | Ga0105239_10033309 | |||
| 1269 | Ga0105239_10063795 | |||
| 1270 | Ga0105239_10142088 | |||
| 1271 | Ga0105239_10236700 | |||
| 1272 | Ga0105239_10266904 | |||
| 1273 | Ga0105246_10000043 | |||
| 1274 | Ga0105246_10004064 | |||
| 1275 | Ga0105246_10363077 | |||
| 1276 | Ga0157373_10241974 | |||
| 1277 | Ga0157373_10301635 | |||
| 1278 | Ga0157371_10004316 | |||
| 1279 | Ga0157371_10023607 | |||
| 1280 | Ga0157370_10040635 | |||
| 1281 | Ga0157370_10072062 | |||
| 1282 | Ga0157370_10310090 | |||
| 1283 | Ga0157369_10104029 | |||
| 1284 | Ga0157369_10109050 | |||
| 1285 | Ga0157369_11154483 | |||
| 1286 | Ga0157374_10090469 | |||
| 1287 | Ga0157374_10359219 | |||
| 1288 | Ga0157378_10071247 | |||
| 1289 | Ga0157378_10994549 | |||
| 1290 | Ga0163162_10014741 | |||
| 1291 | Ga0163162_10311610 | |||
| 1292 | Ga0163162_11223651 | |||
| 1293 | Ga0163162_11349162 | |||
| 1294 | Ga0157372_10000044 | |||
| 1295 | Ga0157372_10202141 | |||
| 1296 | Ga0157372_10777466 | |||
| 1297 | Ga0157375_10028197 | |||
| 1298 | Ga0157375_10275358 | |||
| 1299 | Ga0163163_10033528 | |||
| 1300 | Ga0163163_10523207 | |||
| 1301 | Ga0163163_10756768 | |||
| 1302 | Ga0163163_10935708 | |||
| 1303 | Ga0157380_10092763 | |||
| 1304 | Ga0182008_10103200 | |||
| 1305 | Ga0157377_10003703 | |||
| 1306 | Ga0157377_10013082 | |||
| 1307 | Ga0157377_10214301 | |||
| 1308 | Ga0157379_10029889 | |||
| 1309 | Ga0157379_10244323 | |||
| 1310 | Ga0157376_10010771 | |||
| 1311 | Ga0157376_10304946 | |||
| 1312 | Ga0163161_10020614 | |||
| 1313 | Ga0163161_10506359 | |||
| 1314 | Ga0206356_10753640 | |||
| 1315 | Ga0206349_1470408 | |||
| 1316 | Ga0206355_1357797 | |||
| 1317 | Ga0206350_10968991 | |||
| 1318 | Ga0206354_10015922 | |||
| 1319 | Ga0206354_10607060 | |||
| 1320 | Ga0206354_11197133 | |||
| 1321 | Ga0206353_10374875 | |||
| 1322 | Ga0206353_10375344 | |||
| 1323 | Ga0206353_11751898 | |||
| 1324 | Ga0213872_10164806 | |||
| 1325 | Ga0213872_10169852 | |||
| 1326 | Ga0213876_10346643 | |||
| 1327 | Ga0224712_10003123 | |||
| 1328 | Ga0224712_10048813 | |||
| 1329 | Ga0224712_10361128 | |||
| 1330 | Ga0207713_1085318 | |||
| 1331 | Ga0207653_10029558 | |||
| 1332 | Ga0207692_10294763 | |||
| 1333 | Ga0207642_10165566 | |||
| 1334 | Ga0207642_10225428 | |||
| 1335 | Ga0207710_10109892 | |||
| 1336 | Ga0207688_10005818 | |||
| 1337 | Ga0207688_10217001 | |||
| 1338 | Ga0207680_10021603 | |||
| 1339 | Ga0207647_10005262 | |||
| 1340 | Ga0207647_10015085 | |||
| 1341 | Ga0207647_10124091 | |||
| 1342 | Ga0207647_10168969 | |||
| 1343 | Ga0207647_10186303 | |||
| 1344 | Ga0207647_10228151 | |||
| 1345 | Ga0207685_10004863 | |||
| 1346 | Ga0207699_10002396 | |||
| 1347 | Ga0207699_10691371 | |||
| 1348 | Ga0207645_10074778 | |||
| 1349 | Ga0207645_10152119 | |||
| 1350 | Ga0207643_10000255 | |||
| 1351 | Ga0207643_10176293 | |||
| 1352 | Ga0207643_10188212 | |||
| 1353 | Ga0207705_10017694 | |||
| 1354 | Ga0207705_10922438 | |||
| 1355 | Ga0207684_10264165 | |||
| 1356 | Ga0207654_10013466 | |||
| 1357 | Ga0207654_10766095 | |||
| 1358 | Ga0207707_10221366 | |||
| 1359 | Ga0207707_10460312 | |||
| 1360 | Ga0207695_10033289 | |||
| 1361 | Ga0207695_10041233 | |||
| 1362 | Ga0207695_10174565 | |||
| 1363 | Ga0207695_10196804 | |||
| 1364 | Ga0207695_10511307 | |||
| 1365 | Ga0207695_10519048 | |||
| 1366 | Ga0207671_10098280 | |||
| 1367 | Ga0207671_10131878 | |||
| 1368 | Ga0207671_10262904 | |||
| 1369 | Ga0207693_10000510 | |||
| 1370 | Ga0207693_10369168 | |||
| 1371 | Ga0207663_10162755 | |||
| 1372 | Ga0207660_10033041 | |||
| 1373 | Ga0207662_10010838 | |||
| 1374 | Ga0207662_10527207 | |||
| 1375 | Ga0207657_10003758 | |||
| 1376 | Ga0207657_10090962 | |||
| 1377 | Ga0207657_10533622 | |||
| 1378 | Ga0207649_10070873 | |||
| 1379 | Ga0207652_10017664 | |||
| 1380 | Ga0207652_10159459 | |||
| 1381 | Ga0207652_10844164 | |||
| 1382 | Ga0207646_10626235 | |||
| 1383 | Ga0207681_10361795 | |||
| 1384 | Ga0207694_10214648 | |||
| 1385 | Ga0207694_10425935 | |||
| 1386 | Ga0207694_10634291 | |||
| 1387 | Ga0207650_10075611 | |||
| 1388 | Ga0207659_10013890 | |||
| 1389 | Ga0207659_10049580 | |||
| 1390 | Ga0207687_10017746 | |||
| 1391 | Ga0207687_10042459 | |||
| 1392 | Ga0207687_10052780 | |||
| 1393 | Ga0207687_10081087 | |||
| 1394 | Ga0207687_10181917 | |||
| 1395 | Ga0207687_10385726 | |||
| 1396 | Ga0207700_10046571 | |||
| 1397 | Ga0207700_10215065 | |||
| 1398 | Ga0207700_10971895 | |||
| 1399 | Ga0207700_11417052 | |||
| 1400 | Ga0207664_10246224 | |||
| 1401 | Ga0207644_10227608 | |||
| 1402 | Ga0207690_10643543 | |||
| 1403 | Ga0207706_10003631 | |||
| 1404 | Ga0207706_10166454 | |||
| 1405 | Ga0207706_10167910 | |||
| 1406 | Ga0207686_10750436 | |||
| 1407 | Ga0207686_11199305 | |||
| 1408 | Ga0207709_10270334 | |||
| 1409 | Ga0207670_10058601 | |||
| 1410 | Ga0207669_10405452 | |||
| 1411 | Ga0207704_10374554 | |||
| 1412 | Ga0207665_10004900 | |||
| 1413 | Ga0207691_10023934 | |||
| 1414 | Ga0207691_10262974 | |||
| 1415 | Ga0207711_10325713 | |||
| 1416 | Ga0207689_10002623 | |||
| 1417 | Ga0207689_10006181 | |||
| 1418 | Ga0207661_10005765 | |||
| 1419 | Ga0207661_10009531 | |||
| 1420 | Ga0207661_10089286 | |||
| 1421 | Ga0207661_10182989 | |||
| 1422 | Ga0207679_10004056 | |||
| 1423 | Ga0207679_10010471 | |||
| 1424 | Ga0207679_10015188 | |||
| 1425 | Ga0207679_10180868 | |||
| 1426 | Ga0207667_10107338 | |||
| 1427 | Ga0207667_10318290 | |||
| 1428 | Ga0207651_11302496 | |||
| 1429 | Ga0207712_10055807 | |||
| 1430 | Ga0207712_10440426 | |||
| 1431 | Ga0207712_10534287 | |||
| 1432 | Ga0207712_10883621 | |||
| 1433 | Ga0207668_10025417 | |||
| 1434 | Ga0207668_10069537 | |||
| 1435 | Ga0207640_10366577 | |||
| 1436 | Ga0207640_10374123 | |||
| 1437 | Ga0207640_10564494 | |||
| 1438 | Ga0207658_10016590 | |||
| 1439 | Ga0207658_10043343 | |||
| 1440 | Ga0207677_10011844 | |||
| 1441 | Ga0207677_10030853 | |||
| 1442 | Ga0207677_10142971 | |||
| 1443 | Ga0207677_10175387 | |||
| 1444 | Ga0207677_10527144 | |||
| 1445 | Ga0207703_10013801 | |||
| 1446 | Ga0207703_10041423 | |||
| 1447 | Ga0207703_10179145 | |||
| 1448 | Ga0207639_10487861 | |||
| 1449 | Ga0207678_10000077 | |||
| 1450 | Ga0207678_10000346 | |||
| 1451 | Ga0207678_10001130 | |||
| 1452 | Ga0207678_10067839 | |||
| 1453 | Ga0207678_10184182 | |||
| 1454 | Ga0207678_10208382 | |||
| 1455 | Ga0207708_10000110 | |||
| 1456 | Ga0207708_10015918 | |||
| 1457 | Ga0207708_10052736 | |||
| 1458 | Ga0207708_10060832 | |||
| 1459 | Ga0207702_10000631 | |||
| 1460 | Ga0207702_10009206 | |||
| 1461 | Ga0207702_10067537 | |||
| 1462 | Ga0207702_10200106 | |||
| 1463 | Ga0207702_10212286 | |||
| 1464 | Ga0207641_10000499 | |||
| 1465 | Ga0207641_10002176 | |||
| 1466 | Ga0207641_10656590 | |||
| 1467 | Ga0207641_11054361 | |||
| 1468 | Ga0207676_10016110 | |||
| 1469 | Ga0207674_10020922 | |||
| 1470 | Ga0207674_10395918 | |||
| 1471 | Ga0207675_100039773 | |||
| 1472 | Ga0207675_100335288 | |||
| 1473 | Ga0207683_10000342 | |||
| 1474 | Ga0207683_10000915 | |||
| 1475 | Ga0207683_10316100 | |||
| 1476 | Ga0207698_10014073 | |||
| 1477 | Ga0207698_10057689 | |||
| 1478 | Ga0207698_10202223 | |||
| 1479 | Ga0209588_1160905 | |||
| 1480 | Ga0207428_10003594 | |||
| 1481 | Ga0207428_10008491 | |||
| 1482 | Ga0268266_10010410 | |||
| 1483 | Ga0268266_10030224 | |||
| 1484 | Ga0268266_10072788 | |||
| 1485 | Ga0268266_10577085 | |||
| 1486 | Ga0268265_10008211 | |||
| 1487 | Ga0268265_10240267 | |||
| 1488 | Ga0268265_10489557 | |||
| 1489 | Ga0268264_10000027 | |||
| 1490 | Ga0268264_10255781 | |||
| 1491 | Ga0307515_10017393 | |||
| 1492 | Ga0307515_10854143 | |||
| 1493 | Ga0265760_10018948 | |||
| 1494 | Ga0265340_10057467 | |||
| 1495 | Ga0307508_10489127 | |||
| 1496 | Ga0307514_10356424 | |||
| 1497 | Ga0316576_10001887 | |||
| 1498 | Ga0316576_10024896 | |||
| 1499 | Ga0316578_10089013 | |||
| 1500 | Ga0307405_10268778 | |||
| 1501 | Ga0307405_10436909 | |||
| 1502 | Ga0316577_10000803 | |||
| 1503 | Ga0307413_10270623 | |||
| 1504 | Ga0307518_10020035 | |||
| 1505 | Ga0307406_10024433 | |||
| 1506 | Ga0307406_10181412 | |||
| 1507 | Ga0307406_10246160 | |||
| 1508 | Ga0307409_100068776 | |||
| 1509 | Ga0307409_100964642 | |||
| 1510 | Ga0307416_100120946 | |||
| 1511 | Ga0307415_100018917 | |||
| 1512 | Ga0307415_100020868 | |||
| 1513 | Ga0307415_100040696 | |||
| 1514 | Ga0307415_100062408 | |||
| 1515 | Ga0307415_100170276 | |||
| 1516 | Ga0307415_100350405 | |||
| 1517 | Ga0307415_100780178 | |||
| 1518 | Ga0307507_10096532 | |||
| 1519 | Ga0307507_10336648 | |||
| 1520 | Ga0307510_10038091 | |||
| 1521 | Ga0373948_0022349 | |||
| 1522 | Ga0373958_0071624 | |||
| 1523 | Ga0373938_0030561 | |||
| 1524 | Ga0373928_0091798 | |||
| 1525 | Ga0373929_0074956 | |||
| 1526 | Ga0373952_0001893 | |||
| 1527 | Ga0373923_0348545 | |||
| 1528 | Ga0373932_0020236 | |||
| 1529 | Ga0373941_0079330 | |||
| 1530 | Ga0373956_0415589 | |||
| 1531 | Ga0373960_0004107 | |||
| 1532 | Ga0373943_0330764 | |||
| 1533 | Ga0373946_0616314 | |||
| 1534 | Ga0373961_0003240 | |||
| 1535 | Ga0373931_0031228 | |||
| 1536 | Ga0373931_0198656 | |||
| 1537 | Ga0373931_0225001 | |||
| 1538 | Ga0373935_0130632 | |||
| 1539 | Ga0373927_0114568 | |||
| 1540 | Ga0373927_0247829 | |||
| 1541 | Ga0373947_0350216 | |||
| 1542 | Ga0316582_0773783 | |||
| 1543 | Ga0316584_0093298 | |||
| 1544 | Ga0373925_0116117 | |||
| 1545 | Ga0436364_1373090 | |||
| 1546 | Ga0395901_0229166 | |||
| 1547 | Ga0395901_0264741 | |||
| 1548 | Ga0436365_0493326 | |||
| 1549 | Ga0436361_0217474 | |||
| 1550 | Ga0436361_0741574 | |||
| 1551 | Ga0436362_0031375 | |||
| 1552 | Ga0439448_0108720 | |||
| 1553 | Ga0439455_0065376 | |||
| 1554 | Ga0439456_082315 | |||
| 1555 | Ga0439458_0025483 | |||
| 1556 | Ga0439459_0011222 | |||
| 1557 | Ga0450918_069859 | |||
| 1558 | Ga0466969_0042350 | |||
| 1559 | Ga0466969_0264183 | |||
| 1560 | Ga0466972_0004679 | |||
| 1561 | Ga0466972_0006007 | |||
| 1562 | Ga0466972_0049397 | |||
| 1563 | Ga0466972_0113273 | |||
| 1564 | Ga0466972_0186865 | |||
| 1565 | Ga0466972_0475496 | |||
| 1566 | Ga0466965_0006947 | |||
| 1567 | Ga0466965_0280132 | |||
| 1568 | Ga0466965_0491415 | |||
| 1569 | Ga0466966_0009485 | |||
| 1570 | Ga0466966_0011224 | |||
| 1571 | Ga0466966_0016840 | |||
| 1572 | Ga0466966_0017484 | |||
| 1573 | Ga0466966_0273011 | |||
| 1574 | Ga0466961_0000954 | |||
| 1575 | Ga0466961_0044630 | |||
| 1576 | Ga0466961_0051245 | |||
| 1577 | Ga0466961_0104881 | |||
| 1578 | Ga0466961_0178425 | |||
| 1579 | Ga0466963_0001440 | |||
| 1580 | Ga0466963_0002729 | |||
| 1581 | Ga0466963_0008730 | |||
| 1582 | Ga0466963_0010439 | |||
| 1583 | Ga0466963_0016395 | |||
| 1584 | Ga0466963_0077779 | |||
| 1585 | Ga0466963_0078499 | |||
| 1586 | Ga0466963_0081702 | |||
| 1587 | Ga0466963_0132441 | |||
| 1588 | Ga0466963_0139397 | |||
| 1589 | Ga0466963_0243892 | |||
| 1590 | Ga0466963_0253748 | |||
| 1591 | Ga0466963_0484253 | |||
| 1592 | Ga0466963_0871959 | |||
| 1593 | Ga0466964_0011541 | |||
| 1594 | Ga0466964_0012829 | |||
| 1595 | Ga0466971_0005559 | |||
| 1596 | Ga0466971_0278915 | |||
| 1597 | Ga0466968_0071634 | |||
| 1598 | Ga0466968_0131487 | |||
| 1599 | Ga0466970_0004565 | |||
| 1600 | Ga0466970_0036177 | |||
| 1601 | Ga0466970_0039469 | |||
| 1602 | Ga0466970_0183055 | |||
| 1603 | Ga0466970_0281973 | |||
| 1604 | Ga0466970_0313365 | |||
| 1605 | Ga0466957_0007208 | |||
| 1606 | Ga0466957_0022908 | |||
| 1607 | Ga0466957_0101726 | |||
| 1608 | Ga0466957_0148514 | |||
| 1609 | Ga0466957_0232039 | |||
| 1610 | Ga0466957_0505674 | |||
| 1611 | Ga0466960_0122647 | |||
| 1612 | Ga0466960_0217337 | |||
| 1613 | Ga0466960_0963174 | |||
| 1614 | Ga0466959_0012703 | |||
| 1615 | Ga0466959_0082302 | |||
| 1616 | Ga0466959_0213729 | |||
| 1617 | Ga0466959_0620743 | |||
| 1618 | Ga0466958_0002544 | |||
| 1619 | Ga0466958_0013570 | |||
| 1620 | Ga0466958_0024044 | |||
| 1621 | Ga0466958_0134981 | |||
| 1622 | Ga0466958_0152079 | |||
| 1623 | Ga0466958_0186100 | |||
| 1624 | Ga0466958_0220602 | |||
| 1625 | Ga0466958_0264100 | |||
| 1626 | Ga0466958_0547006 | |||
| 1627 | Ga0466958_0606639 | |||
| 1628 | Ga0466967_0000447 | |||
| 1629 | Ga0466967_0004131 | |||
| 1630 | Ga0466967_0017852 | |||
| 1631 | Ga0466967_0021196 | |||
| 1632 | Ga0466967_0057388 | |||
| 1633 | Ga0466967_0062570 | |||
| 1634 | Ga0466967_0062792 | |||
| 1635 | Ga0466967_0088316 | |||
| 1636 | Ga0466967_0107011 | |||
| 1637 | Ga0466967_0240946 | |||
| 1638 | Ga0466967_0280526 | |||
| 1639 | Ga0466967_0298133 | |||
| 1640 | Ga0466967_0535459 | |||
| 1641 | Ga0466967_0852657 | |||
| 1642 | Ga0466967_1326312 | |||
| 1643 | Ga0466967_1616946 | |||
| 1644 | Ga0495627_015412 | |||
| 1645 | Ga0495603_0475421 | |||
| 1646 | Ga0495590_0110055 | |||
| 1647 | Ga0495653_0219525 | |||
| 1648 | Ga0495650_0103083 | |||
| 1649 | Ga0495580_0508178 | |||
| 1650 | Ga0495580_0553546 | |||
| 1651 | Ga0495582_0408347 | |||
| 1652 | Ga0495628_0101829 | |||
| 1653 | Ga0495666_0294438 | |||
| 1654 | Ga0495652_0202368 | |||
| 1655 | Ga0495667_0399878 | |||
| 1656 | Ga0495658_0505962 | |||
| 1657 | Ga0495624_0813535 | |||
| 1658 | Ga0495649_0355334 | |||
| 1659 | Ga0495604_0074366 | |||
| 1660 | Ga0495674_0119035 | |||
| 1661 | Ga0495674_0217665 | |||
| 1662 | Ga0495672_0070237 | |||
| 1663 | Ga0495602_0086361 | |||
| 1664 | Ga0496100_0024189 | |||
| 1665 | Ga0496100_0142337 | |||
| 1666 | Ga0496101_0011520 | |||
| 1667 | Ga0496101_0074768 | |||
| 1668 | Ga0496101_0231926 | |||
| 1669 | Ga0496102_0000044 | |||
| 1670 | Ga0496102_0000713 | |||
| 1671 | Ga0496102_0281685 | |||
| 1672 | Ga0496102_0426459 | |||
| 1673 | Ga0496102_0702524 | |||
| 1674 | Ga0496103_0000117 | |||
| 1675 | Ga0496103_0005769 | |||
| 1676 | Ga0496103_0084089 | |||
| 1677 | Ga0496104_0025282 | |||
| 1678 | Ga0496104_0080614 | |||
| 1679 | Ga0496104_0123936 | |||
| 1680 | Ga0496104_1700501 | |||
| 1681 | Ga0496105_0010565 | |||
| 1682 | Ga0496105_0018736 | |||
| 1683 | Ga0496105_0185845 | |||
| 1684 | Ga0496105_0510379 | |||
| 1685 | Ga0496106_0027596 | |||
| 1686 | Ga0496106_0130108 | |||
| 1687 | Ga0496107_0011721 | |||
| 1688 | Ga0496107_0152489 | |||
| 1689 | Ga0496108_0019388 | |||
| 1690 | Ga0496108_0162064 | |||
| 1691 | Ga0496108_0641541 | |||
| 1692 | Ga0496108_1081442 | |||
| 1693 | Ga0496109_0003861 | |||
| 1694 | Ga0496109_0010941 | |||
| 1695 | Ga0496109_0047173 | |||
| 1696 | Ga0496110_0002011 | |||
| 1697 | Ga0496110_0004089 | |||
| 1698 | Ga0496110_0077935 | |||
| 1699 | Ga0496110_0293693 | |||
| 1700 | Ga0496111_0020045 | |||
| 1701 | Ga0496111_0054239 | |||
| 1702 | Ga0496112_0058246 | |||
| 1703 | Ga0496112_0149996 | |||
| 1704 | Ga0496112_0330726 | |||
| 1705 | Ga0496112_1141158 | |||
| 1706 | Ga0496113_0010420 | |||
| 1707 | Ga0496113_0012659 | |||
| 1708 | Ga0496113_0081850 | |||
| 1709 | Ga0496113_0107909 | |||
| 1710 | Ga0496114_0008858 | |||
| 1711 | Ga0496114_0474997 | |||
| 1712 | Ga0496115_0372303 | |||
| 1713 | Ga0496118_0102261 | |||
| 1714 | Ga0496118_0104372 | |||
| 1715 | Ga0496119_0003451 | |||
| 1716 | Ga0496120_0001931 | |||
| 1717 | Ga0496121_0018975 | |||
| 1718 | Ga0496126_0000006 | |||
| 1719 | Ga0501031_0001780 | |||
| 1720 | Ga0501031_0019140 | |||
| 1721 | Ga0501031_0108334 | |||
| 1722 | Ga0501031_0350300 | |||
| 1723 | Ga0501031_0896218 | |||
| 1724 | Ga0501033_0021805 | |||
| 1725 | Ga0501033_0131256 | |||
| 1726 | Ga0501033_0274610 | |||
| 1727 | Ga0501034_0432938 | |||
| 1728 | Ga0501036_0002879 | |||
| 1729 | Ga0501036_0013567 | |||
| 1730 | Ga0501036_0048035 | |||
| 1731 | Ga0501036_0135911 | |||
| 1732 | Ga0501036_0584673 | |||
| 1733 | Ga0501036_0912335 | |||
| 1734 | Ga0501037_0018318 | |||
| 1735 | Ga0501037_0038293 | |||
| 1736 | Ga0501037_0065975 | |||
| 1737 | Ga0501037_0099271 | |||
| 1738 | Ga0501037_0163507 | |||
| 1739 | Ga0501037_0255756 | |||
| 1740 | Ga0501038_0000729 | |||
| 1741 | Ga0501038_0022743 | |||
| 1742 | Ga0501038_0041430 | |||
| 1743 | Ga0501038_0056599 | |||
| 1744 | Ga0501038_0132916 | |||
| 1745 | Ga0501038_0144887 | |||
| 1746 | Ga0501039_0002714 | |||
| 1747 | Ga0501039_0010078 | |||
| 1748 | Ga0501039_0015236 | |||
| 1749 | Ga0501039_0021997 | |||
| 1750 | Ga0501039_0041159 | |||
| 1751 | Ga0501039_0136815 | |||
| 1752 | Ga0501040_0001767 | |||
| 1753 | Ga0501040_0001830 | |||
| 1754 | Ga0501040_0019976 | |||
| 1755 | Ga0501040_0029496 | |||
| 1756 | Ga0501040_0029505 | |||
| 1757 | Ga0501040_0032633 | |||
| 1758 | Ga0501040_0033356 | |||
| 1759 | Ga0501040_0046709 | |||
| 1760 | Ga0501040_0149112 | |||
| 1761 | Ga0501041_0001005 | |||
| 1762 | Ga0501041_0002936 | |||
| 1763 | Ga0501041_0035113 | |||
| 1764 | Ga0501041_0200026 | |||
| 1765 | Ga0501042_0000239 | |||
| 1766 | Ga0501042_0007078 | |||
| 1767 | Ga0501042_0013811 | |||
| 1768 | Ga0501042_0018185 | |||
| 1769 | Ga0501042_0241839 | |||
| 1770 | Ga0501042_0275153 | |||
| 1771 | Ga0501042_0406110 | |||
| 1772 | Ga0501042_1250739 | |||
| 1773 | Ga0501043_0048957 | |||
| 1774 | Ga0501043_0217951 | |||
| 1775 | Ga0501043_0230136 | |||
| 1776 | Ga0501043_0313798 | |||
| 1777 | Ga0501046_0012074 | |||
| 1778 | Ga0501046_0021049 | |||
| 1779 | Ga0501046_0024589 | |||
| 1780 | Ga0501046_0102211 | |||
| 1781 | Ga0501046_0165197 | |||
| 1782 | Ga0501047_0020554 | |||
| 1783 | Ga0501047_0098841 | |||
| 1784 | Ga0501048_0000611 | |||
| 1785 | Ga0501048_0004412 | |||
| 1786 | Ga0501048_0007580 | |||
| 1787 | Ga0501048_0011520 | |||
| 1788 | Ga0501048_0038277 | |||
| 1789 | Ga0501048_0043343 | |||
| 1790 | Ga0501048_0115097 | |||
| 1791 | Ga0501048_0574936 | |||
| 1792 | Ga0501068_0009321 | |||
| 1793 | Ga0501068_0028606 | |||
| 1794 | Ga0501068_0047233 | |||
| 1795 | Ga0501068_0663049 | |||
| 1796 | Ga0501069_0038793 | |||
| 1797 | Ga0501069_0128904 | |||
| 1798 | Ga0501069_0885616 | |||
| 1799 | Ga0501070_0015871 | |||
| 1800 | Ga0501070_0194594 | |||
| 1801 | Ga0501070_0269047 | |||
| 1802 | Ga0501070_0384448 | |||
| 1803 | Ga0501070_0635856 | |||
| 1804 | Ga0501071_0000062 | |||
| 1805 | Ga0501071_0002438 | |||
| 1806 | Ga0501071_0003996 | |||
| 1807 | Ga0501071_0005805 | |||
| 1808 | Ga0501071_0024149 | |||
| 1809 | Ga0501071_0032103 | |||
| 1810 | Ga0501071_0041766 | |||
| 1811 | Ga0501071_0079211 | |||
| 1812 | Ga0501071_0124614 | |||
| 1813 | Ga0501071_0246653 | |||
| 1814 | Ga0501071_1133761 | |||
| 1815 | Ga0501072_0004395 | |||
| 1816 | Ga0501072_0004712 | |||
| 1817 | Ga0501072_0008700 | |||
| 1818 | Ga0501072_0045315 | |||
| 1819 | Ga0501072_0047440 | |||
| 1820 | Ga0501072_0055284 | |||
| 1821 | Ga0501072_0107951 | |||
| 1822 | Ga0501072_0113778 | |||
| 1823 | Ga0501072_0130484 | |||
| 1824 | Ga0501072_0597220 | |||
| 1825 | Ga0501072_0613307 | |||
| 1826 | Ga0501073_0034926 | |||
| 1827 | Ga0501073_0035165 | |||
| 1828 | Ga0501074_0005674 | |||
| 1829 | Ga0501074_0009203 | |||
| 1830 | Ga0501074_0014380 | |||
| 1831 | Ga0501074_0119681 | |||
| 1832 | Ga0501074_0541351 | |||
| 1833 | Ga0501074_0640849 | |||
| 1834 | Ga0501075_0006070 | |||
| 1835 | Ga0501075_0010862 | |||
| 1836 | Ga0501075_0018077 | |||
| 1837 | Ga0501075_0027631 | |||
| 1838 | Ga0501075_0033187 | |||
| 1839 | Ga0501075_0040651 | |||
| 1840 | Ga0501075_0094631 | |||
| 1841 | Ga0501075_0144339 | |||
| 1842 | Ga0501075_0172381 | |||
| 1843 | Ga0501075_0816599 | |||
| 1844 | Ga0501076_0005061 | |||
| 1845 | Ga0501076_0108961 | |||
| 1846 | Ga0501076_0166942 | |||
| 1847 | Ga0501076_0187035 | |||
| 1848 | Ga0501076_0298349 | |||
| 1849 | Ga0501076_0492262 | |||
| 1850 | Ga0501076_0656990 | |||
| 1851 | Ga0501076_1154154 | |||
| 1852 | Ga0501077_0005645 | |||
| 1853 | Ga0501077_0009054 | |||
| 1854 | Ga0501077_0009503 | |||
| 1855 | Ga0501077_0010462 | |||
| 1856 | Ga0501077_0096521 | |||
| 1857 | Ga0501077_0349401 | |||
| 1858 | Ga0501079_0000728 | |||
| 1859 | Ga0501079_0003279 | |||
| 1860 | Ga0501079_0004086 | |||
| 1861 | Ga0501079_0007964 | |||
| 1862 | Ga0501079_0019126 | |||
| 1863 | Ga0501079_0024713 | |||
| 1864 | Ga0501079_0035311 | |||
| 1865 | Ga0501079_0060478 | |||
| 1866 | Ga0501079_0073873 | |||
| 1867 | Ga0501079_0074235 | |||
| 1868 | Ga0501079_0188289 | |||
| 1869 | Ga0501080_0011960 | |||
| 1870 | Ga0501080_0129272 | |||
| 1871 | Ga0501080_0220006 | |||
| 1872 | Ga0501080_0237566 | |||
| 1873 | Ga0501081_0001987 | |||
| 1874 | Ga0501081_0005223 | |||
| 1875 | Ga0501081_0006609 | |||
| 1876 | Ga0501081_0016737 | |||
| 1877 | Ga0501081_0026970 | |||
| 1878 | Ga0501081_0038578 | |||
| 1879 | Ga0501081_0050599 | |||
| 1880 | Ga0501081_0194310 | |||
| 1881 | Ga0501081_0198726 | |||
| 1882 | Ga0501081_0282035 | |||
| 1883 | Ga0501083_0009211 | |||
| 1884 | Ga0501083_0079816 | |||
| 1885 | Ga0501083_0090566 | |||
| 1886 | Ga0501083_0985693 | |||
| 1887 | Ga0501035_0005557 | |||
| 1888 | Ga0501035_0016934 | |||
| 1889 | Ga0501035_0024078 | |||
| 1890 | Ga0501035_0041768 | |||
| 1891 | Ga0501035_0825018 | |||
| 1892 | Ga0501044_0108974 | |||
| 1893 | Ga0501044_0127085 | |||
| 1894 | Ga0501044_0260157 | |||
| 1895 | Ga0501044_0465067 | |||
| 1896 | Ga0501044_1299258 | |||
| 1897 | Ga0501045_0003979 | |||
| 1898 | Ga0501045_0005995 | |||
| 1899 | Ga0501045_0013828 | |||
| 1900 | Ga0501045_0032635 | |||
| 1901 | Ga0501045_0058330 | |||
| 1902 | Ga0501045_0134135 | |||
| 1903 | Ga0501045_0199680 | |||
| 1904 | Ga0501045_0240852 | |||
| 1905 | nmdc:mga05p37_1192_c1 | |||
| 1906 | nmdc:mga05p37_190998_c1 | |||
| 1907 | nmdc:mga05p37_972350_c1 | |||
| 1908 | nmdc:mga09592_241_c1 | |||
| 1909 | nmdc:mga0qj67_36841_c1 | |||
| 1910 | nmdc:mga0qj67_550017_c1 | |||
| 1911 | nmdc:mga06r32_283_c1 | |||
| 1912 | nmdc:mga06r32_374372_c1 | |||
| 1913 | nmdc:mga06r32_8334_c1 | |||
| 1914 | nmdc:mga08y16_1006549_c1 | |||
| 1915 | nmdc:mga08y16_24412_c1 | |||
| 1916 | nmdc:mga08y16_8609_c1 | |||
| 1917 | nmdc:mga0n895_8279_c1 | |||
| 1918 | nmdc:mga0rr50_9865_c1 | |||
| 1919 | nmdc:mga08x19_113668_c1 | |||
| 1920 | nmdc:mga08x19_144963_c1 | |||
| 1921 | nmdc:mga08x19_163173_c1 | |||
| 1922 | nmdc:mga0a205_306391_c1 | |||
| 1923 | nmdc:mga0a205_359882_c1 | |||
| 1924 | nmdc:mga0a205_41748_c1 | |||
| 1925 | Ga0495601_0003900 | |||
| 1926 | Ga0495612_0223809 | |||
| 1927 | Ga0495612_0283338 | |||
| 1928 | Ga0495655_0007418 | |||
| 1929 | Ga0495595_0074698 | |||
| 1930 | Ga0495595_0126167 | |||
| 1931 | Ga0495619_0996627 | |||
| 1932 | Ga0500654_106318 | |||
| 1933 | Ga0500568_0153315 | |||
| 1934 | Ga0500616_0020355 | |||
| 1935 | Ga0501084_0003344 | |||
| 1936 | Ga0501084_0038176 | |||
| 1937 | Ga0501084_0053873 | |||
| 1938 | Ga0501084_0090844 | |||
| 1939 | Ga0501084_0302702 | |||
| 1940 | Ga0501084_1067131 | |||
| 1941 | Ga0501082_0002626 | |||
| 1942 | Ga0501082_0011337 | |||
| 1943 | Ga0501082_0011615 | |||
| 1944 | Ga0501082_0021836 | |||
| 1945 | Ga0501082_0047265 | |||
| 1946 | Ga0501082_0211167 | |||
| 1947 | Ga0501082_1570900 | |||
| 1948 | Ga0466962_0023113 | |||
| 1949 | Ga0466962_0032618 | |||
| 1950 | Ga0466962_0050764 | |||
| 1951 | Ga0466962_0056766 | |||
| 1952 | Ga0466962_0102272 | |||
| 1953 | Ga0466962_0140585 | |||
| 1954 | Ga0466962_0239257 | |||
| 1955 | Ga0466962_0384450 | |||
| 1956 | Ga0530510_0006632 | |||
| 1957 | Ga0530510_0016464 | |||
| 1958 | Ga0530510_0018663 | |||
| 1959 | Ga0530510_0020682 | |||
| 1960 | Ga0530510_0029979 | |||
| 1961 | Ga0530510_0065335 | |||
| 1962 | Ga0530510_0075777 | |||
| 1963 | 2586059137 | |||
| 1964 | 2676488925 | |||
| 1965 | 2809592106 | |||
| 1966 | 2816504704 | |||
| 1967 | 2870784845 | |||
| 1968 | 2884702499 | |||
| 1969 | 2895429279 | |||
| 1970 | 2895451998 | |||
| 1971 | 2899364055 | |||
| 1972 | 2899373231 | |||
| 1973 | 2904770131 | |||
| 1974 | 2904771020 | |||
| 1975 | 2908815064 | |||
| 1976 | 2915776204 | |||
| 1977 | 2917743339 | |||
| 1978 | 2919424453 | |||
| 1979 | 2919436846 | |||
| 1980 | 8003322679 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o0a-assembly1.cif.gz_B | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) | 0.9864 | 1 | 155 |
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9826 | 1 | 155 |
| 5o08-assembly1.cif.gz_A | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with dephospho-coenzyme a | 0.9818 | 1 | 156 |
| 5h7x-assembly1.cif.gz_E | crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with 2-hydroxy-1,2,3-propane tricarboxylate at 1.76 a resolution | 0.9765 | 2 | 154 |
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9764 | 2 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9747 | 1 | 154 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9665 | 1 | 154 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9633 | 1 | 155 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9513 | 1 | 155 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9511 | 2 | 155 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7L5ZF09-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9937 | 3 | 155 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-Q6A7Q4-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9925 | 3 | 154 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A6L6ESX5-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9923 | 2 | 155 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A0G3V2A6-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9922 | 2 | 155 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-T5JS59-F1-model_v4 | deleted | 0.991 | 1 | 156 |
|