F487530

General Info

Members Datasets Scaffolds Average Seq Length
986 573 796 280

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0031784|Ga0495603_0031784_378_1382
Length 334
Sequence MIFCAKKCAISGLFTFALRGEGASIAQSIAVLRFFMIAIRGVTVGAAHSRIVVMNSFTIRTMRPDEISLAVDWAAAEGWNPGLADDACFASVDPEGFFIAELDGKPVATVSCVNYDARFAFLGFYMVRADLRGKGFGLRIWDAAIAHAGARVIGLDGVVAQQENYKKSGFQLAYANVRYGGTVVAAPAAPRTDIMALSDIPFAAVEADDATVFPAPRSAFLRAWIGARGHIGCALMRDGRLAGWGVIRPCRKGFKIGPLVADDRASAEVVLSALLARVGGGEIFLDVPGINREAIALAQDFGLAPVFETARMYTGAIPPLRMQRVFGVTSFELG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
29 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
30 2791355199
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
34 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
35 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
38 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
39 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
40 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
41 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
42 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
43 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
50 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
51 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
52 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
59 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
60 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
61 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
62 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
63 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
64 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
65 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
66 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
67 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
68 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
69 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
70 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
71 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
72 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
73 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
74 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
75 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
76 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
77 2904699407
78 2906610324
79 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
80 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
81 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
82 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
83 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
84 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
85 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
86 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
87 2922368715
88 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
89 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
90 2922425934
91 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
92 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
93 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
94 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
95 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
96 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
97 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
98 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
99 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
100 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
103 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
104 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
105 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
106 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
107 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
108 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
109 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
110 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
111 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
112 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
113 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
114 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
115 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
116 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
117 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
118 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
119 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
120 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
121 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
122 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
123 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
124 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
125 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
126 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
127 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
128 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
129 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
130 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
131 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
132 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
133 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
134 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
135 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
136 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
137 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
138 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
139 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
140 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
141 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
142 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
143 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
144 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
145 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
146 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
147 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
148 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
149 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
150 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
151 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
152 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
153 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
154 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
155 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
156 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
157 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
158 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
159 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
160 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
161 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
162 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
163 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
164 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
165 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
166 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
167 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
168 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
169 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
170 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
171 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
172 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
173 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
174 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
175 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
176 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
177 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
178 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
182 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
183 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
184 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
185 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
186 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
187 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
188 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
189 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
190 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
191 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
192 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
193 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
194 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
195 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
196 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
197 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
198 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
199 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
200 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
201 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
202 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
203 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
204 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
205 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
206 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
207 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
208 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
209 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
210 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
211 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
212 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
213 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
214 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
215 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
216 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
217 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
218 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
219 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
220 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
221 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
222 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
223 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
224 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
225 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
226 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
227 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
228 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
229 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
230 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
231 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
232 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
233 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
234 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
235 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
236 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
237 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
238 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
239 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
240 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
241 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
242 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
243 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
244 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
245 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
246 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
247 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
248 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
249 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
250 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
251 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
252 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
253 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
254 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
255 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
256 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
257 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
258 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
259 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
260 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
261 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
262 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
263 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
264 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
265 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
266 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
267 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
268 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
269 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
270 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
271 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
272 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
273 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
274 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
275 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
276 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
277 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
278 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
279 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
282 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
347 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
348 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
349 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
350 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
352 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
353 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
357 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
358 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
359 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
360 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
361 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
362 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
363 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
364 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
365 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
366 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
367 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
368 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
369 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
370 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
371 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
372 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
373 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
374 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
375 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
376 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
377 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
378 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
379 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
380 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
381 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
382 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
383 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
384 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
385 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
386 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
387 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
388 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
389 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
390 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
391 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
392 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
393 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
394 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
395 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
396 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
397 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
398 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
399 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
400 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
401 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
402 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
403 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
404 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
405 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
406 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
407 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
408 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
409 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
410 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
411 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
412 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
413 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
414 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
415 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
416 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
417 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
418 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
419 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
420 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
421 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
422 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
423 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
424 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
425 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
426 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
429 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
430 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
431 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
432 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
433 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
434 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
435 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
436 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
437 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
438 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
439 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
440 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
441 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
442 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
443 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
444 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
445 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
446 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
447 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
448 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
449 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
450 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
451 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
452 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
453 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
454 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
455 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
456 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
457 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
460 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
461 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
462 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
463 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
464 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
465 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
466 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
467 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
468 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
469 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
470 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
471 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
472 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
473 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
474 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
475 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
476 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
477 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
478 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
479 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
480 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
483 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
484 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
485 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
486 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
487 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
488 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
489 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
490 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
491 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
492 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
493 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
494 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
495 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
496 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
497 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
498 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
501 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
502 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
503 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
504 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
505 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
506 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
507 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
508 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
509 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
510 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
511 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
512 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
513 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
514 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
515 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
516 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
517 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
518 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
519 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
520 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
521 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
522 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
523 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
524 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
525 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
526 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
527 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
528 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
529 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
530 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
531 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
532 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
533 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
534 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
535 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
536 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
537 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
538 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
539 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
540 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
541 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
542 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
543 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
544 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
545 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
546 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
547 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
548 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
549 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
550 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
551 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
552 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
553 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
554 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
555 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
556 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
557 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
558 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
559 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
560 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
561 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
562 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
563 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
564 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
565 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
566 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
567 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
568 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
569 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
570 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
571 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
572 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
573 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.14
Metatranscriptomes 0
Isolates 18.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 16.53
Rhizoplane 6.49
Rhizosphere 60.04
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001348 3300003215 Bacteria 14698
2 JGI25153J46596_10005113 3300003215 Bacteria 6921
3 rootH2_10194050 3300003320 Bacteria 1150
4 rootH1_10218802 3300003323 Bacteria 1221
5 JGI25404J52841_10002324 3300003659 Bacteria 3580
6 JGI25404J52841_10011848 3300003659 Bacteria 1884
7 Ga0055542_1007676 3300003762 Bacteria 2168
8 Ga0055531_10017327 3300003794 Bacteria 3049
9 JGI25405J52794_10022700 3300003911 Bacteria 1274
10 Ga0055543_1015382 3300004625 Bacteria 1474
11 Ga0070658_10035994 3300005327 Bacteria 3989
12 Ga0070658_10092501 3300005327 Bacteria 2493
13 Ga0070658_10282547 3300005327 Bacteria 1413
14 Ga0070676_10026600 3300005328 Bacteria 3276
15 Ga0070683_100247212 3300005329 Bacteria 1696
16 Ga0070690_100028466 3300005330 Bacteria 3461
17 Ga0070670_100240832 3300005331 Bacteria 1575
18 Ga0068869_100011695 3300005334 Bacteria 5767
19 Ga0070666_10058884 3300005335 Bacteria 2598
20 Ga0068868_100025028 3300005338 Bacteria 4534
21 Ga0068868_100077386 3300005338 Bacteria 2661
22 Ga0068868_100080433 3300005338 Bacteria 2612
23 Ga0070689_100360228 3300005340 Bacteria 1222
24 Ga0070661_100018105 3300005344 Bacteria 5005
25 Ga0070668_100034971 3300005347 Bacteria 3829
26 Ga0070668_100041085 3300005347 Bacteria 3543
27 Ga0070668_100050372 3300005347 Bacteria 3206
28 Ga0070668_100093700 3300005347 Bacteria 2370
29 Ga0070668_100123454 3300005347 Bacteria 2072
30 Ga0070668_100472798 3300005347 Bacteria 1081
31 Ga0070668_100512617 3300005347 Bacteria 1040
32 Ga0070669_100096764 3300005353 Bacteria 2221
33 Ga0070669_100270370 3300005353 Bacteria 1359
34 Ga0070675_100015290 3300005354 Bacteria 6064
35 Ga0070675_100139137 3300005354 Bacteria 2074
36 Ga0070675_100144007 3300005354 Bacteria 2039
37 Ga0070675_100172639 3300005354 Bacteria 1865
38 Ga0070675_100260914 3300005354 Bacteria 1518
39 Ga0070671_100084323 3300005355 Bacteria 2657
40 Ga0070671_100467827 3300005355 Bacteria 1082
41 Ga0070671_100569626 3300005355 Bacteria 977
42 Ga0070674_100005849 3300005356 Bacteria 7151
43 Ga0070674_100286185 3300005356 Bacteria 1308
44 Ga0070674_100380114 3300005356 Bacteria 1149
45 Ga0070673_100049195 3300005364 Bacteria 3291
46 Ga0070673_100083303 3300005364 Bacteria 2598
47 Ga0070673_100116694 3300005364 Bacteria 2221
48 Ga0070673_100497786 3300005364 Bacteria 1102
49 Ga0070688_100188968 3300005365 Bacteria 1434
50 Ga0070688_100247229 3300005365 Bacteria 1269
51 Ga0070659_100085056 3300005366 Unclassified 2530
52 Ga0070667_100058981 3300005367 Bacteria 3246
53 Ga0070667_100234682 3300005367 Bacteria 1636
54 Ga0070667_100390250 3300005367 Bacteria 1266
55 Ga0070709_10007981 3300005434 Bacteria 5816
56 Ga0070709_10010010 3300005434 Bacteria 5240
57 Ga0070713_100018061 3300005436 Bacteria 5356
58 Ga0070713_100078575 3300005436 Bacteria 2809
59 Ga0070711_100017786 3300005439 Bacteria 4529
60 Ga0070711_100217823 3300005439 Bacteria 1482
61 Ga0070700_100059967 3300005441 Bacteria 2397
62 Ga0070700_100207291 3300005441 Bacteria 1381
63 Ga0070700_100245844 3300005441 Bacteria 1281
64 Ga0070708_100032898 3300005445 Bacteria 4501
65 Ga0070663_100015862 3300005455 Bacteria 4876
66 Ga0070663_100028129 3300005455 Bacteria 3823
67 Ga0070663_100031284 3300005455 Bacteria 3656
68 Ga0070663_100047543 3300005455 Bacteria 3039
69 Ga0070663_100129979 3300005455 Bacteria 1911
70 Ga0070663_100153088 3300005455 Bacteria 1770
71 Ga0070663_100179236 3300005455 Bacteria 1642
72 Ga0070663_100396955 3300005455 Bacteria 1126
73 Ga0070678_100017583 3300005456 Bacteria 4611
74 Ga0070678_100025842 3300005456 Bacteria 3959
75 Ga0070678_100040466 3300005456 Bacteria 3298
76 Ga0070678_100043604 3300005456 Bacteria 3196
77 Ga0070662_100128561 3300005457 Bacteria 1950
78 Ga0070662_100145515 3300005457 Bacteria 1841
79 Ga0070681_10020209 3300005458 Bacteria 6675
80 Ga0068867_100134850 3300005459 Bacteria 1923
81 Ga0070685_10015586 3300005466 Bacteria 4039
82 Ga0070706_100288427 3300005467 Bacteria 1532
83 Ga0070707_100179894 3300005468 Bacteria 2061
84 Ga0070699_100027008 3300005518 Bacteria 4951
85 Ga0070679_100142014 3300005530 Unclassified 2380
86 Ga0070684_100132544 3300005535 Bacteria 2248
87 Ga0070697_100191014 3300005536 Bacteria 1738
88 Ga0068853_100053977 3300005539 Bacteria 3462
89 Ga0068853_100115324 3300005539 Bacteria 2390
90 Ga0068853_100151042 3300005539 Bacteria 2091
91 Ga0068853_100268674 3300005539 Bacteria 1570
92 Ga0070672_100108422 3300005543 Bacteria 2261
93 Ga0070672_100163889 3300005543 Bacteria 1846
94 Ga0070695_100000851 3300005545 Bacteria 16425
95 Ga0070665_100003924 3300005548 Bacteria 15697
96 Ga0070665_100011644 3300005548 Bacteria 8889
97 Ga0070665_100015331 3300005548 Bacteria 7695
98 Ga0070665_100039788 3300005548 Bacteria 4726
99 Ga0070665_100064243 3300005548 Bacteria 3680
100 Ga0070665_100093475 3300005548 Bacteria 3012
101 Ga0070665_100278819 3300005548 Bacteria 1673
102 Ga0070704_100152049 3300005549 Bacteria 1821
103 Ga0070704_100603643 3300005549 Bacteria 965
104 Ga0068855_100139627 3300005563 Bacteria 2763
105 Ga0068855_100140841 3300005563 Bacteria 2749
106 Ga0068855_100352618 3300005563 Bacteria 1621
107 Ga0070664_100074858 3300005564 Bacteria 2907
108 Ga0070664_100114539 3300005564 Bacteria 2356
109 Ga0068857_100768090 3300005577 Bacteria 919
110 Ga0068854_100180415 3300005578 Bacteria 1649
111 Ga0070702_100009600 3300005615 Bacteria 4744
112 Ga0068859_100116234 3300005617 Bacteria 2739
113 Ga0068859_100334823 3300005617 Bacteria 1608
114 Ga0068864_100083414 3300005618 Bacteria 2806
115 Ga0068866_10049442 3300005718 Bacteria 2131
116 Ga0068861_100094526 3300005719 Bacteria 2365
117 Ga0068861_100109378 3300005719 Bacteria 2212
118 Ga0068861_100209411 3300005719 Bacteria 1641
119 Ga0068861_100235133 3300005719 Bacteria 1556
120 Ga0068863_100120646 3300005841 Bacteria 2500
121 Ga0068863_100153799 3300005841 Bacteria 2202
122 Ga0068863_100186494 3300005841 Bacteria 1992
123 Ga0068863_100426709 3300005841 Bacteria 1299
124 Ga0068858_100034300 3300005842 Bacteria 4707
125 Ga0068858_100049819 3300005842 Bacteria 3878
126 Ga0068858_100088988 3300005842 Bacteria 2873
127 Ga0068858_100191614 3300005842 Bacteria 1932
128 Ga0068858_100335497 3300005842 Bacteria 1446
129 Ga0068860_100009962 3300005843 Bacteria 9418
130 Ga0068860_100017045 3300005843 Bacteria 7081
131 Ga0068862_100018832 3300005844 Bacteria 5753
132 Ga0068862_100049355 3300005844 Bacteria 3594
133 Ga0068862_100155323 3300005844 Bacteria 2039
134 Ga0068862_100440358 3300005844 Bacteria 1226
135 Ga0068862_100468346 3300005844 Bacteria 1190
136 Ga0081455_10001207 3300005937 Bacteria 32353
137 Ga0081455_10002021 3300005937 Bacteria 24257
138 Ga0081455_10005151 3300005937 Bacteria 14395
139 Ga0081455_10012489 3300005937 Bacteria 8475
140 Ga0081455_10026629 3300005937 Bacteria 5312
141 Ga0081455_10045635 3300005937 Bacteria 3811
142 Ga0081455_10140027 3300005937 Bacteria 1880
143 Ga0081538_10010297 3300005981 Bacteria 7676
144 Ga0081540_1000075 3300005983 Bacteria 106804
145 Ga0081540_1000199 3300005983 Bacteria 62482
146 Ga0081540_1000373 3300005983 Bacteria 44890
147 Ga0081540_1000904 3300005983 Bacteria 26798
148 Ga0081540_1002468 3300005983 Bacteria 15067
149 Ga0081540_1007774 3300005983 Bacteria 7587
150 Ga0081540_1010461 3300005983 Bacteria 6278
151 Ga0081540_1012806 3300005983 Bacteria 5488
152 Ga0081540_1019596 3300005983 Bacteria 4104
153 Ga0081540_1021716 3300005983 Bacteria 3812
154 Ga0081540_1024507 3300005983 Bacteria 3500
155 Ga0081539_10015306 3300005985 Bacteria 5585
156 Ga0075365_10009759 3300006038 Bacteria 5546
157 Ga0075365_10019345 3300006038 Bacteria 4202
158 Ga0075365_10037162 3300006038 Bacteria 3160
159 Ga0075365_10079261 3300006038 Bacteria 2222
160 Ga0075365_10123565 3300006038 Bacteria 1787
161 Ga0075368_10057946 3300006042 Bacteria 1547
162 Ga0075368_10065280 3300006042 Bacteria 1462
163 Ga0075368_10098526 3300006042 Bacteria 1199
164 Ga0075368_10141845 3300006042 Bacteria 1001
165 Ga0075364_10081732 3300006051 Bacteria 2136
166 Ga0070716_100134796 3300006173 Bacteria 1566
167 Ga0070712_100082567 3300006175 Bacteria 2331
168 Ga0070712_100158897 3300006175 Bacteria 1744
169 Ga0075362_10059855 3300006177 Bacteria 1720
170 Ga0075367_10070460 3300006178 Bacteria 2102
171 Ga0075427_10001634 3300006194 Bacteria 2906
172 Ga0075366_10055853 3300006195 Bacteria 2345
173 Ga0075366_10078980 3300006195 Bacteria 1964
174 Ga0075370_10008406 3300006353 Bacteria 5313
175 Ga0075370_10024237 3300006353 Bacteria 3350
176 Ga0075370_10051867 3300006353 Bacteria 2326
177 Ga0075370_10076862 3300006353 Bacteria 1915
178 Ga0075370_10252653 3300006353 Bacteria 1045
179 Ga0075428_100060636 3300006844 Bacteria 4143
180 Ga0075428_100082182 3300006844 Bacteria 3515
181 Ga0075428_100108421 3300006844 Bacteria 3027
182 Ga0075428_100154086 3300006844 Bacteria 2496
183 Ga0075430_100002329 3300006846 Bacteria 15774
184 Ga0075430_100089238 3300006846 Bacteria 2580
185 Ga0075430_100119211 3300006846 Bacteria 2200
186 Ga0075430_100155852 3300006846 Bacteria 1902
187 Ga0075430_100330088 3300006846 Bacteria 1260
188 Ga0075431_100082967 3300006847 Bacteria 3309
189 Ga0075431_100097653 3300006847 Bacteria 3033
190 Ga0075431_100498710 3300006847 Bacteria 1209
191 Ga0075433_10002467 3300006852 Bacteria 14080
192 Ga0075433_10024444 3300006852 Bacteria 5099
193 Ga0075433_10032543 3300006852 Bacteria 4466
194 Ga0075434_100031382 3300006871 Bacteria 5238
195 Ga0075434_100137186 3300006871 Bacteria 2465
196 Ga0075434_100219154 3300006871 Bacteria 1922
197 Ga0075429_100040222 3300006880 Bacteria 4069
198 Ga0075429_100074856 3300006880 Bacteria 2949
199 Ga0068865_100059781 3300006881 Bacteria 2666
200 Ga0068865_100122289 3300006881 Bacteria 1937
201 Ga0097620_100116231 3300006931 Bacteria 2739
202 Ga0097620_100334836 3300006931 Bacteria 1608
203 Ga0099825_1024499 3300006941 Bacteria 3511
204 Ga0099825_1039920 3300006941 Bacteria 1417
205 Ga0099824_1016075 3300006942 Bacteria 6889
206 Ga0099824_1022540 3300006942 Bacteria 4128
207 Ga0099822_1005361 3300006943 Bacteria 16734
208 Ga0099822_1033954 3300006943 Bacteria 3458
209 Ga0099823_1038759 3300006944 Bacteria 3538
210 Ga0075435_100026199 3300007076 Bacteria 4546
211 Ga0075435_100029267 3300007076 Bacteria 4322
212 Ga0075435_100121623 3300007076 Bacteria 2179
213 Ga0075435_100137889 3300007076 Bacteria 2045
214 Ga0075435_100221112 3300007076 Bacteria 1608
215 Ga0075435_100247987 3300007076 Bacteria 1515
216 Ga0099794_10001910 3300007265 Bacteria 7481
217 Ga0099795_10007092 3300007788 Bacteria 3103
218 Ga0105240_10133696 3300009093 Bacteria 2972
219 Ga0105240_10481126 3300009093 Bacteria 1384
220 Ga0111539_10004711 3300009094 Bacteria 17824
221 Ga0111539_10113788 3300009094 Bacteria 3173
222 Ga0111539_10188582 3300009094 Bacteria 2407
223 Ga0105245_10028707 3300009098 Bacteria 4909
224 Ga0105245_10071874 3300009098 Bacteria 3142
225 Ga0105245_10551295 3300009098 Bacteria 1175
226 Ga0105245_10854204 3300009098 Bacteria 950
227 Ga0105247_10137399 3300009101 Bacteria 1598
228 Ga0114129_10065176 3300009147 Bacteria 5085
229 Ga0114129_10097158 3300009147 Bacteria 4077
230 Ga0114129_10103217 3300009147 Bacteria 3942
231 Ga0114129_10122946 3300009147 Bacteria 3570
232 Ga0114129_10174002 3300009147 Bacteria 2933
233 Ga0114129_10174153 3300009147 Bacteria 2931
234 Ga0114129_10219830 3300009147 Bacteria 2563
235 Ga0114129_11014398 3300009147 Bacteria 1044
236 Ga0105243_10023886 3300009148 Bacteria 4659
237 Ga0105243_10170425 3300009148 Bacteria 1885
238 Ga0105241_10009784 3300009174 Bacteria 7046
239 Ga0105241_10022328 3300009174 Bacteria 4687
240 Ga0105241_10075397 3300009174 Bacteria 2628
241 Ga0105242_10275223 3300009176 Bacteria 1527
242 Ga0105248_10025654 3300009177 Bacteria 6554
243 Ga0105248_10239373 3300009177 Bacteria 2043
244 Ga0105248_10504104 3300009177 Bacteria 1365
245 Ga0105248_10600592 3300009177 Bacteria 1242
246 Ga0105248_10721903 3300009177 Bacteria 1124
247 Ga0105237_10001286 3300009545 Bacteria 33400
248 Ga0105237_10019561 3300009545 Bacteria 6994
249 Ga0105237_10070713 3300009545 Bacteria 3485
250 Ga0105237_10121414 3300009545 Bacteria 2607
251 Ga0105237_10250574 3300009545 Bacteria 1773
252 Ga0105237_10308261 3300009545 Bacteria 1586
253 Ga0105238_10035583 3300009551 Bacteria 5061
254 Ga0105238_10092006 3300009551 Bacteria 3020
255 Ga0105249_10282304 3300009553 Bacteria 1659
256 Ga0105249_10517955 3300009553 Bacteria 1240
257 Ga0105239_10031496 3300010375 Bacteria 5831
258 Ga0105239_10045785 3300010375 Bacteria 4794
259 Ga0105239_10126790 3300010375 Bacteria 2837
260 Ga0105239_10202408 3300010375 Bacteria 2224
261 Ga0105239_10237552 3300010375 Bacteria 2045
262 Ga0105239_10613861 3300010375 Bacteria 1241
263 Ga0105239_11156499 3300010375 Bacteria 891
264 Ga0105246_10012957 3300011119 Bacteria 5217
265 Ga0105246_10022531 3300011119 Bacteria 4064
266 Ga0105246_10061885 3300011119 Bacteria 2606
267 Ga0105246_10085648 3300011119 Bacteria 2257
268 Ga0157374_10302787 3300013296 Bacteria 1582
269 Ga0157374_10440798 3300013296 Bacteria 1303
270 Ga0157374_10441597 3300013296 Bacteria 1302
271 Ga0157378_10018279 3300013297 Bacteria 6154
272 Ga0157378_10140137 3300013297 Bacteria 2245
273 Ga0163162_10043512 3300013306 Bacteria 4497
274 Ga0163162_10233446 3300013306 Bacteria 1970
275 Ga0157372_10116018 3300013307 Unclassified 3070
276 Ga0157375_10038184 3300013308 Bacteria 4609
277 Ga0157375_10047706 3300013308 Bacteria 4185
278 Ga0157375_10056271 3300013308 Bacteria 3882
279 Ga0157375_10312170 3300013308 Bacteria 1737
280 Ga0157375_10364778 3300013308 Bacteria 1611
281 Ga0163163_10041823 3300014325 Bacteria 4484
282 Ga0163163_10078765 3300014325 Bacteria 3293
283 Ga0163163_10450467 3300014325 Bacteria 1347
284 Ga0163163_10541768 3300014325 Bacteria 1226
285 Ga0157380_10051724 3300014326 Bacteria 3250
286 Ga0157380_10079993 3300014326 Bacteria 2670
287 Ga0157380_10301187 3300014326 Bacteria 1477
288 Ga0182008_10020362 3300014497 Bacteria 3418
289 Ga0157379_10017256 3300014968 Bacteria 6359
290 Ga0157379_10187769 3300014968 Bacteria 1868
291 Ga0157379_10198000 3300014968 Bacteria 1816
292 Ga0157379_10200872 3300014968 Bacteria 1803
293 Ga0157376_10411975 3300014969 Bacteria 1309
294 Ga0163161_10022999 3300017792 Bacteria 4392
295 Ga0163161_10076433 3300017792 Bacteria 2458
296 Ga0163161_10240794 3300017792 Bacteria 1407
297 Ga0214544_1000006 3300021320 Bacteria 380728
298 Ga0214542_1000002 3300021321 Bacteria 720798
299 Ga0214545_1000002 3300021324 Bacteria 727485
300 Ga0214543_1000017 3300021327 Bacteria 290109
301 Ga0213872_10030867 3300021361 Bacteria 2456
302 Ga0209563_100471 3300025230 Bacteria 13811
303 Ga0209677_100757 3300025253 Bacteria 16368
304 Ga0209677_108436 3300025253 Bacteria 2000
305 Ga0209233_1010533 3300025261 Bacteria 2765
306 Ga0209455_1005175 3300025272 Bacteria 4090
307 Ga0209675_1004035 3300025291 Bacteria 6691
308 Ga0209758_1000216 3300025297 Bacteria 125352
309 Ga0209758_1005195 3300025297 Bacteria 10227
310 Ga0209256_1003991 3300025299 Bacteria 9675
311 Ga0207426_1002409 3300025302 Bacteria 12033
312 Ga0207426_1006600 3300025302 Bacteria 5002
313 Ga0207426_1034113 3300025302 Bacteria 1635
314 Ga0209257_1001462 3300025304 Bacteria 27887
315 Ga0207697_10053457 3300025315 Bacteria 1672
316 Ga0207653_10014263 3300025885 Bacteria 2492
317 Ga0207692_10001933 3300025898 Bacteria 7899
318 Ga0207642_10156537 3300025899 Bacteria 1219
319 Ga0207710_10020192 3300025900 Bacteria 2847
320 Ga0207710_10123374 3300025900 Bacteria 1239
321 Ga0207688_10000077 3300025901 Bacteria 37350
322 Ga0207688_10027476 3300025901 Bacteria 3130
323 Ga0207680_10018688 3300025903 Bacteria 3691
324 Ga0207680_10287248 3300025903 Bacteria 1144
325 Ga0207647_10081907 3300025904 Bacteria 1933
326 Ga0207645_10059755 3300025907 Bacteria 2435
327 Ga0207643_10036633 3300025908 Bacteria 2751
328 Ga0207705_10025430 3300025909 Bacteria 4227
329 Ga0207684_10387193 3300025910 Bacteria 1202
330 Ga0207654_10065552 3300025911 Bacteria 2139
331 Ga0207707_10057329 3300025912 Bacteria 3390
332 Ga0207695_10000342 3300025913 Bacteria 108393
333 Ga0207671_10003865 3300025914 Bacteria 14649
334 Ga0207671_10048284 3300025914 Bacteria 3151
335 Ga0207671_10276970 3300025914 Bacteria 1322
336 Ga0207671_10380243 3300025914 Bacteria 1122
337 Ga0207693_10007359 3300025915 Bacteria 9056
338 Ga0207663_10010822 3300025916 Bacteria 4871
339 Ga0207663_10012418 3300025916 Bacteria 4605
340 Ga0207660_10469289 3300025917 Bacteria 1019
341 Ga0207662_10122803 3300025918 Bacteria 1630
342 Ga0207657_10199814 3300025919 Bacteria 1609
343 Ga0207649_10010842 3300025920 Bacteria 5010
344 Ga0207652_10170220 3300025921 Unclassified 1954
345 Ga0207646_10431598 3300025922 Bacteria 1189
346 Ga0207681_10141929 3300025923 Bacteria 1790
347 Ga0207681_10294011 3300025923 Bacteria 1283
348 Ga0207681_10533665 3300025923 Bacteria 964
349 Ga0207694_10136289 3300025924 Bacteria 1972
350 Ga0207694_10172060 3300025924 Bacteria 1754
351 Ga0207650_10125013 3300025925 Bacteria 2007
352 Ga0207659_10168954 3300025926 Bacteria 1724
353 Ga0207687_10081618 3300025927 Bacteria 2337
354 Ga0207664_10012334 3300025929 Bacteria 6106
355 Ga0207644_10302496 3300025931 Bacteria 1289
356 Ga0207690_10062447 3300025932 Unclassified 2536
357 Ga0207706_10001566 3300025933 Bacteria 22667
358 Ga0207706_10024495 3300025933 Bacteria 5410
359 Ga0207706_10045202 3300025933 Bacteria 3902
360 Ga0207706_10121570 3300025933 Bacteria 2296
361 Ga0207686_10121522 3300025934 Bacteria 1778
362 Ga0207709_10015580 3300025935 Bacteria 4216
363 Ga0207670_10113344 3300025936 Bacteria 1958
364 Ga0207670_10386086 3300025936 Bacteria 1116
365 Ga0207670_10390743 3300025936 Bacteria 1110
366 Ga0207669_10082312 3300025937 Bacteria 2066
367 Ga0207665_10014843 3300025939 Bacteria 5121
368 Ga0207665_10055607 3300025939 Bacteria 2671
369 Ga0207691_10116641 3300025940 Bacteria 2370
370 Ga0207691_10133599 3300025940 Bacteria 2190
371 Ga0207711_10014612 3300025941 Bacteria 6525
372 Ga0207711_10072116 3300025941 Bacteria 2999
373 Ga0207711_10307545 3300025941 Bacteria 1463
374 Ga0207711_10457356 3300025941 Bacteria 1188
375 Ga0207689_10002811 3300025942 Bacteria 16084
376 Ga0207689_10056696 3300025942 Bacteria 3224
377 Ga0207689_10078711 3300025942 Bacteria 2709
378 Ga0207661_10432011 3300025944 Bacteria 1197
379 Ga0207651_10027057 3300025960 Bacteria 3596
380 Ga0207651_10182020 3300025960 Bacteria 1668
381 Ga0207651_10504668 3300025960 Bacteria 1046
382 Ga0207712_10114698 3300025961 Bacteria 2027
383 Ga0207712_10157922 3300025961 Bacteria 1759
384 Ga0207712_10347826 3300025961 Bacteria 1231
385 Ga0207712_10367331 3300025961 Bacteria 1200
386 Ga0207668_10014121 3300025972 Bacteria 4938
387 Ga0207668_10100003 3300025972 Bacteria 2152
388 Ga0207668_10175145 3300025972 Bacteria 1686
389 Ga0207668_10189653 3300025972 Bacteria 1628
390 Ga0207668_10190269 3300025972 Bacteria 1626
391 Ga0207668_10203020 3300025972 Bacteria 1580
392 Ga0207668_10391802 3300025972 Bacteria 1172
393 Ga0207668_10414000 3300025972 Bacteria 1142
394 Ga0207640_10028836 3300025981 Bacteria 3399
395 Ga0207640_10087828 3300025981 Bacteria 2145
396 Ga0207658_10029667 3300025986 Bacteria 3866
397 Ga0207677_10089401 3300026023 Bacteria 2236
398 Ga0207677_10110273 3300026023 Bacteria 2048
399 Ga0207703_10041818 3300026035 Bacteria 3674
400 Ga0207703_10132767 3300026035 Bacteria 2152
401 Ga0207703_10168877 3300026035 Bacteria 1922
402 Ga0207678_10016327 3300026067 Bacteria 6518
403 Ga0207678_10019801 3300026067 Bacteria 5918
404 Ga0207678_10023742 3300026067 Bacteria 5362
405 Ga0207678_10044292 3300026067 Bacteria 3849
406 Ga0207678_10054649 3300026067 Bacteria 3439
407 Ga0207678_10054664 3300026067 Bacteria 3439
408 Ga0207678_10070409 3300026067 Bacteria 2999
409 Ga0207708_10062016 3300026075 Bacteria 2856
410 Ga0207708_10068790 3300026075 Bacteria 2710
411 Ga0207641_10094128 3300026088 Bacteria 2627
412 Ga0207641_10273835 3300026088 Bacteria 1585
413 Ga0207641_10298532 3300026088 Bacteria 1521
414 Ga0207648_10001800 3300026089 Bacteria 23485
415 Ga0207648_10198539 3300026089 Bacteria 1779
416 Ga0207648_10540914 3300026089 Bacteria 1069
417 Ga0207676_10072722 3300026095 Bacteria 2765
418 Ga0207676_10143852 3300026095 Bacteria 2045
419 Ga0207674_10071136 3300026116 Bacteria 3495
420 Ga0207675_100008275 3300026118 Bacteria 9797
421 Ga0207675_100024973 3300026118 Bacteria 5560
422 Ga0207675_100081999 3300026118 Bacteria 3024
423 Ga0207675_100244883 3300026118 Bacteria 1733
424 Ga0207683_10018799 3300026121 Bacteria 5895
425 Ga0207683_10021283 3300026121 Bacteria 5549
426 Ga0207683_10033761 3300026121 Bacteria 4446
427 Ga0207683_10036754 3300026121 Bacteria 4265
428 Ga0207698_10815684 3300026142 Bacteria 936
429 Ga0209389_1000196 3300027296 Bacteria 43831
430 Ga0209389_1000284 3300027296 Bacteria 31998
431 Ga0209589_1000006 3300027357 Bacteria 436292
432 Ga0209589_1001029 3300027357 Bacteria 43810
433 Ga0209489_100007 3300027361 Bacteria 436292
434 Ga0209489_101824 3300027361 Bacteria 43831
435 Ga0209489_117016 3300027361 Bacteria 3539
436 Ga0209700_100008 3300027363 Bacteria 436292
437 Ga0209700_103273 3300027363 Bacteria 31313
438 Ga0209588_1030098 3300027671 Bacteria 1733
439 Ga0209588_1035751 3300027671 Bacteria 1597
440 Ga0209813_10019693 3300027866 Bacteria 1879
441 Ga0209813_10034302 3300027866 Bacteria 1514
442 Ga0209813_10042184 3300027866 Bacteria 1393
443 Ga0207428_10003095 3300027907 Bacteria 16361
444 Ga0268266_10000544 3300028379 Bacteria 52629
445 Ga0268266_10001633 3300028379 Bacteria 26087
446 Ga0268266_10027900 3300028379 Bacteria 4801
447 Ga0268266_10079594 3300028379 Bacteria 2853
448 Ga0268266_10213358 3300028379 Bacteria 1771
449 Ga0268266_10269456 3300028379 Bacteria 1580
450 Ga0268265_10048073 3300028380 Bacteria 3200
451 Ga0268265_10051918 3300028380 Bacteria 3098
452 Ga0268265_10383668 3300028380 Bacteria 1293
453 Ga0268264_10037322 3300028381 Bacteria 4006
454 Ga0265337_1007475 3300028556 Bacteria 4086
455 Ga0265319_1002882 3300028563 Bacteria 9186
456 Ga0265334_10009925 3300028573 Bacteria 4025
457 Ga0265318_10013021 3300028577 Bacteria 3525
458 Ga0265336_10001981 3300028666 Bacteria 8764
459 Ga0307517_10228684 3300028786 Bacteria 1120
460 Ga0307515_10059588 3300028794 Bacteria 5467
461 Ga0265338_10000013 3300028800 Bacteria 379065
462 Ga0265324_10003322 3300029957 Bacteria 7721
463 Ga0307509_10274011 3300031507 Bacteria 1453
464 Ga0307408_100485484 3300031548 Bacteria 1079
465 Ga0307516_10006378 3300031730 Bacteria 13828
466 Ga0307516_10144193 3300031730 Bacteria 2148
467 Ga0307516_10204159 3300031730 Bacteria 1694
468 Ga0307413_10038382 3300031824 Bacteria 2775
469 Ga0307409_100187443 3300031995 Bacteria 1838
470 Ga0307415_100034576 3300032126 Bacteria 3292
471 Ga0307510_10004428 3300033180 Bacteria 16533
472 Ga0307510_10017480 3300033180 Bacteria 8455
473 Ga0315911_1000010 3300033442 Bacteria 322197
474 Ga0373926_0065719 3300035083 Bacteria 1327
475 Ga0373928_0021744 3300035084 Bacteria 1355
476 Ga0373929_0023510 3300035085 Bacteria 1267
477 Ga0373952_0019731 3300035092 Bacteria 1407
478 Ga0373923_0126224 3300035111 Bacteria 1147
479 Ga0373932_0017972 3300035112 Bacteria 1824
480 Ga0373932_0047206 3300035112 Bacteria 1265
481 Ga0373932_0062846 3300035112 Bacteria 1133
482 Ga0373936_0053244 3300035113 Bacteria 1641
483 Ga0373939_0005708 3300035114 Bacteria 2967
484 Ga0373939_0138478 3300035114 Bacteria 875
485 Ga0373941_0053037 3300035115 Bacteria 1295
486 Ga0373945_0061371 3300035116 Bacteria 1404
487 Ga0373960_0030197 3300035121 Bacteria 1508
488 Ga0373960_0078200 3300035121 Bacteria 1036
489 Ga0373943_0012834 3300035170 Bacteria 3776
490 Ga0373943_0071923 3300035170 Bacteria 1753
491 Ga0373943_0114119 3300035170 Bacteria 1428
492 Ga0373946_0006617 3300035171 Bacteria 4208
493 Ga0373955_0152426 3300035172 Bacteria 1361
494 Ga0373942_0010929 3300035207 Bacteria 2143
495 Ga0373961_0012173 3300035241 Bacteria 2149
496 Ga0373962_0012362 3300035242 Bacteria 2150
497 Ga0373962_0028315 3300035242 Bacteria 1519
498 Ga0373931_0000589 3300035691 Bacteria 14992
499 Ga0373931_0013520 3300035691 Bacteria 3976
500 Ga0373935_0052593 3300035692 Bacteria 2589
501 Ga0373935_0056830 3300035692 Bacteria 2496
502 Ga0373935_0080948 3300035692 Bacteria 2110
503 Ga0373927_0007128 3300035695 Bacteria 7587
504 Ga0373927_0041681 3300035695 Bacteria 2977
505 Ga0373927_0048146 3300035695 Bacteria 2757
506 Ga0373927_0071342 3300035695 Bacteria 2248
507 Ga0373927_0156791 3300035695 Bacteria 1491
508 Ga0373933_0038204 3300035724 Bacteria 2821
509 Ga0373947_0001699 3300035725 Bacteria 13502
510 Ga0373947_0007402 3300035725 Bacteria 6356
511 Ga0373947_0055264 3300035725 Unclassified 2397
512 Ga0373947_0069905 3300035725 Bacteria 2150
513 Ga0373937_0009747 3300036401 Bacteria 8373
514 Ga0373937_0376498 3300036401 Bacteria 1346
515 Ga0373925_0022773 3300037068 Bacteria 4572
516 Ga0373925_0067599 3300037068 Bacteria 2696
517 Ga0373925_0089875 3300037068 Bacteria 2347
518 Ga0373925_0116895 3300037068 Bacteria 2066
519 Ga0395905_0124921 3300037471 Bacteria 2420
520 Ga0395905_0160393 3300037471 Bacteria 2114
521 Ga0395901_0404554 3300038443 Bacteria 1402
522 Ga0436365_1610361 3300039437 Bacteria 1154
523 Ga0436360_0737618 3300039438 Bacteria 2741
524 Ga0436361_0102531 3300039447 Bacteria 4162
525 Ga0436361_0496474 3300039447 Bacteria 7367
526 Ga0436361_0857818 3300039447 Bacteria 13715
527 Ga0436363_0112888 3300039450 Bacteria 1089
528 Ga0436362_1154959 3300039453 Bacteria 3540
529 Ga0439465_0017091 3300041413 Bacteria 2264
530 Ga0439465_0078545 3300041413 Bacteria 1116
531 Ga0451807_2471553 3300041486 Bacteria 909
532 Ga0450897_009266 3300042128 Bacteria 929
533 Ga0439446_0037075 3300042156 Bacteria 1427
534 Ga0466972_0068802 3300044658 Bacteria 1691
535 Ga0466972_0114728 3300044658 Bacteria 1272
536 Ga0466961_0271468 3300044693 Bacteria 1039
537 Ga0466959_0246904 3300045049 Bacteria 1232
538 Ga0466967_0013831 3300045976 Bacteria 6257
539 Ga0495617_004300 3300046452 Bacteria 5193
540 Ga0495617_056880 3300046452 Bacteria 1297
541 Ga0495592_0027994 3300046454 Bacteria 4269
542 Ga0495603_0002549 3300046455 Bacteria 10732
543 Ga0495603_0007037 3300046455 Bacteria 6750
544 Ga0495603_0031784 3300046455 Bacteria 3178
545 Ga0495603_0045565 3300046455 Bacteria 2615
546 Ga0495603_0166349 3300046455 Bacteria 1278
547 Ga0495629_0004300 3300046459 Bacteria 10676
548 Ga0495629_0005021 3300046459 Bacteria 9917
549 Ga0495638_0035509 3300046460 Bacteria 3177
550 Ga0495638_0037407 3300046460 Bacteria 3087
551 Ga0495580_0041029 3300046472 Bacteria 3302
552 Ga0495582_0114352 3300046473 Bacteria 1517
553 Ga0495605_0072932 3300046474 Bacteria 1618
554 Ga0495639_0004473 3300046475 Bacteria 5988
555 Ga0495639_0095316 3300046475 Bacteria 1400
556 Ga0495639_0176879 3300046475 Bacteria 1038
557 Ga0495662_0012054 3300046476 Bacteria 4225
558 Ga0495664_0009734 3300046477 Bacteria 5386
559 Ga0495664_0132492 3300046477 Bacteria 1510
560 Ga0495585_0079024 3300046492 Bacteria 1784
561 Ga0495585_0155111 3300046492 Bacteria 1192
562 Ga0495585_0175457 3300046492 Bacteria 1104
563 Ga0495594_0010444 3300046499 Bacteria 4816
564 Ga0495594_0023889 3300046499 Bacteria 3279
565 Ga0495596_0118653 3300046500 Bacteria 1027
566 Ga0495607_0149066 3300046501 Bacteria 1199
567 Ga0495606_0038752 3300046507 Bacteria 3220
568 Ga0495616_0144378 3300046513 Bacteria 1081
569 Ga0495618_0025545 3300046514 Bacteria 3667
570 Ga0495628_0091771 3300046516 Bacteria 2350
571 Ga0495628_0137156 3300046516 Bacteria 1869
572 Ga0495631_0131545 3300046518 Bacteria 1075
573 Ga0495643_0081618 3300046522 Bacteria 1681
574 Ga0495644_0024670 3300046523 Bacteria 2287
575 Ga0495644_0157517 3300046523 Bacteria 870
576 Ga0495663_0068741 3300046525 Bacteria 1125
577 Ga0495666_0043604 3300046526 Bacteria 2167
578 Ga0495642_0062807 3300046528 Bacteria 1543
579 Ga0495665_0026950 3300046531 Bacteria 3085
580 Ga0495640_0023620 3300046533 Bacteria 4475
581 Ga0495640_0040831 3300046533 Bacteria 3246
582 Ga0495598_0013894 3300046537 Bacteria 2005
583 Ga0495609_0152860 3300046538 Bacteria 981
584 Ga0495621_0050282 3300046539 Bacteria 1489
585 Ga0495597_0025896 3300046542 Bacteria 2698
586 Ga0495667_0035623 3300046559 Bacteria 3325
587 Ga0495656_0002595 3300046615 Bacteria 6028
588 Ga0495656_0189933 3300046615 Bacteria 1014
589 Ga0495668_0069745 3300046616 Bacteria 1933
590 Ga0495634_0012735 3300046642 Bacteria 6088
591 Ga0495611_0150360 3300046648 Bacteria 1087
592 Ga0495625_0009575 3300046660 Bacteria 8094
593 Ga0495625_0048587 3300046660 Bacteria 3054
594 Ga0495625_0121291 3300046660 Bacteria 1779
595 Ga0495625_0317169 3300046660 Bacteria 993
596 Ga0495635_0005943 3300046663 Bacteria 8515
597 Ga0495635_0085160 3300046663 Bacteria 2162
598 Ga0495659_0008078 3300046664 Bacteria 3343
599 Ga0495661_0218414 3300046665 Bacteria 989
600 Ga0495588_0025133 3300046674 Bacteria 2965
601 Ga0495588_0103725 3300046674 Bacteria 1495
602 Ga0495588_0154253 3300046674 Bacteria 1214
603 Ga0495657_0041743 3300046675 Bacteria 3137
604 Ga0495646_0139351 3300046680 Bacteria 1358
605 Ga0495647_0003332 3300046681 Bacteria 5149
606 Ga0495647_0047611 3300046681 Bacteria 1655
607 Ga0495658_0017021 3300046683 Bacteria 3748
608 Ga0495658_0091052 3300046683 Bacteria 1806
609 Ga0495658_0135977 3300046683 Bacteria 1499
610 Ga0495669_0001655 3300046684 Bacteria 9153
611 Ga0495613_0060267 3300046689 Bacteria 2780
612 Ga0495613_0098560 3300046689 Bacteria 2112
613 Ga0495624_0003239 3300046690 Bacteria 12139
614 Ga0495624_0148702 3300046690 Bacteria 1433
615 Ga0495649_0004412 3300046694 Bacteria 9195
616 Ga0495589_0061947 3300046794 Bacteria 1835
617 Ga0495600_0029114 3300046809 Bacteria 3575
618 Ga0495581_0002498 3300047315 Bacteria 10427
619 Ga0495581_0097956 3300047315 Bacteria 1703
620 Ga0495604_0102779 3300047317 Bacteria 2097
621 Ga0495636_0056022 3300047318 Bacteria 1659
622 Ga0495674_0031540 3300047319 Bacteria 4814
623 Ga0495672_0058508 3300047320 Bacteria 2234
624 Ga0495676_0015378 3300047321 Bacteria 6815
625 Ga0495683_0109795 3300047323 Bacteria 1318
626 Ga0495683_0134017 3300047323 Bacteria 1166
627 Ga0495673_0042343 3300047469 Bacteria 2045
628 Ga0495686_0047811 3300047472 Bacteria 2700
629 Ga0495686_0126967 3300047472 Bacteria 1516
630 Ga0495593_0000942 3300047673 Bacteria 16962
631 Ga0495614_0110194 3300048089 Bacteria 1208
632 Ga0495614_0144894 3300048089 Bacteria 1057
633 Ga0495615_0031144 3300048090 Bacteria 1278
634 Ga0495615_0067856 3300048090 Bacteria 955
635 Ga0496100_0332759 3300048903 Bacteria 1143
636 Ga0496100_0440611 3300048903 Bacteria 997
637 Ga0496101_0074176 3300048904 Bacteria 2501
638 Ga0496101_0090953 3300048904 Bacteria 2270
639 Ga0496101_0103682 3300048904 Bacteria 2132
640 Ga0496101_0111802 3300048904 Bacteria 2057
641 Ga0496101_0228021 3300048904 Bacteria 1447
642 Ga0496102_0012884 3300048905 Bacteria 7238
643 Ga0496102_0050685 3300048905 Bacteria 3781
644 Ga0496102_0102199 3300048905 Bacteria 2664
645 Ga0496102_0250623 3300048905 Bacteria 1669
646 Ga0496102_0362380 3300048905 Bacteria 1365
647 Ga0496103_0074034 3300048906 Bacteria 2134
648 Ga0496104_0000916 3300048907 Bacteria 25286
649 Ga0496104_0058187 3300048907 Bacteria 3658
650 Ga0496104_0065281 3300048907 Bacteria 3454
651 Ga0496104_0091319 3300048907 Bacteria 2910
652 Ga0496104_0121880 3300048907 Bacteria 2503
653 Ga0496104_0302932 3300048907 Bacteria 1510
654 Ga0496104_0339954 3300048907 Bacteria 1414
655 Ga0496105_0018517 3300048908 Bacteria 5601
656 Ga0496105_0169445 3300048908 Bacteria 1790
657 Ga0496105_0197699 3300048908 Bacteria 1642
658 Ga0496105_0225750 3300048908 Bacteria 1523
659 Ga0496105_0301692 3300048908 Bacteria 1287
660 Ga0496105_0379562 3300048908 Bacteria 1125
661 Ga0496106_0188090 3300048909 Bacteria 1641
662 Ga0496106_0494849 3300048909 Bacteria 982
663 Ga0496107_0063803 3300048910 Bacteria 2670
664 Ga0496107_0212560 3300048910 Bacteria 1438
665 Ga0496108_0203309 3300048911 Bacteria 1719
666 Ga0496108_0303673 3300048911 Bacteria 1390
667 Ga0496109_0300568 3300048912 Bacteria 1513
668 Ga0496109_0306471 3300048912 Bacteria 1498
669 Ga0496110_0009234 3300048913 Bacteria 7970
670 Ga0496110_0046873 3300048913 Bacteria 3782
671 Ga0496110_0233232 3300048913 Bacteria 1674
672 Ga0496110_0242547 3300048913 Bacteria 1640
673 Ga0496111_0028232 3300048914 Bacteria 3976
674 Ga0496111_0071062 3300048914 Bacteria 2533
675 Ga0496112_0071722 3300048915 Bacteria 3423
676 Ga0496112_0073248 3300048915 Bacteria 3386
677 Ga0496112_0144283 3300048915 Bacteria 2349
678 Ga0496112_0193576 3300048915 Bacteria 1994
679 Ga0496112_0260818 3300048915 Bacteria 1682
680 Ga0496113_0029907 3300048916 Bacteria 3938
681 Ga0496113_0121262 3300048916 Bacteria 2044
682 Ga0496113_0216416 3300048916 Bacteria 1526
683 Ga0496113_0249510 3300048916 Bacteria 1417
684 Ga0496113_0313176 3300048916 Bacteria 1258
685 Ga0496114_0073481 3300048917 Bacteria 2878
686 Ga0496114_0172047 3300048917 Bacteria 1888
687 Ga0496114_0205672 3300048917 Bacteria 1725
688 Ga0496114_0463564 3300048917 Bacteria 1122
689 Ga0496114_0526132 3300048917 Bacteria 1045
690 Ga0496115_0054272 3300048918 Bacteria 3218
691 Ga0496115_0089891 3300048918 Bacteria 2508
692 Ga0496115_0095660 3300048918 Bacteria 2431
693 Ga0496115_0110292 3300048918 Bacteria 2260
694 Ga0496115_0120612 3300048918 Bacteria 2158
695 Ga0496115_0152102 3300048918 Bacteria 1911
696 Ga0496115_0183849 3300048918 Bacteria 1727
697 Ga0496116_0076727 3300048919 Bacteria 2092
698 Ga0496118_0020691 3300048921 Bacteria 5826
699 Ga0496118_0119089 3300048921 Bacteria 1727
700 Ga0496118_0121408 3300048921 Bacteria 1702
701 Ga0496119_0024691 3300048922 Bacteria 4220
702 Ga0496119_0192969 3300048922 Bacteria 1060
703 Ga0496120_0030655 3300048923 Bacteria 3264
704 Ga0496121_0015817 3300048924 Bacteria 7853
705 Ga0496121_0018938 3300048924 Bacteria 6908
706 Ga0496121_0042465 3300048924 Bacteria 3954
707 Ga0496121_0044500 3300048924 Bacteria 3828
708 Ga0496121_0059718 3300048924 Bacteria 3142
709 Ga0496121_0060439 3300048924 Bacteria 3116
710 Ga0496121_0061883 3300048924 Bacteria 3069
711 Ga0496121_0228380 3300048924 Bacteria 1305
712 Ga0496121_0231457 3300048924 Bacteria 1294
713 Ga0496121_0339662 3300048924 Bacteria 1004
714 Ga0496121_0402545 3300048924 Bacteria 896
715 Ga0496124_0008072 3300048927 Bacteria 11068
716 Ga0496124_0078139 3300048927 Bacteria 2728
717 Ga0496124_0113175 3300048927 Bacteria 2181
718 Ga0496125_0064169 3300048928 Bacteria 2921
719 Ga0496125_0101569 3300048928 Bacteria 2116
720 Ga0496125_0128971 3300048928 Bacteria 1785
721 Ga0496126_0002447 3300048929 Bacteria 25067
722 Ga0496126_0021927 3300048929 Bacteria 6228
723 Ga0496126_0043210 3300048929 Bacteria 4158
724 Ga0496126_0129359 3300048929 Bacteria 2183
725 Ga0496126_0141674 3300048929 Bacteria 2069
726 Ga0496126_0141788 3300048929 Bacteria 2068
727 Ga0496126_0158676 3300048929 Bacteria 1934
728 Ga0496126_0162654 3300048929 Bacteria 1906
729 Ga0496126_0258317 3300048929 Bacteria 1449
730 Ga0496126_0582869 3300048929 Bacteria 883
731 Ga0501039_0454496 3300049575 Bacteria 1006
732 Ga0501071_0008888 3300049587 Bacteria 6663
733 Ga0501081_0128703 3300049743 Bacteria 1808
734 Ga0501083_0357688 3300049744 Bacteria 949
735 Ga0501045_0068998 3300049824 Bacteria 2598
736 nmdc:mga03683_15843_c1 3300050489 Bacteria 2821
737 nmdc:mga03n38_88327_c1 3300050490 Bacteria 1470
738 nmdc:mga00v17_134587_c1 3300050491 Bacteria 1581
739 nmdc:mga0yw44_26825_c1 3300050492 Bacteria 3294
740 nmdc:mga0yw44_63600_c1 3300050492 Bacteria 2269
741 nmdc:mga0yw44_86331_c1 3300050492 Bacteria 1976
742 nmdc:mga06z11_27833_c1 3300050494 Bacteria 2706
743 nmdc:mga06z11_48054_c1 3300050494 Bacteria 2170
744 nmdc:mga04h51_92630_c1 3300050495 Bacteria 1090
745 nmdc:mga07m45_17287_c1 3300050496 Bacteria 3870
746 nmdc:mga07m45_23241_c1 3300050496 Bacteria 3387
747 nmdc:mga07m45_3901_c1 3300050496 Bacteria 7244
748 nmdc:mga05p37_190242_c1 3300050507 Bacteria 2492
749 nmdc:mga05p37_38746_c1 3300050507 Bacteria 5848
750 nmdc:mga05p37_5331_c1 3300050507 Bacteria 15103
751 nmdc:mga09592_30838_c1 3300050508 Bacteria 4464
752 nmdc:mga0qj67_147369_c1 3300050509 Bacteria 1908
753 nmdc:mga0qj67_30180_c1 3300050509 Bacteria 4216
754 nmdc:mga0qj67_48398_c1 3300050509 Bacteria 3359
755 nmdc:mga06r32_198858_c1 3300050510 Bacteria 1992
756 nmdc:mga06r32_320092_c1 3300050510 Bacteria 1537
757 nmdc:mga06r32_487812_c1 3300050510 Bacteria 1210
758 nmdc:mga08y16_308916_c1 3300050511 Bacteria 1629
759 nmdc:mga08y16_34711_c1 3300050511 Bacteria 5300
760 nmdc:mga0n895_160319_c1 3300050512 Bacteria 2281
761 nmdc:mga0n895_167823_c1 3300050512 Bacteria 2227
762 nmdc:mga0n895_219851_c1 3300050512 Bacteria 1929
763 nmdc:mga0rr50_211700_c1 3300050513 Bacteria 1597
764 nmdc:mga0rr50_625140_c1 3300050513 Bacteria 918
765 nmdc:mga0a205_10385_c1 3300050515 Bacteria 8556
766 nmdc:mga0a205_270135_c1 3300050515 Bacteria 1240
767 nmdc:mga0a205_517752_c1 3300050515 Bacteria 1049
768 nmdc:mga0a205_6427_c1 3300050515 Bacteria 10625
769 nmdc:mga0sz30_43035_c1 3300050516 Bacteria 1901
770 Ga0495601_0035361 3300053077 Bacteria 3118
771 Ga0495601_0093556 3300053077 Bacteria 1936
772 Ga0495619_0005502 3300053085 Bacteria 8033
773 Ga0500578_0081033 3300053086 Bacteria 2064
774 Ga0500643_000114 3300053087 Bacteria 84221
775 Ga0500643_076630 3300053087 Bacteria 923
776 Ga0500566_0001448 3300053094 Bacteria 13912
777 Ga0500641_0118170 3300053096 Bacteria 1142
778 Ga0500648_176918 3300053097 Bacteria 1103
779 Ga0500556_0023415 3300053104 Bacteria 2017
780 Ga0500557_000001 3300053105 Bacteria 241298
781 Ga0500595_002799 3300053119 Bacteria 8399
782 Ga0500595_010510 3300053119 Bacteria 3675
783 Ga0500608_168768 3300053122 Bacteria 940
784 Ga0500642_0000240 3300053130 Bacteria 21191
785 Ga0500590_013608 3300053148 Bacteria 4180
786 Ga0500590_126025 3300053148 Bacteria 1192
787 Ga0500636_0129277 3300053177 Bacteria 1409
788 Ga0500636_0145011 3300053177 Bacteria 1310
789 Ga0500625_006844 3300053729 Bacteria 4898
790 Ga0500645_008456 3300053730 Bacteria 3514
791 Ga0500656_004287 3300053732 Bacteria 1374
792 Ga0500601_000202 3300053737 Bacteria 12063
793 Ga0501084_0163282 3300054114 Bacteria 1879
794 Ga0500661_008088 3300055283 Bacteria 1935
795 Ga0530510_0016583 3300061734 Bacteria 5215
796 Ga0530510_0219456 3300061734 Bacteria 1413

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10252653 Ga0075370_102526531 260
2 3300035112 Ga0373932_0062846 Ga0373932_0062846_195_1037 260
3 3300035114 Ga0373939_0005708 Ga0373939_0005708_1483_2325 260
4 3300035115 Ga0373941_0053037 Ga0373941_0053037_134_976 260
5 3300035121 Ga0373960_0030197 Ga0373960_0030197_337_1179 260
6 3300035207 Ga0373942_0010929 Ga0373942_0010929_294_1136 260
7 3300035242 Ga0373962_0012362 Ga0373962_0012362_637_1479 260
8 3300035691 Ga0373931_0000589 Ga0373931_0000589_9094_9936 260
9 3300005441 Ga0070700_100245844 Ga0070700_1002458442 261
10 3300005719 Ga0068861_100109378 Ga0068861_1001093782 261
11 3300005841 Ga0068863_100120646 Ga0068863_1001206461 261
12 3300005842 Ga0068858_100335497 Ga0068858_1003354972 261
13 3300005843 Ga0068860_100017045 Ga0068860_1000170455 261
14 3300006038 Ga0075365_10123565 Ga0075365_101235652 261
15 3300006042 Ga0075368_10098526 Ga0075368_100985261 261
16 3300011119 Ga0105246_10061885 Ga0105246_100618852 261
17 3300025901 Ga0207688_10000077 Ga0207688_100000773 261
18 3300025908 Ga0207643_10036633 Ga0207643_100366332 261
19 3300025919 Ga0207657_10199814 Ga0207657_101998141 261
20 3300025933 Ga0207706_10001566 Ga0207706_100015662 261
21 3300025934 Ga0207686_10121522 Ga0207686_101215222 261
22 3300025981 Ga0207640_10028836 Ga0207640_100288362 261
23 3300026035 Ga0207703_10041818 Ga0207703_100418182 261
24 3300026075 Ga0207708_10062016 Ga0207708_100620162 261
25 3300046616 Ga0495668_0069745 Ga0495668_0069745_609_1466 261
26 3300048904 Ga0496101_0074176 Ga0496101_0074176_1106_1987 261
27 3300048907 Ga0496104_0091319 Ga0496104_0091319_50_931 261
28 3300048915 Ga0496112_0193576 Ga0496112_0193576_658_1539 261
29 3300048917 Ga0496114_0526132 Ga0496114_0526132_162_1010 261
30 3300005983 Ga0081540_1000199 Ga0081540_100019931 262
31 3300026089 Ga0207648_10540914 Ga0207648_105409141 263
32 3300025299 Ga0209256_1003991 Ga0209256_100399110 264
33 3300006880 Ga0075429_100040222 Ga0075429_1000402222 268
34 3300031730 Ga0307516_10006378 Ga0307516_100063782 268
35 3300006038 Ga0075365_10079261 Ga0075365_100792612 269
36 3300053097 Ga0500648_176918 Ga0500648_176918_160_1002 269
37 3300005335 Ga0070666_10058884 Ga0070666_100588843 271
38 3300005548 Ga0070665_100003924 Ga0070665_1000039246 271
39 3300005841 Ga0068863_100426709 Ga0068863_1004267091 271
40 3300007076 Ga0075435_100137889 Ga0075435_1001378892 271
41 3300009545 Ga0105237_10070713 Ga0105237_100707132 271
42 3300011119 Ga0105246_10085648 Ga0105246_100856483 271
43 3300014968 Ga0157379_10017256 Ga0157379_100172561 271
44 3300021361 Ga0213872_10030867 Ga0213872_100308672 271
45 3300025261 Ga0209233_1010533 Ga0209233_10105332 271
46 3300025272 Ga0209455_1005175 Ga0209455_10051753 271
47 3300025903 Ga0207680_10018688 Ga0207680_100186881 271
48 3300025961 Ga0207712_10367331 Ga0207712_103673311 271
49 3300026088 Ga0207641_10273835 Ga0207641_102738352 271
50 3300026121 Ga0207683_10021283 Ga0207683_100212832 271
51 3300039437 Ga0436365_1610361 Ga0436365_1610361_214_1032 271
52 3300039447 Ga0436361_0102531 Ga0436361_0102531_2797_3615 271
53 3300048903 Ga0496100_0440611 Ga0496100_0440611_85_903 271
54 3300048905 Ga0496102_0050685 Ga0496102_0050685_2431_3249 271
55 3300048907 Ga0496104_0000916 Ga0496104_0000916_22186_23004 271
56 3300048907 Ga0496104_0065281 Ga0496104_0065281_379_1197 271
57 3300048908 Ga0496105_0169445 Ga0496105_0169445_657_1475 271
58 3300048908 Ga0496105_0197699 Ga0496105_0197699_23_841 271
59 3300048909 Ga0496106_0188090 Ga0496106_0188090_530_1348 271
60 3300048910 Ga0496107_0063803 Ga0496107_0063803_1456_2274 271
61 3300048912 Ga0496109_0300568 Ga0496109_0300568_385_1203 271
62 3300048913 Ga0496110_0233232 Ga0496110_0233232_84_902 271
63 3300048913 Ga0496110_0242547 Ga0496110_0242547_381_1199 271
64 3300048915 Ga0496112_0260818 Ga0496112_0260818_255_1073 271
65 3300048916 Ga0496113_0313176 Ga0496113_0313176_65_883 271
66 3300048918 Ga0496115_0183849 Ga0496115_0183849_586_1404 271
67 3300048921 Ga0496118_0020691 Ga0496118_0020691_654_1472 271
68 3300048924 Ga0496121_0059718 Ga0496121_0059718_362_1180 271
69 3300048924 Ga0496121_0060439 Ga0496121_0060439_1802_2620 271
70 3300049587 Ga0501071_0008888 Ga0501071_0008888_3315_4136 271
71 3300050513 nmdc:mga0rr50_625140_c1 nmdc:mga0rr50_625140_c1_84_899 271
72 3300005330 Ga0070690_100028466 Ga0070690_1000284663 272
73 3300005347 Ga0070668_100123454 Ga0070668_1001234542 272
74 3300005356 Ga0070674_100005849 Ga0070674_1000058494 272
75 3300005434 Ga0070709_10010010 Ga0070709_100100103 272
76 3300005436 Ga0070713_100018061 Ga0070713_1000180612 272
77 3300005439 Ga0070711_100217823 Ga0070711_1002178232 272
78 3300005441 Ga0070700_100059967 Ga0070700_1000599672 272
79 3300005455 Ga0070663_100028129 Ga0070663_1000281291 272
80 3300005456 Ga0070678_100025842 Ga0070678_1000258422 272
81 3300005457 Ga0070662_100128561 Ga0070662_1001285612 272
82 3300005549 Ga0070704_100152049 Ga0070704_1001520491 272
83 3300005578 Ga0068854_100180415 Ga0068854_1001804152 272
84 3300005615 Ga0070702_100009600 Ga0070702_1000096001 272
85 3300005718 Ga0068866_10049442 Ga0068866_100494422 272
86 3300005719 Ga0068861_100209411 Ga0068861_1002094111 272
87 3300005844 Ga0068862_100049355 Ga0068862_1000493552 272
88 3300006881 Ga0068865_100059781 Ga0068865_1000597813 272
89 3300009094 Ga0111539_10188582 Ga0111539_101885823 272
90 3300009098 Ga0105245_10028707 Ga0105245_100287074 272
91 3300009098 Ga0105245_10071874 Ga0105245_100718743 272
92 3300009148 Ga0105243_10023886 Ga0105243_100238863 272
93 3300009174 Ga0105241_10009784 Ga0105241_100097844 272
94 3300009545 Ga0105237_10019561 Ga0105237_100195614 272
95 3300009553 Ga0105249_10517955 Ga0105249_105179551 272
96 3300010375 Ga0105239_10126790 Ga0105239_101267902 272
97 3300010375 Ga0105239_10237552 Ga0105239_102375523 272
98 3300011119 Ga0105246_10012957 Ga0105246_100129572 272
99 3300013296 Ga0157374_10440798 Ga0157374_104407981 272
100 3300013306 Ga0163162_10043512 Ga0163162_100435125 272
101 3300013308 Ga0157375_10312170 Ga0157375_103121703 272
102 3300013308 Ga0157375_10364778 Ga0157375_103647782 272
103 3300014325 Ga0163163_10078765 Ga0163163_100787654 272
104 3300014326 Ga0157380_10051724 Ga0157380_100517243 272
105 3300017792 Ga0163161_10022999 Ga0163161_100229994 272
106 3300025907 Ga0207645_10059755 Ga0207645_100597552 272
107 3300025916 Ga0207663_10012418 Ga0207663_100124183 272
108 3300025933 Ga0207706_10045202 Ga0207706_100452023 272
109 3300025935 Ga0207709_10015580 Ga0207709_100155803 272
110 3300025939 Ga0207665_10055607 Ga0207665_100556072 272
111 3300025941 Ga0207711_10014612 Ga0207711_100146122 272
112 3300025972 Ga0207668_10014121 Ga0207668_100141214 272
113 3300026067 Ga0207678_10019801 Ga0207678_100198013 272
114 3300026118 Ga0207675_100024973 Ga0207675_1000249732 272
115 3300026121 Ga0207683_10036754 Ga0207683_100367542 272
116 3300028800 Ga0265338_10000013 Ga0265338_1000001346 272
117 3300035113 Ga0373936_0053244 Ga0373936_0053244_19_837 272
118 3300035695 Ga0373927_0041681 Ga0373927_0041681_1797_2615 272
119 3300035725 Ga0373947_0001699 Ga0373947_0001699_2098_2916 272
120 3300037068 Ga0373925_0022773 Ga0373925_0022773_537_1355 272
121 3300041413 Ga0439465_0017091 Ga0439465_0017091_982_1803 272
122 3300046455 Ga0495603_0007037 Ga0495603_0007037_4293_5111 272
123 3300046455 Ga0495603_0166349 Ga0495603_0166349_37_855 272
124 3300046473 Ga0495582_0114352 Ga0495582_0114352_45_863 272
125 3300046500 Ga0495596_0118653 Ga0495596_0118653_127_969 272
126 3300046518 Ga0495631_0131545 Ga0495631_0131545_187_1029 272
127 3300046523 Ga0495644_0157517 Ga0495644_0157517_34_852 272
128 3300046528 Ga0495642_0062807 Ga0495642_0062807_302_1120 272
129 3300046615 Ga0495656_0189933 Ga0495656_0189933_145_975 272
130 3300046684 Ga0495669_0001655 Ga0495669_0001655_3517_4359 272
131 3300046690 Ga0495624_0148702 Ga0495624_0148702_111_929 272
132 3300046794 Ga0495589_0061947 Ga0495589_0061947_124_966 272
133 3300047315 Ga0495581_0097956 Ga0495581_0097956_170_988 272
134 3300047469 Ga0495673_0042343 Ga0495673_0042343_33_854 272
135 3300048089 Ga0495614_0144894 Ga0495614_0144894_167_985 272
136 3300048904 Ga0496101_0103682 Ga0496101_0103682_467_1309 272
137 3300048908 Ga0496105_0301692 Ga0496105_0301692_439_1257 272
138 3300048916 Ga0496113_0249510 Ga0496113_0249510_586_1404 272
139 3300048918 Ga0496115_0120612 Ga0496115_0120612_847_1677 272
140 3300048924 Ga0496121_0042465 Ga0496121_0042465_1203_2021 272
141 3300048929 Ga0496126_0258317 Ga0496126_0258317_577_1395 272
142 3300050489 nmdc:mga03683_15843_c1 nmdc:mga03683_15843_c1_618_1436 272
143 3300005354 Ga0070675_100172639 Ga0070675_1001726392 275
144 3300005364 Ga0070673_100083303 Ga0070673_1000833033 275
145 3300005563 Ga0068855_100352618 Ga0068855_1003526181 275
146 3300006195 Ga0075366_10078980 Ga0075366_100789802 275
147 3300013308 Ga0157375_10038184 Ga0157375_100381844 275
148 3300025960 Ga0207651_10504668 Ga0207651_105046681 275
149 3300026089 Ga0207648_10001800 Ga0207648_100018007 275
150 3300035695 Ga0373927_0071342 Ga0373927_0071342_582_1415 275
151 iso_pu_bacteria 2513237104 2513722919 275
152 iso_pu_bacteria 2842038055 2842038718 275
153 iso_pu_bacteria 2842045827 2842048337 275
154 iso_pu_bacteria 2874628541 2874636554 275
155 iso_pu_bacteria 2906626472 2906628181 275
156 iso_pu_bacteria 2932818245 2932819451 275
157 iso_pu_bacteria 8016583857 8016591373 275
158 3300025291 Ga0209675_1004035 Ga0209675_10040356 276
159 iso_pu_bacteria 2507262055 2507509683 276
160 iso_pu_bacteria 2508501009 2508543699 276
161 iso_pu_bacteria 2508501042 2508698518 276
162 iso_pu_bacteria 2513237092 2513628282 276
163 iso_pu_bacteria 2513237094 2513641940 276
164 iso_pu_bacteria 2513237096 2513655054 276
165 iso_pu_bacteria 2513237101 2513693551 276
166 iso_pu_bacteria 2513237145 2513915923 276
167 iso_pu_bacteria 2515154112 2515629130 276
168 iso_pu_bacteria 2517093001 2517103621 276
169 iso_pu_bacteria 2517572143 2517894773 276
170 iso_pu_bacteria 2524023205 2524442212 276
171 iso_pu_bacteria 2524023228 2524534522 276
172 iso_pu_bacteria 2528768022 2528855501 276
173 iso_pu_bacteria 2617270741 2617378266 276
174 iso_pu_bacteria 2667528175 2671119185 276
175 iso_pu_bacteria 2721755755 2723848443 276
176 iso_pu_bacteria 2728368998 2728747571 276
177 iso_pu_bacteria 2744054633 2745079503 276
178 iso_pu_bacteria 2791355196 2793060345 276
179 iso_pu_bacteria 2791355197 2793071244 276
180 iso_pu_bacteria 2791355199 2793080991 276
181 iso_pu_bacteria 2802429603 2805917725 276
182 iso_pu_bacteria 2816332527 2818241406 276
183 iso_pu_bacteria 2824600985 2824602201 276
184 iso_pu_bacteria 2824609381 2824610189 276
185 iso_pu_bacteria 2824617872 2824623797 276
186 iso_pu_bacteria 2824626560 2824627789 276
187 iso_pu_bacteria 2824635225 2824639325 276
188 iso_pu_bacteria 2824644064 2824646896 276
189 iso_pu_bacteria 2824653114 2824656172 276
190 iso_pu_bacteria 2824661429 2824666976 276
191 iso_pu_bacteria 2824679649 2824686123 276
192 iso_pu_bacteria 2824696289 2824698382 276
193 iso_pu_bacteria 2824714736 2824720758 276
194 iso_pu_bacteria 2824723954 2824730894 276
195 iso_pu_bacteria 2824732956 2824735987 276
196 iso_pu_bacteria 2824746037 2824746841 276
197 iso_pu_bacteria 2824773399 2824773937 276
198 iso_pu_bacteria 2847930680 2847934917 276
199 iso_pu_bacteria 2847939898 2847945492 276
200 iso_pu_bacteria 2849076700 2849080321 276
201 iso_pu_bacteria 2857509624 2857510317 276
202 iso_pu_bacteria 2874604998 2874609216 276
203 iso_pu_bacteria 2874612657 2874613163 276
204 iso_pu_bacteria 2879083081 2879086308 276
205 iso_pu_bacteria 2879099564 2879109428 276
206 iso_pu_bacteria 2879110137 2879119197 276
207 iso_pu_bacteria 2881364244 2881366310 276
208 iso_pu_bacteria 2881665667 2881672943 276
209 iso_pu_bacteria 2885374607 2885378787 276
210 iso_pu_bacteria 2885409591 2885416660 276
211 iso_pu_bacteria 2888388044 2888394882 276
212 iso_pu_bacteria 2888419890 2888423381 276
213 iso_pu_bacteria 2889033259 2889036991 276
214 iso_pu_bacteria 2903748898 2903749629 276
215 iso_pu_bacteria 2904690495 2904697755 276
216 iso_pu_bacteria 2904699407 2904705907 276
217 iso_pu_bacteria 2906610324 2906611486 276
218 iso_pu_bacteria 2906635258 2906641671 276
219 iso_pu_bacteria 2906643746 2906649823 276
220 iso_pu_bacteria 2906660503 2906660773 276
221 iso_pu_bacteria 2908739725 2908745079 276
222 iso_pu_bacteria 2908756301 2908757148 276
223 iso_pu_bacteria 2908775508 2908779020 276
224 iso_pu_bacteria 2922361189 2922363627 276
225 iso_pu_bacteria 2922368715 2922373127 276
226 iso_pu_bacteria 2922386360 2922392804 276
227 iso_pu_bacteria 2922393267 2922395323 276
228 iso_pu_bacteria 2922425934 2922427869 276
229 iso_pu_bacteria 2929615660 2929615816 276
230 iso_pu_bacteria 2929624759 2929630429 276
231 iso_pu_bacteria 2932784394 2932792072 276
232 iso_pu_bacteria 2932809354 2932814061 276
233 iso_pu_bacteria 2932828146 2932833840 276
234 iso_pu_bacteria 2933577622 2933578898 276
235 iso_pu_bacteria 2935608549 2935611458 276
236 iso_pu_bacteria 2935616580 2935618630 276
237 iso_pu_bacteria 2935630451 2935632200 276
238 iso_pu_bacteria 2935638405 2935644527 276
239 iso_pu_bacteria 2935648319 2935648844 276
240 iso_pu_bacteria 2935656913 2935657074 276
241 iso_pu_bacteria 2935665750 2935673582 276
242 iso_pu_bacteria 2935675223 2935678469 276
243 iso_pu_bacteria 2935684952 2935688097 276
244 iso_pu_bacteria 2935694250 2935701361 276
245 iso_pu_bacteria 2935703347 2935708384 276
246 iso_pu_bacteria 2935713505 2935715116 276
247 iso_pu_bacteria 2935722832 2935726319 276
248 iso_pu_bacteria 2935732158 2935733935 276
249 iso_pu_bacteria 2935741537 2935743314 276
250 iso_pu_bacteria 2935750917 2935754648 276
251 iso_pu_bacteria 2935760218 2935765422 276
252 iso_pu_bacteria 2935769743 2935776300 276
253 iso_pu_bacteria 2935777560 2935784176 276
254 iso_pu_bacteria 2935785616 2935790289 276
255 iso_pu_bacteria 2935793552 2935798872 276
256 iso_pu_bacteria 2935801545 2935805373 276
257 iso_pu_bacteria 2935810662 2935816671 276
258 iso_pu_bacteria 2935819856 2935820935 276
259 iso_pu_bacteria 2935827899 2935833724 276
260 iso_pu_bacteria 2935837841 2935839590 276
261 iso_pu_bacteria 2935847175 2935850805 276
262 iso_pu_bacteria 2935855204 2935856995 276
263 iso_pu_bacteria 2935864058 2935871177 276
264 iso_pu_bacteria 2935873716 2935876320 276
265 iso_pu_bacteria 2935908558 2935913827 276
266 iso_pu_bacteria 2935916978 2935920183 276
267 iso_pu_bacteria 2935926038 2935930522 276
268 iso_pu_bacteria 2935934488 2935939505 276
269 iso_pu_bacteria 2935942939 2935946454 276
270 iso_pu_bacteria 2935951376 2935955707 276
271 iso_pu_bacteria 2935959822 2935964600 276
272 iso_pu_bacteria 2935967501 2935972583 276
273 iso_pu_bacteria 2935984226 2935989026 276
274 iso_pu_bacteria 2935992306 2935997716 276
275 iso_pu_bacteria 2936002035 2936007229 276
276 iso_pu_bacteria 2936011229 2936011754 276
277 iso_pu_bacteria 2936019824 2936020349 276
278 iso_pu_bacteria 2936028420 2936029043 276
279 iso_pu_bacteria 2936037263 2936043067 276
280 iso_pu_bacteria 2936046547 2936047072 276
281 iso_pu_bacteria 2936055302 2936061303 276
282 iso_pu_bacteria 2940556831 2940559975 276
283 iso_pu_bacteria 2941507105 2941508148 276
284 iso_pu_bacteria 2941515067 2941515347 276
285 iso_pu_bacteria 2941523033 2941524078 276
286 iso_pu_bacteria 2941531003 2941535992 276
287 iso_pu_bacteria 2941538514 2941540279 276
288 iso_pu_bacteria 3005474847 3005477576 276
289 iso_pu_bacteria 3005483717 3005489864 276
290 iso_pu_bacteria 3005506211 3005507808 276
291 iso_pu_bacteria 3005587118 3005590388 276
292 iso_pu_bacteria 3005594810 3005598160 276
293 iso_pu_bacteria 3005710791 3005713835 276
294 iso_pu_bacteria 3005718088 3005721346 276
295 iso_pu_bacteria 8006926726 8006931591 276
296 iso_pu_bacteria 8006933436 8006933648 276
297 iso_pu_bacteria 8006973647 8006983320 276
298 iso_pu_bacteria 8006984368 8006988924 276
299 iso_pu_bacteria 8016511872 8016514593 276
300 iso_pu_bacteria 8016522445 8016530693 276
301 iso_pu_bacteria 8016530956 8016535979 276
302 iso_pu_bacteria 8016539877 8016540259 276
303 iso_pu_bacteria 8016548790 8016552973 276
304 iso_pu_bacteria 8016557553 8016561349 276
305 iso_pu_bacteria 8016566248 8016574324 276
306 iso_pu_bacteria 8016575299 8016578424 276
307 iso_pu_bacteria 8016595262 8016599206 276
308 iso_pu_bacteria 8016603502 8016611840 276
309 iso_pu_bacteria 8016613128 8016621967 276
310 iso_pu_bacteria 8016622563 8016627888 276
311 iso_pu_bacteria 8016630954 8016632197 276
312 iso_pu_bacteria 8017057580 8017061837 276
313 iso_pu_bacteria 8019530166 8019535705 276
314 iso_pu_bacteria 8019538911 8019543773 276
315 iso_pu_bacteria 8019555841 8019559583 276
316 iso_pu_bacteria 8019565922 8019569684 276
317 iso_pu_bacteria 8019576017 8019581366 276
318 iso_pu_bacteria 8019586578 8019588992 276
319 iso_pu_bacteria 8019597564 8019602241 276
320 iso_pu_bacteria 8019608314 8019616321 276
321 iso_pu_bacteria 8019619141 8019626972 276
322 iso_pu_bacteria 8019648815 8019657111 276
323 iso_pu_bacteria 8019687851 8019688840 276
324 iso_pu_bacteria 8055742211 8055747463 276
325 iso_pu_bacteria 8056673599 8056676901 276
326 iso_pu_bacteria 8056689827 8056695191 276
327 3300005338 Ga0068868_100077386 Ga0068868_1000773862 277
328 3300005355 Ga0070671_100569626 Ga0070671_1005696261 277
329 3300005356 Ga0070674_100286185 Ga0070674_1002861851 277
330 3300005367 Ga0070667_100058981 Ga0070667_1000589813 277
331 3300005456 Ga0070678_100017583 Ga0070678_1000175833 277
332 3300005937 Ga0081455_10001207 Ga0081455_100012072 277
333 3300005983 Ga0081540_1000075 Ga0081540_100007571 277
334 3300006844 Ga0075428_100060636 Ga0075428_1000606364 277
335 3300006846 Ga0075430_100155852 Ga0075430_1001558522 277
336 3300006871 Ga0075434_100219154 Ga0075434_1002191541 277
337 3300007076 Ga0075435_100221112 Ga0075435_1002211122 277
338 3300009098 Ga0105245_10854204 Ga0105245_108542041 277
339 3300009147 Ga0114129_10174153 Ga0114129_101741532 277
340 3300009147 Ga0114129_10219830 Ga0114129_102198302 277
341 3300009545 Ga0105237_10250574 Ga0105237_102505742 277
342 3300009551 Ga0105238_10035583 Ga0105238_100355832 277
343 3300013296 Ga0157374_10302787 Ga0157374_103027871 277
344 3300013297 Ga0157378_10140137 Ga0157378_101401373 277
345 3300025937 Ga0207669_10082312 Ga0207669_100823121 277
346 3300025940 Ga0207691_10116641 Ga0207691_101166412 277
347 3300025972 Ga0207668_10189653 Ga0207668_101896531 277
348 3300025986 Ga0207658_10029667 Ga0207658_100296673 277
349 3300035692 Ga0373935_0056830 Ga0373935_0056830_1504_2349 277
350 3300035695 Ga0373927_0156791 Ga0373927_0156791_521_1366 277
351 3300037068 Ga0373925_0089875 Ga0373925_0089875_97_942 277
352 3300038443 Ga0395901_0404554 Ga0395901_0404554_335_1180 277
353 3300048904 Ga0496101_0111802 Ga0496101_0111802_1188_2033 277
354 3300048907 Ga0496104_0121880 Ga0496104_0121880_1621_2466 277
355 3300048911 Ga0496108_0303673 Ga0496108_0303673_414_1259 277
356 3300048917 Ga0496114_0205672 Ga0496114_0205672_174_1019 277
357 3300048917 Ga0496114_0463564 Ga0496114_0463564_24_869 277
358 3300048918 Ga0496115_0089891 Ga0496115_0089891_418_1263 277
359 3300050507 nmdc:mga05p37_38746_c1 nmdc:mga05p37_38746_c1_4194_5039 277
360 3300050509 nmdc:mga0qj67_147369_c1 nmdc:mga0qj67_147369_c1_401_1246 277
361 3300050510 nmdc:mga06r32_198858_c1 nmdc:mga06r32_198858_c1_117_962 277
362 3300050512 nmdc:mga0n895_219851_c1 nmdc:mga0n895_219851_c1_89_991 277
363 3300050513 nmdc:mga0rr50_211700_c1 nmdc:mga0rr50_211700_c1_50_952 277
364 3300050515 nmdc:mga0a205_270135_c1 nmdc:mga0a205_270135_c1_99_1001 277
365 3300005331 Ga0070670_100240832 Ga0070670_1002408322 278
366 3300005347 Ga0070668_100472798 Ga0070668_1004727981 278
367 3300005354 Ga0070675_100015290 Ga0070675_1000152903 278
368 3300005364 Ga0070673_100049195 Ga0070673_1000491952 278
369 3300005543 Ga0070672_100163889 Ga0070672_1001638892 278
370 3300005844 Ga0068862_100018832 Ga0068862_1000188326 278
371 3300014326 Ga0157380_10301187 Ga0157380_103011872 278
372 3300014497 Ga0182008_10020362 Ga0182008_100203621 278
373 3300025925 Ga0207650_10125013 Ga0207650_101250132 278
374 3300025960 Ga0207651_10027057 Ga0207651_100270574 278
375 3300028380 Ga0268265_10051918 Ga0268265_100519184 278
376 3300036401 Ga0373937_0009747 Ga0373937_0009747_5353_6192 278
377 3300039450 Ga0436363_0112888 Ga0436363_0112888_191_1036 278
378 3300003659 JGI25404J52841_10002324 JGI25404J52841_100023242 279
379 3300004625 Ga0055543_1015382 Ga0055543_10153821 279
380 3300005327 Ga0070658_10282547 Ga0070658_102825472 279
381 3300005328 Ga0070676_10026600 Ga0070676_100266003 279
382 3300005347 Ga0070668_100041085 Ga0070668_1000410852 279
383 3300005353 Ga0070669_100096764 Ga0070669_1000967642 279
384 3300005354 Ga0070675_100139137 Ga0070675_1001391372 279
385 3300005354 Ga0070675_100260914 Ga0070675_1002609141 279
386 3300005366 Ga0070659_100085056 Ga0070659_1000850562 279
387 3300005434 Ga0070709_10007981 Ga0070709_100079815 279
388 3300005436 Ga0070713_100078575 Ga0070713_1000785756 279
389 3300005439 Ga0070711_100017786 Ga0070711_1000177865 279
390 3300005445 Ga0070708_100032898 Ga0070708_1000328983 279
391 3300005456 Ga0070678_100043604 Ga0070678_1000436042 279
392 3300005457 Ga0070662_100145515 Ga0070662_1001455152 279
393 3300005458 Ga0070681_10020209 Ga0070681_100202094 279
394 3300005467 Ga0070706_100288427 Ga0070706_1002884272 279
395 3300005468 Ga0070707_100179894 Ga0070707_1001798942 279
396 3300005518 Ga0070699_100027008 Ga0070699_1000270085 279
397 3300005530 Ga0070679_100142014 Ga0070679_1001420142 279
398 3300005548 Ga0070665_100039788 Ga0070665_1000397885 279
399 3300005937 Ga0081455_10002021 Ga0081455_1000202117 279
400 3300005937 Ga0081455_10026629 Ga0081455_100266296 279
401 3300005937 Ga0081455_10140027 Ga0081455_101400271 279
402 3300005983 Ga0081540_1002468 Ga0081540_10024688 279
403 3300005983 Ga0081540_1019596 Ga0081540_10195962 279
404 3300005983 Ga0081540_1024507 Ga0081540_10245072 279
405 3300006173 Ga0070716_100134796 Ga0070716_1001347963 279
406 3300006175 Ga0070712_100082567 Ga0070712_1000825671 279
407 3300006175 Ga0070712_100158897 Ga0070712_1001588973 279
408 3300006846 Ga0075430_100089238 Ga0075430_1000892382 279
409 3300006847 Ga0075431_100082967 Ga0075431_1000829672 279
410 3300006852 Ga0075433_10032543 Ga0075433_100325434 279
411 3300006881 Ga0068865_100122289 Ga0068865_1001222892 279
412 3300007076 Ga0075435_100026199 Ga0075435_1000261993 279
413 3300007076 Ga0075435_100121623 Ga0075435_1001216232 279
414 3300007265 Ga0099794_10001910 Ga0099794_100019107 279
415 3300009147 Ga0114129_10174002 Ga0114129_101740022 279
416 3300009147 Ga0114129_11014398 Ga0114129_110143982 279
417 3300013307 Ga0157372_10116018 Ga0157372_101160182 279
418 3300014325 Ga0163163_10541768 Ga0163163_105417682 279
419 3300025253 Ga0209677_100757 Ga0209677_1007573 279
420 3300025302 Ga0207426_1002409 Ga0207426_10024093 279
421 3300025885 Ga0207653_10014263 Ga0207653_100142632 279
422 3300025898 Ga0207692_10001933 Ga0207692_100019334 279
423 3300025910 Ga0207684_10387193 Ga0207684_103871931 279
424 3300025912 Ga0207707_10057329 Ga0207707_100573294 279
425 3300025915 Ga0207693_10007359 Ga0207693_100073595 279
426 3300025916 Ga0207663_10010822 Ga0207663_100108224 279
427 3300025917 Ga0207660_10469289 Ga0207660_104692892 279
428 3300025921 Ga0207652_10170220 Ga0207652_101702203 279
429 3300025922 Ga0207646_10431598 Ga0207646_104315982 279
430 3300025923 Ga0207681_10294011 Ga0207681_102940112 279
431 3300025926 Ga0207659_10168954 Ga0207659_101689543 279
432 3300025929 Ga0207664_10012334 Ga0207664_1001233412 279
433 3300025932 Ga0207690_10062447 Ga0207690_100624472 279
434 3300025939 Ga0207665_10014843 Ga0207665_100148438 279
435 3300025942 Ga0207689_10078711 Ga0207689_100787112 279
436 3300025972 Ga0207668_10190269 Ga0207668_101902692 279
437 3300026121 Ga0207683_10033761 Ga0207683_100337613 279
438 3300027671 Ga0209588_1035751 Ga0209588_10357512 279
439 3300028379 Ga0268266_10027900 Ga0268266_100279002 279
440 3300031548 Ga0307408_100485484 Ga0307408_1004854841 279
441 3300033180 Ga0307510_10017480 Ga0307510_100174809 279
442 3300039438 Ga0436360_0737618 Ga0436360_0737618_1837_2706 279
443 3300039447 Ga0436361_0496474 Ga0436361_0496474_5334_6203 279
444 3300039447 Ga0436361_0857818 Ga0436361_0857818_3629_4480 279
445 3300039453 Ga0436362_1154959 Ga0436362_1154959_602_1471 279
446 3300042128 Ga0450897_009266 Ga0450897_009266_50_898 279
447 3300042156 Ga0439446_0037075 Ga0439446_0037075_303_1151 279
448 3300046460 Ga0495638_0037407 Ga0495638_0037407_1219_2058 279
449 3300046648 Ga0495611_0150360 Ga0495611_0150360_169_1008 279
450 3300046665 Ga0495661_0218414 Ga0495661_0218414_13_852 279
451 3300047472 Ga0495686_0126967 Ga0495686_0126967_246_1085 279
452 3300048914 Ga0496111_0028232 Ga0496111_0028232_1081_1932 279
453 3300048916 Ga0496113_0121262 Ga0496113_0121262_98_964 279
454 3300048921 Ga0496118_0119089 Ga0496118_0119089_605_1444 279
455 3300048924 Ga0496121_0061883 Ga0496121_0061883_192_1031 279
456 3300048924 Ga0496121_0231457 Ga0496121_0231457_175_1041 279
457 3300048924 Ga0496121_0402545 Ga0496121_0402545_42_881 279
458 3300048929 Ga0496126_0141674 Ga0496126_0141674_22_867 279
459 3300048929 Ga0496126_0582869 Ga0496126_0582869_30_869 279
460 3300049744 Ga0501083_0357688 Ga0501083_0357688_84_932 279
461 3300050507 nmdc:mga05p37_190242_c1 nmdc:mga05p37_190242_c1_1484_2335 279
462 3300050509 nmdc:mga0qj67_30180_c1 nmdc:mga0qj67_30180_c1_367_1206 279
463 3300050512 nmdc:mga0n895_160319_c1 nmdc:mga0n895_160319_c1_1186_2025 279
464 3300050515 nmdc:mga0a205_517752_c1 nmdc:mga0a205_517752_c1_138_989 279
465 3300053087 Ga0500643_000114 Ga0500643_000114_35908_36747 279
466 3300053104 Ga0500556_0023415 Ga0500556_0023415_745_1584 279
467 3300053122 Ga0500608_168768 Ga0500608_168768_91_930 279
468 3300053177 Ga0500636_0129277 Ga0500636_0129277_503_1369 279
469 3300053737 Ga0500601_000202 Ga0500601_000202_5955_6794 279
470 3300061734 Ga0530510_0016583 Ga0530510_0016583_680_1528 279
471 iso_pu_bacteria 2513237141 2513894485 279
472 3300003215 JGI25153J46596_10001348 JGI25153J46596_1000134810 280
473 3300003215 JGI25153J46596_10005113 JGI25153J46596_100051131 280
474 3300003320 rootH2_10194050 rootH2_101940501 280
475 3300003323 rootH1_10218802 rootH1_102188022 280
476 3300003659 JGI25404J52841_10011848 JGI25404J52841_100118483 280
477 3300003762 Ga0055542_1007676 Ga0055542_10076763 280
478 3300003794 Ga0055531_10017327 Ga0055531_100173272 280
479 3300003911 JGI25405J52794_10022700 JGI25405J52794_100227001 280
480 3300005327 Ga0070658_10035994 Ga0070658_100359943 280
481 3300005327 Ga0070658_10092501 Ga0070658_100925013 280
482 3300005329 Ga0070683_100247212 Ga0070683_1002472122 280
483 3300005334 Ga0068869_100011695 Ga0068869_1000116955 280
484 3300005338 Ga0068868_100025028 Ga0068868_1000250285 280
485 3300005338 Ga0068868_100080433 Ga0068868_1000804334 280
486 3300005340 Ga0070689_100360228 Ga0070689_1003602281 280
487 3300005344 Ga0070661_100018105 Ga0070661_1000181053 280
488 3300005347 Ga0070668_100034971 Ga0070668_1000349714 280
489 3300005347 Ga0070668_100050372 Ga0070668_1000503724 280
490 3300005347 Ga0070668_100093700 Ga0070668_1000937002 280
491 3300005347 Ga0070668_100512617 Ga0070668_1005126171 280
492 3300005353 Ga0070669_100270370 Ga0070669_1002703701 280
493 3300005354 Ga0070675_100144007 Ga0070675_1001440072 280
494 3300005355 Ga0070671_100084323 Ga0070671_1000843232 280
495 3300005355 Ga0070671_100467827 Ga0070671_1004678271 280
496 3300005356 Ga0070674_100380114 Ga0070674_1003801141 280
497 3300005364 Ga0070673_100116694 Ga0070673_1001166942 280
498 3300005364 Ga0070673_100497786 Ga0070673_1004977861 280
499 3300005365 Ga0070688_100188968 Ga0070688_1001889681 280
500 3300005365 Ga0070688_100247229 Ga0070688_1002472292 280
501 3300005367 Ga0070667_100234682 Ga0070667_1002346822 280
502 3300005367 Ga0070667_100390250 Ga0070667_1003902502 280
503 3300005441 Ga0070700_100207291 Ga0070700_1002072911 280
504 3300005455 Ga0070663_100015862 Ga0070663_1000158628 280
505 3300005455 Ga0070663_100031284 Ga0070663_1000312844 280
506 3300005455 Ga0070663_100047543 Ga0070663_1000475435 280
507 3300005455 Ga0070663_100129979 Ga0070663_1001299792 280
508 3300005455 Ga0070663_100153088 Ga0070663_1001530883 280
509 3300005455 Ga0070663_100179236 Ga0070663_1001792362 280
510 3300005455 Ga0070663_100396955 Ga0070663_1003969551 280
511 3300005456 Ga0070678_100040466 Ga0070678_1000404663 280
512 3300005459 Ga0068867_100134850 Ga0068867_1001348503 280
513 3300005466 Ga0070685_10015586 Ga0070685_100155864 280
514 3300005535 Ga0070684_100132544 Ga0070684_1001325442 280
515 3300005536 Ga0070697_100191014 Ga0070697_1001910142 280
516 3300005539 Ga0068853_100053977 Ga0068853_1000539771 280
517 3300005539 Ga0068853_100115324 Ga0068853_1001153244 280
518 3300005539 Ga0068853_100151042 Ga0068853_1001510423 280
519 3300005539 Ga0068853_100268674 Ga0068853_1002686741 280
520 3300005543 Ga0070672_100108422 Ga0070672_1001084223 280
521 3300005545 Ga0070695_100000851 Ga0070695_10000085113 280
522 3300005548 Ga0070665_100011644 Ga0070665_1000116448 280
523 3300005548 Ga0070665_100015331 Ga0070665_1000153317 280
524 3300005548 Ga0070665_100064243 Ga0070665_1000642437 280
525 3300005548 Ga0070665_100093475 Ga0070665_1000934754 280
526 3300005548 Ga0070665_100278819 Ga0070665_1002788191 280
527 3300005549 Ga0070704_100603643 Ga0070704_1006036431 280
528 3300005563 Ga0068855_100139627 Ga0068855_1001396272 280
529 3300005563 Ga0068855_100140841 Ga0068855_1001408411 280
530 3300005564 Ga0070664_100074858 Ga0070664_1000748582 280
531 3300005564 Ga0070664_100114539 Ga0070664_1001145392 280
532 3300005577 Ga0068857_100768090 Ga0068857_1007680901 280
533 3300005617 Ga0068859_100116234 Ga0068859_1001162343 280
534 3300005617 Ga0068859_100334823 Ga0068859_1003348231 280
535 3300005618 Ga0068864_100083414 Ga0068864_1000834142 280
536 3300005719 Ga0068861_100094526 Ga0068861_1000945263 280
537 3300005719 Ga0068861_100235133 Ga0068861_1002351332 280
538 3300005841 Ga0068863_100153799 Ga0068863_1001537993 280
539 3300005841 Ga0068863_100186494 Ga0068863_1001864942 280
540 3300005842 Ga0068858_100034300 Ga0068858_1000343006 280
541 3300005842 Ga0068858_100049819 Ga0068858_1000498191 280
542 3300005842 Ga0068858_100088988 Ga0068858_1000889882 280
543 3300005842 Ga0068858_100191614 Ga0068858_1001916142 280
544 3300005843 Ga0068860_100009962 Ga0068860_1000099624 280
545 3300005844 Ga0068862_100155323 Ga0068862_1001553232 280
546 3300005844 Ga0068862_100440358 Ga0068862_1004403582 280
547 3300005844 Ga0068862_100468346 Ga0068862_1004683461 280
548 3300005937 Ga0081455_10005151 Ga0081455_1000515110 280
549 3300005937 Ga0081455_10012489 Ga0081455_100124895 280
550 3300005937 Ga0081455_10045635 Ga0081455_100456353 280
551 3300005981 Ga0081538_10010297 Ga0081538_100102974 280
552 3300005983 Ga0081540_1000373 Ga0081540_10003734 280
553 3300005983 Ga0081540_1000904 Ga0081540_100090431 280
554 3300005983 Ga0081540_1007774 Ga0081540_10077745 280
555 3300005983 Ga0081540_1010461 Ga0081540_10104614 280
556 3300005983 Ga0081540_1012806 Ga0081540_10128067 280
557 3300005983 Ga0081540_1021716 Ga0081540_10217165 280
558 3300005985 Ga0081539_10015306 Ga0081539_100153061 280
559 3300006038 Ga0075365_10009759 Ga0075365_100097598 280
560 3300006038 Ga0075365_10019345 Ga0075365_100193453 280
561 3300006038 Ga0075365_10037162 Ga0075365_100371621 280
562 3300006042 Ga0075368_10057946 Ga0075368_100579462 280
563 3300006042 Ga0075368_10065280 Ga0075368_100652802 280
564 3300006042 Ga0075368_10141845 Ga0075368_101418451 280
565 3300006051 Ga0075364_10081732 Ga0075364_100817321 280
566 3300006177 Ga0075362_10059855 Ga0075362_100598552 280
567 3300006178 Ga0075367_10070460 Ga0075367_100704602 280
568 3300006194 Ga0075427_10001634 Ga0075427_100016343 280
569 3300006195 Ga0075366_10055853 Ga0075366_100558532 280
570 3300006353 Ga0075370_10008406 Ga0075370_100084063 280
571 3300006353 Ga0075370_10024237 Ga0075370_100242375 280
572 3300006353 Ga0075370_10051867 Ga0075370_100518671 280
573 3300006353 Ga0075370_10076862 Ga0075370_100768623 280
574 3300006844 Ga0075428_100082182 Ga0075428_1000821823 280
575 3300006844 Ga0075428_100108421 Ga0075428_1001084212 280
576 3300006844 Ga0075428_100154086 Ga0075428_1001540863 280
577 3300006846 Ga0075430_100002329 Ga0075430_1000023294 280
578 3300006846 Ga0075430_100119211 Ga0075430_1001192111 280
579 3300006846 Ga0075430_100330088 Ga0075430_1003300881 280
580 3300006847 Ga0075431_100097653 Ga0075431_1000976535 280
581 3300006847 Ga0075431_100498710 Ga0075431_1004987101 280
582 3300006852 Ga0075433_10002467 Ga0075433_1000246720 280
583 3300006852 Ga0075433_10024444 Ga0075433_100244443 280
584 3300006871 Ga0075434_100031382 Ga0075434_1000313824 280
585 3300006871 Ga0075434_100137186 Ga0075434_1001371862 280
586 3300006880 Ga0075429_100074856 Ga0075429_1000748565 280
587 3300006931 Ga0097620_100116231 Ga0097620_1001162313 280
588 3300006931 Ga0097620_100334836 Ga0097620_1003348362 280
589 3300006941 Ga0099825_1024499 Ga0099825_10244993 280
590 3300006941 Ga0099825_1039920 Ga0099825_10399202 280
591 3300006942 Ga0099824_1016075 Ga0099824_10160754 280
592 3300006942 Ga0099824_1022540 Ga0099824_10225401 280
593 3300006943 Ga0099822_1005361 Ga0099822_100536116 280
594 3300006943 Ga0099822_1033954 Ga0099822_10339545 280
595 3300006944 Ga0099823_1038759 Ga0099823_10387592 280
596 3300007076 Ga0075435_100029267 Ga0075435_1000292677 280
597 3300007076 Ga0075435_100247987 Ga0075435_1002479871 280
598 3300007788 Ga0099795_10007092 Ga0099795_100070923 280
599 3300009093 Ga0105240_10133696 Ga0105240_101336964 280
600 3300009093 Ga0105240_10481126 Ga0105240_104811262 280
601 3300009094 Ga0111539_10004711 Ga0111539_100047113 280
602 3300009094 Ga0111539_10113788 Ga0111539_101137883 280
603 3300009098 Ga0105245_10551295 Ga0105245_105512952 280
604 3300009101 Ga0105247_10137399 Ga0105247_101373992 280
605 3300009147 Ga0114129_10065176 Ga0114129_100651761 280
606 3300009147 Ga0114129_10097158 Ga0114129_100971586 280
607 3300009147 Ga0114129_10103217 Ga0114129_101032175 280
608 3300009147 Ga0114129_10122946 Ga0114129_101229464 280
609 3300009148 Ga0105243_10170425 Ga0105243_101704253 280
610 3300009174 Ga0105241_10022328 Ga0105241_100223287 280
611 3300009174 Ga0105241_10075397 Ga0105241_100753975 280
612 3300009176 Ga0105242_10275223 Ga0105242_102752231 280
613 3300009177 Ga0105248_10025654 Ga0105248_100256542 280
614 3300009177 Ga0105248_10239373 Ga0105248_102393732 280
615 3300009177 Ga0105248_10504104 Ga0105248_105041042 280
616 3300009177 Ga0105248_10600592 Ga0105248_106005922 280
617 3300009177 Ga0105248_10721903 Ga0105248_107219031 280
618 3300009545 Ga0105237_10001286 Ga0105237_1000128632 280
619 3300009545 Ga0105237_10121414 Ga0105237_101214143 280
620 3300009545 Ga0105237_10308261 Ga0105237_103082612 280
621 3300009551 Ga0105238_10092006 Ga0105238_100920061 280
622 3300009553 Ga0105249_10282304 Ga0105249_102823041 280
623 3300010375 Ga0105239_10031496 Ga0105239_100314966 280
624 3300010375 Ga0105239_10045785 Ga0105239_100457855 280
625 3300010375 Ga0105239_10202408 Ga0105239_102024082 280
626 3300010375 Ga0105239_10613861 Ga0105239_106138612 280
627 3300010375 Ga0105239_11156499 Ga0105239_111564991 280
628 3300011119 Ga0105246_10022531 Ga0105246_100225313 280
629 3300013296 Ga0157374_10441597 Ga0157374_104415971 280
630 3300013297 Ga0157378_10018279 Ga0157378_100182792 280
631 3300013306 Ga0163162_10233446 Ga0163162_102334462 280
632 3300013308 Ga0157375_10047706 Ga0157375_100477067 280
633 3300013308 Ga0157375_10056271 Ga0157375_100562713 280
634 3300014325 Ga0163163_10041823 Ga0163163_100418238 280
635 3300014325 Ga0163163_10450467 Ga0163163_104504671 280
636 3300014326 Ga0157380_10079993 Ga0157380_100799933 280
637 3300014968 Ga0157379_10187769 Ga0157379_101877693 280
638 3300014968 Ga0157379_10198000 Ga0157379_101980003 280
639 3300014968 Ga0157379_10200872 Ga0157379_102008721 280
640 3300014969 Ga0157376_10411975 Ga0157376_104119752 280
641 3300017792 Ga0163161_10076433 Ga0163161_100764332 280
642 3300017792 Ga0163161_10240794 Ga0163161_102407941 280
643 3300021320 Ga0214544_1000006 Ga0214544_100000697 280
644 3300021321 Ga0214542_1000002 Ga0214542_1000002279 280
645 3300021324 Ga0214545_1000002 Ga0214545_1000002440 280
646 3300021327 Ga0214543_1000017 Ga0214543_100001744 280
647 3300025230 Ga0209563_100471 Ga0209563_1004718 280
648 3300025253 Ga0209677_108436 Ga0209677_1084362 280
649 3300025297 Ga0209758_1000216 Ga0209758_100021637 280
650 3300025297 Ga0209758_1005195 Ga0209758_100519512 280
651 3300025302 Ga0207426_1006600 Ga0207426_10066006 280
652 3300025302 Ga0207426_1034113 Ga0207426_10341132 280
653 3300025304 Ga0209257_1001462 Ga0209257_100146212 280
654 3300025315 Ga0207697_10053457 Ga0207697_100534572 280
655 3300025899 Ga0207642_10156537 Ga0207642_101565371 280
656 3300025900 Ga0207710_10020192 Ga0207710_100201921 280
657 3300025900 Ga0207710_10123374 Ga0207710_101233741 280
658 3300025901 Ga0207688_10027476 Ga0207688_100274762 280
659 3300025903 Ga0207680_10287248 Ga0207680_102872481 280
660 3300025904 Ga0207647_10081907 Ga0207647_100819072 280
661 3300025909 Ga0207705_10025430 Ga0207705_100254304 280
662 3300025911 Ga0207654_10065552 Ga0207654_100655523 280
663 3300025913 Ga0207695_10000342 Ga0207695_100003424 280
664 3300025914 Ga0207671_10003865 Ga0207671_1000386510 280
665 3300025914 Ga0207671_10048284 Ga0207671_100482842 280
666 3300025914 Ga0207671_10276970 Ga0207671_102769702 280
667 3300025914 Ga0207671_10380243 Ga0207671_103802431 280
668 3300025918 Ga0207662_10122803 Ga0207662_101228032 280
669 3300025920 Ga0207649_10010842 Ga0207649_100108425 280
670 3300025923 Ga0207681_10141929 Ga0207681_101419293 280
671 3300025923 Ga0207681_10533665 Ga0207681_105336651 280
672 3300025924 Ga0207694_10136289 Ga0207694_101362891 280
673 3300025924 Ga0207694_10172060 Ga0207694_101720602 280
674 3300025927 Ga0207687_10081618 Ga0207687_100816182 280
675 3300025931 Ga0207644_10302496 Ga0207644_103024962 280
676 3300025933 Ga0207706_10024495 Ga0207706_100244954 280
677 3300025933 Ga0207706_10121570 Ga0207706_101215702 280
678 3300025936 Ga0207670_10113344 Ga0207670_101133442 280
679 3300025936 Ga0207670_10386086 Ga0207670_103860861 280
680 3300025936 Ga0207670_10390743 Ga0207670_103907432 280
681 3300025940 Ga0207691_10133599 Ga0207691_101335992 280
682 3300025941 Ga0207711_10072116 Ga0207711_100721161 280
683 3300025941 Ga0207711_10307545 Ga0207711_103075451 280
684 3300025941 Ga0207711_10457356 Ga0207711_104573561 280
685 3300025942 Ga0207689_10002811 Ga0207689_1000281116 280
686 3300025942 Ga0207689_10056696 Ga0207689_100566964 280
687 3300025944 Ga0207661_10432011 Ga0207661_104320112 280
688 3300025960 Ga0207651_10182020 Ga0207651_101820202 280
689 3300025961 Ga0207712_10114698 Ga0207712_101146982 280
690 3300025961 Ga0207712_10157922 Ga0207712_101579222 280
691 3300025961 Ga0207712_10347826 Ga0207712_103478261 280
692 3300025972 Ga0207668_10100003 Ga0207668_101000033 280
693 3300025972 Ga0207668_10175145 Ga0207668_101751452 280
694 3300025972 Ga0207668_10203020 Ga0207668_102030201 280
695 3300025972 Ga0207668_10391802 Ga0207668_103918021 280
696 3300025972 Ga0207668_10414000 Ga0207668_104140002 280
697 3300025981 Ga0207640_10087828 Ga0207640_100878281 280
698 3300026023 Ga0207677_10089401 Ga0207677_100894014 280
699 3300026023 Ga0207677_10110273 Ga0207677_101102732 280
700 3300026035 Ga0207703_10132767 Ga0207703_101327674 280
701 3300026035 Ga0207703_10168877 Ga0207703_101688773 280
702 3300026067 Ga0207678_10016327 Ga0207678_100163278 280
703 3300026067 Ga0207678_10023742 Ga0207678_100237423 280
704 3300026067 Ga0207678_10044292 Ga0207678_100442923 280
705 3300026067 Ga0207678_10054649 Ga0207678_100546491 280
706 3300026067 Ga0207678_10054664 Ga0207678_100546643 280
707 3300026067 Ga0207678_10070409 Ga0207678_100704092 280
708 3300026075 Ga0207708_10068790 Ga0207708_100687902 280
709 3300026088 Ga0207641_10094128 Ga0207641_100941284 280
710 3300026088 Ga0207641_10298532 Ga0207641_102985322 280
711 3300026089 Ga0207648_10198539 Ga0207648_101985392 280
712 3300026095 Ga0207676_10072722 Ga0207676_100727223 280
713 3300026095 Ga0207676_10143852 Ga0207676_101438521 280
714 3300026116 Ga0207674_10071136 Ga0207674_100711362 280
715 3300026118 Ga0207675_100008275 Ga0207675_1000082759 280
716 3300026118 Ga0207675_100081999 Ga0207675_1000819992 280
717 3300026118 Ga0207675_100244883 Ga0207675_1002448832 280
718 3300026121 Ga0207683_10018799 Ga0207683_100187997 280
719 3300026142 Ga0207698_10815684 Ga0207698_108156841 280
720 3300027296 Ga0209389_1000196 Ga0209389_10001963 280
721 3300027296 Ga0209389_1000284 Ga0209389_100028430 280
722 3300027357 Ga0209589_1000006 Ga0209589_1000006397 280
723 3300027357 Ga0209589_1001029 Ga0209589_10010293 280
724 3300027361 Ga0209489_100007 Ga0209489_100007397 280
725 3300027361 Ga0209489_101824 Ga0209489_1018243 280
726 3300027361 Ga0209489_117016 Ga0209489_1170163 280
727 3300027363 Ga0209700_100008 Ga0209700_100008397 280
728 3300027363 Ga0209700_103273 Ga0209700_10327331 280
729 3300027671 Ga0209588_1030098 Ga0209588_10300982 280
730 3300027866 Ga0209813_10019693 Ga0209813_100196932 280
731 3300027866 Ga0209813_10034302 Ga0209813_100343021 280
732 3300027866 Ga0209813_10042184 Ga0209813_100421841 280
733 3300027907 Ga0207428_10003095 Ga0207428_1000309518 280
734 3300028379 Ga0268266_10000544 Ga0268266_1000054436 280
735 3300028379 Ga0268266_10001633 Ga0268266_100016339 280
736 3300028379 Ga0268266_10079594 Ga0268266_100795943 280
737 3300028379 Ga0268266_10213358 Ga0268266_102133581 280
738 3300028379 Ga0268266_10269456 Ga0268266_102694562 280
739 3300028380 Ga0268265_10048073 Ga0268265_100480735 280
740 3300028380 Ga0268265_10383668 Ga0268265_103836681 280
741 3300028381 Ga0268264_10037322 Ga0268264_100373221 280
742 3300028556 Ga0265337_1007475 Ga0265337_10074754 280
743 3300028563 Ga0265319_1002882 Ga0265319_10028824 280
744 3300028573 Ga0265334_10009925 Ga0265334_100099253 280
745 3300028577 Ga0265318_10013021 Ga0265318_100130214 280
746 3300028666 Ga0265336_10001981 Ga0265336_100019813 280
747 3300028786 Ga0307517_10228684 Ga0307517_102286842 280
748 3300028794 Ga0307515_10059588 Ga0307515_100595883 280
749 3300029957 Ga0265324_10003322 Ga0265324_100033227 280
750 3300031507 Ga0307509_10274011 Ga0307509_102740112 280
751 3300031730 Ga0307516_10144193 Ga0307516_101441932 280
752 3300031730 Ga0307516_10204159 Ga0307516_102041592 280
753 3300031824 Ga0307413_10038382 Ga0307413_100383823 280
754 3300031995 Ga0307409_100187443 Ga0307409_1001874432 280
755 3300032126 Ga0307415_100034576 Ga0307415_1000345763 280
756 3300033180 Ga0307510_10004428 Ga0307510_1000442814 280
757 3300033442 Ga0315911_1000010 Ga0315911_1000010129 280
758 3300035083 Ga0373926_0065719 Ga0373926_0065719_210_1058 280
759 3300035084 Ga0373928_0021744 Ga0373928_0021744_190_1032 280
760 3300035085 Ga0373929_0023510 Ga0373929_0023510_291_1133 280
761 3300035092 Ga0373952_0019731 Ga0373952_0019731_289_1131 280
762 3300035111 Ga0373923_0126224 Ga0373923_0126224_228_1070 280
763 3300035112 Ga0373932_0017972 Ga0373932_0017972_78_920 280
764 3300035112 Ga0373932_0047206 Ga0373932_0047206_289_1131 280
765 3300035114 Ga0373939_0138478 Ga0373939_0138478_23_865 280
766 3300035116 Ga0373945_0061371 Ga0373945_0061371_538_1386 280
767 3300035121 Ga0373960_0078200 Ga0373960_0078200_156_998 280
768 3300035170 Ga0373943_0012834 Ga0373943_0012834_1020_1862 280
769 3300035170 Ga0373943_0071923 Ga0373943_0071923_177_1025 280
770 3300035170 Ga0373943_0114119 Ga0373943_0114119_335_1177 280
771 3300035171 Ga0373946_0006617 Ga0373946_0006617_137_979 280
772 3300035172 Ga0373955_0152426 Ga0373955_0152426_398_1240 280
773 3300035241 Ga0373961_0012173 Ga0373961_0012173_1266_2108 280
774 3300035242 Ga0373962_0028315 Ga0373962_0028315_253_1095 280
775 3300035691 Ga0373931_0013520 Ga0373931_0013520_1243_2085 280
776 3300035692 Ga0373935_0052593 Ga0373935_0052593_1241_2083 280
777 3300035692 Ga0373935_0080948 Ga0373935_0080948_463_1305 280
778 3300035695 Ga0373927_0007128 Ga0373927_0007128_3305_4147 280
779 3300035695 Ga0373927_0048146 Ga0373927_0048146_1776_2618 280
780 3300035724 Ga0373933_0038204 Ga0373933_0038204_495_1337 280
781 3300035725 Ga0373947_0007402 Ga0373947_0007402_5166_6008 280
782 3300035725 Ga0373947_0055264 Ga0373947_0055264_1467_2309 280
783 3300035725 Ga0373947_0069905 Ga0373947_0069905_651_1499 280
784 3300036401 Ga0373937_0376498 Ga0373937_0376498_28_870 280
785 3300037068 Ga0373925_0067599 Ga0373925_0067599_1153_2001 280
786 3300037068 Ga0373925_0116895 Ga0373925_0116895_72_914 280
787 3300037471 Ga0395905_0124921 Ga0395905_0124921_66_935 280
788 3300037471 Ga0395905_0160393 Ga0395905_0160393_347_1189 280
789 3300041413 Ga0439465_0078545 Ga0439465_0078545_195_1070 280
790 3300041486 Ga0451807_2471553 Ga0451807_2471553_30_872 280
791 3300044658 Ga0466972_0068802 Ga0466972_0068802_503_1378 280
792 3300044658 Ga0466972_0114728 Ga0466972_0114728_344_1219 280
793 3300044693 Ga0466961_0271468 Ga0466961_0271468_24_866 280
794 3300045049 Ga0466959_0246904 Ga0466959_0246904_46_888 280
795 3300045976 Ga0466967_0013831 Ga0466967_0013831_5061_5903 280
796 3300046452 Ga0495617_004300 Ga0495617_004300_3636_4478 280
797 3300046452 Ga0495617_056880 Ga0495617_056880_190_1032 280
798 3300046454 Ga0495592_0027994 Ga0495592_0027994_641_1483 280
799 3300046455 Ga0495603_0002549 Ga0495603_0002549_6289_7131 280
800 3300046455 Ga0495603_0031784 Ga0495603_0031784_378_1382 280
801 3300046455 Ga0495603_0045565 Ga0495603_0045565_1563_2405 280
802 3300046459 Ga0495629_0004300 Ga0495629_0004300_6496_7338 280
803 3300046459 Ga0495629_0005021 Ga0495629_0005021_4517_5359 280
804 3300046460 Ga0495638_0035509 Ga0495638_0035509_2121_2963 280
805 3300046472 Ga0495580_0041029 Ga0495580_0041029_997_1839 280
806 3300046474 Ga0495605_0072932 Ga0495605_0072932_300_1142 280
807 3300046475 Ga0495639_0004473 Ga0495639_0004473_4412_5254 280
808 3300046475 Ga0495639_0095316 Ga0495639_0095316_145_987 280
809 3300046475 Ga0495639_0176879 Ga0495639_0176879_11_853 280
810 3300046476 Ga0495662_0012054 Ga0495662_0012054_202_1044 280
811 3300046477 Ga0495664_0009734 Ga0495664_0009734_3281_4123 280
812 3300046477 Ga0495664_0132492 Ga0495664_0132492_609_1451 280
813 3300046492 Ga0495585_0079024 Ga0495585_0079024_390_1232 280
814 3300046492 Ga0495585_0155111 Ga0495585_0155111_55_897 280
815 3300046492 Ga0495585_0175457 Ga0495585_0175457_62_904 280
816 3300046499 Ga0495594_0010444 Ga0495594_0010444_274_1116 280
817 3300046499 Ga0495594_0023889 Ga0495594_0023889_2058_2900 280
818 3300046501 Ga0495607_0149066 Ga0495607_0149066_52_960 280
819 3300046507 Ga0495606_0038752 Ga0495606_0038752_560_1402 280
820 3300046513 Ga0495616_0144378 Ga0495616_0144378_130_972 280
821 3300046514 Ga0495618_0025545 Ga0495618_0025545_2236_3078 280
822 3300046516 Ga0495628_0091771 Ga0495628_0091771_951_1793 280
823 3300046516 Ga0495628_0137156 Ga0495628_0137156_521_1363 280
824 3300046522 Ga0495643_0081618 Ga0495643_0081618_641_1483 280
825 3300046523 Ga0495644_0024670 Ga0495644_0024670_337_1179 280
826 3300046525 Ga0495663_0068741 Ga0495663_0068741_152_1018 280
827 3300046526 Ga0495666_0043604 Ga0495666_0043604_739_1581 280
828 3300046531 Ga0495665_0026950 Ga0495665_0026950_279_1121 280
829 3300046533 Ga0495640_0023620 Ga0495640_0023620_2693_3535 280
830 3300046533 Ga0495640_0040831 Ga0495640_0040831_1744_2586 280
831 3300046537 Ga0495598_0013894 Ga0495598_0013894_163_1005 280
832 3300046538 Ga0495609_0152860 Ga0495609_0152860_80_922 280
833 3300046539 Ga0495621_0050282 Ga0495621_0050282_32_874 280
834 3300046542 Ga0495597_0025896 Ga0495597_0025896_1402_2244 280
835 3300046559 Ga0495667_0035623 Ga0495667_0035623_1445_2287 280
836 3300046615 Ga0495656_0002595 Ga0495656_0002595_3129_3971 280
837 3300046642 Ga0495634_0012735 Ga0495634_0012735_1912_2754 280
838 3300046660 Ga0495625_0009575 Ga0495625_0009575_2163_3005 280
839 3300046660 Ga0495625_0048587 Ga0495625_0048587_269_1111 280
840 3300046660 Ga0495625_0121291 Ga0495625_0121291_638_1480 280
841 3300046660 Ga0495625_0317169 Ga0495625_0317169_31_873 280
842 3300046663 Ga0495635_0005943 Ga0495635_0005943_2694_3536 280
843 3300046663 Ga0495635_0085160 Ga0495635_0085160_1144_1986 280
844 3300046664 Ga0495659_0008078 Ga0495659_0008078_411_1253 280
845 3300046674 Ga0495588_0025133 Ga0495588_0025133_738_1580 280
846 3300046674 Ga0495588_0103725 Ga0495588_0103725_481_1323 280
847 3300046674 Ga0495588_0154253 Ga0495588_0154253_70_966 280
848 3300046675 Ga0495657_0041743 Ga0495657_0041743_1387_2229 280
849 3300046680 Ga0495646_0139351 Ga0495646_0139351_211_1053 280
850 3300046681 Ga0495647_0003332 Ga0495647_0003332_981_1823 280
851 3300046681 Ga0495647_0047611 Ga0495647_0047611_318_1160 280
852 3300046683 Ga0495658_0017021 Ga0495658_0017021_637_1479 280
853 3300046683 Ga0495658_0091052 Ga0495658_0091052_634_1476 280
854 3300046683 Ga0495658_0135977 Ga0495658_0135977_387_1229 280
855 3300046689 Ga0495613_0060267 Ga0495613_0060267_671_1513 280
856 3300046689 Ga0495613_0098560 Ga0495613_0098560_582_1424 280
857 3300046690 Ga0495624_0003239 Ga0495624_0003239_6926_7768 280
858 3300046694 Ga0495649_0004412 Ga0495649_0004412_2657_3499 280
859 3300046809 Ga0495600_0029114 Ga0495600_0029114_771_1613 280
860 3300047315 Ga0495581_0002498 Ga0495581_0002498_4392_5234 280
861 3300047317 Ga0495604_0102779 Ga0495604_0102779_1082_1924 280
862 3300047318 Ga0495636_0056022 Ga0495636_0056022_573_1415 280
863 3300047319 Ga0495674_0031540 Ga0495674_0031540_1062_1904 280
864 3300047320 Ga0495672_0058508 Ga0495672_0058508_887_1729 280
865 3300047321 Ga0495676_0015378 Ga0495676_0015378_2024_2866 280
866 3300047323 Ga0495683_0109795 Ga0495683_0109795_90_932 280
867 3300047323 Ga0495683_0134017 Ga0495683_0134017_225_1067 280
868 3300047472 Ga0495686_0047811 Ga0495686_0047811_626_1468 280
869 3300047673 Ga0495593_0000942 Ga0495593_0000942_12293_13135 280
870 3300048089 Ga0495614_0110194 Ga0495614_0110194_104_946 280
871 3300048090 Ga0495615_0031144 Ga0495615_0031144_392_1234 280
872 3300048090 Ga0495615_0067856 Ga0495615_0067856_47_889 280
873 3300048903 Ga0496100_0332759 Ga0496100_0332759_176_1018 280
874 3300048904 Ga0496101_0090953 Ga0496101_0090953_140_982 280
875 3300048904 Ga0496101_0228021 Ga0496101_0228021_278_1120 280
876 3300048905 Ga0496102_0012884 Ga0496102_0012884_5909_6751 280
877 3300048905 Ga0496102_0102199 Ga0496102_0102199_775_1617 280
878 3300048905 Ga0496102_0250623 Ga0496102_0250623_448_1290 280
879 3300048905 Ga0496102_0362380 Ga0496102_0362380_463_1305 280
880 3300048906 Ga0496103_0074034 Ga0496103_0074034_777_1619 280
881 3300048907 Ga0496104_0058187 Ga0496104_0058187_1722_2564 280
882 3300048907 Ga0496104_0302932 Ga0496104_0302932_610_1452 280
883 3300048907 Ga0496104_0339954 Ga0496104_0339954_10_852 280
884 3300048908 Ga0496105_0018517 Ga0496105_0018517_3806_4648 280
885 3300048908 Ga0496105_0225750 Ga0496105_0225750_98_940 280
886 3300048908 Ga0496105_0379562 Ga0496105_0379562_45_887 280
887 3300048909 Ga0496106_0494849 Ga0496106_0494849_107_949 280
888 3300048910 Ga0496107_0212560 Ga0496107_0212560_436_1278 280
889 3300048911 Ga0496108_0203309 Ga0496108_0203309_806_1648 280
890 3300048912 Ga0496109_0306471 Ga0496109_0306471_388_1230 280
891 3300048913 Ga0496110_0009234 Ga0496110_0009234_6315_7157 280
892 3300048913 Ga0496110_0046873 Ga0496110_0046873_2354_3196 280
893 3300048914 Ga0496111_0071062 Ga0496111_0071062_1018_1860 280
894 3300048915 Ga0496112_0071722 Ga0496112_0071722_14_856 280
895 3300048915 Ga0496112_0073248 Ga0496112_0073248_1014_1856 280
896 3300048915 Ga0496112_0144283 Ga0496112_0144283_68_910 280
897 3300048916 Ga0496113_0029907 Ga0496113_0029907_1793_2635 280
898 3300048916 Ga0496113_0216416 Ga0496113_0216416_285_1127 280
899 3300048917 Ga0496114_0073481 Ga0496114_0073481_196_1038 280
900 3300048917 Ga0496114_0172047 Ga0496114_0172047_382_1224 280
901 3300048918 Ga0496115_0054272 Ga0496115_0054272_893_1735 280
902 3300048918 Ga0496115_0095660 Ga0496115_0095660_719_1561 280
903 3300048918 Ga0496115_0110292 Ga0496115_0110292_920_1762 280
904 3300048918 Ga0496115_0152102 Ga0496115_0152102_588_1430 280
905 3300048919 Ga0496116_0076727 Ga0496116_0076727_470_1312 280
906 3300048921 Ga0496118_0121408 Ga0496118_0121408_30_974 280
907 3300048922 Ga0496119_0024691 Ga0496119_0024691_1427_2269 280
908 3300048922 Ga0496119_0192969 Ga0496119_0192969_142_984 280
909 3300048923 Ga0496120_0030655 Ga0496120_0030655_573_1415 280
910 3300048924 Ga0496121_0015817 Ga0496121_0015817_4053_4895 280
911 3300048924 Ga0496121_0018938 Ga0496121_0018938_128_1072 280
912 3300048924 Ga0496121_0044500 Ga0496121_0044500_1994_2836 280
913 3300048924 Ga0496121_0228380 Ga0496121_0228380_384_1253 280
914 3300048924 Ga0496121_0339662 Ga0496121_0339662_150_992 280
915 3300048927 Ga0496124_0008072 Ga0496124_0008072_620_1564 280
916 3300048927 Ga0496124_0078139 Ga0496124_0078139_1785_2627 280
917 3300048927 Ga0496124_0113175 Ga0496124_0113175_582_1424 280
918 3300048928 Ga0496125_0064169 Ga0496125_0064169_600_1442 280
919 3300048928 Ga0496125_0101569 Ga0496125_0101569_650_1492 280
920 3300048928 Ga0496125_0128971 Ga0496125_0128971_283_1125 280
921 3300048929 Ga0496126_0002447 Ga0496126_0002447_15055_15897 280
922 3300048929 Ga0496126_0021927 Ga0496126_0021927_1515_2390 280
923 3300048929 Ga0496126_0043210 Ga0496126_0043210_174_1016 280
924 3300048929 Ga0496126_0129359 Ga0496126_0129359_1208_2152 280
925 3300048929 Ga0496126_0141788 Ga0496126_0141788_285_1151 280
926 3300048929 Ga0496126_0158676 Ga0496126_0158676_27_869 280
927 3300048929 Ga0496126_0162654 Ga0496126_0162654_297_1139 280
928 3300049575 Ga0501039_0454496 Ga0501039_0454496_18_869 280
929 3300049743 Ga0501081_0128703 Ga0501081_0128703_406_1257 280
930 3300049824 Ga0501045_0068998 Ga0501045_0068998_1246_2097 280
931 3300050490 nmdc:mga03n38_88327_c1 nmdc:mga03n38_88327_c1_10_852 280
932 3300050491 nmdc:mga00v17_134587_c1 nmdc:mga00v17_134587_c1_200_1042 280
933 3300050492 nmdc:mga0yw44_26825_c1 nmdc:mga0yw44_26825_c1_121_963 280
934 3300050492 nmdc:mga0yw44_63600_c1 nmdc:mga0yw44_63600_c1_44_1039 280
935 3300050492 nmdc:mga0yw44_86331_c1 nmdc:mga0yw44_86331_c1_186_1028 280
936 3300050494 nmdc:mga06z11_27833_c1 nmdc:mga06z11_27833_c1_1842_2684 280
937 3300050494 nmdc:mga06z11_48054_c1 nmdc:mga06z11_48054_c1_619_1461 280
938 3300050495 nmdc:mga04h51_92630_c1 nmdc:mga04h51_92630_c1_87_929 280
939 3300050496 nmdc:mga07m45_17287_c1 nmdc:mga07m45_17287_c1_1582_2592 280
940 3300050496 nmdc:mga07m45_23241_c1 nmdc:mga07m45_23241_c1_949_1791 280
941 3300050496 nmdc:mga07m45_3901_c1 nmdc:mga07m45_3901_c1_3176_4018 280
942 3300050507 nmdc:mga05p37_5331_c1 nmdc:mga05p37_5331_c1_996_1838 280
943 3300050508 nmdc:mga09592_30838_c1 nmdc:mga09592_30838_c1_2315_3157 280
944 3300050509 nmdc:mga0qj67_48398_c1 nmdc:mga0qj67_48398_c1_1250_2092 280
945 3300050510 nmdc:mga06r32_320092_c1 nmdc:mga06r32_320092_c1_394_1236 280
946 3300050510 nmdc:mga06r32_487812_c1 nmdc:mga06r32_487812_c1_330_1172 280
947 3300050511 nmdc:mga08y16_308916_c1 nmdc:mga08y16_308916_c1_630_1472 280
948 3300050511 nmdc:mga08y16_34711_c1 nmdc:mga08y16_34711_c1_4029_4871 280
949 3300050512 nmdc:mga0n895_167823_c1 nmdc:mga0n895_167823_c1_1293_2135 280
950 3300050515 nmdc:mga0a205_10385_c1 nmdc:mga0a205_10385_c1_3435_4277 280
951 3300050515 nmdc:mga0a205_6427_c1 nmdc:mga0a205_6427_c1_8625_9467 280
952 3300050516 nmdc:mga0sz30_43035_c1 nmdc:mga0sz30_43035_c1_497_1339 280
953 3300053077 Ga0495601_0035361 Ga0495601_0035361_968_1810 280
954 3300053077 Ga0495601_0093556 Ga0495601_0093556_543_1391 280
955 3300053085 Ga0495619_0005502 Ga0495619_0005502_4988_5830 280
956 3300053086 Ga0500578_0081033 Ga0500578_0081033_1085_1927 280
957 3300053087 Ga0500643_076630 Ga0500643_076630_27_869 280
958 3300053094 Ga0500566_0001448 Ga0500566_0001448_4648_5490 280
959 3300053096 Ga0500641_0118170 Ga0500641_0118170_28_870 280
960 3300053105 Ga0500557_000001 Ga0500557_000001_231885_232727 280
961 3300053119 Ga0500595_002799 Ga0500595_002799_5918_6760 280
962 3300053119 Ga0500595_010510 Ga0500595_010510_2553_3395 280
963 3300053130 Ga0500642_0000240 Ga0500642_0000240_13375_14217 280
964 3300053148 Ga0500590_013608 Ga0500590_013608_3104_3946 280
965 3300053148 Ga0500590_126025 Ga0500590_126025_195_1037 280
966 3300053177 Ga0500636_0145011 Ga0500636_0145011_184_1026 280
967 3300053729 Ga0500625_006844 Ga0500625_006844_3977_4819 280
968 3300053730 Ga0500645_008456 Ga0500645_008456_1419_2360 280
969 3300053732 Ga0500656_004287 Ga0500656_004287_40_882 280
970 3300054114 Ga0501084_0163282 Ga0501084_0163282_708_1559 280
971 3300055283 Ga0500661_008088 Ga0500661_008088_52_894 280
972 3300061734 Ga0530510_0219456 Ga0530510_0219456_295_1146 280
973 iso_pu_bacteria 2513237098 2513673450 280
974 iso_pu_bacteria 2513237102 2513703841 280
975 iso_pu_bacteria 2513237137 2513861074 280
976 iso_pu_bacteria 2513237139 2513875763 280
977 iso_pu_bacteria 2513237161 2514016199 280
978 iso_pu_bacteria 2617270735 2617349184 280
979 iso_pu_bacteria 2824671348 2824672766 280
980 iso_pu_bacteria 2824687955 2824693416 280
981 iso_pu_bacteria 2838122688 2838130623 280
982 iso_pu_bacteria 2841941048 2841941143 280
983 iso_pu_bacteria 2841949485 2841957303 280
984 iso_pu_bacteria 2841966195 2841967297 280
985 iso_pu_bacteria 2841974524 2841979307 280
986 iso_pu_bacteria 2841983080 2841989782 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18014

Acetyltransf_18

Acetyltransferase (GNAT) domain

205

327

0.98

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

63

170

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

93

172

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ddd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution 0.8475 4 280
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.8365 44 118
5xxs-assembly1.cif.gz_A crystal structure of native ribt from bacillus subtilis 0.8135 44 100
3ddd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase (np_142035.1) from pyrococcus horikoshii at 2.25 a resolution 0.8134 4 280
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8113 4 122
ID Description Score Start End Superfamily
af_Q9NAR2_219_339_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8906 174 225 3.40.630.30
af_I1KMR4_18_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8779 44 93 3.40.630.30
af_I1MRQ6_38_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8779 44 93 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8708 44 122 3.40.630.30
af_Q9N5J3_186_300_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.8704 138 223 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A090D1U8-F1-model_v4 Acetyltransferase, GNAT family 0.9732 1 280 GO:0016747
AF-A0A2N1VL18-F1-model_v4 GNAT family N-acetyltransferase 0.9728 3 280 GO:0016747
AF-B3SBF2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9722 2 275 GO:0016747
AF-A0A7C7WKX4-F1-model_v4 GNAT family N-acetyltransferase 0.9721 9 280 GO:0016747
AF-A0A5B7V481-F1-model_v4 Acetyltransferase (GNAT) family protein 0.972 2 280 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map