F487526

General Info

Members Datasets Scaffolds Average Seq Length
986 373 983 282

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10050150|Ga0207669_100501501
Length 324
Sequence MGSNERNPIPTPALPLKGRGITSLLPSFPPSLIQNMQIFDIFLLEAILNGILLGGILALLALGLNLIFGVIDVVWICYAELIMIGMYAIFYLHVSYGWPLWLAFPCAVVVVAMLGLLLHQLVIRPVLAAEPINQLLVTGGVLFFLQGVATLAFGVEFKNLGVNLPPISLGEMQFSSARLVAFLAALGCMIGMYLFLTRTYLGTAIRAISQDRAIMPLMGVNPSRIFLITSALGGGLAGLASCLLVLQYDIHPAIGLSFGPITFLVCVLGGLGNMIGGFIAAFIFAQFISVGGFFLHLEWGYVLAFLFFIGFMFWRPRGLLGGKS

Samples

Sample ID Description Type Environment
1 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
2 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
3 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
238 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
239 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
240 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
245 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 4.06
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006501 3300003203 Bacteria 5377
2 JGI25406J46586_10011229 3300003203 Bacteria 3937
3 JGI26129J50193_1002204 3300003349 Bacteria 1366
4 Ga0065712_10030896 3300005290 Bacteria 1858
5 Ga0065715_10124256 3300005293 Bacteria 2158
6 Ga0065715_10157979 3300005293 Bacteria 1658
7 Ga0065707_10096354 3300005295 Bacteria 3275
8 Ga0065707_10119257 3300005295 Bacteria 2162
9 Ga0070676_10034437 3300005328 Bacteria 2908
10 Ga0070690_100067294 3300005330 Bacteria 2321
11 Ga0070690_100162427 3300005330 Bacteria 1532
12 Ga0070670_100356109 3300005331 Bacteria 1286
13 Ga0070677_10022862 3300005333 Bacteria 2308
14 Ga0068869_100002482 3300005334 Bacteria 11121
15 Ga0068869_100006166 3300005334 Bacteria 7591
16 Ga0068869_100015428 3300005334 Bacteria 5124
17 Ga0068869_100187717 3300005334 Bacteria 1624
18 Ga0068869_100349072 3300005334 Bacteria 1206
19 Ga0070680_100176034 3300005336 Bacteria 1801
20 Ga0070680_100259607 3300005336 Bacteria 1469
21 Ga0070682_100001528 3300005337 Bacteria 12962
22 Ga0068868_100002947 3300005338 Bacteria 11815
23 Ga0070689_100002038 3300005340 Bacteria 13107
24 Ga0070689_100156381 3300005340 Bacteria 1841
25 Ga0070691_10016926 3300005341 Bacteria 3353
26 Ga0070691_10017617 3300005341 Bacteria 3287
27 Ga0070691_10021810 3300005341 Bacteria 2967
28 Ga0070691_10028327 3300005341 Bacteria 2616
29 Ga0070691_10076194 3300005341 Bacteria 1635
30 Ga0070687_100000326 3300005343 Bacteria 16173
31 Ga0070687_100056298 3300005343 Bacteria 2057
32 Ga0070692_10008943 3300005345 Bacteria 4491
33 Ga0070692_10010920 3300005345 Bacteria 4155
34 Ga0070692_10070275 3300005345 Bacteria 1864
35 Ga0070692_10157985 3300005345 Bacteria 1296
36 Ga0070668_100027604 3300005347 Bacteria 4310
37 Ga0070668_100337000 3300005347 Bacteria 1273
38 Ga0070668_100359050 3300005347 Bacteria 1235
39 Ga0070669_100002984 3300005353 Bacteria 12193
40 Ga0070669_100382177 3300005353 Bacteria 1148
41 Ga0070669_100388179 3300005353 Bacteria 1140
42 Ga0070675_100179485 3300005354 Bacteria 1830
43 Ga0070675_100270406 3300005354 Bacteria 1491
44 Ga0070671_100204493 3300005355 Bacteria 1675
45 Ga0070671_100282518 3300005355 Bacteria 1412
46 Ga0070674_100028481 3300005356 Bacteria 3670
47 Ga0070674_100103882 3300005356 Bacteria 2075
48 Ga0070659_100096411 3300005366 Bacteria 2376
49 Ga0070709_10193076 3300005434 Bacteria 1438
50 Ga0070714_100050541 3300005435 Bacteria 3542
51 Ga0070714_100066078 3300005435 Bacteria 3117
52 Ga0070714_100526074 3300005435 Bacteria 1130
53 Ga0070713_100035581 3300005436 Bacteria 4010
54 Ga0070701_10005350 3300005438 Bacteria 5290
55 Ga0070701_10010591 3300005438 Bacteria 4084
56 Ga0070705_100000638 3300005440 Bacteria 20069
57 Ga0070705_100000671 3300005440 Bacteria 19567
58 Ga0070705_100016484 3300005440 Bacteria 3841
59 Ga0070705_100029720 3300005440 Bacteria 3010
60 Ga0070705_100152480 3300005440 Bacteria 1535
61 Ga0070705_100177207 3300005440 Bacteria 1440
62 Ga0070705_100193116 3300005440 Bacteria 1389
63 Ga0070705_100235746 3300005440 Bacteria 1276
64 Ga0070700_100000211 3300005441 Bacteria 32522
65 Ga0070700_100003296 3300005441 Bacteria 8326
66 Ga0070700_100011184 3300005441 Bacteria 4967
67 Ga0070700_100031792 3300005441 Bacteria 3166
68 Ga0070700_100205331 3300005441 Bacteria 1387
69 Ga0070694_100002732 3300005444 Bacteria 10466
70 Ga0070694_100003420 3300005444 Bacteria 9515
71 Ga0070694_100003723 3300005444 Bacteria 9094
72 Ga0070694_100003917 3300005444 Bacteria 8904
73 Ga0070694_100041452 3300005444 Bacteria 3072
74 Ga0070694_100051160 3300005444 Bacteria 2787
75 Ga0070694_100052666 3300005444 Bacteria 2752
76 Ga0070694_100114275 3300005444 Bacteria 1927
77 Ga0070694_100147170 3300005444 Bacteria 1717
78 Ga0070694_100174022 3300005444 Bacteria 1588
79 Ga0070708_100006158 3300005445 Bacteria 9543
80 Ga0070708_100026888 3300005445 Bacteria 4930
81 Ga0070708_100083951 3300005445 Bacteria 2889
82 Ga0070708_100238026 3300005445 Bacteria 1709
83 Ga0070708_100303382 3300005445 Bacteria 1504
84 Ga0070663_100256353 3300005455 Bacteria 1386
85 Ga0070678_100061326 3300005456 Bacteria 2771
86 Ga0070678_100254757 3300005456 Bacteria 1473
87 Ga0070662_100094058 3300005457 Bacteria 2256
88 Ga0070662_100201370 3300005457 Bacteria 1580
89 Ga0070681_10010518 3300005458 Bacteria 9136
90 Ga0070681_10021226 3300005458 Bacteria 6507
91 Ga0070681_10078253 3300005458 Bacteria 3264
92 Ga0070681_10108660 3300005458 Bacteria 2714
93 Ga0068867_100001335 3300005459 Bacteria 17077
94 Ga0068867_100003689 3300005459 Bacteria 10776
95 Ga0068867_100134456 3300005459 Bacteria 1926
96 Ga0068867_100165182 3300005459 Bacteria 1749
97 Ga0070706_100073844 3300005467 Bacteria 3157
98 Ga0070706_100078254 3300005467 Bacteria 3062
99 Ga0070707_100018938 3300005468 Bacteria 6483
100 Ga0070707_100037794 3300005468 Bacteria 4610
101 Ga0070707_100274545 3300005468 Bacteria 1639
102 Ga0070707_100317232 3300005468 Bacteria 1515
103 Ga0070698_100005791 3300005471 Bacteria 13518
104 Ga0070698_100137973 3300005471 Bacteria 2392
105 Ga0070699_100003010 3300005518 Bacteria 14968
106 Ga0070699_100006362 3300005518 Bacteria 10297
107 Ga0070699_100006895 3300005518 Bacteria 9881
108 Ga0070699_100042885 3300005518 Bacteria 3916
109 Ga0070699_100381209 3300005518 Bacteria 1273
110 Ga0070679_100064153 3300005530 Bacteria 3661
111 Ga0070679_100113499 3300005530 Bacteria 2695
112 Ga0070679_100202722 3300005530 Bacteria 1949
113 Ga0070679_100400224 3300005530 Bacteria 1319
114 Ga0070697_100001293 3300005536 Bacteria 18848
115 Ga0070697_100001434 3300005536 Bacteria 18124
116 Ga0070697_100005785 3300005536 Bacteria 9535
117 Ga0070697_100007886 3300005536 Bacteria 8297
118 Ga0070697_100008411 3300005536 Bacteria 8051
119 Ga0070697_100019057 3300005536 Bacteria 5415
120 Ga0070697_100072868 3300005536 Bacteria 2819
121 Ga0068853_100274211 3300005539 Bacteria 1554
122 Ga0070672_100083906 3300005543 Bacteria 2558
123 Ga0070672_100129583 3300005543 Bacteria 2072
124 Ga0070672_100254777 3300005543 Bacteria 1479
125 Ga0070686_100010234 3300005544 Bacteria 5280
126 Ga0070686_100173058 3300005544 Bacteria 1529
127 Ga0070686_100339895 3300005544 Bacteria 1125
128 Ga0070686_100459993 3300005544 Bacteria 980
129 Ga0070695_100000948 3300005545 Bacteria 15745
130 Ga0070695_100001721 3300005545 Bacteria 12312
131 Ga0070695_100002319 3300005545 Bacteria 10916
132 Ga0070695_100005573 3300005545 Bacteria 7415
133 Ga0070695_100022262 3300005545 Bacteria 3886
134 Ga0070695_100022535 3300005545 Bacteria 3864
135 Ga0070695_100027043 3300005545 Bacteria 3552
136 Ga0070695_100031558 3300005545 Bacteria 3306
137 Ga0070695_100086311 3300005545 Bacteria 2085
138 Ga0070696_100000012 3300005546 Bacteria 79388
139 Ga0070696_100002401 3300005546 Bacteria 12400
140 Ga0070696_100009167 3300005546 Bacteria 6624
141 Ga0070696_100044664 3300005546 Bacteria 3068
142 Ga0070696_100095717 3300005546 Bacteria 2121
143 Ga0070696_100126282 3300005546 Bacteria 1856
144 Ga0070696_100278221 3300005546 Bacteria 1275
145 Ga0070693_100000135 3300005547 Bacteria 33350
146 Ga0070693_100007379 3300005547 Bacteria 5372
147 Ga0070693_100128216 3300005547 Bacteria 1582
148 Ga0070693_100281037 3300005547 Bacteria 1115
149 Ga0070704_100000108 3300005549 Bacteria 28920
150 Ga0070704_100000193 3300005549 Bacteria 25011
151 Ga0070704_100029938 3300005549 Bacteria 3641
152 Ga0070704_100080648 3300005549 Bacteria 2394
153 Ga0070704_100169376 3300005549 Bacteria 1735
154 Ga0070704_100236196 3300005549 Bacteria 1494
155 Ga0070704_100277704 3300005549 Bacteria 1386
156 Ga0070704_100282099 3300005549 Bacteria 1377
157 Ga0070704_100393298 3300005549 Bacteria 1181
158 Ga0070704_100399480 3300005549 Bacteria 1172
159 Ga0068855_100063388 3300005563 Bacteria 4313
160 Ga0068855_100288486 3300005563 Bacteria 1820
161 Ga0070664_100138582 3300005564 Bacteria 2141
162 Ga0068857_100022542 3300005577 Bacteria 5541
163 Ga0068857_100359791 3300005577 Bacteria 1349
164 Ga0068857_100430073 3300005577 Bacteria 1232
165 Ga0068857_100740837 3300005577 Bacteria 936
166 Ga0068854_100001657 3300005578 Bacteria 13562
167 Ga0068854_100407247 3300005578 Bacteria 1127
168 Ga0068856_100332974 3300005614 Bacteria 1536
169 Ga0068859_100003978 3300005617 Bacteria 15080
170 Ga0068859_100006107 3300005617 Bacteria 12235
171 Ga0068859_100007972 3300005617 Bacteria 10743
172 Ga0068859_100021038 3300005617 Bacteria 6547
173 Ga0068859_100099270 3300005617 Bacteria 2967
174 Ga0068859_100383206 3300005617 Bacteria 1501
175 Ga0068859_100432520 3300005617 Bacteria 1412
176 Ga0068864_100149961 3300005618 Bacteria 2111
177 Ga0068864_100381014 3300005618 Bacteria 1337
178 Ga0068866_10009989 3300005718 Bacteria 4053
179 Ga0068861_100000173 3300005719 Bacteria 34168
180 Ga0068861_100019210 3300005719 Bacteria 4882
181 Ga0068861_100113605 3300005719 Bacteria 2173
182 Ga0068861_100131722 3300005719 Bacteria 2030
183 Ga0068861_100424200 3300005719 Bacteria 1186
184 Ga0068863_100126447 3300005841 Bacteria 2439
185 Ga0068858_100001425 3300005842 Bacteria 24575
186 Ga0068858_100136445 3300005842 Bacteria 2302
187 Ga0068858_100161059 3300005842 Bacteria 2113
188 Ga0068858_100228900 3300005842 Bacteria 1762
189 Ga0068860_100001885 3300005843 Bacteria 22275
190 Ga0068860_100060141 3300005843 Bacteria 3611
191 Ga0068860_100554582 3300005843 Bacteria 1152
192 Ga0068862_100000594 3300005844 Bacteria 37690
193 Ga0068862_100004236 3300005844 Bacteria 12153
194 Ga0081455_10000014 3300005937 Bacteria 193884
195 Ga0081455_10007461 3300005937 Bacteria 11516
196 Ga0081455_10017729 3300005937 Bacteria 6813
197 Ga0081538_10027411 3300005981 Bacteria 3950
198 Ga0081538_10048592 3300005981 Bacteria 2585
199 Ga0081540_1000035 3300005983 Bacteria 141244
200 Ga0081540_1000878 3300005983 Bacteria 27167
201 Ga0081539_10000462 3300005985 Bacteria 86060
202 Ga0081539_10001341 3300005985 Bacteria 42889
203 Ga0070717_10424093 3300006028 Bacteria 1197
204 Ga0070717_10463418 3300006028 Bacteria 1143
205 Ga0075365_10011758 3300006038 Bacteria 5162
206 Ga0075368_10003743 3300006042 Bacteria 5105
207 Ga0075368_10012309 3300006042 Bacteria 3124
208 Ga0075363_100030177 3300006048 Bacteria 2804
209 Ga0075363_100052945 3300006048 Bacteria 2167
210 Ga0075432_10041440 3300006058 Bacteria 1609
211 Ga0070715_10083343 3300006163 Bacteria 1456
212 Ga0070716_100078136 3300006173 Bacteria 1967
213 Ga0070716_100231393 3300006173 Bacteria 1248
214 Ga0070712_100006640 3300006175 Bacteria 7192
215 Ga0070712_100057102 3300006175 Bacteria 2741
216 Ga0075362_10078884 3300006177 Bacteria 1515
217 Ga0075367_10028637 3300006178 Bacteria 3179
218 Ga0075367_10040940 3300006178 Bacteria 2706
219 Ga0075367_10208319 3300006178 Bacteria 1222
220 Ga0097621_100000939 3300006237 Bacteria 20422
221 Ga0075370_10033514 3300006353 Bacteria 2876
222 Ga0068871_100000370 3300006358 Bacteria 31403
223 Ga0068871_100080962 3300006358 Bacteria 2689
224 Ga0075428_100000446 3300006844 Bacteria 41165
225 Ga0075428_100001232 3300006844 Bacteria 27372
226 Ga0075428_100009146 3300006844 Bacteria 10994
227 Ga0075428_100018652 3300006844 Bacteria 7669
228 Ga0075428_100019802 3300006844 Bacteria 7447
229 Ga0075428_100022052 3300006844 Bacteria 7050
230 Ga0075428_100044588 3300006844 Bacteria 4873
231 Ga0075428_100223503 3300006844 Bacteria 2033
232 Ga0075428_100535990 3300006844 Bacteria 1252
233 Ga0075428_100653210 3300006844 Bacteria 1121
234 Ga0075430_100006952 3300006846 Bacteria 9540
235 Ga0075430_100010982 3300006846 Bacteria 7671
236 Ga0075430_100048016 3300006846 Bacteria 3605
237 Ga0075430_100307408 3300006846 Bacteria 1311
238 Ga0075430_100349174 3300006846 Bacteria 1222
239 Ga0075431_100000586 3300006847 Bacteria 30900
240 Ga0075431_100002204 3300006847 Bacteria 18653
241 Ga0075431_100006333 3300006847 Bacteria 11758
242 Ga0075431_100023814 3300006847 Bacteria 6267
243 Ga0075431_100100743 3300006847 Bacteria 2981
244 Ga0075431_100150402 3300006847 Bacteria 2397
245 Ga0075431_100155138 3300006847 Bacteria 2356
246 Ga0075431_100204579 3300006847 Bacteria 2019
247 Ga0075433_10001281 3300006852 Bacteria 18351
248 Ga0075433_10006995 3300006852 Bacteria 8944
249 Ga0075433_10033836 3300006852 Bacteria 4384
250 Ga0075433_10119236 3300006852 Bacteria 2342
251 Ga0075434_100001574 3300006871 Bacteria 19334
252 Ga0075434_100002685 3300006871 Bacteria 15706
253 Ga0075434_100053555 3300006871 Bacteria 4009
254 Ga0075434_100082740 3300006871 Bacteria 3207
255 Ga0075434_100093341 3300006871 Bacteria 3013
256 Ga0075434_100104025 3300006871 Bacteria 2848
257 Ga0075434_100577052 3300006871 Bacteria 1144
258 Ga0075429_100000259 3300006880 Bacteria 36776
259 Ga0075429_100000922 3300006880 Bacteria 23290
260 Ga0075429_100002976 3300006880 Bacteria 14374
261 Ga0068865_100007455 3300006881 Bacteria 6733
262 Ga0068865_100017764 3300006881 Bacteria 4579
263 Ga0068865_100020281 3300006881 Bacteria 4311
264 Ga0075436_100001357 3300006914 Bacteria 16645
265 Ga0075436_100006485 3300006914 Bacteria 8017
266 Ga0075436_100142454 3300006914 Bacteria 1685
267 Ga0075436_100204923 3300006914 Bacteria 1397
268 Ga0075436_100210584 3300006914 Bacteria 1378
269 Ga0075436_100284425 3300006914 Bacteria 1183
270 Ga0097620_100003978 3300006931 Bacteria 15080
271 Ga0097620_100006104 3300006931 Bacteria 12235
272 Ga0097620_100007972 3300006931 Bacteria 10743
273 Ga0097620_100021038 3300006931 Bacteria 6547
274 Ga0097620_100099264 3300006931 Bacteria 2967
275 Ga0097620_100383240 3300006931 Bacteria 1501
276 Ga0097620_100432525 3300006931 Bacteria 1412
277 Ga0075435_100000047 3300007076 Bacteria 60782
278 Ga0075435_100017237 3300007076 Bacteria 5462
279 Ga0075435_100256335 3300007076 Bacteria 1490
280 Ga0099794_10059969 3300007265 Bacteria 1847
281 Ga0099794_10158993 3300007265 Bacteria 1149
282 Ga0105240_10394231 3300009093 Bacteria 1561
283 Ga0111539_10003844 3300009094 Bacteria 19777
284 Ga0111539_10011877 3300009094 Bacteria 10916
285 Ga0111539_10031418 3300009094 Bacteria 6451
286 Ga0111539_10034785 3300009094 Bacteria 6104
287 Ga0111539_10086334 3300009094 Bacteria 3687
288 Ga0111539_10291090 3300009094 Bacteria 1900
289 Ga0111539_10354182 3300009094 Bacteria 1708
290 Ga0111539_10405491 3300009094 Bacteria 1588
291 Ga0111539_10663496 3300009094 Bacteria 1214
292 Ga0105245_10007041 3300009098 Bacteria 9866
293 Ga0105245_10012980 3300009098 Bacteria 7260
294 Ga0105245_10075077 3300009098 Bacteria 3077
295 Ga0105247_10112872 3300009101 Bacteria 1751
296 Ga0114129_10000068 3300009147 Bacteria 93579
297 Ga0114129_10000430 3300009147 Bacteria 49930
298 Ga0114129_10000703 3300009147 Bacteria 42137
299 Ga0114129_10002359 3300009147 Bacteria 26209
300 Ga0114129_10020013 3300009147 Bacteria 9525
301 Ga0114129_10020418 3300009147 Bacteria 9421
302 Ga0114129_10074037 3300009147 Bacteria 4744
303 Ga0114129_10164336 3300009147 Bacteria 3030
304 Ga0114129_10915868 3300009147 Bacteria 1110
305 Ga0105243_10000708 3300009148 Bacteria 32162
306 Ga0105243_10043929 3300009148 Bacteria 3504
307 Ga0105243_10444606 3300009148 Bacteria 1215
308 Ga0105241_10092438 3300009174 Bacteria 2389
309 Ga0105241_10122645 3300009174 Bacteria 2095
310 Ga0105242_10041789 3300009176 Bacteria 3700
311 Ga0105242_10258302 3300009176 Bacteria 1573
312 Ga0105248_10114457 3300009177 Bacteria 3042
313 Ga0105248_10368233 3300009177 Bacteria 1618
314 Ga0105237_10029142 3300009545 Bacteria 5615
315 Ga0105237_10037012 3300009545 Bacteria 4934
316 Ga0105238_10341110 3300009551 Bacteria 1486
317 Ga0105249_10000599 3300009553 Bacteria 32843
318 Ga0105249_10002072 3300009553 Bacteria 17373
319 Ga0105249_10131152 3300009553 Bacteria 2393
320 Ga0105249_10603595 3300009553 Bacteria 1152
321 Ga0099796_10028306 3300010159 Bacteria 1798
322 Ga0105239_10036817 3300010375 Bacteria 5368
323 Ga0105239_10242555 3300010375 Bacteria 2023
324 Ga0105246_10136796 3300011119 Bacteria 1837
325 Ga0157369_10217554 3300013105 Bacteria 2000
326 Ga0157378_10006229 3300013297 Bacteria 10445
327 Ga0157378_10422905 3300013297 Bacteria 1317
328 Ga0157378_10491426 3300013297 Bacteria 1224
329 Ga0163162_10018668 3300013306 Bacteria 6794
330 Ga0163162_10333214 3300013306 Bacteria 1650
331 Ga0163162_10436895 3300013306 Bacteria 1441
332 Ga0163162_10494459 3300013306 Bacteria 1354
333 Ga0157372_10202758 3300013307 Bacteria 2298
334 Ga0157375_10444959 3300013308 Bacteria 1461
335 Ga0157375_10516832 3300013308 Bacteria 1357
336 Ga0163163_10001948 3300014325 Bacteria 17455
337 Ga0163163_10609142 3300014325 Bacteria 1155
338 Ga0157380_10270015 3300014326 Bacteria 1550
339 Ga0157380_10305790 3300014326 Bacteria 1467
340 Ga0157380_10463956 3300014326 Bacteria 1220
341 Ga0157377_10101288 3300014745 Bacteria 1717
342 Ga0157379_10441317 3300014968 Bacteria 1200
343 Ga0157376_10011568 3300014969 Bacteria 6512
344 Ga0157376_10059518 3300014969 Bacteria 3203
345 Ga0213873_10024658 3300021358 Bacteria 1445
346 Ga0213874_10011204 3300021377 Bacteria 2265
347 Ga0213876_10000816 3300021384 Bacteria 21075
348 Ga0213876_10000944 3300021384 Bacteria 19157
349 Ga0213876_10084059 3300021384 Bacteria 1684
350 Ga0213875_10000003 3300021388 Bacteria 719367
351 Ga0213875_10001075 3300021388 Bacteria 19135
352 Ga0213875_10012486 3300021388 Bacteria 4193
353 Ga0213875_10016470 3300021388 Bacteria 3583
354 Ga0213875_10034599 3300021388 Bacteria 2386
355 Ga0207653_10001145 3300025885 Bacteria 8692
356 Ga0207682_10002103 3300025893 Bacteria 9019
357 Ga0207692_10195460 3300025898 Bacteria 1186
358 Ga0207642_10005920 3300025899 Bacteria 4029
359 Ga0207642_10018611 3300025899 Bacteria 2670
360 Ga0207710_10024128 3300025900 Bacteria 2617
361 Ga0207688_10016496 3300025901 Bacteria 4006
362 Ga0207645_10045314 3300025907 Bacteria 2811
363 Ga0207684_10004520 3300025910 Bacteria 13068
364 Ga0207654_10035292 3300025911 Bacteria 2785
365 Ga0207654_10089196 3300025911 Bacteria 1875
366 Ga0207707_10001852 3300025912 Bacteria 19339
367 Ga0207707_10010205 3300025912 Bacteria 8153
368 Ga0207707_10064689 3300025912 Bacteria 3184
369 Ga0207671_10030628 3300025914 Bacteria 4011
370 Ga0207693_10003608 3300025915 Bacteria 13212
371 Ga0207693_10013129 3300025915 Bacteria 6682
372 Ga0207693_10052856 3300025915 Bacteria 3187
373 Ga0207662_10000639 3300025918 Bacteria 15770
374 Ga0207662_10010145 3300025918 Bacteria 5193
375 Ga0207662_10044570 3300025918 Bacteria 2619
376 Ga0207652_10159637 3300025921 Bacteria 2021
377 Ga0207652_10180287 3300025921 Bacteria 1898
378 Ga0207652_10187492 3300025921 Bacteria 1860
379 Ga0207646_10003037 3300025922 Bacteria 19308
380 Ga0207646_10065719 3300025922 Bacteria 3238
381 Ga0207646_10176822 3300025922 Bacteria 1928
382 Ga0207681_10002455 3300025923 Bacteria 11755
383 Ga0207681_10404072 3300025923 Bacteria 1104
384 Ga0207694_10237511 3300025924 Bacteria 1489
385 Ga0207650_10246261 3300025925 Bacteria 1446
386 Ga0207659_10189264 3300025926 Bacteria 1637
387 Ga0207687_10003950 3300025927 Bacteria 9932
388 Ga0207687_10016484 3300025927 Bacteria 4853
389 Ga0207687_10184012 3300025927 Bacteria 1620
390 Ga0207664_10331786 3300025929 Bacteria 1344
391 Ga0207644_10072069 3300025931 Bacteria 2529
392 Ga0207706_10040460 3300025933 Bacteria 4131
393 Ga0207706_10080777 3300025933 Bacteria 2858
394 Ga0207706_10149150 3300025933 Bacteria 2057
395 Ga0207686_10006692 3300025934 Bacteria 6211
396 Ga0207686_10064621 3300025934 Bacteria 2331
397 Ga0207709_10036753 3300025935 Bacteria 2904
398 Ga0207709_10049360 3300025935 Bacteria 2568
399 Ga0207709_10225211 3300025935 Bacteria 1355
400 Ga0207709_10234795 3300025935 Bacteria 1330
401 Ga0207670_10185603 3300025936 Bacteria 1569
402 Ga0207669_10043433 3300025937 Bacteria 2632
403 Ga0207669_10050150 3300025937 Bacteria 2493
404 Ga0207704_10007060 3300025938 Bacteria 5280
405 Ga0207704_10460629 3300025938 Bacteria 1017
406 Ga0207665_10136272 3300025939 Bacteria 1747
407 Ga0207691_10059780 3300025940 Bacteria 3464
408 Ga0207691_10081129 3300025940 Bacteria 2916
409 Ga0207691_10119619 3300025940 Bacteria 2336
410 Ga0207711_10097521 3300025941 Bacteria 2595
411 Ga0207711_10411394 3300025941 Bacteria 1257
412 Ga0207689_10007163 3300025942 Bacteria 9806
413 Ga0207689_10036449 3300025942 Bacteria 4083
414 Ga0207689_10097726 3300025942 Bacteria 2412
415 Ga0207661_10219910 3300025944 Bacteria 1678
416 Ga0207679_10016081 3300025945 Bacteria 4961
417 Ga0207667_10033944 3300025949 Bacteria 5481
418 Ga0207667_10054565 3300025949 Bacteria 4203
419 Ga0207651_10195438 3300025960 Bacteria 1617
420 Ga0207712_10003113 3300025961 Bacteria 10584
421 Ga0207712_10003418 3300025961 Bacteria 10034
422 Ga0207712_10217206 3300025961 Bacteria 1526
423 Ga0207712_10244082 3300025961 Bacteria 1448
424 Ga0207668_10087785 3300025972 Bacteria 2276
425 Ga0207640_10014585 3300025981 Bacteria 4528
426 Ga0207640_10287323 3300025981 Bacteria 1295
427 Ga0207658_10106231 3300025986 Bacteria 2210
428 Ga0207677_10029879 3300026023 Bacteria 3470
429 Ga0207703_10013352 3300026035 Bacteria 6400
430 Ga0207703_10055811 3300026035 Bacteria 3214
431 Ga0207703_10084896 3300026035 Bacteria 2649
432 Ga0207703_10136321 3300026035 Bacteria 2125
433 Ga0207703_10278628 3300026035 Bacteria 1518
434 Ga0207703_10680861 3300026035 Bacteria 977
435 Ga0207639_10004290 3300026041 Bacteria 9612
436 Ga0207639_10569432 3300026041 Bacteria 1042
437 Ga0207678_10003276 3300026067 Bacteria 14615
438 Ga0207708_10000142 3300026075 Bacteria 56900
439 Ga0207708_10000153 3300026075 Bacteria 54987
440 Ga0207708_10001509 3300026075 Bacteria 17351
441 Ga0207708_10026481 3300026075 Bacteria 4389
442 Ga0207708_10050676 3300026075 Bacteria 3160
443 Ga0207708_10070975 3300026075 Bacteria 2667
444 Ga0207708_10296444 3300026075 Bacteria 1314
445 Ga0207708_10345084 3300026075 Bacteria 1220
446 Ga0207702_10192198 3300026078 Bacteria 1887
447 Ga0207641_10075539 3300026088 Bacteria 2910
448 Ga0207641_10720362 3300026088 Bacteria 983
449 Ga0207648_10000130 3300026089 Bacteria 74342
450 Ga0207648_10003264 3300026089 Bacteria 17048
451 Ga0207648_10081281 3300026089 Bacteria 2826
452 Ga0207676_10008709 3300026095 Bacteria 7216
453 Ga0207676_10203923 3300026095 Bacteria 1749
454 Ga0207674_10008447 3300026116 Bacteria 11892
455 Ga0207674_10014574 3300026116 Bacteria 8676
456 Ga0207674_10147265 3300026116 Bacteria 2313
457 Ga0207675_100000253 3300026118 Bacteria 51284
458 Ga0207675_100000648 3300026118 Bacteria 34256
459 Ga0207675_100105017 3300026118 Bacteria 2662
460 Ga0207675_100151459 3300026118 Bacteria 2207
461 Ga0207675_100185079 3300026118 Bacteria 1996
462 Ga0207683_10023791 3300026121 Bacteria 5270
463 Ga0209969_1002469 3300027360 Bacteria 2557
464 Ga0209981_1012871 3300027378 Bacteria 1161
465 Ga0209996_1000475 3300027395 Bacteria 4824
466 Ga0209996_1004059 3300027395 Bacteria 1855
467 Ga0209996_1008521 3300027395 Bacteria 1344
468 Ga0210000_1001307 3300027462 Bacteria 3509
469 Ga0210000_1001320 3300027462 Bacteria 3499
470 Ga0209995_1005928 3300027471 Bacteria 1967
471 Ga0209968_1001005 3300027526 Bacteria 4335
472 Ga0209968_1005706 3300027526 Bacteria 1870
473 Ga0209968_1015897 3300027526 Bacteria 1193
474 Ga0209999_1008492 3300027543 Bacteria 1853
475 Ga0209983_1000380 3300027665 Bacteria 9453
476 Ga0209971_1000228 3300027682 Bacteria 16409
477 Ga0209971_1006441 3300027682 Bacteria 2775
478 Ga0209966_1000098 3300027695 Bacteria 38805
479 Ga0209998_10000125 3300027717 Bacteria 29964
480 Ga0209813_10006973 3300027866 Bacteria 2804
481 Ga0209813_10035293 3300027866 Bacteria 1497
482 Ga0209974_10004008 3300027876 Bacteria 5265
483 Ga0207428_10000721 3300027907 Bacteria 38142
484 Ga0207428_10012105 3300027907 Bacteria 7591
485 Ga0207428_10209626 3300027907 Bacteria 1464
486 Ga0268265_10000627 3300028380 Bacteria 35202
487 Ga0268265_10000885 3300028380 Bacteria 28020
488 Ga0268265_10000939 3300028380 Bacteria 26819
489 Ga0268265_10006592 3300028380 Bacteria 7858
490 Ga0268265_10012099 3300028380 Bacteria 5843
491 Ga0268265_10200165 3300028380 Bacteria 1732
492 Ga0268264_10001246 3300028381 Bacteria 24277
493 Ga0268264_10047794 3300028381 Bacteria 3558
494 Ga0268264_10245600 3300028381 Bacteria 1660
495 Ga0268264_10249517 3300028381 Bacteria 1648
496 Ga0265338_10288882 3300028800 Bacteria 1196
497 Ga0265330_10032768 3300031235 Bacteria 2327
498 Ga0265320_10038673 3300031240 Bacteria 2391
499 Ga0265329_10038528 3300031242 Bacteria 1537
500 Ga0265339_10041981 3300031249 Bacteria 2534
501 Ga0265316_10019986 3300031344 Bacteria 5712
502 Ga0265316_10045361 3300031344 Bacteria 3490
503 Ga0307408_100070265 3300031548 Bacteria 2585
504 Ga0316575_10014633 3300031665 Bacteria 2949
505 Ga0316575_10020135 3300031665 Bacteria 2558
506 Ga0265342_10025824 3300031712 Bacteria 3687
507 Ga0265342_10027031 3300031712 Bacteria 3592
508 Ga0307416_100047257 3300032002 Bacteria 3405
509 Ga0307414_10360773 3300032004 Bacteria 1250
510 Ga0373950_0015439 3300034818 Bacteria 1295
511 Ga0373938_0009918 3300034957 Bacteria 1736
512 Ga0373926_0000320 3300035083 Bacteria 11963
513 Ga0373926_0002880 3300035083 Bacteria 5512
514 Ga0373940_0008635 3300035088 Bacteria 2345
515 Ga0373944_0007777 3300035089 Bacteria 2881
516 Ga0373952_0008135 3300035092 Bacteria 1983
517 Ga0373923_0015997 3300035111 Bacteria 2841
518 Ga0373932_0019320 3300035112 Bacteria 1775
519 Ga0373936_0013035 3300035113 Bacteria 3170
520 Ga0373936_0037929 3300035113 Bacteria 1926
521 Ga0373941_0009738 3300035115 Bacteria 2428
522 Ga0373945_0002043 3300035116 Bacteria 6277
523 Ga0373945_0012081 3300035116 Bacteria 2863
524 Ga0373954_0032281 3300035118 Bacteria 2420
525 Ga0373956_0032314 3300035119 Bacteria 2296
526 Ga0373957_0068681 3300035120 Bacteria 1383
527 Ga0373960_0010649 3300035121 Bacteria 2250
528 Ga0373943_0000424 3300035170 Bacteria 17836
529 Ga0373943_0006382 3300035170 Bacteria 5298
530 Ga0373943_0028636 3300035170 Bacteria 2626
531 Ga0373946_0003275 3300035171 Bacteria 5751
532 Ga0373946_0006545 3300035171 Bacteria 4227
533 Ga0373946_0020065 3300035171 Bacteria 2580
534 Ga0373955_0039290 3300035172 Bacteria 2525
535 Ga0373955_0310029 3300035172 Bacteria 953
536 Ga0373962_0048074 3300035242 Bacteria 1222
537 Ga0316574_0004412 3300035398 Bacteria 7366
538 Ga0373931_0000207 3300035691 Bacteria 25079
539 Ga0373931_0002172 3300035691 Bacteria 8643
540 Ga0373931_0027600 3300035691 Bacteria 2899
541 Ga0373931_0094053 3300035691 Bacteria 1675
542 Ga0373931_0096222 3300035691 Bacteria 1658
543 Ga0373931_0152554 3300035691 Bacteria 1348
544 Ga0373931_0273544 3300035691 Bacteria 1035
545 Ga0373935_0000882 3300035692 Bacteria 16207
546 Ga0373935_0002678 3300035692 Bacteria 10245
547 Ga0373935_0006454 3300035692 Bacteria 7002
548 Ga0373935_0009918 3300035692 Bacteria 5707
549 Ga0373927_0000414 3300035695 Bacteria 32784
550 Ga0373927_0006828 3300035695 Bacteria 7767
551 Ga0373927_0025829 3300035695 Bacteria 3839
552 Ga0373927_0098409 3300035695 Bacteria 1902
553 Ga0373927_0149233 3300035695 Bacteria 1531
554 Ga0373933_0008780 3300035724 Bacteria 5510
555 Ga0373933_0123375 3300035724 Bacteria 1624
556 Ga0373947_0000275 3300035725 Bacteria 29242
557 Ga0373947_0007039 3300035725 Bacteria 6519
558 Ga0373947_0017419 3300035725 Bacteria 4132
559 Ga0373947_0066277 3300035725 Bacteria 2204
560 Ga0373937_0108121 3300036401 Bacteria 2586
561 Ga0373937_0134761 3300036401 Bacteria 2308
562 Ga0373937_0394453 3300036401 Bacteria 1313
563 Ga0373925_0002725 3300037068 Bacteria 13982
564 Ga0373925_0014839 3300037068 Bacteria 5630
565 Ga0373925_0087640 3300037068 Bacteria 2376
566 Ga0373925_0109429 3300037068 Bacteria 2133
567 Ga0395905_0537467 3300037471 Bacteria 1070
568 Ga0316581_0006661 3300037588 Bacteria 3068
569 Ga0436364_0147453 3300037853 Bacteria 11701
570 Ga0436364_0162358 3300037853 Bacteria 4611
571 Ga0436364_0676530 3300037853 Bacteria 1157
572 Ga0436364_0685371 3300037853 Bacteria 68284
573 Ga0436364_0700611 3300037853 Bacteria 2954
574 Ga0436364_0705174 3300037853 Bacteria 16891
575 Ga0436364_0760962 3300037853 Bacteria 28778
576 Ga0436364_1082407 3300037853 Bacteria 7015
577 Ga0436364_1114716 3300037853 Bacteria 3092
578 Ga0436365_0159339 3300039437 Bacteria 58353
579 Ga0436365_0736793 3300039437 Bacteria 96466
580 Ga0436365_1308054 3300039437 Bacteria 2450
581 Ga0436365_1837194 3300039437 Bacteria 2771
582 Ga0436365_1892164 3300039437 Bacteria 4736
583 Ga0436360_0404169 3300039438 Bacteria 1139
584 Ga0436360_0886479 3300039438 Bacteria 1593
585 Ga0436361_0847532 3300039447 Bacteria 980
586 Ga0436363_0313348 3300039450 Bacteria 32729
587 Ga0436363_1475436 3300039450 Bacteria 11441
588 Ga0436362_1056133 3300039453 Bacteria 1577
589 Ga0436362_1066130 3300039453 Bacteria 5116
590 Ga0436362_1124287 3300039453 Bacteria 1131
591 Ga0439461_0030608 3300041410 Bacteria 1120
592 Ga0439441_001670 3300042001 Bacteria 2973
593 Ga0439441_002598 3300042001 Bacteria 2561
594 Ga0439443_002737 3300042003 Bacteria 2144
595 Ga0439450_012023 3300042008 Bacteria 1709
596 Ga0439446_0004940 3300042156 Bacteria 3408
597 Ga0439434_0003115 3300042435 Bacteria 4874
598 Ga0439434_0038426 3300042435 Bacteria 1467
599 Ga0439434_0056815 3300042435 Bacteria 1219
600 Ga0439435_0004837 3300042436 Bacteria 2925
601 Ga0439444_0001275 3300042437 Bacteria 3213
602 Ga0439459_0008227 3300042438 Bacteria 1778
603 Ga0439464_0020595 3300042439 Bacteria 1806
604 Ga0439464_0056003 3300042439 Bacteria 1148
605 Ga0439460_0001552 3300042461 Bacteria 5415
606 Ga0439460_0018435 3300042461 Bacteria 1880
607 Ga0451577_0204639 3300042876 Bacteria 1782
608 Ga0451577_0300010 3300042876 Bacteria 1456
609 Ga0451577_0343975 3300042876 Bacteria 1353
610 Ga0439440_0013406 3300042993 Bacteria 1758
611 Ga0453683_0025310 3300044673 Bacteria 3772
612 Ga0453684_0024772 3300044712 Bacteria 8747
613 Ga0451576_0030558 3300045051 Bacteria 5756
614 Ga0451576_0031269 3300045051 Bacteria 5678
615 Ga0451576_0034448 3300045051 Bacteria 5378
616 Ga0451576_0035065 3300045051 Bacteria 5324
617 Ga0451576_0253503 3300045051 Bacteria 1839
618 Ga0451576_0536241 3300045051 Bacteria 1229
619 Ga0466967_0251474 3300045976 Bacteria 1688
620 Ga0495603_0028409 3300046455 Bacteria 3373
621 Ga0495603_0244401 3300046455 Bacteria 1034
622 Ga0495629_0170376 3300046459 Bacteria 1511
623 Ga0495653_0057546 3300046463 Bacteria 2958
624 Ga0495653_0058032 3300046463 Bacteria 2943
625 Ga0495653_0233476 3300046463 Bacteria 1230
626 Ga0495580_0001270 3300046472 Bacteria 22269
627 Ga0495580_0058049 3300046472 Bacteria 2723
628 Ga0495662_0000261 3300046476 Bacteria 22323
629 Ga0495662_0016950 3300046476 Bacteria 3525
630 Ga0495662_0034302 3300046476 Bacteria 2450
631 Ga0495664_0000736 3300046477 Bacteria 16729
632 Ga0495608_0019659 3300046511 Bacteria 4646
633 Ga0495608_0128988 3300046511 Bacteria 1619
634 Ga0495618_0160733 3300046514 Bacteria 1432
635 Ga0495628_0202423 3300046516 Bacteria 1495
636 Ga0495630_0002218 3300046517 Bacteria 13534
637 Ga0495663_0030658 3300046525 Bacteria 1595
638 Ga0495666_0057274 3300046526 Bacteria 1866
639 Ga0495666_0166937 3300046526 Bacteria 1019
640 Ga0495652_0199677 3300046529 Bacteria 1519
641 Ga0495665_0024212 3300046531 Bacteria 3261
642 Ga0495640_0002964 3300046533 Bacteria 13677
643 Ga0495640_0013343 3300046533 Bacteria 6244
644 Ga0495640_0217321 3300046533 Bacteria 1206
645 Ga0495586_0001814 3300046535 Bacteria 11645
646 Ga0495586_0048291 3300046535 Bacteria 2299
647 Ga0495621_0019212 3300046539 Bacteria 2229
648 Ga0495621_0039933 3300046539 Bacteria 1643
649 Ga0495645_0002109 3300046543 Bacteria 13497
650 Ga0495667_0048970 3300046559 Bacteria 2790
651 Ga0495656_0044546 3300046615 Bacteria 1869
652 Ga0495634_0006321 3300046642 Bacteria 9017
653 Ga0495634_0017261 3300046642 Bacteria 5153
654 Ga0495634_0039498 3300046642 Bacteria 3213
655 Ga0495634_0223442 3300046642 Bacteria 1161
656 Ga0495625_0049301 3300046660 Bacteria 3028
657 Ga0495635_0000438 3300046663 Bacteria 26330
658 Ga0495588_0010367 3300046674 Bacteria 4334
659 Ga0495646_0022684 3300046680 Bacteria 3957
660 Ga0495647_0016640 3300046681 Bacteria 2591
661 Ga0495658_0005364 3300046683 Bacteria 6306
662 Ga0495658_0134032 3300046683 Bacteria 1510
663 Ga0495669_0005523 3300046684 Bacteria 5277
664 Ga0495613_0027628 3300046689 Bacteria 4223
665 Ga0495613_0122418 3300046689 Bacteria 1867
666 Ga0495613_0245809 3300046689 Bacteria 1250
667 Ga0495613_0307480 3300046689 Bacteria 1096
668 Ga0495624_0001570 3300046690 Bacteria 17622
669 Ga0495624_0064570 3300046690 Bacteria 2288
670 Ga0495600_0028225 3300046809 Bacteria 3630
671 Ga0495581_0025033 3300047315 Bacteria 3459
672 Ga0495604_0346453 3300047317 Bacteria 988
673 Ga0495674_0000209 3300047319 Bacteria 48240
674 Ga0495674_0024470 3300047319 Bacteria 5548
675 Ga0495674_0314268 3300047319 Bacteria 1278
676 Ga0495676_0033822 3300047321 Bacteria 4297
677 Ga0495676_0047447 3300047321 Bacteria 3473
678 Ga0495676_0085983 3300047321 Bacteria 2368
679 Ga0495680_0386936 3300047322 Bacteria 968
680 Ga0495684_0001766 3300047471 Bacteria 17346
681 Ga0495684_0003044 3300047471 Bacteria 13189
682 Ga0495684_0049314 3300047471 Bacteria 3217
683 Ga0495593_0007179 3300047673 Bacteria 6532
684 Ga0495602_0080662 3300048088 Bacteria 2740
685 Ga0495602_0454798 3300048088 Bacteria 903
686 Ga0495615_0012423 3300048090 Bacteria 1755
687 Ga0496100_0134321 3300048903 Bacteria 1746
688 Ga0496100_0207228 3300048903 Bacteria 1432
689 Ga0496100_0332254 3300048903 Bacteria 1144
690 Ga0496101_0424249 3300048904 Bacteria 1048
691 Ga0496102_0010995 3300048905 Bacteria 7800
692 Ga0496102_0176348 3300048905 Bacteria 2013
693 Ga0496103_0030761 3300048906 Bacteria 3268
694 Ga0496104_0006466 3300048907 Bacteria 10301
695 Ga0496104_0011676 3300048907 Bacteria 7875
696 Ga0496104_0035653 3300048907 Bacteria 4645
697 Ga0496104_0040885 3300048907 Bacteria 4347
698 Ga0496105_0000783 3300048908 Bacteria 21486
699 Ga0496105_0006116 3300048908 Bacteria 9216
700 Ga0496105_0017779 3300048908 Bacteria 5703
701 Ga0496105_0037299 3300048908 Bacteria 4003
702 Ga0496106_0002235 3300048909 Bacteria 14435
703 Ga0496106_0094236 3300048909 Bacteria 2315
704 Ga0496106_0108221 3300048909 Bacteria 2162
705 Ga0496106_0209392 3300048909 Bacteria 1553
706 Ga0496107_0005679 3300048910 Bacteria 8536
707 Ga0496108_0000783 3300048911 Bacteria 24833
708 Ga0496108_0005523 3300048911 Bacteria 10227
709 Ga0496109_0002516 3300048912 Bacteria 15368
710 Ga0496109_0044666 3300048912 Bacteria 4020
711 Ga0496110_0023893 3300048913 Bacteria 5204
712 Ga0496110_0039288 3300048913 Bacteria 4120
713 Ga0496110_0163933 3300048913 Bacteria 2015
714 Ga0496110_0192729 3300048913 Bacteria 1851
715 Ga0496110_0227850 3300048913 Bacteria 1695
716 Ga0496110_0444194 3300048913 Bacteria 1182
717 Ga0496111_0000495 3300048914 Bacteria 20302
718 Ga0496111_0012998 3300048914 Bacteria 5651
719 Ga0496112_0003524 3300048915 Bacteria 12978
720 Ga0496112_0008371 3300048915 Bacteria 9263
721 Ga0496113_0000529 3300048916 Bacteria 18858
722 Ga0496114_0109194 3300048917 Bacteria 2369
723 Ga0496114_0167669 3300048917 Bacteria 1912
724 Ga0496115_0004616 3300048918 Bacteria 9972
725 Ga0496115_0156652 3300048918 Bacteria 1882
726 Ga0496115_0376978 3300048918 Bacteria 1154
727 Ga0496117_0032979 3300048920 Bacteria 3923
728 Ga0496120_0106075 3300048923 Bacteria 1476
729 Ga0496122_0017063 3300048925 Bacteria 6814
730 Ga0496124_0012283 3300048927 Bacteria 8461
731 Ga0496124_0087643 3300048927 Bacteria 2546
732 Ga0496125_0002695 3300048928 Bacteria 22608
733 Ga0501033_0083116 3300049570 Bacteria 2347
734 Ga0501033_0201346 3300049570 Bacteria 1422
735 Ga0501034_0019935 3300049571 Bacteria 6848
736 Ga0501034_0273000 3300049571 Bacteria 1631
737 Ga0501036_0001382 3300049572 Bacteria 18652
738 Ga0501036_0020963 3300049572 Bacteria 5489
739 Ga0501036_0103560 3300049572 Bacteria 2407
740 Ga0501036_0111786 3300049572 Bacteria 2308
741 Ga0501036_0190621 3300049572 Bacteria 1725
742 Ga0501037_0003480 3300049573 Bacteria 11423
743 Ga0501037_0154252 3300049573 Bacteria 1640
744 Ga0501038_0000646 3300049574 Bacteria 30992
745 Ga0501038_0012439 3300049574 Bacteria 7776
746 Ga0501038_0073051 3300049574 Bacteria 2905
747 Ga0501038_0191459 3300049574 Bacteria 1645
748 Ga0501038_0342704 3300049574 Bacteria 1165
749 Ga0501038_0378757 3300049574 Bacteria 1098
750 Ga0501039_0001534 3300049575 Bacteria 16970
751 Ga0501039_0112756 3300049575 Bacteria 2126
752 Ga0501039_0137082 3300049575 Bacteria 1922
753 Ga0501039_0157905 3300049575 Bacteria 1782
754 Ga0501039_0175265 3300049575 Bacteria 1686
755 Ga0501039_0280225 3300049575 Bacteria 1310
756 Ga0501040_0000087 3300049576 Bacteria 46070
757 Ga0501040_0017509 3300049576 Bacteria 4756
758 Ga0501041_0002380 3300049577 Bacteria 10639
759 Ga0501041_0007945 3300049577 Bacteria 6239
760 Ga0501041_0021655 3300049577 Bacteria 3851
761 Ga0501041_0074019 3300049577 Bacteria 2093
762 Ga0501041_0132095 3300049577 Bacteria 1555
763 Ga0501041_0137561 3300049577 Bacteria 1522
764 Ga0501041_0195047 3300049577 Bacteria 1269
765 Ga0501041_0214942 3300049577 Bacteria 1206
766 Ga0501042_0000957 3300049578 Bacteria 16263
767 Ga0501042_0002829 3300049578 Bacteria 10750
768 Ga0501042_0038500 3300049578 Bacteria 3396
769 Ga0501042_0040685 3300049578 Bacteria 3304
770 Ga0501043_0008327 3300049579 Bacteria 8164
771 Ga0501043_0008730 3300049579 Bacteria 7975
772 Ga0501043_0240942 3300049579 Bacteria 1395
773 Ga0501043_0254530 3300049579 Bacteria 1352
774 Ga0501043_0286800 3300049579 Bacteria 1261
775 Ga0501046_0000364 3300049580 Bacteria 45712
776 Ga0501046_0022776 3300049580 Bacteria 5158
777 Ga0501046_0036174 3300049580 Bacteria 3975
778 Ga0501046_0042825 3300049580 Bacteria 3608
779 Ga0501046_0068487 3300049580 Bacteria 2762
780 Ga0501046_0112204 3300049580 Bacteria 2082
781 Ga0501047_0028382 3300049581 Bacteria 5394
782 Ga0501048_0001228 3300049582 Bacteria 19413
783 Ga0501048_0017702 3300049582 Bacteria 5245
784 Ga0501048_0024555 3300049582 Bacteria 4399
785 Ga0501048_0026590 3300049582 Bacteria 4212
786 Ga0501048_0152336 3300049582 Bacteria 1636
787 Ga0501048_0249039 3300049582 Bacteria 1261
788 Ga0501067_0037054 3300049583 Bacteria 2709
789 Ga0501068_0011606 3300049584 Bacteria 4976
790 Ga0501068_0040132 3300049584 Bacteria 2809
791 Ga0501068_0054258 3300049584 Bacteria 2428
792 Ga0501068_0064794 3300049584 Bacteria 2224
793 Ga0501069_0026341 3300049585 Bacteria 3183
794 Ga0501069_0103036 3300049585 Bacteria 1621
795 Ga0501069_0260763 3300049585 Unclassified 1012
796 Ga0501070_0373034 3300049586 Bacteria 1156
797 Ga0501071_0000156 3300049587 Bacteria 28990
798 Ga0501071_0001439 3300049587 Bacteria 13746
799 Ga0501071_0045592 3300049587 Bacteria 3148
800 Ga0501071_0055335 3300049587 Bacteria 2864
801 Ga0501071_0146449 3300049587 Bacteria 1760
802 Ga0501072_0000252 3300049588 Bacteria 39255
803 Ga0501072_0002340 3300049588 Bacteria 14217
804 Ga0501072_0011074 3300049588 Bacteria 6882
805 Ga0501072_0014152 3300049588 Bacteria 6112
806 Ga0501072_0015235 3300049588 Bacteria 5894
807 Ga0501072_0084821 3300049588 Bacteria 2512
808 Ga0501072_0108041 3300049588 Bacteria 2213
809 Ga0501072_0142384 3300049588 Bacteria 1912
810 Ga0501072_0191446 3300049588 Bacteria 1631
811 Ga0501072_0251166 3300049588 Bacteria 1408
812 Ga0501072_0262130 3300049588 Bacteria 1376
813 Ga0501073_0085182 3300049589 Bacteria 2199
814 Ga0501073_0237298 3300049589 Bacteria 1259
815 Ga0501074_0001338 3300049590 Bacteria 16345
816 Ga0501074_0035939 3300049590 Bacteria 3589
817 Ga0501074_0075577 3300049590 Bacteria 2418
818 Ga0501074_0220011 3300049590 Bacteria 1352
819 Ga0501074_0251630 3300049590 Bacteria 1256
820 Ga0501075_0000004 3300049591 Bacteria 148813
821 Ga0501075_0000058 3300049591 Bacteria 46963
822 Ga0501075_0045061 3300049591 Bacteria 3310
823 Ga0501075_0074851 3300049591 Bacteria 2561
824 Ga0501075_0287979 3300049591 Bacteria 1252
825 Ga0501076_0000729 3300049592 Bacteria 21290
826 Ga0501076_0000774 3300049592 Bacteria 20666
827 Ga0501076_0005575 3300049592 Bacteria 9066
828 Ga0501076_0006035 3300049592 Bacteria 8762
829 Ga0501076_0008073 3300049592 Bacteria 7693
830 Ga0501076_0015076 3300049592 Bacteria 5836
831 Ga0501076_0104111 3300049592 Bacteria 2289
832 Ga0501077_0000178 3300049593 Bacteria 36417
833 Ga0501077_0022957 3300049593 Bacteria 3955
834 Ga0501077_0106072 3300049593 Bacteria 1781
835 Ga0501077_0171686 3300049593 Bacteria 1377
836 Ga0501077_0204832 3300049593 Bacteria 1253
837 Ga0501079_0000022 3300049741 Bacteria 63662
838 Ga0501079_0005648 3300049741 Bacteria 9338
839 Ga0501079_0032205 3300049741 Bacteria 4030
840 Ga0501079_0051015 3300049741 Bacteria 3193
841 Ga0501079_0068313 3300049741 Bacteria 2743
842 Ga0501079_0074885 3300049741 Bacteria 2617
843 Ga0501079_0096889 3300049741 Bacteria 2287
844 Ga0501079_0165351 3300049741 Bacteria 1725
845 Ga0501079_0215556 3300049741 Bacteria 1499
846 Ga0501080_0001368 3300049742 Bacteria 20407
847 Ga0501080_0007494 3300049742 Bacteria 9853
848 Ga0501080_0011566 3300049742 Bacteria 8083
849 Ga0501080_0013259 3300049742 Bacteria 7572
850 Ga0501080_0014988 3300049742 Bacteria 7138
851 Ga0501080_0091352 3300049742 Bacteria 2828
852 Ga0501080_0163888 3300049742 Bacteria 2052
853 Ga0501080_0263607 3300049742 Bacteria 1569
854 Ga0501080_0322145 3300049742 Bacteria 1399
855 Ga0501081_0000774 3300049743 Bacteria 18730
856 Ga0501081_0005054 3300049743 Bacteria 8490
857 Ga0501081_0043796 3300049743 Bacteria 3071
858 Ga0501081_0090558 3300049743 Bacteria 2150
859 Ga0501081_0110500 3300049743 Bacteria 1950
860 Ga0501081_0259297 3300049743 Bacteria 1270
861 Ga0501083_0009935 3300049744 Bacteria 6718
862 Ga0501083_0066623 3300049744 Bacteria 2397
863 Ga0501083_0084820 3300049744 Bacteria 2096
864 Ga0501083_0100994 3300049744 Bacteria 1902
865 Ga0501083_0170035 3300049744 Bacteria 1425
866 Ga0501083_0212132 3300049744 Bacteria 1262
867 Ga0501035_0001252 3300049822 Bacteria 26379
868 Ga0501035_0031108 3300049822 Bacteria 4861
869 Ga0501035_0216312 3300049822 Bacteria 1638
870 Ga0501044_0097643 3300049823 Bacteria 2958
871 Ga0501045_0001164 3300049824 Bacteria 17428
872 Ga0501045_0005395 3300049824 Bacteria 8854
873 Ga0501045_0038943 3300049824 Bacteria 3459
874 Ga0501045_0039692 3300049824 Bacteria 3425
875 Ga0501045_0050317 3300049824 Bacteria 3040
876 Ga0501045_0053256 3300049824 Bacteria 2957
877 Ga0501045_0067775 3300049824 Bacteria 2621
878 Ga0501045_0345062 3300049824 Bacteria 1108
879 nmdc:mga03n38_70088_c1 3300050490 Bacteria 1621
880 nmdc:mga00v17_42716_c1 3300050491 Bacteria 2728
881 nmdc:mga00v17_663_c1 3300050491 Bacteria 18944
882 nmdc:mga0yw44_125726_c1 3300050492 Bacteria 1656
883 nmdc:mga0yw44_241100_c1 3300050492 Bacteria 1202
884 nmdc:mga0yw44_6134_c1 3300050492 Bacteria 5773
885 nmdc:mga0k408_144836_c1 3300050493 Bacteria 1414
886 nmdc:mga0k408_21840_c1 3300050493 Bacteria 3600
887 nmdc:mga06z11_1221_c1 3300050494 Bacteria 9490
888 nmdc:mga06z11_14795_c1 3300050494 Bacteria 3465
889 nmdc:mga06z11_4849_c1 3300050494 Bacteria 5328
890 nmdc:mga04h51_18663_c1 3300050495 Bacteria 2046
891 nmdc:mga04h51_5277_c1 3300050495 Bacteria 3283
892 nmdc:mga07m45_140965_c1 3300050496 Bacteria 1396
893 nmdc:mga05p37_11593_c1 3300050507 Bacteria 10504
894 nmdc:mga05p37_286168_c1 3300050507 Bacteria 1964
895 nmdc:mga05p37_3149_c1 3300050507 Bacteria 19194
896 nmdc:mga05p37_3283_c1 3300050507 Bacteria 18860
897 nmdc:mga05p37_53751_c1 3300050507 Bacteria 4954
898 nmdc:mga05p37_591813_c1 3300050507 Bacteria 1254
899 nmdc:mga05p37_710_c2 3300050507 Bacteria 23500
900 nmdc:mga09592_126_c1 3300050508 Bacteria 35358
901 nmdc:mga09592_1332_c1 3300050508 Bacteria 19780
902 nmdc:mga09592_3063_c1 3300050508 Bacteria 13561
903 nmdc:mga09592_4616_c1 3300050508 Bacteria 11157
904 nmdc:mga09592_51499_c1 3300050508 Bacteria 3474
905 nmdc:mga09592_77287_c1 3300050508 Bacteria 2832
906 nmdc:mga0qj67_132673_c1 3300050509 Bacteria 2017
907 nmdc:mga0qj67_2393_c1 3300050509 Bacteria 13371
908 nmdc:mga06r32_100774_c1 3300050510 Bacteria 2833
909 nmdc:mga06r32_178409_c1 3300050510 Bacteria 2109
910 nmdc:mga06r32_2441_c1 3300050510 Bacteria 16629
911 nmdc:mga06r32_256198_c1 3300050510 Bacteria 1737
912 nmdc:mga06r32_343670_c1 3300050510 Bacteria 1477
913 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
914 nmdc:mga06r32_6022_c1 3300050510 Bacteria 10911
915 nmdc:mga06r32_61903_c1 3300050510 Bacteria 3604
916 nmdc:mga06r32_63545_c1 3300050510 Bacteria 3559
917 nmdc:mga06r32_7414_c1 3300050510 Bacteria 9867
918 nmdc:mga08y16_1078_c1 3300050511 Bacteria 26854
919 nmdc:mga08y16_156104_c1 3300050511 Bacteria 2371
920 nmdc:mga08y16_16843_c1 3300050511 Bacteria 7694
921 nmdc:mga08y16_182193_c1 3300050511 Bacteria 2181
922 nmdc:mga08y16_39253_c1 3300050511 Bacteria 4968
923 nmdc:mga08y16_399621_c1 3300050511 Bacteria 1407
924 nmdc:mga08y16_4436_c1 3300050511 Bacteria 14668
925 nmdc:mga0n895_110942_c1 3300050512 Bacteria 2759
926 nmdc:mga0n895_1570_c1 3300050512 Bacteria 17182
927 nmdc:mga0n895_3956_c1 3300050512 Bacteria 12046
928 nmdc:mga0n895_401522_c1 3300050512 Bacteria 1386
929 nmdc:mga0n895_42634_c1 3300050512 Bacteria 4416
930 nmdc:mga0n895_50020_c1 3300050512 Bacteria 4097
931 nmdc:mga0rr50_18250_c1 3300050513 Bacteria 4707
932 nmdc:mga0rr50_315148_c1 3300050513 Bacteria 1311
933 nmdc:mga0rr50_359_c1 3300050513 Bacteria 24852
934 nmdc:mga0rr50_55745_c1 3300050513 Bacteria 2950
935 nmdc:mga08x19_120397_c1 3300050514 Bacteria 1759
936 nmdc:mga08x19_12690_c1 3300050514 Bacteria 5080
937 nmdc:mga08x19_20446_c1 3300050514 Bacteria 4075
938 nmdc:mga08x19_245588_c1 3300050514 Bacteria 1235
939 nmdc:mga08x19_47006_c1 3300050514 Bacteria 2762
940 nmdc:mga0a205_1075_c1 3300050515 Bacteria 22701
941 nmdc:mga0a205_16420_c1 3300050515 Bacteria 6934
942 nmdc:mga0a205_297825_c1 3300050515 Bacteria 1486
943 nmdc:mga0a205_311895_c1 3300050515 Bacteria 1445
944 nmdc:mga0a205_34387_c1 3300050515 Bacteria 4862
945 nmdc:mga0a205_93_c2 3300050515 Bacteria 37118
946 nmdc:mga0sz30_68952_c1 3300050516 Bacteria 1520
947 Ga0495601_0001471 3300053077 Bacteria 12982
948 Ga0495601_0035335 3300053077 Bacteria 3119
949 Ga0495601_0310879 3300053077 Bacteria 1026
950 Ga0495612_0000353 3300053078 Bacteria 18580
951 Ga0495595_0036616 3300053084 Bacteria 2228
952 Ga0495619_0001077 3300053085 Bacteria 17905
953 Ga0495619_0084025 3300053085 Bacteria 2148
954 Ga0500658_0085078 3300053134 Bacteria 1359
955 Ga0500568_0002596 3300053139 Bacteria 10496
956 Ga0500577_0029867 3300053142 Bacteria 1892
957 Ga0500616_0095822 3300053153 Bacteria 1460
958 Ga0501084_0000157 3300054114 Bacteria 52388
959 Ga0501084_0002367 3300054114 Bacteria 15172
960 Ga0501084_0039329 3300054114 Bacteria 3956
961 Ga0501084_0053208 3300054114 Bacteria 3386
962 Ga0501084_0113461 3300054114 Bacteria 2278
963 Ga0501084_0225774 3300054114 Bacteria 1580
964 Ga0501084_0250867 3300054114 Bacteria 1494
965 Ga0501084_0410885 3300054114 Bacteria 1144
966 Ga0501082_0000050 3300060353 Bacteria 83978
967 Ga0501082_0000341 3300060353 Bacteria 41171
968 Ga0501082_0001651 3300060353 Bacteria 19655
969 Ga0501082_0063226 3300060353 Bacteria 3187
970 Ga0501082_0100457 3300060353 Bacteria 2502
971 Ga0501082_0152329 3300060353 Bacteria 2009
972 Ga0501082_0160913 3300060353 Bacteria 1951
973 Ga0501082_0199196 3300060353 Bacteria 1742
974 Ga0530510_0000084 3300061734 Bacteria 49991
975 Ga0530510_0000222 3300061734 Bacteria 35471
976 Ga0530510_0002069 3300061734 Bacteria 13788
977 Ga0530510_0002542 3300061734 Bacteria 12535
978 Ga0530510_0003261 3300061734 Bacteria 11152
979 Ga0530510_0004269 3300061734 Bacteria 9891
980 Ga0530510_0010377 3300061734 Bacteria 6531
981 Ga0530510_0039127 3300061734 Bacteria 3423
982 Ga0530510_0115418 3300061734 Bacteria 1968
983 Ga0530510_0298034 3300061734 Bacteria 1206

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035111 Ga0373923_0015997 Ga0373923_0015997_2099_2812 223
2 3300049741 Ga0501079_0005648 Ga0501079_0005648_24_743 233
3 3300042439 Ga0439464_0056003 Ga0439464_0056003_14_745 243
4 3300061734 Ga0530510_0003261 Ga0530510_0003261_6799_7665 247
5 3300039437 Ga0436365_1837194 Ga0436365_1837194_86_937 250
6 3300005340 Ga0070689_100156381 Ga0070689_1001563812 256
7 3300005343 Ga0070687_100056298 Ga0070687_1000562982 256
8 3300005347 Ga0070668_100359050 Ga0070668_1003590502 256
9 3300005434 Ga0070709_10193076 Ga0070709_101930762 256
10 3300005435 Ga0070714_100050541 Ga0070714_1000505413 256
11 3300005455 Ga0070663_100256353 Ga0070663_1002563532 256
12 3300005544 Ga0070686_100173058 Ga0070686_1001730582 256
13 3300005617 Ga0068859_100099270 Ga0068859_1000992703 256
14 3300005719 Ga0068861_100113605 Ga0068861_1001136052 256
15 3300006028 Ga0070717_10424093 Ga0070717_104240931 256
16 3300006931 Ga0097620_100099264 Ga0097620_1000992643 256
17 3300025918 Ga0207662_10044570 Ga0207662_100445702 256
18 3300025929 Ga0207664_10331786 Ga0207664_103317862 256
19 3300025933 Ga0207706_10149150 Ga0207706_101491502 256
20 3300026075 Ga0207708_10345084 Ga0207708_103450841 256
21 3300048905 Ga0496102_0176348 Ga0496102_0176348_70_936 256
22 3300048909 Ga0496106_0209392 Ga0496106_0209392_630_1496 256
23 3300005518 Ga0070699_100042885 Ga0070699_1000428853 257
24 3300014326 Ga0157380_10463956 Ga0157380_104639562 257
25 3300025898 Ga0207692_10195460 Ga0207692_101954602 257
26 3300021388 Ga0213875_10000003 Ga0213875_10000003622 258
27 3300037853 Ga0436364_0760962 Ga0436364_0760962_3609_4460 258
28 3300025927 Ga0207687_10016484 Ga0207687_100164844 259
29 3300027462 Ga0210000_1001307 Ga0210000_10013073 260
30 3300045976 Ga0466967_0251474 Ga0466967_0251474_461_1315 260
31 3300049743 Ga0501081_0259297 Ga0501081_0259297_285_1151 260
32 3300009098 Ga0105245_10012980 Ga0105245_100129805 261
33 3300006847 Ga0075431_100100743 Ga0075431_1001007433 262
34 3300050510 nmdc:mga06r32_256198_c1 nmdc:mga06r32_256198_c1_832_1698 262
35 3300009147 Ga0114129_10000703 Ga0114129_1000070314 263
36 3300050507 nmdc:mga05p37_11593_c1 nmdc:mga05p37_11593_c1_4105_4971 263
37 3300013297 Ga0157378_10491426 Ga0157378_104914262 264
38 3300049573 Ga0501037_0154252 Ga0501037_0154252_691_1557 264
39 3300049574 Ga0501038_0012439 Ga0501038_0012439_707_1573 264
40 3300049578 Ga0501042_0000957 Ga0501042_0000957_6761_7627 264
41 3300049580 Ga0501046_0112204 Ga0501046_0112204_178_1044 264
42 3300049582 Ga0501048_0017702 Ga0501048_0017702_3349_4215 264
43 3300049587 Ga0501071_0001439 Ga0501071_0001439_7860_8726 264
44 3300049588 Ga0501072_0002340 Ga0501072_0002340_9207_10073 264
45 3300049591 Ga0501075_0000004 Ga0501075_0000004_204_1070 264
46 3300049592 Ga0501076_0000774 Ga0501076_0000774_17100_17966 264
47 3300049742 Ga0501080_0011566 Ga0501080_0011566_4056_4922 264
48 3300049743 Ga0501081_0005054 Ga0501081_0005054_3401_4267 264
49 3300054114 Ga0501084_0053208 Ga0501084_0053208_505_1371 264
50 3300061734 Ga0530510_0000084 Ga0530510_0000084_32021_32887 264
51 3300050492 nmdc:mga0yw44_6134_c1 nmdc:mga0yw44_6134_c1_805_1674 265
52 3300050516 nmdc:mga0sz30_68952_c1 nmdc:mga0sz30_68952_c1_423_1292 265
53 3300028800 Ga0265338_10288882 Ga0265338_102888822 266
54 3300031235 Ga0265330_10032768 Ga0265330_100327681 266
55 3300031240 Ga0265320_10038673 Ga0265320_100386732 266
56 3300031242 Ga0265329_10038528 Ga0265329_100385282 266
57 3300031344 Ga0265316_10019986 Ga0265316_100199865 266
58 3300031712 Ga0265342_10025824 Ga0265342_100258245 266
59 3300045051 Ga0451576_0035065 Ga0451576_0035065_2423_3286 266
60 3300046690 Ga0495624_0064570 Ga0495624_0064570_873_1736 266
61 3300047317 Ga0495604_0346453 Ga0495604_0346453_93_956 266
62 3300009094 Ga0111539_10405491 Ga0111539_104054912 267
63 3300005440 Ga0070705_100235746 Ga0070705_1002357462 268
64 3300005545 Ga0070695_100022262 Ga0070695_1000222624 268
65 3300005546 Ga0070696_100044664 Ga0070696_1000446642 268
66 3300031249 Ga0265339_10041981 Ga0265339_100419812 269
67 3300049571 Ga0501034_0019935 Ga0501034_0019935_5056_5910 269
68 3300049571 Ga0501034_0273000 Ga0501034_0273000_135_989 269
69 3300049572 Ga0501036_0111786 Ga0501036_0111786_1327_2181 269
70 3300049573 Ga0501037_0003480 Ga0501037_0003480_910_1764 269
71 3300049574 Ga0501038_0073051 Ga0501038_0073051_1252_2106 269
72 3300049579 Ga0501043_0008730 Ga0501043_0008730_262_1116 269
73 3300049580 Ga0501046_0068487 Ga0501046_0068487_1642_2496 269
74 3300049581 Ga0501047_0028382 Ga0501047_0028382_3241_4095 269
75 3300049742 Ga0501080_0013259 Ga0501080_0013259_369_1223 269
76 3300049822 Ga0501035_0031108 Ga0501035_0031108_2059_2913 269
77 3300049823 Ga0501044_0097643 Ga0501044_0097643_204_1058 269
78 3300053077 Ga0495601_0310879 Ga0495601_0310879_150_1004 269
79 3300054114 Ga0501084_0410885 Ga0501084_0410885_217_1071 269
80 3300060353 Ga0501082_0160913 Ga0501082_0160913_154_1008 269
81 3300005336 Ga0070680_100259607 Ga0070680_1002596072 270
82 3300005435 Ga0070714_100526074 Ga0070714_1005260741 270
83 3300005444 Ga0070694_100003420 Ga0070694_1000034209 270
84 3300005549 Ga0070704_100169376 Ga0070704_1001693762 270
85 3300006175 Ga0070712_100057102 Ga0070712_1000571022 270
86 3300006914 Ga0075436_100284425 Ga0075436_1002844251 270
87 3300025915 Ga0207693_10052856 Ga0207693_100528562 270
88 3300025972 Ga0207668_10087785 Ga0207668_100877852 270
89 3300035083 Ga0373926_0002880 Ga0373926_0002880_3203_4057 270
90 3300035116 Ga0373945_0012081 Ga0373945_0012081_389_1243 270
91 3300035170 Ga0373943_0000424 Ga0373943_0000424_1681_2535 270
92 3300035171 Ga0373946_0003275 Ga0373946_0003275_1507_2361 270
93 3300035171 Ga0373946_0020065 Ga0373946_0020065_1431_2285 270
94 3300035172 Ga0373955_0310029 Ga0373955_0310029_56_910 270
95 3300035692 Ga0373935_0000882 Ga0373935_0000882_14706_15560 270
96 3300035692 Ga0373935_0006454 Ga0373935_0006454_6104_6958 270
97 3300035695 Ga0373927_0000414 Ga0373927_0000414_17549_18403 270
98 3300035695 Ga0373927_0025829 Ga0373927_0025829_1402_2256 270
99 3300035725 Ga0373947_0000275 Ga0373947_0000275_15075_15929 270
100 3300037068 Ga0373925_0002725 Ga0373925_0002725_4755_5609 270
101 3300037853 Ga0436364_0700611 Ga0436364_0700611_1498_2367 270
102 3300046463 Ga0495653_0057546 Ga0495653_0057546_1392_2246 270
103 3300046472 Ga0495580_0058049 Ga0495580_0058049_445_1299 270
104 3300046476 Ga0495662_0000261 Ga0495662_0000261_11264_12118 270
105 3300046476 Ga0495662_0016950 Ga0495662_0016950_794_1648 270
106 3300046477 Ga0495664_0000736 Ga0495664_0000736_9803_10657 270
107 3300046517 Ga0495630_0002218 Ga0495630_0002218_5848_6702 270
108 3300046529 Ga0495652_0199677 Ga0495652_0199677_195_1049 270
109 3300046531 Ga0495665_0024212 Ga0495665_0024212_2112_2966 270
110 3300046533 Ga0495640_0002964 Ga0495640_0002964_600_1454 270
111 3300046535 Ga0495586_0001814 Ga0495586_0001814_9645_10499 270
112 3300046543 Ga0495645_0002109 Ga0495645_0002109_4800_5654 270
113 3300046642 Ga0495634_0006321 Ga0495634_0006321_1392_2246 270
114 3300046642 Ga0495634_0017261 Ga0495634_0017261_3957_4811 270
115 3300046663 Ga0495635_0000438 Ga0495635_0000438_8872_9726 270
116 3300046680 Ga0495646_0022684 Ga0495646_0022684_3092_3946 270
117 3300046689 Ga0495613_0027628 Ga0495613_0027628_3294_4148 270
118 3300046689 Ga0495613_0307480 Ga0495613_0307480_45_899 270
119 3300046690 Ga0495624_0001570 Ga0495624_0001570_12702_13556 270
120 3300047315 Ga0495581_0025033 Ga0495581_0025033_2507_3361 270
121 3300047319 Ga0495674_0000209 Ga0495674_0000209_29571_30425 270
122 3300047321 Ga0495676_0033822 Ga0495676_0033822_338_1192 270
123 3300047471 Ga0495684_0001766 Ga0495684_0001766_4984_5838 270
124 3300047471 Ga0495684_0003044 Ga0495684_0003044_9696_10550 270
125 3300047471 Ga0495684_0049314 Ga0495684_0049314_391_1245 270
126 3300047673 Ga0495593_0007179 Ga0495593_0007179_5084_5938 270
127 3300053078 Ga0495612_0000353 Ga0495612_0000353_6644_7498 270
128 3300053084 Ga0495595_0036616 Ga0495595_0036616_1272_2126 270
129 3300053085 Ga0495619_0001077 Ga0495619_0001077_56_910 270
130 3300005445 Ga0070708_100006158 Ga0070708_1000061582 271
131 3300005467 Ga0070706_100073844 Ga0070706_1000738441 271
132 3300005468 Ga0070707_100018938 Ga0070707_1000189385 271
133 3300005471 Ga0070698_100005791 Ga0070698_10000579111 271
134 3300005518 Ga0070699_100006895 Ga0070699_1000068953 271
135 3300005536 Ga0070697_100019057 Ga0070697_1000190574 271
136 3300006914 Ga0075436_100001357 Ga0075436_10000135716 271
137 3300025910 Ga0207684_10004520 Ga0207684_100045203 271
138 3300025922 Ga0207646_10003037 Ga0207646_100030374 271
139 3300044673 Ga0453683_0025310 Ga0453683_0025310_1811_2680 271
140 3300044712 Ga0453684_0024772 Ga0453684_0024772_339_1208 271
141 3300045051 Ga0451576_0030558 Ga0451576_0030558_3089_3958 271
142 3300049741 Ga0501079_0096889 Ga0501079_0096889_271_1137 271
143 3300050514 nmdc:mga08x19_47006_c1 nmdc:mga08x19_47006_c1_386_1252 271
144 3300005543 Ga0070672_100083906 Ga0070672_1000839062 272
145 3300009174 Ga0105241_10092438 Ga0105241_100924383 272
146 3300009553 Ga0105249_10603595 Ga0105249_106035952 272
147 3300013306 Ga0163162_10018668 Ga0163162_100186684 272
148 3300013308 Ga0157375_10516832 Ga0157375_105168322 272
149 3300025940 Ga0207691_10059780 Ga0207691_100597802 272
150 3300026118 Ga0207675_100185079 Ga0207675_1001850792 272
151 3300028381 Ga0268264_10245600 Ga0268264_102456002 272
152 3300032004 Ga0307414_10360773 Ga0307414_103607732 272
153 3300046684 Ga0495669_0005523 Ga0495669_0005523_1388_2257 272
154 3300048909 Ga0496106_0094236 Ga0496106_0094236_1086_1955 272
155 3300049570 Ga0501033_0083116 Ga0501033_0083116_259_1125 272
156 3300049570 Ga0501033_0201346 Ga0501033_0201346_298_1164 272
157 3300049572 Ga0501036_0001382 Ga0501036_0001382_2865_3731 272
158 3300049572 Ga0501036_0103560 Ga0501036_0103560_523_1389 272
159 3300049574 Ga0501038_0000646 Ga0501038_0000646_13072_13938 272
160 3300049575 Ga0501039_0001534 Ga0501039_0001534_15246_16112 272
161 3300049575 Ga0501039_0175265 Ga0501039_0175265_129_995 272
162 3300049576 Ga0501040_0000087 Ga0501040_0000087_40424_41290 272
163 3300049577 Ga0501041_0002380 Ga0501041_0002380_854_1720 272
164 3300049577 Ga0501041_0021655 Ga0501041_0021655_759_1625 272
165 3300049578 Ga0501042_0002829 Ga0501042_0002829_1086_1952 272
166 3300049578 Ga0501042_0040685 Ga0501042_0040685_1556_2422 272
167 3300049579 Ga0501043_0008327 Ga0501043_0008327_832_1698 272
168 3300049580 Ga0501046_0000364 Ga0501046_0000364_7056_7922 272
169 3300049580 Ga0501046_0042825 Ga0501046_0042825_1625_2491 272
170 3300049582 Ga0501048_0001228 Ga0501048_0001228_5451_6317 272
171 3300049582 Ga0501048_0024555 Ga0501048_0024555_2522_3388 272
172 3300049584 Ga0501068_0011606 Ga0501068_0011606_1018_1884 272
173 3300049584 Ga0501068_0040132 Ga0501068_0040132_1201_2067 272
174 3300049586 Ga0501070_0373034 Ga0501070_0373034_12_878 272
175 3300049587 Ga0501071_0000156 Ga0501071_0000156_10250_11116 272
176 3300049587 Ga0501071_0045592 Ga0501071_0045592_2016_2882 272
177 3300049588 Ga0501072_0000252 Ga0501072_0000252_15500_16366 272
178 3300049588 Ga0501072_0108041 Ga0501072_0108041_632_1498 272
179 3300049589 Ga0501073_0085182 Ga0501073_0085182_809_1675 272
180 3300049590 Ga0501074_0001338 Ga0501074_0001338_13581_14447 272
181 3300049591 Ga0501075_0000058 Ga0501075_0000058_8920_9786 272
182 3300049591 Ga0501075_0045061 Ga0501075_0045061_715_1581 272
183 3300049592 Ga0501076_0000729 Ga0501076_0000729_10925_11791 272
184 3300049592 Ga0501076_0104111 Ga0501076_0104111_950_1816 272
185 3300049593 Ga0501077_0000178 Ga0501077_0000178_33525_34391 272
186 3300049741 Ga0501079_0000022 Ga0501079_0000022_57729_58595 272
187 3300049741 Ga0501079_0068313 Ga0501079_0068313_1226_2092 272
188 3300049742 Ga0501080_0001368 Ga0501080_0001368_15500_16366 272
189 3300049742 Ga0501080_0091352 Ga0501080_0091352_1581_2447 272
190 3300049743 Ga0501081_0000774 Ga0501081_0000774_8365_9231 272
191 3300049744 Ga0501083_0009935 Ga0501083_0009935_777_1643 272
192 3300049744 Ga0501083_0100994 Ga0501083_0100994_279_1145 272
193 3300049822 Ga0501035_0001252 Ga0501035_0001252_9484_10350 272
194 3300049824 Ga0501045_0001164 Ga0501045_0001164_15745_16611 272
195 3300049824 Ga0501045_0067775 Ga0501045_0067775_1286_2152 272
196 3300054114 Ga0501084_0000157 Ga0501084_0000157_4194_5060 272
197 3300054114 Ga0501084_0039329 Ga0501084_0039329_1410_2276 272
198 3300060353 Ga0501082_0000341 Ga0501082_0000341_26069_26935 272
199 3300061734 Ga0530510_0002542 Ga0530510_0002542_8739_9605 272
200 3300061734 Ga0530510_0115418 Ga0530510_0115418_402_1268 272
201 3300005440 Ga0070705_100029720 Ga0070705_1000297203 273
202 3300005471 Ga0070698_100137973 Ga0070698_1001379733 273
203 3300005549 Ga0070704_100236196 Ga0070704_1002361962 273
204 3300005577 Ga0068857_100740837 Ga0068857_1007408371 273
205 3300006844 Ga0075428_100223503 Ga0075428_1002235033 273
206 3300021388 Ga0213875_10001075 Ga0213875_100010758 273
207 3300025938 Ga0207704_10460629 Ga0207704_104606292 273
208 3300037471 Ga0395905_0537467 Ga0395905_0537467_68_940 273
209 3300037853 Ga0436364_0685371 Ga0436364_0685371_43811_44665 273
210 3300039447 Ga0436361_0847532 Ga0436361_0847532_44_895 273
211 3300049575 Ga0501039_0280225 Ga0501039_0280225_371_1237 273
212 3300049577 Ga0501041_0074019 Ga0501041_0074019_693_1559 273
213 3300049582 Ga0501048_0249039 Ga0501048_0249039_367_1233 273
214 3300049584 Ga0501068_0064794 Ga0501068_0064794_1034_1900 273
215 3300049587 Ga0501071_0146449 Ga0501071_0146449_641_1507 273
216 3300049588 Ga0501072_0015235 Ga0501072_0015235_1810_2676 273
217 3300049589 Ga0501073_0237298 Ga0501073_0237298_192_1058 273
218 3300049590 Ga0501074_0075577 Ga0501074_0075577_1073_1939 273
219 3300049591 Ga0501075_0074851 Ga0501075_0074851_763_1629 273
220 3300049592 Ga0501076_0015076 Ga0501076_0015076_2638_3504 273
221 3300049741 Ga0501079_0032205 Ga0501079_0032205_2986_3852 273
222 3300049742 Ga0501080_0014988 Ga0501080_0014988_1256_2122 273
223 3300054114 Ga0501084_0113461 Ga0501084_0113461_602_1468 273
224 3300005444 Ga0070694_100051160 Ga0070694_1000511604 274
225 3300005459 Ga0068867_100134456 Ga0068867_1001344562 274
226 3300005545 Ga0070695_100027043 Ga0070695_1000270432 274
227 3300005546 Ga0070696_100009167 Ga0070696_1000091672 274
228 3300005719 Ga0068861_100131722 Ga0068861_1001317222 274
229 3300006175 Ga0070712_100006640 Ga0070712_1000066407 274
230 3300006177 Ga0075362_10078884 Ga0075362_100788842 274
231 3300006178 Ga0075367_10040940 Ga0075367_100409402 274
232 3300009148 Ga0105243_10043929 Ga0105243_100439292 274
233 3300025915 Ga0207693_10013129 Ga0207693_100131298 274
234 3300025935 Ga0207709_10036753 Ga0207709_100367533 274
235 3300026088 Ga0207641_10720362 Ga0207641_107203621 274
236 3300026089 Ga0207648_10081281 Ga0207648_100812812 274
237 3300026118 Ga0207675_100105017 Ga0207675_1001050173 274
238 3300028380 Ga0268265_10006592 Ga0268265_100065924 274
239 3300035691 Ga0373931_0096222 Ga0373931_0096222_115_978 274
240 3300039437 Ga0436365_1308054 Ga0436365_1308054_676_1545 274
241 3300046463 Ga0495653_0233476 Ga0495653_0233476_79_933 274
242 3300046511 Ga0495608_0128988 Ga0495608_0128988_322_1176 274
243 3300046525 Ga0495663_0030658 Ga0495663_0030658_435_1301 274
244 3300047319 Ga0495674_0314268 Ga0495674_0314268_276_1130 274
245 3300047322 Ga0495680_0386936 Ga0495680_0386936_71_925 274
246 3300048088 Ga0495602_0080662 Ga0495602_0080662_896_1750 274
247 3300048088 Ga0495602_0454798 Ga0495602_0454798_33_887 274
248 3300049577 Ga0501041_0214942 Ga0501041_0214942_163_1014 274
249 3300050493 nmdc:mga0k408_144836_c1 nmdc:mga0k408_144836_c1_291_1145 274
250 3300005290 Ga0065712_10030896 Ga0065712_100308962 275
251 3300005330 Ga0070690_100162427 Ga0070690_1001624271 275
252 3300005333 Ga0070677_10022862 Ga0070677_100228623 275
253 3300005334 Ga0068869_100349072 Ga0068869_1003490722 275
254 3300005354 Ga0070675_100270406 Ga0070675_1002704062 275
255 3300005356 Ga0070674_100103882 Ga0070674_1001038822 275
256 3300005456 Ga0070678_100061326 Ga0070678_1000613262 275
257 3300005457 Ga0070662_100201370 Ga0070662_1002013701 275
258 3300005518 Ga0070699_100381209 Ga0070699_1003812092 275
259 3300005543 Ga0070672_100129583 Ga0070672_1001295832 275
260 3300005617 Ga0068859_100432520 Ga0068859_1004325201 275
261 3300005618 Ga0068864_100149961 Ga0068864_1001499612 275
262 3300006931 Ga0097620_100432525 Ga0097620_1004325251 275
263 3300009101 Ga0105247_10112872 Ga0105247_101128722 275
264 3300011119 Ga0105246_10136796 Ga0105246_101367961 275
265 3300025893 Ga0207682_10002103 Ga0207682_100021033 275
266 3300025900 Ga0207710_10024128 Ga0207710_100241282 275
267 3300025918 Ga0207662_10010145 Ga0207662_100101451 275
268 3300025931 Ga0207644_10072069 Ga0207644_100720693 275
269 3300025935 Ga0207709_10049360 Ga0207709_100493602 275
270 3300025936 Ga0207670_10185603 Ga0207670_101856032 275
271 3300025937 Ga0207669_10043433 Ga0207669_100434332 275
272 3300025961 Ga0207712_10217206 Ga0207712_102172062 275
273 3300025986 Ga0207658_10106231 Ga0207658_101062311 275
274 3300026088 Ga0207641_10075539 Ga0207641_100755392 275
275 3300026121 Ga0207683_10023791 Ga0207683_100237914 275
276 3300042435 Ga0439434_0056815 Ga0439434_0056815_297_1166 275
277 3300046539 Ga0495621_0019212 Ga0495621_0019212_1068_1937 275
278 3300046615 Ga0495656_0044546 Ga0495656_0044546_180_1049 275
279 3300048090 Ga0495615_0012423 Ga0495615_0012423_820_1689 275
280 3300005345 Ga0070692_10157985 Ga0070692_101579852 276
281 3300005440 Ga0070705_100177207 Ga0070705_1001772072 276
282 3300005546 Ga0070696_100095717 Ga0070696_1000957172 276
283 3300006852 Ga0075433_10001281 Ga0075433_100012817 276
284 3300050515 nmdc:mga0a205_1075_c1 nmdc:mga0a205_1075_c1_12849_13718 276
285 3300005444 Ga0070694_100174022 Ga0070694_1001740222 277
286 3300005985 Ga0081539_10000462 Ga0081539_1000046263 277
287 3300009147 Ga0114129_10915868 Ga0114129_109158682 277
288 3300045051 Ga0451576_0253503 Ga0451576_0253503_385_1251 277
289 3300049574 Ga0501038_0342704 Ga0501038_0342704_82_948 277
290 3300049577 Ga0501041_0137561 Ga0501041_0137561_486_1352 277
291 3300049580 Ga0501046_0022776 Ga0501046_0022776_2800_3666 277
292 3300049582 Ga0501048_0152336 Ga0501048_0152336_444_1310 277
293 3300049584 Ga0501068_0054258 Ga0501068_0054258_389_1255 277
294 3300049585 Ga0501069_0260763 Ga0501069_0260763_122_988 277
295 3300049587 Ga0501071_0055335 Ga0501071_0055335_1193_2059 277
296 3300049588 Ga0501072_0251166 Ga0501072_0251166_362_1228 277
297 3300049593 Ga0501077_0171686 Ga0501077_0171686_43_909 277
298 3300049741 Ga0501079_0074885 Ga0501079_0074885_1055_1921 277
299 3300049742 Ga0501080_0263607 Ga0501080_0263607_624_1490 277
300 3300049743 Ga0501081_0043796 Ga0501081_0043796_1708_2574 277
301 3300049824 Ga0501045_0050317 Ga0501045_0050317_1741_2607 277
302 3300049824 Ga0501045_0053256 Ga0501045_0053256_1256_2122 277
303 3300050514 nmdc:mga08x19_120397_c1 nmdc:mga08x19_120397_c1_606_1475 277
304 3300060353 Ga0501082_0063226 Ga0501082_0063226_1217_2083 277
305 3300005445 Ga0070708_100303382 Ga0070708_1003033822 278
306 3300005518 Ga0070699_100006362 Ga0070699_1000063623 278
307 3300006058 Ga0075432_10041440 Ga0075432_100414401 278
308 3300006852 Ga0075433_10006995 Ga0075433_100069956 278
309 3300006871 Ga0075434_100001574 Ga0075434_1000015748 278
310 3300006871 Ga0075434_100002685 Ga0075434_1000026852 278
311 3300006914 Ga0075436_100210584 Ga0075436_1002105842 278
312 3300007076 Ga0075435_100017237 Ga0075435_1000172373 278
313 3300009094 Ga0111539_10031418 Ga0111539_100314183 278
314 3300039438 Ga0436360_0404169 Ga0436360_0404169_276_1112 278
315 3300042435 Ga0439434_0038426 Ga0439434_0038426_81_947 278
316 3300050511 nmdc:mga08y16_399621_c1 nmdc:mga08y16_399621_c1_238_1107 278
317 3300050512 nmdc:mga0n895_1570_c1 nmdc:mga0n895_1570_c1_14600_15466 278
318 3300050512 nmdc:mga0n895_3956_c1 nmdc:mga0n895_3956_c1_5507_6376 278
319 3300050513 nmdc:mga0rr50_18250_c1 nmdc:mga0rr50_18250_c1_1885_2751 278
320 3300050515 nmdc:mga0a205_16420_c1 nmdc:mga0a205_16420_c1_1079_1948 278
321 3300053142 Ga0500577_0029867 Ga0500577_0029867_105_974 278
322 3300005440 Ga0070705_100016484 Ga0070705_1000164843 279
323 3300005467 Ga0070706_100078254 Ga0070706_1000782543 279
324 3300005536 Ga0070697_100001293 Ga0070697_10000129323 279
325 3300005545 Ga0070695_100001721 Ga0070695_1000017217 279
326 3300006173 Ga0070716_100078136 Ga0070716_1000781362 279
327 3300006844 Ga0075428_100001232 Ga0075428_10000123210 279
328 3300006847 Ga0075431_100006333 Ga0075431_1000063339 279
329 3300009147 Ga0114129_10002359 Ga0114129_100023592 279
330 3300034818 Ga0373950_0015439 Ga0373950_0015439_99_968 279
331 3300034957 Ga0373938_0009918 Ga0373938_0009918_568_1437 279
332 3300035088 Ga0373940_0008635 Ga0373940_0008635_804_1673 279
333 3300035092 Ga0373952_0008135 Ga0373952_0008135_605_1474 279
334 3300035112 Ga0373932_0019320 Ga0373932_0019320_790_1659 279
335 3300035691 Ga0373931_0002172 Ga0373931_0002172_4389_5258 279
336 3300042876 Ga0451577_0300010 Ga0451577_0300010_570_1436 279
337 3300048927 Ga0496124_0012283 Ga0496124_0012283_5706_6578 279
338 3300048928 Ga0496125_0002695 Ga0496125_0002695_11135_12007 279
339 3300049579 Ga0501043_0240942 Ga0501043_0240942_189_1055 279
340 3300049585 Ga0501069_0026341 Ga0501069_0026341_1173_2039 279
341 3300050507 nmdc:mga05p37_3283_c1 nmdc:mga05p37_3283_c1_15449_16315 279
342 3300050508 nmdc:mga09592_4616_c1 nmdc:mga09592_4616_c1_3735_4601 279
343 3300050510 nmdc:mga06r32_7414_c1 nmdc:mga06r32_7414_c1_5297_6163 279
344 3300005356 Ga0070674_100028481 Ga0070674_1000284812 280
345 3300005549 Ga0070704_100080648 Ga0070704_1000806482 280
346 3300005937 Ga0081455_10007461 Ga0081455_100074615 280
347 3300042008 Ga0439450_012023 Ga0439450_012023_242_1108 280
348 3300042439 Ga0439464_0020595 Ga0439464_0020595_353_1219 280
349 3300042461 Ga0439460_0001552 Ga0439460_0001552_1903_2769 280
350 3300048913 Ga0496110_0227850 Ga0496110_0227850_114_983 280
351 3300049572 Ga0501036_0190621 Ga0501036_0190621_361_1227 280
352 3300049575 Ga0501039_0112756 Ga0501039_0112756_128_994 280
353 3300049576 Ga0501040_0017509 Ga0501040_0017509_1392_2258 280
354 3300049580 Ga0501046_0036174 Ga0501046_0036174_2159_3025 280
355 3300049582 Ga0501048_0026590 Ga0501048_0026590_1227_2093 280
356 3300049588 Ga0501072_0084821 Ga0501072_0084821_1044_1910 280
357 3300049590 Ga0501074_0035939 Ga0501074_0035939_599_1465 280
358 3300049592 Ga0501076_0006035 Ga0501076_0006035_1302_2168 280
359 3300049593 Ga0501077_0106072 Ga0501077_0106072_768_1634 280
360 3300049742 Ga0501080_0322145 Ga0501080_0322145_505_1371 280
361 3300049743 Ga0501081_0090558 Ga0501081_0090558_657_1523 280
362 3300049744 Ga0501083_0066623 Ga0501083_0066623_296_1162 280
363 3300049824 Ga0501045_0039692 Ga0501045_0039692_1462_2328 280
364 3300060353 Ga0501082_0001651 Ga0501082_0001651_2627_3493 280
365 3300061734 Ga0530510_0039127 Ga0530510_0039127_1179_2045 280
366 3300061734 Ga0530510_0298034 Ga0530510_0298034_52_918 280
367 iso_pu_bacteria 2894772417 2894773134 280
368 3300003349 JGI26129J50193_1002204 JGI26129J50193_10022042 281
369 3300005341 Ga0070691_10076194 Ga0070691_100761942 281
370 3300005468 Ga0070707_100317232 Ga0070707_1003172322 281
371 3300005536 Ga0070697_100001434 Ga0070697_1000014344 281
372 3300005545 Ga0070695_100005573 Ga0070695_1000055734 281
373 3300009147 Ga0114129_10020418 Ga0114129_100204185 281
374 3300025922 Ga0207646_10176822 Ga0207646_101768222 281
375 3300027360 Ga0209969_1002469 Ga0209969_10024694 281
376 3300027395 Ga0209996_1000475 Ga0209996_10004755 281
377 3300027526 Ga0209968_1001005 Ga0209968_10010054 281
378 3300027665 Ga0209983_1000380 Ga0209983_10003805 281
379 3300027682 Ga0209971_1000228 Ga0209971_10002289 281
380 3300027695 Ga0209966_1000098 Ga0209966_100009817 281
381 3300027717 Ga0209998_10000125 Ga0209998_100001252 281
382 3300027876 Ga0209974_10004008 Ga0209974_100040084 281
383 3300028381 Ga0268264_10249517 Ga0268264_102495172 281
384 3300042876 Ga0451577_0343975 Ga0451577_0343975_251_1117 281
385 3300045051 Ga0451576_0536241 Ga0451576_0536241_212_1078 281
386 3300050507 nmdc:mga05p37_286168_c1 nmdc:mga05p37_286168_c1_953_1822 281
387 3300050507 nmdc:mga05p37_591813_c1 nmdc:mga05p37_591813_c1_92_958 281
388 3300005341 Ga0070691_10021810 Ga0070691_100218102 282
389 3300005444 Ga0070694_100003917 Ga0070694_1000039177 282
390 3300005536 Ga0070697_100008411 Ga0070697_1000084111 282
391 3300005545 Ga0070695_100022535 Ga0070695_1000225352 282
392 3300045051 Ga0451576_0031269 Ga0451576_0031269_1485_2351 282
393 3300048920 Ga0496117_0032979 Ga0496117_0032979_165_1034 282
394 3300048923 Ga0496120_0106075 Ga0496120_0106075_29_898 282
395 3300048925 Ga0496122_0017063 Ga0496122_0017063_4512_5381 282
396 3300048927 Ga0496124_0087643 Ga0496124_0087643_1472_2341 282
397 3300005328 Ga0070676_10034437 Ga0070676_100344373 284
398 3300005436 Ga0070713_100035581 Ga0070713_1000355814 284
399 3300005458 Ga0070681_10010518 Ga0070681_1001051810 284
400 3300005530 Ga0070679_100064153 Ga0070679_1000641532 284
401 3300005544 Ga0070686_100459993 Ga0070686_1004599931 284
402 3300006028 Ga0070717_10463418 Ga0070717_104634181 284
403 3300006846 Ga0075430_100307408 Ga0075430_1003074082 284
404 3300006871 Ga0075434_100082740 Ga0075434_1000827403 284
405 3300006914 Ga0075436_100142454 Ga0075436_1001424542 284
406 3300007076 Ga0075435_100256335 Ga0075435_1002563351 284
407 3300010159 Ga0099796_10028306 Ga0099796_100283061 284
408 3300021377 Ga0213874_10011204 Ga0213874_100112042 284
409 3300021384 Ga0213876_10000816 Ga0213876_1000081615 284
410 3300021388 Ga0213875_10012486 Ga0213875_100124864 284
411 3300021388 Ga0213875_10034599 Ga0213875_100345993 284
412 3300025907 Ga0207645_10045314 Ga0207645_100453142 284
413 3300025912 Ga0207707_10010205 Ga0207707_100102054 284
414 3300025915 Ga0207693_10003608 Ga0207693_1000360810 284
415 3300025939 Ga0207665_10136272 Ga0207665_101362722 284
416 3300031344 Ga0265316_10045361 Ga0265316_100453612 284
417 3300035118 Ga0373954_0032281 Ga0373954_0032281_495_1349 284
418 3300035120 Ga0373957_0068681 Ga0373957_0068681_290_1144 284
419 3300035170 Ga0373943_0028636 Ga0373943_0028636_1056_1910 284
420 3300035172 Ga0373955_0039290 Ga0373955_0039290_1067_1921 284
421 3300035691 Ga0373931_0027600 Ga0373931_0027600_833_1696 284
422 3300035691 Ga0373931_0152554 Ga0373931_0152554_447_1301 284
423 3300035695 Ga0373927_0098409 Ga0373927_0098409_792_1646 284
424 3300035724 Ga0373933_0008780 Ga0373933_0008780_2069_2923 284
425 3300035725 Ga0373947_0017419 Ga0373947_0017419_1267_2121 284
426 3300035725 Ga0373947_0066277 Ga0373947_0066277_685_1539 284
427 3300036401 Ga0373937_0134761 Ga0373937_0134761_66_920 284
428 3300037068 Ga0373925_0087640 Ga0373925_0087640_347_1201 284
429 3300037853 Ga0436364_0162358 Ga0436364_0162358_252_1106 284
430 3300037853 Ga0436364_0705174 Ga0436364_0705174_14248_15102 284
431 3300037853 Ga0436364_1114716 Ga0436364_1114716_468_1322 284
432 3300039437 Ga0436365_0736793 Ga0436365_0736793_7655_8509 284
433 3300039438 Ga0436360_0886479 Ga0436360_0886479_611_1465 284
434 3300039450 Ga0436363_0313348 Ga0436363_0313348_13043_13897 284
435 3300039450 Ga0436363_1475436 Ga0436363_1475436_416_1270 284
436 3300039453 Ga0436362_1124287 Ga0436362_1124287_110_964 284
437 3300046476 Ga0495662_0034302 Ga0495662_0034302_1100_1954 284
438 3300046514 Ga0495618_0160733 Ga0495618_0160733_101_955 284
439 3300046533 Ga0495640_0013343 Ga0495640_0013343_3098_3952 284
440 3300046559 Ga0495667_0048970 Ga0495667_0048970_596_1450 284
441 3300046642 Ga0495634_0039498 Ga0495634_0039498_998_1852 284
442 3300046660 Ga0495625_0049301 Ga0495625_0049301_1047_1901 284
443 3300046689 Ga0495613_0245809 Ga0495613_0245809_188_1042 284
444 3300047319 Ga0495674_0024470 Ga0495674_0024470_1136_1990 284
445 3300048903 Ga0496100_0207228 Ga0496100_0207228_197_1051 284
446 3300048904 Ga0496101_0424249 Ga0496101_0424249_55_909 284
447 3300048907 Ga0496104_0035653 Ga0496104_0035653_1942_2796 284
448 3300048908 Ga0496105_0017779 Ga0496105_0017779_3439_4293 284
449 3300048909 Ga0496106_0108221 Ga0496106_0108221_858_1712 284
450 3300048912 Ga0496109_0044666 Ga0496109_0044666_2244_3098 284
451 3300048913 Ga0496110_0444194 Ga0496110_0444194_166_1020 284
452 3300049583 Ga0501067_0037054 Ga0501067_0037054_879_1733 284
453 3300050512 nmdc:mga0n895_401522_c1 nmdc:mga0n895_401522_c1_198_1052 284
454 3300050513 nmdc:mga0rr50_55745_c1 nmdc:mga0rr50_55745_c1_192_1046 284
455 3300053077 Ga0495601_0001471 Ga0495601_0001471_1942_2796 284
456 3300053085 Ga0495619_0084025 Ga0495619_0084025_1248_2102 284
457 iso_pu_bacteria 2883577096 2883581241 284
458 3300005295 Ga0065707_10096354 Ga0065707_100963542 285
459 3300005334 Ga0068869_100002482 Ga0068869_1000024824 285
460 3300005337 Ga0070682_100001528 Ga0070682_10000152812 285
461 3300005338 Ga0068868_100002947 Ga0068868_1000029475 285
462 3300005340 Ga0070689_100002038 Ga0070689_1000020384 285
463 3300005341 Ga0070691_10017617 Ga0070691_100176174 285
464 3300005343 Ga0070687_100000326 Ga0070687_10000032616 285
465 3300005345 Ga0070692_10008943 Ga0070692_100089432 285
466 3300005345 Ga0070692_10010920 Ga0070692_100109204 285
467 3300005353 Ga0070669_100002984 Ga0070669_1000029844 285
468 3300005355 Ga0070671_100204493 Ga0070671_1002044932 285
469 3300005435 Ga0070714_100066078 Ga0070714_1000660782 285
470 3300005438 Ga0070701_10005350 Ga0070701_100053505 285
471 3300005440 Ga0070705_100000638 Ga0070705_1000006383 285
472 3300005441 Ga0070700_100000211 Ga0070700_1000002113 285
473 3300005444 Ga0070694_100003723 Ga0070694_1000037234 285
474 3300005444 Ga0070694_100114275 Ga0070694_1001142752 285
475 3300005445 Ga0070708_100083951 Ga0070708_1000839513 285
476 3300005458 Ga0070681_10078253 Ga0070681_100782533 285
477 3300005459 Ga0068867_100001335 Ga0068867_1000013354 285
478 3300005459 Ga0068867_100003689 Ga0068867_1000036894 285
479 3300005530 Ga0070679_100113499 Ga0070679_1001134993 285
480 3300005536 Ga0070697_100072868 Ga0070697_1000728683 285
481 3300005539 Ga0068853_100274211 Ga0068853_1002742112 285
482 3300005543 Ga0070672_100254777 Ga0070672_1002547772 285
483 3300005544 Ga0070686_100010234 Ga0070686_1000102344 285
484 3300005544 Ga0070686_100339895 Ga0070686_1003398952 285
485 3300005545 Ga0070695_100000948 Ga0070695_10000094816 285
486 3300005546 Ga0070696_100000012 Ga0070696_10000001282 285
487 3300005546 Ga0070696_100126282 Ga0070696_1001262822 285
488 3300005547 Ga0070693_100000135 Ga0070693_1000001353 285
489 3300005547 Ga0070693_100281037 Ga0070693_1002810372 285
490 3300005549 Ga0070704_100000108 Ga0070704_10000010828 285
491 3300005563 Ga0068855_100063388 Ga0068855_1000633883 285
492 3300005578 Ga0068854_100001657 Ga0068854_10000165715 285
493 3300005614 Ga0068856_100332974 Ga0068856_1003329742 285
494 3300005617 Ga0068859_100003978 Ga0068859_10000397816 285
495 3300005718 Ga0068866_10009989 Ga0068866_100099894 285
496 3300005719 Ga0068861_100000173 Ga0068861_10000017319 285
497 3300005719 Ga0068861_100019210 Ga0068861_1000192104 285
498 3300005842 Ga0068858_100001425 Ga0068858_1000014254 285
499 3300005842 Ga0068858_100136445 Ga0068858_1001364452 285
500 3300005844 Ga0068862_100000594 Ga0068862_1000005944 285
501 3300006163 Ga0070715_10083343 Ga0070715_100833432 285
502 3300006173 Ga0070716_100231393 Ga0070716_1002313932 285
503 3300006237 Ga0097621_100000939 Ga0097621_1000009394 285
504 3300006358 Ga0068871_100000370 Ga0068871_10000037033 285
505 3300006844 Ga0075428_100019802 Ga0075428_1000198028 285
506 3300006847 Ga0075431_100155138 Ga0075431_1001551382 285
507 3300006852 Ga0075433_10033836 Ga0075433_100338364 285
508 3300006852 Ga0075433_10119236 Ga0075433_101192362 285
509 3300006871 Ga0075434_100053555 Ga0075434_1000535553 285
510 3300006871 Ga0075434_100104025 Ga0075434_1001040253 285
511 3300006880 Ga0075429_100000259 Ga0075429_10000025938 285
512 3300006881 Ga0068865_100007455 Ga0068865_1000074554 285
513 3300006881 Ga0068865_100020281 Ga0068865_1000202813 285
514 3300006914 Ga0075436_100006485 Ga0075436_1000064853 285
515 3300006914 Ga0075436_100204923 Ga0075436_1002049232 285
516 3300006931 Ga0097620_100003978 Ga0097620_10000397816 285
517 3300007076 Ga0075435_100000047 Ga0075435_10000004718 285
518 3300007265 Ga0099794_10158993 Ga0099794_101589931 285
519 3300009094 Ga0111539_10034785 Ga0111539_100347853 285
520 3300009094 Ga0111539_10354182 Ga0111539_103541822 285
521 3300009098 Ga0105245_10007041 Ga0105245_100070414 285
522 3300009147 Ga0114129_10000430 Ga0114129_1000043047 285
523 3300009148 Ga0105243_10000708 Ga0105243_100007083 285
524 3300009176 Ga0105242_10041789 Ga0105242_100417894 285
525 3300009176 Ga0105242_10258302 Ga0105242_102583021 285
526 3300009177 Ga0105248_10368233 Ga0105248_103682332 285
527 3300009553 Ga0105249_10000599 Ga0105249_1000059911 285
528 3300010375 Ga0105239_10036817 Ga0105239_100368175 285
529 3300013297 Ga0157378_10006229 Ga0157378_100062293 285
530 3300014969 Ga0157376_10011568 Ga0157376_100115684 285
531 3300021358 Ga0213873_10024658 Ga0213873_100246582 285
532 3300021384 Ga0213876_10000944 Ga0213876_1000094413 285
533 3300025899 Ga0207642_10005920 Ga0207642_100059205 285
534 3300025899 Ga0207642_10018611 Ga0207642_100186113 285
535 3300025901 Ga0207688_10016496 Ga0207688_100164962 285
536 3300025911 Ga0207654_10035292 Ga0207654_100352924 285
537 3300025912 Ga0207707_10064689 Ga0207707_100646892 285
538 3300025918 Ga0207662_10000639 Ga0207662_100006394 285
539 3300025921 Ga0207652_10159637 Ga0207652_101596372 285
540 3300025923 Ga0207681_10002455 Ga0207681_100024554 285
541 3300025926 Ga0207659_10189264 Ga0207659_101892642 285
542 3300025927 Ga0207687_10003950 Ga0207687_100039506 285
543 3300025934 Ga0207686_10006692 Ga0207686_100066923 285
544 3300025938 Ga0207704_10007060 Ga0207704_100070604 285
545 3300025940 Ga0207691_10119619 Ga0207691_101196192 285
546 3300025941 Ga0207711_10097521 Ga0207711_100975212 285
547 3300025949 Ga0207667_10033944 Ga0207667_100339444 285
548 3300025960 Ga0207651_10195438 Ga0207651_101954382 285
549 3300025961 Ga0207712_10003113 Ga0207712_100031134 285
550 3300025981 Ga0207640_10014585 Ga0207640_100145853 285
551 3300026023 Ga0207677_10029879 Ga0207677_100298792 285
552 3300026035 Ga0207703_10013352 Ga0207703_100133526 285
553 3300026035 Ga0207703_10136321 Ga0207703_101363212 285
554 3300026075 Ga0207708_10000142 Ga0207708_1000014239 285
555 3300026075 Ga0207708_10000153 Ga0207708_100001539 285
556 3300026089 Ga0207648_10000130 Ga0207648_100001304 285
557 3300026089 Ga0207648_10003264 Ga0207648_100032644 285
558 3300026118 Ga0207675_100000253 Ga0207675_1000002534 285
559 3300026118 Ga0207675_100000648 Ga0207675_10000064819 285
560 3300027907 Ga0207428_10000721 Ga0207428_100007217 285
561 3300028380 Ga0268265_10000627 Ga0268265_1000062735 285
562 3300028380 Ga0268265_10000885 Ga0268265_1000088517 285
563 3300031548 Ga0307408_100070265 Ga0307408_1000702652 285
564 3300032002 Ga0307416_100047257 Ga0307416_1000472573 285
565 3300035083 Ga0373926_0000320 Ga0373926_0000320_7024_7890 285
566 3300035089 Ga0373944_0007777 Ga0373944_0007777_1122_1988 285
567 3300035113 Ga0373936_0013035 Ga0373936_0013035_150_1016 285
568 3300035116 Ga0373945_0002043 Ga0373945_0002043_1603_2469 285
569 3300035170 Ga0373943_0006382 Ga0373943_0006382_1136_2002 285
570 3300035171 Ga0373946_0006545 Ga0373946_0006545_1549_2415 285
571 3300035692 Ga0373935_0002678 Ga0373935_0002678_5087_5953 285
572 3300035695 Ga0373927_0006828 Ga0373927_0006828_3685_4551 285
573 3300035725 Ga0373947_0007039 Ga0373947_0007039_3245_4111 285
574 3300037068 Ga0373925_0014839 Ga0373925_0014839_3208_4074 285
575 3300037853 Ga0436364_0147453 Ga0436364_0147453_1375_2238 285
576 3300039437 Ga0436365_0159339 Ga0436365_0159339_50308_51171 285
577 3300039453 Ga0436362_1066130 Ga0436362_1066130_3804_4667 285
578 3300046455 Ga0495603_0028409 Ga0495603_0028409_2271_3137 285
579 3300046459 Ga0495629_0170376 Ga0495629_0170376_549_1445 285
580 3300046463 Ga0495653_0058032 Ga0495653_0058032_1009_1872 285
581 3300046472 Ga0495580_0001270 Ga0495580_0001270_10996_11862 285
582 3300046511 Ga0495608_0019659 Ga0495608_0019659_1895_2758 285
583 3300046516 Ga0495628_0202423 Ga0495628_0202423_310_1173 285
584 3300046526 Ga0495666_0057274 Ga0495666_0057274_889_1752 285
585 3300046533 Ga0495640_0217321 Ga0495640_0217321_218_1081 285
586 3300046535 Ga0495586_0048291 Ga0495586_0048291_90_956 285
587 3300046642 Ga0495634_0223442 Ga0495634_0223442_166_1029 285
588 3300046674 Ga0495588_0010367 Ga0495588_0010367_1147_2013 285
589 3300046681 Ga0495647_0016640 Ga0495647_0016640_1430_2296 285
590 3300046683 Ga0495658_0005364 Ga0495658_0005364_3072_3938 285
591 3300046683 Ga0495658_0134032 Ga0495658_0134032_108_971 285
592 3300046689 Ga0495613_0122418 Ga0495613_0122418_550_1413 285
593 3300046809 Ga0495600_0028225 Ga0495600_0028225_491_1354 285
594 3300047321 Ga0495676_0047447 Ga0495676_0047447_718_1584 285
595 3300048908 Ga0496105_0037299 Ga0496105_0037299_826_1746 285
596 3300050507 nmdc:mga05p37_3149_c1 nmdc:mga05p37_3149_c1_8099_8962 285
597 3300050508 nmdc:mga09592_3063_c1 nmdc:mga09592_3063_c1_4965_5828 285
598 3300050511 nmdc:mga08y16_182193_c1 nmdc:mga08y16_182193_c1_299_1162 285
599 3300050511 nmdc:mga08y16_39253_c1 nmdc:mga08y16_39253_c1_1284_2147 285
600 3300050511 nmdc:mga08y16_4436_c1 nmdc:mga08y16_4436_c1_4085_4948 285
601 3300050512 nmdc:mga0n895_110942_c1 nmdc:mga0n895_110942_c1_1795_2661 285
602 3300050512 nmdc:mga0n895_42634_c1 nmdc:mga0n895_42634_c1_1222_2085 285
603 3300050512 nmdc:mga0n895_50020_c1 nmdc:mga0n895_50020_c1_1651_2517 285
604 3300050513 nmdc:mga0rr50_359_c1 nmdc:mga0rr50_359_c1_17365_18228 285
605 3300050514 nmdc:mga08x19_12690_c1 nmdc:mga08x19_12690_c1_3532_4398 285
606 3300050514 nmdc:mga08x19_20446_c1 nmdc:mga08x19_20446_c1_1675_2538 285
607 3300050514 nmdc:mga08x19_245588_c1 nmdc:mga08x19_245588_c1_352_1218 285
608 3300050515 nmdc:mga0a205_34387_c1 nmdc:mga0a205_34387_c1_1180_2046 285
609 3300050515 nmdc:mga0a205_93_c2 nmdc:mga0a205_93_c2_33908_34771 285
610 3300053077 Ga0495601_0035335 Ga0495601_0035335_1983_2846 285
611 iso_pu_bacteria 2775507049 2776910825 285
612 3300005345 Ga0070692_10070275 Ga0070692_100702752 286
613 3300005545 Ga0070695_100086311 Ga0070695_1000863112 286
614 3300005546 Ga0070696_100278221 Ga0070696_1002782211 286
615 3300005549 Ga0070704_100277704 Ga0070704_1002777042 286
616 3300005549 Ga0070704_100399480 Ga0070704_1003994802 286
617 3300005617 Ga0068859_100006107 Ga0068859_1000061078 286
618 3300005617 Ga0068859_100021038 Ga0068859_1000210383 286
619 3300006844 Ga0075428_100018652 Ga0075428_1000186527 286
620 3300006844 Ga0075428_100022052 Ga0075428_1000220523 286
621 3300006847 Ga0075431_100204579 Ga0075431_1002045793 286
622 3300006880 Ga0075429_100000922 Ga0075429_10000092213 286
623 3300006931 Ga0097620_100006104 Ga0097620_1000061045 286
624 3300006931 Ga0097620_100021038 Ga0097620_1000210383 286
625 3300007265 Ga0099794_10059969 Ga0099794_100599691 286
626 3300009094 Ga0111539_10663496 Ga0111539_106634962 286
627 3300009147 Ga0114129_10020013 Ga0114129_100200133 286
628 3300009148 Ga0105243_10444606 Ga0105243_104446062 286
629 3300013297 Ga0157378_10422905 Ga0157378_104229052 286
630 3300025935 Ga0207709_10234795 Ga0207709_102347952 286
631 3300025961 Ga0207712_10244082 Ga0207712_102440822 286
632 3300026075 Ga0207708_10070975 Ga0207708_100709753 286
633 3300027378 Ga0209981_1012871 Ga0209981_10128712 286
634 3300027395 Ga0209996_1004059 Ga0209996_10040593 286
635 3300027395 Ga0209996_1008521 Ga0209996_10085212 286
636 3300027462 Ga0210000_1001320 Ga0210000_10013204 286
637 3300027471 Ga0209995_1005928 Ga0209995_10059283 286
638 3300027526 Ga0209968_1005706 Ga0209968_10057062 286
639 3300027526 Ga0209968_1015897 Ga0209968_10158972 286
640 3300027543 Ga0209999_1008492 Ga0209999_10084922 286
641 3300027682 Ga0209971_1006441 Ga0209971_10064413 286
642 3300031665 Ga0316575_10014633 Ga0316575_100146334 286
643 3300031665 Ga0316575_10020135 Ga0316575_100201353 286
644 3300035113 Ga0373936_0037929 Ga0373936_0037929_371_1240 286
645 3300035398 Ga0316574_0004412 Ga0316574_0004412_2341_3207 286
646 3300035692 Ga0373935_0009918 Ga0373935_0009918_596_1465 286
647 3300035724 Ga0373933_0123375 Ga0373933_0123375_561_1430 286
648 3300036401 Ga0373937_0108121 Ga0373937_0108121_236_1105 286
649 3300037068 Ga0373925_0109429 Ga0373925_0109429_875_1744 286
650 3300037588 Ga0316581_0006661 Ga0316581_0006661_2164_3030 286
651 3300041410 Ga0439461_0030608 Ga0439461_0030608_88_954 286
652 3300042001 Ga0439441_001670 Ga0439441_001670_1945_2811 286
653 3300042001 Ga0439441_002598 Ga0439441_002598_1509_2375 286
654 3300042156 Ga0439446_0004940 Ga0439446_0004940_837_1703 286
655 3300042435 Ga0439434_0003115 Ga0439434_0003115_1321_2187 286
656 3300042436 Ga0439435_0004837 Ga0439435_0004837_469_1335 286
657 3300042437 Ga0439444_0001275 Ga0439444_0001275_2118_2984 286
658 3300042876 Ga0451577_0204639 Ga0451577_0204639_900_1766 286
659 3300045051 Ga0451576_0034448 Ga0451576_0034448_869_1735 286
660 3300046526 Ga0495666_0166937 Ga0495666_0166937_16_885 286
661 3300046539 Ga0495621_0039933 Ga0495621_0039933_610_1476 286
662 3300049579 Ga0501043_0286800 Ga0501043_0286800_197_1057 286
663 3300050508 nmdc:mga09592_1332_c1 nmdc:mga09592_1332_c1_11973_12839 286
664 3300050508 nmdc:mga09592_51499_c1 nmdc:mga09592_51499_c1_915_1781 286
665 3300050510 nmdc:mga06r32_2441_c1 nmdc:mga06r32_2441_c1_14602_15468 286
666 3300050510 nmdc:mga06r32_343670_c1 nmdc:mga06r32_343670_c1_262_1128 286
667 3300050515 nmdc:mga0a205_297825_c1 nmdc:mga0a205_297825_c1_430_1296 286
668 3300003203 JGI25406J46586_10011229 JGI25406J46586_100112292 287
669 3300005293 Ga0065715_10124256 Ga0065715_101242562 287
670 3300005293 Ga0065715_10157979 Ga0065715_101579792 287
671 3300005331 Ga0070670_100356109 Ga0070670_1003561092 287
672 3300005334 Ga0068869_100006166 Ga0068869_1000061663 287
673 3300005334 Ga0068869_100187717 Ga0068869_1001877171 287
674 3300005336 Ga0070680_100176034 Ga0070680_1001760342 287
675 3300005341 Ga0070691_10016926 Ga0070691_100169262 287
676 3300005341 Ga0070691_10028327 Ga0070691_100283272 287
677 3300005347 Ga0070668_100337000 Ga0070668_1003370002 287
678 3300005353 Ga0070669_100382177 Ga0070669_1003821772 287
679 3300005353 Ga0070669_100388179 Ga0070669_1003881791 287
680 3300005354 Ga0070675_100179485 Ga0070675_1001794852 287
681 3300005355 Ga0070671_100282518 Ga0070671_1002825182 287
682 3300005366 Ga0070659_100096411 Ga0070659_1000964112 287
683 3300005438 Ga0070701_10010591 Ga0070701_100105914 287
684 3300005440 Ga0070705_100000671 Ga0070705_10000067114 287
685 3300005440 Ga0070705_100152480 Ga0070705_1001524802 287
686 3300005441 Ga0070700_100003296 Ga0070700_1000032965 287
687 3300005441 Ga0070700_100011184 Ga0070700_1000111842 287
688 3300005441 Ga0070700_100031792 Ga0070700_1000317921 287
689 3300005441 Ga0070700_100205331 Ga0070700_1002053312 287
690 3300005444 Ga0070694_100002732 Ga0070694_1000027327 287
691 3300005444 Ga0070694_100052666 Ga0070694_1000526663 287
692 3300005444 Ga0070694_100147170 Ga0070694_1001471702 287
693 3300005445 Ga0070708_100238026 Ga0070708_1002380262 287
694 3300005456 Ga0070678_100254757 Ga0070678_1002547572 287
695 3300005457 Ga0070662_100094058 Ga0070662_1000940583 287
696 3300005458 Ga0070681_10021226 Ga0070681_100212266 287
697 3300005459 Ga0068867_100165182 Ga0068867_1001651822 287
698 3300005468 Ga0070707_100274545 Ga0070707_1002745451 287
699 3300005518 Ga0070699_100003010 Ga0070699_1000030108 287
700 3300005530 Ga0070679_100202722 Ga0070679_1002027222 287
701 3300005530 Ga0070679_100400224 Ga0070679_1004002242 287
702 3300005536 Ga0070697_100005785 Ga0070697_1000057853 287
703 3300005545 Ga0070695_100002319 Ga0070695_1000023195 287
704 3300005545 Ga0070695_100031558 Ga0070695_1000315582 287
705 3300005546 Ga0070696_100002401 Ga0070696_10000240110 287
706 3300005547 Ga0070693_100007379 Ga0070693_1000073792 287
707 3300005547 Ga0070693_100128216 Ga0070693_1001282162 287
708 3300005549 Ga0070704_100000193 Ga0070704_1000001933 287
709 3300005549 Ga0070704_100282099 Ga0070704_1002820991 287
710 3300005549 Ga0070704_100393298 Ga0070704_1003932981 287
711 3300005563 Ga0068855_100288486 Ga0068855_1002884862 287
712 3300005564 Ga0070664_100138582 Ga0070664_1001385822 287
713 3300005577 Ga0068857_100022542 Ga0068857_1000225422 287
714 3300005577 Ga0068857_100430073 Ga0068857_1004300732 287
715 3300005578 Ga0068854_100407247 Ga0068854_1004072471 287
716 3300005617 Ga0068859_100007972 Ga0068859_1000079725 287
717 3300005719 Ga0068861_100424200 Ga0068861_1004242001 287
718 3300005841 Ga0068863_100126447 Ga0068863_1001264472 287
719 3300005842 Ga0068858_100161059 Ga0068858_1001610592 287
720 3300005842 Ga0068858_100228900 Ga0068858_1002289002 287
721 3300005843 Ga0068860_100001885 Ga0068860_1000018852 287
722 3300005843 Ga0068860_100554582 Ga0068860_1005545822 287
723 3300005844 Ga0068862_100004236 Ga0068862_1000042369 287
724 3300005937 Ga0081455_10000014 Ga0081455_10000014105 287
725 3300005937 Ga0081455_10017729 Ga0081455_100177296 287
726 3300005981 Ga0081538_10027411 Ga0081538_100274113 287
727 3300005981 Ga0081538_10048592 Ga0081538_100485922 287
728 3300005983 Ga0081540_1000035 Ga0081540_1000035139 287
729 3300005983 Ga0081540_1000878 Ga0081540_100087813 287
730 3300005985 Ga0081539_10001341 Ga0081539_1000134128 287
731 3300006038 Ga0075365_10011758 Ga0075365_100117582 287
732 3300006042 Ga0075368_10003743 Ga0075368_100037431 287
733 3300006042 Ga0075368_10012309 Ga0075368_100123094 287
734 3300006048 Ga0075363_100030177 Ga0075363_1000301772 287
735 3300006048 Ga0075363_100052945 Ga0075363_1000529453 287
736 3300006178 Ga0075367_10028637 Ga0075367_100286373 287
737 3300006178 Ga0075367_10208319 Ga0075367_102083192 287
738 3300006353 Ga0075370_10033514 Ga0075370_100335142 287
739 3300006358 Ga0068871_100080962 Ga0068871_1000809623 287
740 3300006844 Ga0075428_100000446 Ga0075428_10000044628 287
741 3300006844 Ga0075428_100044588 Ga0075428_1000445883 287
742 3300006844 Ga0075428_100535990 Ga0075428_1005359902 287
743 3300006844 Ga0075428_100653210 Ga0075428_1006532102 287
744 3300006846 Ga0075430_100006952 Ga0075430_1000069524 287
745 3300006846 Ga0075430_100048016 Ga0075430_1000480163 287
746 3300006846 Ga0075430_100349174 Ga0075430_1003491742 287
747 3300006847 Ga0075431_100000586 Ga0075431_10000058620 287
748 3300006847 Ga0075431_100002204 Ga0075431_10000220415 287
749 3300006847 Ga0075431_100023814 Ga0075431_1000238144 287
750 3300006847 Ga0075431_100150402 Ga0075431_1001504022 287
751 3300006871 Ga0075434_100577052 Ga0075434_1005770522 287
752 3300006880 Ga0075429_100002976 Ga0075429_10000297612 287
753 3300006881 Ga0068865_100017764 Ga0068865_1000177642 287
754 3300006931 Ga0097620_100007972 Ga0097620_1000079725 287
755 3300009093 Ga0105240_10394231 Ga0105240_103942312 287
756 3300009094 Ga0111539_10003844 Ga0111539_100038443 287
757 3300009094 Ga0111539_10011877 Ga0111539_100118776 287
758 3300009094 Ga0111539_10086334 Ga0111539_100863344 287
759 3300009094 Ga0111539_10291090 Ga0111539_102910902 287
760 3300009098 Ga0105245_10075077 Ga0105245_100750772 287
761 3300009147 Ga0114129_10000068 Ga0114129_1000006874 287
762 3300009147 Ga0114129_10074037 Ga0114129_100740374 287
763 3300009174 Ga0105241_10122645 Ga0105241_101226452 287
764 3300009177 Ga0105248_10114457 Ga0105248_101144573 287
765 3300009545 Ga0105237_10029142 Ga0105237_100291426 287
766 3300009545 Ga0105237_10037012 Ga0105237_100370122 287
767 3300009551 Ga0105238_10341110 Ga0105238_103411101 287
768 3300009553 Ga0105249_10002072 Ga0105249_100020723 287
769 3300013105 Ga0157369_10217554 Ga0157369_102175542 287
770 3300013306 Ga0163162_10333214 Ga0163162_103332142 287
771 3300013306 Ga0163162_10436895 Ga0163162_104368952 287
772 3300013306 Ga0163162_10494459 Ga0163162_104944592 287
773 3300013307 Ga0157372_10202758 Ga0157372_102027582 287
774 3300013308 Ga0157375_10444959 Ga0157375_104449591 287
775 3300014325 Ga0163163_10001948 Ga0163163_100019483 287
776 3300014325 Ga0163163_10609142 Ga0163163_106091422 287
777 3300014326 Ga0157380_10305790 Ga0157380_103057902 287
778 3300014745 Ga0157377_10101288 Ga0157377_101012882 287
779 3300014968 Ga0157379_10441317 Ga0157379_104413172 287
780 3300014969 Ga0157376_10059518 Ga0157376_100595183 287
781 3300021384 Ga0213876_10084059 Ga0213876_100840592 287
782 3300021388 Ga0213875_10016470 Ga0213875_100164703 287
783 3300025885 Ga0207653_10001145 Ga0207653_100011453 287
784 3300025911 Ga0207654_10089196 Ga0207654_100891962 287
785 3300025912 Ga0207707_10001852 Ga0207707_1000185216 287
786 3300025914 Ga0207671_10030628 Ga0207671_100306283 287
787 3300025921 Ga0207652_10180287 Ga0207652_101802872 287
788 3300025921 Ga0207652_10187492 Ga0207652_101874922 287
789 3300025924 Ga0207694_10237511 Ga0207694_102375112 287
790 3300025925 Ga0207650_10246261 Ga0207650_102462612 287
791 3300025927 Ga0207687_10184012 Ga0207687_101840122 287
792 3300025933 Ga0207706_10040460 Ga0207706_100404602 287
793 3300025933 Ga0207706_10080777 Ga0207706_100807771 287
794 3300025934 Ga0207686_10064621 Ga0207686_100646213 287
795 3300025935 Ga0207709_10225211 Ga0207709_102252112 287
796 3300025937 Ga0207669_10050150 Ga0207669_100501501 287
797 3300025940 Ga0207691_10081129 Ga0207691_100811292 287
798 3300025941 Ga0207711_10411394 Ga0207711_104113942 287
799 3300025942 Ga0207689_10007163 Ga0207689_100071635 287
800 3300025942 Ga0207689_10036449 Ga0207689_100364492 287
801 3300025944 Ga0207661_10219910 Ga0207661_102199102 287
802 3300025945 Ga0207679_10016081 Ga0207679_100160815 287
803 3300025949 Ga0207667_10054565 Ga0207667_100545652 287
804 3300025961 Ga0207712_10003418 Ga0207712_100034183 287
805 3300025981 Ga0207640_10287323 Ga0207640_102873231 287
806 3300026035 Ga0207703_10055811 Ga0207703_100558113 287
807 3300026035 Ga0207703_10084896 Ga0207703_100848962 287
808 3300026035 Ga0207703_10278628 Ga0207703_102786282 287
809 3300026035 Ga0207703_10680861 Ga0207703_106808611 287
810 3300026041 Ga0207639_10004290 Ga0207639_100042902 287
811 3300026041 Ga0207639_10569432 Ga0207639_105694321 287
812 3300026067 Ga0207678_10003276 Ga0207678_100032766 287
813 3300026075 Ga0207708_10001509 Ga0207708_100015094 287
814 3300026075 Ga0207708_10026481 Ga0207708_100264813 287
815 3300026075 Ga0207708_10050676 Ga0207708_100506764 287
816 3300026075 Ga0207708_10296444 Ga0207708_102964442 287
817 3300026078 Ga0207702_10192198 Ga0207702_101921982 287
818 3300026095 Ga0207676_10008709 Ga0207676_100087093 287
819 3300026116 Ga0207674_10008447 Ga0207674_100084478 287
820 3300026116 Ga0207674_10014574 Ga0207674_100145745 287
821 3300027866 Ga0209813_10006973 Ga0209813_100069732 287
822 3300027866 Ga0209813_10035293 Ga0209813_100352932 287
823 3300027907 Ga0207428_10012105 Ga0207428_100121053 287
824 3300027907 Ga0207428_10209626 Ga0207428_102096262 287
825 3300028380 Ga0268265_10000939 Ga0268265_100009396 287
826 3300028380 Ga0268265_10200165 Ga0268265_102001651 287
827 3300028381 Ga0268264_10001246 Ga0268264_1000124623 287
828 3300031712 Ga0265342_10027031 Ga0265342_100270312 287
829 3300035115 Ga0373941_0009738 Ga0373941_0009738_347_1216 287
830 3300035119 Ga0373956_0032314 Ga0373956_0032314_177_1046 287
831 3300035121 Ga0373960_0010649 Ga0373960_0010649_629_1498 287
832 3300035242 Ga0373962_0048074 Ga0373962_0048074_311_1180 287
833 3300035691 Ga0373931_0000207 Ga0373931_0000207_4078_4947 287
834 3300035691 Ga0373931_0094053 Ga0373931_0094053_778_1647 287
835 3300035691 Ga0373931_0273544 Ga0373931_0273544_62_964 287
836 3300035695 Ga0373927_0149233 Ga0373927_0149233_565_1464 287
837 3300036401 Ga0373937_0394453 Ga0373937_0394453_156_1025 287
838 3300037853 Ga0436364_0676530 Ga0436364_0676530_257_1126 287
839 3300037853 Ga0436364_1082407 Ga0436364_1082407_4353_5222 287
840 3300039437 Ga0436365_1892164 Ga0436365_1892164_3747_4616 287
841 3300039453 Ga0436362_1056133 Ga0436362_1056133_292_1161 287
842 3300042003 Ga0439443_002737 Ga0439443_002737_631_1500 287
843 3300042438 Ga0439459_0008227 Ga0439459_0008227_254_1123 287
844 3300042461 Ga0439460_0018435 Ga0439460_0018435_559_1428 287
845 3300042993 Ga0439440_0013406 Ga0439440_0013406_31_900 287
846 3300046455 Ga0495603_0244401 Ga0495603_0244401_44_913 287
847 3300047321 Ga0495676_0085983 Ga0495676_0085983_309_1178 287
848 3300048903 Ga0496100_0134321 Ga0496100_0134321_544_1413 287
849 3300048903 Ga0496100_0332254 Ga0496100_0332254_16_885 287
850 3300048905 Ga0496102_0010995 Ga0496102_0010995_2584_3453 287
851 3300048906 Ga0496103_0030761 Ga0496103_0030761_1237_2106 287
852 3300048907 Ga0496104_0006466 Ga0496104_0006466_4182_5051 287
853 3300048907 Ga0496104_0011676 Ga0496104_0011676_5134_6003 287
854 3300048907 Ga0496104_0040885 Ga0496104_0040885_1147_2016 287
855 3300048908 Ga0496105_0000783 Ga0496105_0000783_6402_7271 287
856 3300048908 Ga0496105_0006116 Ga0496105_0006116_4672_5541 287
857 3300048909 Ga0496106_0002235 Ga0496106_0002235_7180_8049 287
858 3300048910 Ga0496107_0005679 Ga0496107_0005679_7130_8032 287
859 3300048911 Ga0496108_0000783 Ga0496108_0000783_9201_10070 287
860 3300048911 Ga0496108_0005523 Ga0496108_0005523_4415_5284 287
861 3300048912 Ga0496109_0002516 Ga0496109_0002516_13335_14204 287
862 3300048913 Ga0496110_0023893 Ga0496110_0023893_1565_2434 287
863 3300048913 Ga0496110_0039288 Ga0496110_0039288_130_999 287
864 3300048913 Ga0496110_0163933 Ga0496110_0163933_292_1161 287
865 3300048913 Ga0496110_0192729 Ga0496110_0192729_267_1169 287
866 3300048914 Ga0496111_0000495 Ga0496111_0000495_14549_15418 287
867 3300048914 Ga0496111_0012998 Ga0496111_0012998_1694_2563 287
868 3300048915 Ga0496112_0003524 Ga0496112_0003524_7921_8790 287
869 3300048915 Ga0496112_0008371 Ga0496112_0008371_427_1329 287
870 3300048916 Ga0496113_0000529 Ga0496113_0000529_13105_13974 287
871 3300048917 Ga0496114_0109194 Ga0496114_0109194_195_1097 287
872 3300048917 Ga0496114_0167669 Ga0496114_0167669_195_1064 287
873 3300048918 Ga0496115_0004616 Ga0496115_0004616_396_1265 287
874 3300048918 Ga0496115_0156652 Ga0496115_0156652_546_1415 287
875 3300048918 Ga0496115_0376978 Ga0496115_0376978_18_887 287
876 3300049572 Ga0501036_0020963 Ga0501036_0020963_3915_4784 287
877 3300049574 Ga0501038_0191459 Ga0501038_0191459_727_1596 287
878 3300049574 Ga0501038_0378757 Ga0501038_0378757_88_957 287
879 3300049575 Ga0501039_0137082 Ga0501039_0137082_234_1103 287
880 3300049575 Ga0501039_0157905 Ga0501039_0157905_195_1064 287
881 3300049577 Ga0501041_0007945 Ga0501041_0007945_5344_6213 287
882 3300049577 Ga0501041_0132095 Ga0501041_0132095_259_1128 287
883 3300049578 Ga0501042_0038500 Ga0501042_0038500_2036_2905 287
884 3300049579 Ga0501043_0254530 Ga0501043_0254530_134_1003 287
885 3300049585 Ga0501069_0103036 Ga0501069_0103036_703_1572 287
886 3300049588 Ga0501072_0011074 Ga0501072_0011074_534_1403 287
887 3300049588 Ga0501072_0014152 Ga0501072_0014152_3587_4456 287
888 3300049588 Ga0501072_0142384 Ga0501072_0142384_986_1855 287
889 3300049588 Ga0501072_0191446 Ga0501072_0191446_88_957 287
890 3300049588 Ga0501072_0262130 Ga0501072_0262130_395_1264 287
891 3300049590 Ga0501074_0220011 Ga0501074_0220011_161_1045 287
892 3300049590 Ga0501074_0251630 Ga0501074_0251630_13_882 287
893 3300049591 Ga0501075_0287979 Ga0501075_0287979_241_1113 287
894 3300049592 Ga0501076_0005575 Ga0501076_0005575_754_1623 287
895 3300049592 Ga0501076_0008073 Ga0501076_0008073_1944_2813 287
896 3300049593 Ga0501077_0022957 Ga0501077_0022957_2359_3228 287
897 3300049593 Ga0501077_0204832 Ga0501077_0204832_77_946 287
898 3300049741 Ga0501079_0051015 Ga0501079_0051015_178_1047 287
899 3300049741 Ga0501079_0165351 Ga0501079_0165351_315_1199 287
900 3300049741 Ga0501079_0215556 Ga0501079_0215556_129_998 287
901 3300049742 Ga0501080_0007494 Ga0501080_0007494_3555_4424 287
902 3300049742 Ga0501080_0163888 Ga0501080_0163888_979_1848 287
903 3300049743 Ga0501081_0110500 Ga0501081_0110500_626_1510 287
904 3300049744 Ga0501083_0084820 Ga0501083_0084820_606_1475 287
905 3300049744 Ga0501083_0170035 Ga0501083_0170035_79_948 287
906 3300049744 Ga0501083_0212132 Ga0501083_0212132_326_1195 287
907 3300049822 Ga0501035_0216312 Ga0501035_0216312_654_1523 287
908 3300049824 Ga0501045_0005395 Ga0501045_0005395_1143_2012 287
909 3300049824 Ga0501045_0038943 Ga0501045_0038943_783_1652 287
910 3300049824 Ga0501045_0345062 Ga0501045_0345062_102_971 287
911 3300050490 nmdc:mga03n38_70088_c1 nmdc:mga03n38_70088_c1_58_927 287
912 3300050491 nmdc:mga00v17_42716_c1 nmdc:mga00v17_42716_c1_479_1348 287
913 3300050491 nmdc:mga00v17_663_c1 nmdc:mga00v17_663_c1_16384_17253 287
914 3300050492 nmdc:mga0yw44_125726_c1 nmdc:mga0yw44_125726_c1_242_1111 287
915 3300050492 nmdc:mga0yw44_241100_c1 nmdc:mga0yw44_241100_c1_66_935 287
916 3300050493 nmdc:mga0k408_21840_c1 nmdc:mga0k408_21840_c1_1173_2042 287
917 3300050494 nmdc:mga06z11_1221_c1 nmdc:mga06z11_1221_c1_1002_1871 287
918 3300050494 nmdc:mga06z11_14795_c1 nmdc:mga06z11_14795_c1_910_1779 287
919 3300050494 nmdc:mga06z11_4849_c1 nmdc:mga06z11_4849_c1_98_985 287
920 3300050495 nmdc:mga04h51_18663_c1 nmdc:mga04h51_18663_c1_221_1090 287
921 3300050495 nmdc:mga04h51_5277_c1 nmdc:mga04h51_5277_c1_1416_2285 287
922 3300050496 nmdc:mga07m45_140965_c1 nmdc:mga07m45_140965_c1_324_1193 287
923 3300050507 nmdc:mga05p37_53751_c1 nmdc:mga05p37_53751_c1_2454_3323 287
924 3300050507 nmdc:mga05p37_710_c2 nmdc:mga05p37_710_c2_5017_5886 287
925 3300050508 nmdc:mga09592_126_c1 nmdc:mga09592_126_c1_17528_18397 287
926 3300050508 nmdc:mga09592_77287_c1 nmdc:mga09592_77287_c1_1755_2624 287
927 3300050509 nmdc:mga0qj67_132673_c1 nmdc:mga0qj67_132673_c1_432_1301 287
928 3300050509 nmdc:mga0qj67_2393_c1 nmdc:mga0qj67_2393_c1_5852_6721 287
929 3300050510 nmdc:mga06r32_100774_c1 nmdc:mga06r32_100774_c1_1860_2729 287
930 3300050510 nmdc:mga06r32_178409_c1 nmdc:mga06r32_178409_c1_398_1267 287
931 3300050510 nmdc:mga06r32_4_c1 nmdc:mga06r32_4_c1_70638_71507 287
932 3300050510 nmdc:mga06r32_6022_c1 nmdc:mga06r32_6022_c1_6639_7508 287
933 3300050510 nmdc:mga06r32_61903_c1 nmdc:mga06r32_61903_c1_100_969 287
934 3300050510 nmdc:mga06r32_63545_c1 nmdc:mga06r32_63545_c1_1323_2192 287
935 3300050511 nmdc:mga08y16_1078_c1 nmdc:mga08y16_1078_c1_5465_6334 287
936 3300050511 nmdc:mga08y16_156104_c1 nmdc:mga08y16_156104_c1_695_1564 287
937 3300050511 nmdc:mga08y16_16843_c1 nmdc:mga08y16_16843_c1_4563_5432 287
938 3300050515 nmdc:mga0a205_311895_c1 nmdc:mga0a205_311895_c1_379_1248 287
939 3300053134 Ga0500658_0085078 Ga0500658_0085078_324_1196 287
940 3300053139 Ga0500568_0002596 Ga0500568_0002596_2327_3199 287
941 3300053153 Ga0500616_0095822 Ga0500616_0095822_559_1428 287
942 3300054114 Ga0501084_0002367 Ga0501084_0002367_8267_9136 287
943 3300054114 Ga0501084_0225774 Ga0501084_0225774_225_1094 287
944 3300054114 Ga0501084_0250867 Ga0501084_0250867_260_1129 287
945 3300060353 Ga0501082_0000050 Ga0501082_0000050_69258_70127 287
946 3300060353 Ga0501082_0100457 Ga0501082_0100457_638_1507 287
947 3300060353 Ga0501082_0152329 Ga0501082_0152329_718_1587 287
948 3300060353 Ga0501082_0199196 Ga0501082_0199196_95_964 287
949 3300061734 Ga0530510_0000222 Ga0530510_0000222_9616_10479 287
950 3300061734 Ga0530510_0002069 Ga0530510_0002069_5390_6259 287
951 3300061734 Ga0530510_0004269 Ga0530510_0004269_1228_2097 287
952 3300061734 Ga0530510_0010377 Ga0530510_0010377_1712_2581 287
953 3300003203 JGI25406J46586_10006501 JGI25406J46586_100065015 288
954 3300005295 Ga0065707_10119257 Ga0065707_101192572 288
955 3300005330 Ga0070690_100067294 Ga0070690_1000672943 288
956 3300005334 Ga0068869_100015428 Ga0068869_1000154284 288
957 3300005347 Ga0070668_100027604 Ga0070668_1000276043 288
958 3300005440 Ga0070705_100193116 Ga0070705_1001931162 288
959 3300005444 Ga0070694_100041452 Ga0070694_1000414523 288
960 3300005445 Ga0070708_100026888 Ga0070708_1000268884 288
961 3300005458 Ga0070681_10108660 Ga0070681_101086603 288
962 3300005468 Ga0070707_100037794 Ga0070707_1000377944 288
963 3300005536 Ga0070697_100007886 Ga0070697_1000078868 288
964 3300005549 Ga0070704_100029938 Ga0070704_1000299383 288
965 3300005577 Ga0068857_100359791 Ga0068857_1003597912 288
966 3300005617 Ga0068859_100383206 Ga0068859_1003832062 288
967 3300005618 Ga0068864_100381014 Ga0068864_1003810142 288
968 3300005843 Ga0068860_100060141 Ga0068860_1000601412 288
969 3300006844 Ga0075428_100009146 Ga0075428_10000914612 288
970 3300006846 Ga0075430_100010982 Ga0075430_1000109826 288
971 3300006871 Ga0075434_100093341 Ga0075434_1000933413 288
972 3300006931 Ga0097620_100383240 Ga0097620_1003832402 288
973 3300009147 Ga0114129_10164336 Ga0114129_101643362 288
974 3300009553 Ga0105249_10131152 Ga0105249_101311523 288
975 3300010375 Ga0105239_10242555 Ga0105239_102425551 288
976 3300014326 Ga0157380_10270015 Ga0157380_102700152 288
977 3300025922 Ga0207646_10065719 Ga0207646_100657194 288
978 3300025923 Ga0207681_10404072 Ga0207681_104040721 288
979 3300025942 Ga0207689_10097726 Ga0207689_100977261 288
980 3300026095 Ga0207676_10203923 Ga0207676_102039232 288
981 3300026116 Ga0207674_10147265 Ga0207674_101472653 288
982 3300026118 Ga0207675_100151459 Ga0207675_1001514591 288
983 3300028380 Ga0268265_10012099 Ga0268265_100120993 288
984 3300028381 Ga0268264_10047794 Ga0268264_100477944 288
985 3300049577 Ga0501041_0195047 Ga0501041_0195047_192_1058 288
986 3300050513 nmdc:mga0rr50_315148_c1 nmdc:mga0rr50_315148_c1_232_1098 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

46

312

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5677 5 276
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5571 8 274
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5423 6 281
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5422 5 276
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5396 13 281
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8987 11 275 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8448 11 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8221 9 277 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7848 9 277 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7785 8 275 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V7A8I3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9693 2 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A2V7A8I3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.966 2 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A2V6Z4S1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9626 48 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A147K391-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9606 1 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A1W9U1L0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9589 7 287 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
91.29 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map